BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4071

Length=777
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009597287.1|  PREDICTED: isoflavone 2'-hydroxylase-like          252   2e-76   Nicotiana tomentosiformis
ref|XP_009780215.1|  PREDICTED: isoflavone 2'-hydroxylase-like          250   1e-75   Nicotiana sylvestris
ref|XP_006359732.1|  PREDICTED: isoflavone 2'-hydroxylase-like          244   3e-73   Solanum tuberosum [potatoes]
ref|XP_004242874.1|  PREDICTED: cytochrome P450 81D11-like              243   8e-73   Solanum lycopersicum
ref|XP_009760136.1|  PREDICTED: isoflavone 2'-hydroxylase-like          241   6e-72   Nicotiana sylvestris
ref|XP_006367416.1|  PREDICTED: isoflavone 2'-hydroxylase-like          239   3e-71   Solanum tuberosum [potatoes]
dbj|BAH84783.1|  cytochrome P450                                        237   2e-70   Nicotiana tabacum [American tobacco]
ref|XP_011074387.1|  PREDICTED: cytochrome P450 81E8-like               235   6e-70   Sesamum indicum [beniseed]
ref|XP_009597427.1|  PREDICTED: isoflavone 2'-hydroxylase-like          234   1e-69   Nicotiana tomentosiformis
ref|XP_006367415.1|  PREDICTED: isoflavone 2'-hydroxylase-like          234   2e-69   Solanum tuberosum [potatoes]
gb|ABC69379.1|  CYP81C6v2                                               233   5e-69   Nicotiana tabacum [American tobacco]
gb|ABC69380.1|  CYP81C6v2                                               233   5e-69   Nicotiana tabacum [American tobacco]
ref|XP_009785012.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    232   1e-68   Nicotiana sylvestris
emb|CDP01251.1|  unnamed protein product                                224   8e-67   Coffea canephora [robusta coffee]
gb|AHK60838.1|  CYP81C13                                                226   1e-66   Catharanthus roseus [chatas]
ref|XP_004238119.1|  PREDICTED: cytochrome P450 81E8                    219   5e-64   
emb|CDP01250.1|  unnamed protein product                                220   6e-64   Coffea canephora [robusta coffee]
emb|CDP01253.1|  unnamed protein product                                215   3e-62   Coffea canephora [robusta coffee]
ref|XP_007018581.1|  Cytochrome P450, family 81, subfamily D, pol...    206   4e-62   
ref|XP_011015740.1|  PREDICTED: cytochrome P450 81D11-like              214   6e-62   Populus euphratica
ref|XP_011017148.1|  PREDICTED: cytochrome P450 81D11-like              213   2e-61   Populus euphratica
gb|KJB29440.1|  hypothetical protein B456_005G100700                    213   3e-61   Gossypium raimondii
gb|KJB29441.1|  hypothetical protein B456_005G100700                    213   4e-61   Gossypium raimondii
ref|XP_006374861.1|  cytochrome P450 family protein                     211   1e-60   Populus trichocarpa [western balsam poplar]
ref|XP_007018579.1|  Cytochrome P450, family 81, subfamily K, pol...    210   2e-60   
dbj|BAH84784.1|  cytochrome P450                                        209   3e-60   Nicotiana tabacum [American tobacco]
emb|CDP20410.1|  unnamed protein product                                209   6e-60   Coffea canephora [robusta coffee]
ref|XP_006374863.1|  hypothetical protein POPTR_0014s02170g             207   2e-59   
gb|KHG18425.1|  Isoflavone 2'-hydroxylase                               206   8e-59   Gossypium arboreum [tree cotton]
ref|XP_002301158.2|  cytochrome P450 family protein                     204   3e-58   
ref|XP_012068271.1|  PREDICTED: cytochrome P450 81E8-like               204   4e-58   Jatropha curcas
ref|XP_002285066.1|  PREDICTED: isoflavone 3'-hydroxylase-like          201   4e-57   Vitis vinifera
ref|XP_002510136.1|  cytochrome P450, putative                          199   4e-56   Ricinus communis
ref|XP_010271770.1|  PREDICTED: isoflavone 2'-hydroxylase-like          197   2e-55   Nelumbo nucifera [Indian lotus]
emb|CDP21119.1|  unnamed protein product                                195   7e-55   Coffea canephora [robusta coffee]
emb|CDP15267.1|  unnamed protein product                                194   2e-54   Coffea canephora [robusta coffee]
gb|KDO81589.1|  hypothetical protein CISIN_1g020029mg                   189   2e-54   Citrus sinensis [apfelsine]
ref|XP_010271541.1|  PREDICTED: isoflavone 3'-hydroxylase-like          194   2e-54   Nelumbo nucifera [Indian lotus]
ref|XP_010556108.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    194   4e-54   Tarenaya hassleriana [spider flower]
ref|XP_010556107.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    194   4e-54   Tarenaya hassleriana [spider flower]
ref|XP_011029147.1|  PREDICTED: isoflavone 2'-hydroxylase-like          193   6e-54   Populus euphratica
gb|AAD32570.1|  NT7                                                     186   9e-54   Nicotiana tabacum [American tobacco]
ref|XP_006374862.1|  hypothetical protein POPTR_0014s02160g             191   2e-53   
ref|XP_006374864.1|  hypothetical protein POPTR_0014s02180g             191   2e-53   
ref|XP_010271553.1|  PREDICTED: isoflavone 2'-hydroxylase-like          190   5e-53   Nelumbo nucifera [Indian lotus]
ref|XP_006472253.1|  PREDICTED: cytochrome P450 81D1-like               190   7e-53   Citrus sinensis [apfelsine]
ref|XP_011069758.1|  PREDICTED: isoflavone 2'-hydroxylase-like          189   7e-53   Sesamum indicum [beniseed]
ref|XP_011029134.1|  PREDICTED: isoflavone 2'-hydroxylase-like          189   1e-52   Populus euphratica
ref|XP_006433586.1|  hypothetical protein CICLE_v10000895mg             189   3e-52   
ref|XP_010101691.1|  Isoflavone 2'-hydroxylase                          189   3e-52   
ref|XP_010692652.1|  PREDICTED: cytochrome P450 81E8-like               188   5e-52   Beta vulgaris subsp. vulgaris [field beet]
gb|AJD25195.1|  cytochrome P450 CYP81C16                                187   5e-52   Salvia miltiorrhiza [Chinese salvia]
emb|CDP19801.1|  unnamed protein product                                179   1e-51   Coffea canephora [robusta coffee]
ref|XP_009360167.1|  PREDICTED: isoflavone 2'-hydroxylase-like          186   1e-51   
ref|XP_007018555.1|  Cytochrome P450                                    184   1e-50   
ref|XP_002267485.1|  PREDICTED: isoflavone 3'-hydroxylase-like          184   1e-50   Vitis vinifera
ref|XP_006387951.1|  hypothetical protein POPTR_0458s00200g             181   1e-50   
ref|XP_010320311.1|  PREDICTED: cytochrome P450 81D1-like               176   2e-50   
gb|ABK96123.1|  unknown                                                 183   4e-50   Populus trichocarpa [western balsam poplar]
dbj|BAF98467.1|  cytochrome P450                                        182   4e-50   Coptis japonica var. dissecta
ref|XP_004238115.1|  PREDICTED: cytochrome P450 81D1-like               183   4e-50   
ref|XP_008337049.1|  PREDICTED: cytochrome P450 81D1-like               178   4e-50   
ref|XP_006372853.1|  cytochrome P450 family protein                     183   5e-50   
ref|XP_009620154.1|  PREDICTED: isoflavone 2'-hydroxylase-like          182   5e-50   Nicotiana tomentosiformis
ref|XP_006372852.1|  hypothetical protein POPTR_0017s05680g             182   5e-50   
ref|XP_006362076.1|  PREDICTED: cytochrome P450 81D1-like               182   6e-50   Solanum tuberosum [potatoes]
ref|XP_011037157.1|  PREDICTED: cytochrome P450 81D11-like              182   9e-50   Populus euphratica
ref|XP_002267599.1|  PREDICTED: isoflavone 2'-hydroxylase-like          181   1e-49   
ref|XP_009380098.1|  PREDICTED: cytochrome P450 81D1                    174   1e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008393762.1|  PREDICTED: cytochrome P450 81D1-like               181   1e-49   
ref|XP_010274363.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    172   2e-49   
emb|CDP14452.1|  unnamed protein product                                181   2e-49   Coffea canephora [robusta coffee]
emb|CBI33752.3|  unnamed protein product                                176   3e-49   Vitis vinifera
ref|XP_006387952.1|  hypothetical protein POPTR_0458s00200g             180   4e-49   
ref|XP_009760134.1|  PREDICTED: cytochrome P450 81D11-like              179   5e-49   Nicotiana sylvestris
ref|XP_006389073.1|  cytochrome P450 family protein                     179   6e-49   
ref|XP_002320704.2|  cytochrome P450 family protein                     179   7e-49   
ref|XP_006367423.1|  PREDICTED: isoflavone 2'-hydroxylase-like          179   7e-49   Solanum tuberosum [potatoes]
ref|XP_010672783.1|  PREDICTED: cytochrome P450 81E8-like               179   8e-49   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU35841.1|  hypothetical protein MIMGU_mgv1a024949mg                178   8e-49   Erythranthe guttata [common monkey flower]
gb|AHF22081.1|  CYP81B58                                                179   9e-49   Artemisia annua [sweet Annie]
gb|AFO64617.1|  cytochrome P450 mono-oxygenase                          179   1e-48   Artemisia annua [sweet Annie]
ref|XP_006453453.1|  hypothetical protein CICLE_v10008060mg             179   1e-48   Citrus clementina [clementine]
gb|ACJ85868.1|  unknown                                                 178   2e-48   Medicago truncatula
ref|XP_011029060.1|  PREDICTED: cytochrome P450 81D11-like              178   2e-48   Populus euphratica
gb|KEH31510.1|  cytochrome P450 family protein                          178   2e-48   Medicago truncatula
ref|XP_004238572.1|  PREDICTED: cytochrome P450 81E8-like               177   2e-48   
emb|CDX85218.1|  BnaC07g25290D                                          177   3e-48   
ref|XP_009380096.1|  PREDICTED: isoflavone 2'-hydroxylase-like          177   4e-48   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP14451.1|  unnamed protein product                                177   5e-48   Coffea canephora [robusta coffee]
ref|XP_004238116.2|  PREDICTED: isoflavone 2'-hydroxylase-like          177   5e-48   Solanum lycopersicum
emb|CAA04116.1|  cytochrome P450                                        177   6e-48   Helianthus tuberosus [Jerusalem artichoke]
emb|CBI33748.3|  unnamed protein product                                176   7e-48   Vitis vinifera
ref|XP_010531165.1|  PREDICTED: cytochrome P450 81E8-like               177   7e-48   Tarenaya hassleriana [spider flower]
ref|XP_007018568.1|  Cytochrome P450, putative                          176   8e-48   
ref|XP_006362077.1|  PREDICTED: isoflavone 2'-hydroxylase-like          177   8e-48   
ref|XP_009796226.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    176   8e-48   Nicotiana sylvestris
ref|XP_008453068.1|  PREDICTED: cytochrome P450 81D1-like               176   8e-48   Cucumis melo [Oriental melon]
ref|XP_007018567.1|  Cytochrome P450                                    176   9e-48   
emb|CAA04117.1|  cytochrome P450                                        176   1e-47   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_002283502.1|  PREDICTED: cytochrome P450 81E8-like               176   1e-47   Vitis vinifera
emb|CDP01233.1|  unnamed protein product                                172   1e-47   Coffea canephora [robusta coffee]
ref|XP_002283792.2|  PREDICTED: isoflavone 2'-hydroxylase               176   1e-47   Vitis vinifera
gb|ABC69377.1|  CYP81B2v2                                               176   1e-47   Nicotiana tabacum [American tobacco]
ref|XP_002283500.1|  PREDICTED: isoflavone 3'-hydroxylase               176   1e-47   Vitis vinifera
ref|XP_009796225.1|  PREDICTED: isoflavone 2'-hydroxylase-like          176   1e-47   Nicotiana sylvestris
ref|XP_011069766.1|  PREDICTED: isoflavone 3'-hydroxylase-like          176   1e-47   Sesamum indicum [beniseed]
ref|XP_007033007.1|  Cytochrome P450, family 81, subfamily D, pol...    175   2e-47   
ref|XP_004141398.1|  PREDICTED: cytochrome P450 81E8-like               175   2e-47   Cucumis sativus [cucumbers]
gb|KGN55250.1|  hypothetical protein Csa_4G642310                       175   2e-47   Cucumis sativus [cucumbers]
gb|ABC69378.1|  CYP81B2v1                                               175   2e-47   Nicotiana tabacum [American tobacco]
emb|CDX86416.1|  BnaA06g31330D                                          174   3e-47   
gb|KGN55242.1|  hypothetical protein Csa_4G641740                       167   3e-47   Cucumis sativus [cucumbers]
ref|XP_010277161.1|  PREDICTED: cytochrome P450 81E8-like               175   4e-47   Nelumbo nucifera [Indian lotus]
ref|XP_010446678.1|  PREDICTED: cytochrome P450 81D11-like              171   4e-47   
ref|XP_009620153.1|  PREDICTED: isoflavone 2'-hydroxylase-like          174   5e-47   Nicotiana tomentosiformis
ref|XP_002302425.2|  cytochrome P450 family protein                     174   5e-47   
ref|XP_008369127.1|  PREDICTED: LOW QUALITY PROTEIN: isoflavone 2...    174   6e-47   
ref|XP_002456656.1|  hypothetical protein SORBIDRAFT_03g040280          174   6e-47   Sorghum bicolor [broomcorn]
emb|CBI33744.3|  unnamed protein product                                167   6e-47   Vitis vinifera
ref|XP_004292745.1|  PREDICTED: isoflavone 2'-hydroxylase-like          174   8e-47   Fragaria vesca subsp. vesca
ref|XP_011069764.1|  PREDICTED: cytochrome P450 81E8-like isoform X1    174   8e-47   
ref|XP_008220355.1|  PREDICTED: cytochrome P450 81D11-like              166   8e-47   
ref|XP_010059864.1|  PREDICTED: isoflavone 2'-hydroxylase-like          174   9e-47   Eucalyptus grandis [rose gum]
ref|XP_009372454.1|  PREDICTED: isoflavone 2'-hydroxylase-like          173   1e-46   Pyrus x bretschneideri [bai li]
ref|XP_004231887.1|  PREDICTED: cytochrome P450 81D1-like               173   1e-46   Solanum lycopersicum
ref|XP_004290943.1|  PREDICTED: cytochrome P450 81D11-like              173   1e-46   Fragaria vesca subsp. vesca
ref|XP_006472256.1|  PREDICTED: isoflavone 2'-hydroxylase-like          173   1e-46   Citrus sinensis [apfelsine]
emb|CDP01236.1|  unnamed protein product                                173   1e-46   Coffea canephora [robusta coffee]
ref|XP_004290944.1|  PREDICTED: cytochrome P450 81D11-like              173   2e-46   Fragaria vesca subsp. vesca
ref|XP_012082300.1|  PREDICTED: cytochrome P450 81E8-like               173   2e-46   Jatropha curcas
ref|XP_007224527.1|  hypothetical protein PRUPE_ppa024021mg             172   2e-46   
ref|XP_010911513.1|  PREDICTED: cytochrome P450 81D11-like              170   2e-46   
ref|XP_010491736.1|  PREDICTED: isoflavone 2'-hydroxylase-like          172   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_007018554.1|  Cytochrome P450                                    172   2e-46   
ref|XP_002285061.2|  PREDICTED: cytochrome P450 81E8-like               173   2e-46   Vitis vinifera
gb|KFK25349.1|  hypothetical protein AALP_AA8G101100                    172   2e-46   Arabis alpina [alpine rockcress]
ref|XP_004509096.1|  PREDICTED: isoflavone 2'-hydroxylase-like          172   2e-46   Cicer arietinum [garbanzo]
ref|XP_008367651.1|  PREDICTED: cytochrome P450 81D11-like              172   3e-46   
gb|KHG05117.1|  Isoflavone 2'-hydroxylase                               172   3e-46   Gossypium arboreum [tree cotton]
ref|XP_011099312.1|  PREDICTED: cytochrome P450 81E8-like               172   3e-46   
ref|NP_001269247.1|  isoflavone 2'-hydroxylase-like                     172   3e-46   Cicer arietinum [garbanzo]
ref|XP_009151853.1|  PREDICTED: cytochrome P450 81D11                   172   3e-46   Brassica rapa
ref|XP_011029079.1|  PREDICTED: cytochrome P450 81D1-like               172   3e-46   Populus euphratica
ref|XP_002524941.1|  cytochrome P450, putative                          172   4e-46   Ricinus communis
emb|CDY47253.1|  BnaA02g29390D                                          172   4e-46   Brassica napus [oilseed rape]
ref|XP_008220288.1|  PREDICTED: isoflavone 2'-hydroxylase-like          172   4e-46   Prunus mume [ume]
ref|XP_008220356.1|  PREDICTED: cytochrome P450 81D11-like              172   4e-46   
ref|XP_002510130.1|  cytochrome P450, putative                          172   4e-46   
ref|XP_007227313.1|  hypothetical protein PRUPE_ppa016513mg             171   5e-46   
ref|XP_008452620.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    172   5e-46   
ref|XP_011099320.1|  PREDICTED: cytochrome P450 81D1-like               172   5e-46   Sesamum indicum [beniseed]
ref|XP_012079327.1|  PREDICTED: cytochrome P450 81E8-like               172   5e-46   Jatropha curcas
emb|CBI33745.3|  unnamed protein product                                171   5e-46   Vitis vinifera
gb|KDO79057.1|  hypothetical protein CISIN_1g019895mg                   168   5e-46   Citrus sinensis [apfelsine]
emb|CDY44041.1|  BnaA08g15650D                                          171   5e-46   Brassica napus [oilseed rape]
ref|XP_009129360.1|  PREDICTED: cytochrome P450 81D11-like              171   5e-46   Brassica rapa
ref|XP_009129359.1|  PREDICTED: cytochrome P450 81D11-like              172   5e-46   Brassica rapa
ref|XP_009109368.1|  PREDICTED: cytochrome P450 81F1-like               171   5e-46   Brassica rapa
emb|CBI38503.3|  unnamed protein product                                167   6e-46   Vitis vinifera
gb|AGC29950.1|  CYP81B56                                                168   6e-46   Sinopodophyllum hexandrum [Himalayan mayapple]
ref|XP_010059867.1|  PREDICTED: isoflavone 2'-hydroxylase-like          171   6e-46   Eucalyptus grandis [rose gum]
ref|XP_004141397.1|  PREDICTED: cytochrome P450 81D1-like               172   6e-46   Cucumis sativus [cucumbers]
ref|XP_009372456.1|  PREDICTED: cytochrome P450 81D11-like              171   7e-46   Pyrus x bretschneideri [bai li]
ref|XP_010095334.1|  Cytochrome P450 81D1                               170   7e-46   
ref|XP_010059866.1|  PREDICTED: isoflavone 2'-hydroxylase-like          171   7e-46   Eucalyptus grandis [rose gum]
gb|AJD25193.1|  cytochrome P450 CYP81B61                                171   7e-46   Salvia miltiorrhiza [Chinese salvia]
ref|XP_009796227.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    171   7e-46   Nicotiana sylvestris
ref|XP_006283601.1|  hypothetical protein CARUB_v10004657mg             171   7e-46   Capsella rubella
ref|XP_008781034.1|  PREDICTED: cytochrome P450 81D1-like               165   7e-46   
ref|XP_006425998.1|  hypothetical protein CICLE_v10025370mg             171   9e-46   Citrus clementina [clementine]
ref|XP_010936572.1|  PREDICTED: cytochrome P450 81D1-like               165   9e-46   
ref|XP_006399557.1|  hypothetical protein EUTSA_v10016031mg             171   1e-45   Eutrema salsugineum [saltwater cress]
emb|CDP12912.1|  unnamed protein product                                173   1e-45   Coffea canephora [robusta coffee]
gb|ADD84651.1|  CYP81B36                                                171   1e-45   Scoparia dulcis [escobilla]
ref|XP_004292746.2|  PREDICTED: isoflavone 3'-hydroxylase-like          171   1e-45   Fragaria vesca subsp. vesca
emb|CBI33746.3|  unnamed protein product                                169   1e-45   Vitis vinifera
ref|XP_010647303.1|  PREDICTED: cytochrome P450 81E8-like               168   1e-45   
ref|XP_010502943.1|  PREDICTED: cytochrome P450 81D11-like isofor...    167   1e-45   
emb|CAN72520.1|  hypothetical protein VITISV_040350                     171   1e-45   Vitis vinifera
ref|XP_012079329.1|  PREDICTED: cytochrome P450 81D1-like               171   1e-45   Jatropha curcas
emb|CAN60309.1|  hypothetical protein VITISV_015004                     174   1e-45   Vitis vinifera
ref|XP_002279038.1|  PREDICTED: isoflavone 2'-hydroxylase               171   1e-45   Vitis vinifera
ref|XP_007206766.1|  hypothetical protein PRUPE_ppa025296mg             170   1e-45   Prunus persica
gb|ACG29835.1|  cytochrome P450 CYP81A1                                 171   1e-45   Zea mays [maize]
gb|AIM45245.1|  flavonoid 3' hydroxylase-like protein                   170   1e-45   Fagopyrum tataricum [Kangra buckwheat]
gb|AHK60837.1|  CYP81Q32                                                170   1e-45   Catharanthus roseus [chatas]
ref|XP_012068397.1|  PREDICTED: isoflavone 3'-hydroxylase-like          170   1e-45   Jatropha curcas
ref|XP_010910128.1|  PREDICTED: cytochrome P450 81E8-like               170   1e-45   Elaeis guineensis
ref|XP_009406660.1|  PREDICTED: isoflavone 2'-hydroxylase-like          170   2e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006395346.1|  hypothetical protein EUTSA_v10004055mg             170   2e-45   Eutrema salsugineum [saltwater cress]
ref|XP_010446676.1|  PREDICTED: cytochrome P450 81D11-like              170   2e-45   
emb|CDX72625.1|  BnaC07g46470D                                          170   2e-45   
gb|KCW45256.1|  hypothetical protein EUGRSUZ_L010952                    164   2e-45   Eucalyptus grandis [rose gum]
dbj|BAF96951.1|  flavone synthase II                                    170   2e-45   Iris x hollandica [Dutch iris]
gb|KCW66347.1|  hypothetical protein EUGRSUZ_F001732                    162   2e-45   Eucalyptus grandis [rose gum]
ref|XP_006339843.1|  PREDICTED: cytochrome P450 81D1-like               170   2e-45   Solanum tuberosum [potatoes]
ref|XP_010437237.1|  PREDICTED: cytochrome P450 81D11-like              170   2e-45   Camelina sativa [gold-of-pleasure]
gb|KHN12964.1|  Cytochrome P450 81D1                                    166   2e-45   Glycine soja [wild soybean]
emb|CDP19800.1|  unnamed protein product                                170   2e-45   Coffea canephora [robusta coffee]
ref|XP_006466538.1|  PREDICTED: isoflavone 2'-hydroxylase-like          170   2e-45   Citrus sinensis [apfelsine]
dbj|BAN19900.1|  cytochrome P450                                        170   2e-45   Echinochloa phyllopogon
ref|XP_011099321.1|  PREDICTED: cytochrome P450 81D1-like               169   3e-45   Sesamum indicum [beniseed]
ref|XP_010424701.1|  PREDICTED: cytochrome P450 81D1-like               168   3e-45   
ref|NP_189516.1|  cytochrome P450 CYP81D11                              169   3e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010692651.1|  PREDICTED: cytochrome P450 81D1-like               167   3e-45   
ref|XP_010095331.1|  Cytochrome P450 81D1                               169   3e-45   Morus notabilis
emb|CDP01241.1|  unnamed protein product                                169   3e-45   Coffea canephora [robusta coffee]
gb|KCW66326.1|  hypothetical protein EUGRSUZ_F00151                     167   3e-45   Eucalyptus grandis [rose gum]
ref|XP_002510140.1|  cytochrome P450, putative                          169   3e-45   
dbj|BAP46307.1|  cytochrome P450                                        169   3e-45   Phryma leptostachya
ref|XP_011097392.1|  PREDICTED: cytochrome P450 81E8-like               169   4e-45   Sesamum indicum [beniseed]
ref|XP_007207372.1|  hypothetical protein PRUPE_ppa004635mg             169   4e-45   Prunus persica
ref|XP_010679549.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    169   4e-45   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI33749.3|  unnamed protein product                                162   4e-45   Vitis vinifera
ref|XP_002877127.1|  cytochrome P450 family protein                     169   4e-45   
ref|XP_004290938.1|  PREDICTED: isoflavone 3'-hydroxylase-like          169   5e-45   Fragaria vesca subsp. vesca
ref|XP_010047103.1|  PREDICTED: isoflavone 2'-hydroxylase-like          169   5e-45   Eucalyptus grandis [rose gum]
ref|XP_010936527.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    169   5e-45   
emb|CDY04030.1|  BnaC02g37450D                                          169   5e-45   
ref|XP_008780931.1|  PREDICTED: isoflavone 2'-hydroxylase-like          169   5e-45   Phoenix dactylifera
ref|XP_010446668.1|  PREDICTED: cytochrome P450 81D11-like              169   5e-45   
ref|XP_008238634.1|  PREDICTED: cytochrome P450 81D11-like              169   5e-45   Prunus mume [ume]
ref|XP_010531288.1|  PREDICTED: isoflavone 2'-hydroxylase-like          169   6e-45   Tarenaya hassleriana [spider flower]
gb|KGN63299.1|  hypothetical protein Csa_2G425760                       166   6e-45   Cucumis sativus [cucumbers]
ref|XP_010652757.1|  PREDICTED: isoflavone 2'-hydroxylase-like          169   6e-45   Vitis vinifera
ref|XP_007018553.1|  Cytochrome P450                                    169   6e-45   
emb|CDY04029.1|  BnaC02g37440D                                          169   6e-45   
dbj|BAN19901.1|  cytochrome P450                                        169   6e-45   Echinochloa phyllopogon
ref|XP_010095329.1|  putative receptor-like protein kinase              173   6e-45   
ref|XP_004970623.1|  PREDICTED: isoflavone 2'-hydroxylase-like          169   6e-45   Setaria italica
ref|XP_010502942.1|  PREDICTED: cytochrome P450 81D11-like isofor...    166   6e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010432066.1|  PREDICTED: cytochrome P450 81D11-like              168   7e-45   Camelina sativa [gold-of-pleasure]
emb|CDP04571.1|  unnamed protein product                                168   7e-45   Coffea canephora [robusta coffee]
ref|XP_011017526.1|  PREDICTED: cytochrome P450 81D1-like               169   7e-45   Populus euphratica
ref|XP_010911255.1|  PREDICTED: isoflavone 2'-hydroxylase-like          168   8e-45   Elaeis guineensis
gb|KFK28144.1|  hypothetical protein AALP_AA8G478000                    168   8e-45   Arabis alpina [alpine rockcress]
dbj|BAF00654.1|  cytochrome P450 like protein                           168   8e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006374853.1|  cytochrome P450 family protein                     168   8e-45   
emb|CDY29547.1|  BnaA03g53920D                                          168   9e-45   Brassica napus [oilseed rape]
gb|KDO81584.1|  hypothetical protein CISIN_1g015593mg                   166   9e-45   Citrus sinensis [apfelsine]
ref|XP_010070610.1|  PREDICTED: isoflavone 2'-hydroxylase-like          168   9e-45   Eucalyptus grandis [rose gum]
ref|XP_010095332.1|  Isoflavone 2'-hydroxylase                          168   9e-45   Morus notabilis
ref|XP_009354137.1|  PREDICTED: cytochrome P450 81D11-like              168   9e-45   Pyrus x bretschneideri [bai li]
ref|XP_008787116.1|  PREDICTED: isoflavone 2'-hydroxylase-like          168   9e-45   Phoenix dactylifera
dbj|BAE48235.1|  cytochrome P450                                        168   1e-44   Sesamum radiatum
ref|XP_008444122.1|  PREDICTED: cytochrome P450 81D1-like               168   1e-44   Cucumis melo [Oriental melon]
ref|NP_196622.2|  cytochrome P450, family 81, subfamily K, polype...    168   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010105470.1|  Cytochrome P450 81D1                               168   1e-44   
ref|XP_012079324.1|  PREDICTED: cytochrome P450 81E8-like               168   1e-44   Jatropha curcas
ref|XP_006472258.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    168   1e-44   
gb|AJD25199.1|  cytochrome P450 CYP81Q43                                167   1e-44   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010437239.1|  PREDICTED: cytochrome P450 81D11-like              167   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_009380100.1|  PREDICTED: isoflavone 2'-hydroxylase-like          168   1e-44   
gb|KJB59856.1|  hypothetical protein B456_009G276900                    168   1e-44   Gossypium raimondii
ref|XP_008238686.1|  PREDICTED: cytochrome P450 81D11-like              167   1e-44   Prunus mume [ume]
ref|XP_010425654.1|  PREDICTED: cytochrome P450 81D11                   167   1e-44   Camelina sativa [gold-of-pleasure]
gb|AFW84519.1|  putative cytochrome P450 superfamily protein            168   1e-44   
ref|XP_010059880.1|  PREDICTED: isoflavone 2'-hydroxylase-like          168   1e-44   
ref|XP_006466537.1|  PREDICTED: isoflavone 2'-hydroxylase-like          168   1e-44   Citrus sinensis [apfelsine]
ref|XP_010936531.1|  PREDICTED: isoflavone 2'-hydroxylase-like          168   1e-44   Elaeis guineensis
ref|XP_006433591.1|  hypothetical protein CICLE_v10000934mg             167   1e-44   
ref|XP_011458843.1|  PREDICTED: cytochrome P450 81D11-like              162   1e-44   Fragaria vesca subsp. vesca
ref|XP_008378170.1|  PREDICTED: cytochrome P450 81D1-like               167   1e-44   
emb|CBI33753.3|  unnamed protein product                                161   1e-44   Vitis vinifera
dbj|BAJ09068.1|  cytochrome P450                                        167   2e-44   Sesamum schinzianum
ref|XP_006411898.1|  hypothetical protein EUTSA_v10024985mg             167   2e-44   Eutrema salsugineum [saltwater cress]
dbj|BAJ34200.1|  unnamed protein product                                167   2e-44   Eutrema halophilum
ref|XP_008238660.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    167   2e-44   Prunus mume [ume]
ref|XP_007047420.1|  Cytochrome P450, family 81, subfamily D, pol...    167   2e-44   
ref|XP_007206553.1|  hypothetical protein PRUPE_ppa019965mg             167   2e-44   Prunus persica
ref|XP_010531270.1|  PREDICTED: cytochrome P450 81D11-like              167   2e-44   Tarenaya hassleriana [spider flower]
ref|XP_007225038.1|  hypothetical protein PRUPE_ppa019886mg             167   2e-44   
ref|XP_006386494.1|  cytochrome P450 family protein                     167   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_008365132.1|  PREDICTED: cytochrome P450 81D1-like               167   2e-44   
ref|XP_006466536.1|  PREDICTED: isoflavone 2'-hydroxylase-like          167   2e-44   Citrus sinensis [apfelsine]
gb|KDO79056.1|  hypothetical protein CISIN_1g020899mg                   163   2e-44   Citrus sinensis [apfelsine]
ref|NP_195459.1|  cytochrome P450 81F1                                  167   2e-44   Arabidopsis thaliana [mouse-ear cress]
gb|AAM67324.1|  cytochrome P450 monooxygenase CYP91A2                   167   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006289488.1|  hypothetical protein CARUB_v10003021mg             167   2e-44   
gb|EYU25480.1|  hypothetical protein MIMGU_mgv1a020641mg                168   2e-44   
gb|AAL69519.1|  AT4g37430/F6G17_80                                      167   2e-44   
ref|XP_009354183.1|  PREDICTED: uncharacterized protein LOC103945350    172   2e-44   
ref|XP_010514586.1|  PREDICTED: cytochrome P450 81D11-like isofor...    167   3e-44   
gb|KFK30357.1|  hypothetical protein AALP_AA7G250900                    167   3e-44   
dbj|BAP46308.1|  cytochrome P450                                        167   3e-44   
ref|XP_006283585.1|  hypothetical protein CARUB_v10004642mg             167   3e-44   
ref|XP_006433590.1|  hypothetical protein CICLE_v10000918mg             167   3e-44   
gb|KCW54840.1|  hypothetical protein EUGRSUZ_I00783                     163   3e-44   
ref|XP_007018569.1|  Cytochrome P450, putative                          167   3e-44   
gb|KFK33753.1|  hypothetical protein AALP_AA5G055600                    167   3e-44   
ref|XP_010040392.1|  PREDICTED: cytochrome P450 81F1-like               165   3e-44   
ref|XP_004141393.1|  PREDICTED: cytochrome P450 81E8-like               167   3e-44   
ref|NP_196623.1|  cytochrome P450, family 81, subfamily K, polype...    167   3e-44   
ref|NP_001117558.1|  cytochrome P450 superfamily protein                163   3e-44   
ref|XP_010095335.1|  Isoflavone 2'-hydroxylase                          167   3e-44   
dbj|BAA28539.1|  cytochrome P450 monooxygenase                          167   3e-44   
ref|XP_008812889.1|  PREDICTED: isoflavone 2'-hydroxylase-like          167   3e-44   
ref|XP_009380101.1|  PREDICTED: isoflavone 2'-hydroxylase-like          167   3e-44   
ref|XP_008812892.1|  PREDICTED: isoflavone 2'-hydroxylase-like          167   3e-44   
ref|XP_006472257.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    167   3e-44   
ref|XP_011078365.1|  PREDICTED: cytochrome P450 81D11-like              166   4e-44   
emb|CBI33755.3|  unnamed protein product                                160   4e-44   
ref|XP_006433592.1|  hypothetical protein CICLE_v10000926mg             166   4e-44   
ref|XP_010906241.1|  PREDICTED: isoflavone 2'-hydroxylase-like          166   4e-44   
ref|XP_010695902.1|  PREDICTED: cytochrome P450 81D11-like              163   4e-44   
ref|XP_002285105.1|  PREDICTED: isoflavone 2'-hydroxylase-like          166   4e-44   
ref|XP_006425999.1|  hypothetical protein CICLE_v10027560mg             166   4e-44   
ref|XP_002871428.1|  CYP81K1                                            166   4e-44   
ref|XP_010432067.1|  PREDICTED: cytochrome P450 81D11-like              166   4e-44   
ref|XP_002279056.2|  PREDICTED: isoflavone 2'-hydroxylase               167   4e-44   
ref|XP_002866952.1|  CYP81D8                                            166   4e-44   
ref|XP_010432068.1|  PREDICTED: cytochrome P450 81D11-like              166   4e-44   
ref|XP_006411892.1|  hypothetical protein EUTSA_v10024981mg             166   4e-44   
emb|CDY22431.1|  BnaC03g61440D                                          166   5e-44   
ref|XP_004287988.1|  PREDICTED: cytochrome P450 81E8-like               166   5e-44   
ref|XP_010456472.1|  PREDICTED: cytochrome P450 81E8-like               165   5e-44   
gb|AGO03791.1|  cytochrome P450-like protein                            166   5e-44   
ref|XP_012068272.1|  PREDICTED: cytochrome P450 81E8-like               166   5e-44   
ref|XP_007156755.1|  hypothetical protein PHAVU_002G014700g             166   6e-44   
emb|CDP01240.1|  unnamed protein product                                167   6e-44   
ref|XP_006590643.1|  PREDICTED: isoflavone 2'-hydroxylase               166   6e-44   
ref|XP_012068274.1|  PREDICTED: isoflavone 2'-hydroxylase-like          166   6e-44   
gb|KDP41666.1|  hypothetical protein JCGZ_16073                         166   6e-44   
ref|XP_007033004.1|  Cytochrome P450, family 81, subfamily D, pol...    166   6e-44   
dbj|BAN19899.1|  cytochrome P450                                        166   7e-44   
ref|XP_002302426.2|  cytochrome P450 family protein                     166   7e-44   
ref|XP_004151868.1|  PREDICTED: cytochrome P450 81E8-like               166   7e-44   
dbj|BAJ09386.1|  cytochrome P450                                        166   8e-44   
ref|XP_010688240.1|  PREDICTED: isoflavone 3'-hydroxylase-like          166   8e-44   
dbj|BAE48236.1|  cytochrome P450                                        166   8e-44   
ref|XP_009380099.1|  PREDICTED: isoflavone 2'-hydroxylase-like          166   9e-44   
emb|CBI19438.3|  unnamed protein product                                165   1e-43   
ref|XP_012079326.1|  PREDICTED: isoflavone 3'-hydroxylase-like          165   1e-43   
emb|CAN69522.1|  hypothetical protein VITISV_018333                     165   1e-43   
gb|KFK30358.1|  hypothetical protein AALP_AA7G251000                    165   1e-43   
ref|XP_010548442.1|  PREDICTED: cytochrome P450 81D11-like              165   1e-43   
emb|CDY00119.1|  BnaC09g01820D                                          165   1e-43   
ref|NP_176827.2|  cytochrome P450 superfamily protein                   163   1e-43   
ref|XP_006285213.1|  hypothetical protein CARUB_v10006572mg             165   1e-43   
ref|XP_008378166.1|  PREDICTED: isoflavone 2'-hydroxylase-like          165   1e-43   
emb|CDP21125.1|  unnamed protein product                                162   1e-43   
ref|XP_008393761.1|  PREDICTED: cytochrome P450 81D11-like              165   1e-43   
ref|XP_002283235.1|  PREDICTED: isoflavone 2'-hydroxylase               165   1e-43   
ref|XP_009122037.1|  PREDICTED: cytochrome P450 81D1                    165   2e-43   
ref|XP_010548438.1|  PREDICTED: cytochrome P450 81D11-like              165   2e-43   
ref|XP_009354182.1|  PREDICTED: cytochrome P450 81D11-like              165   2e-43   
emb|CDP01238.1|  unnamed protein product                                166   2e-43   
emb|CDX69303.1|  BnaC01g01500D                                          164   2e-43   
ref|XP_002868988.1|  CYP91A2                                            164   2e-43   
ref|XP_008238612.1|  PREDICTED: cytochrome P450 81D11                   164   2e-43   
ref|XP_007208229.1|  hypothetical protein PRUPE_ppa017987mg             164   2e-43   
gb|AFK44067.1|  unknown                                                 158   2e-43   
ref|XP_004287985.1|  PREDICTED: cytochrome P450 81E8-like               164   2e-43   
gb|KJB43843.1|  hypothetical protein B456_007G219100                    164   2e-43   
ref|XP_010059887.1|  PREDICTED: isoflavone 2'-hydroxylase-like          164   2e-43   
gb|AGC29952.1|  CYP81B57                                                164   2e-43   
ref|XP_010659889.1|  PREDICTED: cytochrome P450 81E8-like               164   2e-43   
ref|XP_006472259.1|  PREDICTED: cytochrome P450 81D1-like               164   3e-43   
ref|XP_002887056.1|  hypothetical protein ARALYDRAFT_475761             162   3e-43   
ref|XP_012079328.1|  PREDICTED: isoflavone 3'-hydroxylase-like          164   3e-43   
ref|XP_010059863.1|  PREDICTED: isoflavone 2'-hydroxylase-like          164   3e-43   
emb|CAN70574.1|  hypothetical protein VITISV_018972                     164   3e-43   
ref|XP_010652758.1|  PREDICTED: cytochrome P450 81E8 isoform X1         162   3e-43   
ref|XP_009111606.1|  PREDICTED: cytochrome P450 81D11                   164   3e-43   
ref|XP_006290401.1|  hypothetical protein CARUB_v10018682mg             164   3e-43   
ref|XP_002283222.3|  PREDICTED: cytochrome P450 81E8-like               164   3e-43   
ref|XP_009796228.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    164   4e-43   
ref|XP_010059888.1|  PREDICTED: isoflavone 2'-hydroxylase-like          164   4e-43   
emb|CDX69819.1|  BnaA10g21680D                                          164   4e-43   
ref|XP_009136438.1|  PREDICTED: cytochrome P450 81F1-like               164   4e-43   
emb|CDX75650.1|  BnaA01g00520D                                          164   4e-43   
ref|XP_009630633.1|  PREDICTED: isoflavone 2'-hydroxylase-like          164   4e-43   
ref|XP_004141996.2|  PREDICTED: cytochrome P450 81E8-like               164   4e-43   
ref|XP_010526705.1|  PREDICTED: cytochrome P450 81D11-like              164   4e-43   
gb|AAG51161.1|AC074025_11  cytochrome P450, putative                    163   5e-43   
ref|XP_006426000.1|  hypothetical protein CICLE_v10025420mg             163   5e-43   
ref|XP_007207761.1|  hypothetical protein PRUPE_ppa026692mg             163   5e-43   
ref|XP_003635481.1|  PREDICTED: isoflavone 2'-hydroxylase-like          163   5e-43   
gb|AGO03794.1|  cytochrome P450-like protein                            163   5e-43   
emb|CDX69299.1|  BnaC01g01540D                                          163   6e-43   
ref|XP_009407093.1|  PREDICTED: isoflavone 2'-hydroxylase-like          163   6e-43   
ref|XP_008238642.1|  PREDICTED: isoflavone 2'-hydroxylase-like          163   6e-43   
gb|AAQ89607.1|  At4g37400                                               159   6e-43   
tpg|DAA47255.1|  TPA: putative cytochrome P450 superfamily protein      163   7e-43   
ref|XP_002888509.1|  hypothetical protein ARALYDRAFT_475755             161   7e-43   
gb|ACG37780.1|  cytochrome P450 CYP81A17                                163   7e-43   
emb|CAB89383.1|  cytochrome P450-like protein                           164   7e-43   
gb|AAN31933.1|  putative cytochrome P450 monooxygenase (CYP91A2)        162   8e-43   
ref|XP_008661335.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    163   8e-43   
ref|XP_011657880.1|  PREDICTED: cytochrome P450 81E8                    162   8e-43   
emb|CAN76836.1|  hypothetical protein VITISV_029031                     162   9e-43   
ref|XP_010095333.1|  Isoflavone 2'-hydroxylase                          163   9e-43   
ref|XP_002510131.1|  cytochrome P450, putative                          163   9e-43   
gb|ACG27899.1|  cytochrome P450 CYP81N4                                 163   9e-43   
emb|CBI18830.3|  unnamed protein product                                163   9e-43   
ref|XP_009791128.1|  PREDICTED: cytochrome P450 81D11-like              163   9e-43   
ref|XP_003611660.1|  Cytochrome P450 81D1                               162   9e-43   
ref|XP_010511484.1|  PREDICTED: cytochrome P450 81D11-like isofor...    162   9e-43   
emb|CDX75645.1|  BnaA01g00570D                                          162   9e-43   
ref|XP_011650031.1|  PREDICTED: isoflavone 2'-hydroxylase-like          162   1e-42   
ref|XP_011029179.1|  PREDICTED: isoflavone 2'-hydroxylase-like          162   1e-42   
gb|KCW66315.1|  hypothetical protein EUGRSUZ_F00141                     162   1e-42   
gb|EYU43431.1|  hypothetical protein MIMGU_mgv1a004884mg                162   1e-42   
ref|XP_010548441.1|  PREDICTED: cytochrome P450 81D11-like              162   1e-42   
ref|XP_011070140.1|  PREDICTED: cytochrome P450 81E8-like               162   1e-42   
ref|XP_010059868.1|  PREDICTED: isoflavone 2'-hydroxylase-like          162   1e-42   
ref|XP_009372457.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    162   1e-42   
ref|XP_010686532.1|  PREDICTED: isoflavone 2'-hydroxylase-like          162   1e-42   
emb|CDX75640.1|  BnaA01g00620D                                          158   1e-42   
ref|XP_002523472.1|  cytochrome P450, putative                          162   1e-42   
ref|XP_004252822.1|  PREDICTED: isoflavone 2'-hydroxylase-like          162   1e-42   
ref|XP_002524937.1|  cytochrome P450, putative                          158   1e-42   
ref|XP_007207692.1|  hypothetical protein PRUPE_ppa023786mg             162   1e-42   
gb|AFW67560.1|  putative cytochrome P450 superfamily protein            162   2e-42   
ref|XP_008453067.1|  PREDICTED: LOW QUALITY PROTEIN: isoflavone 2...    162   2e-42   
ref|XP_004142688.1|  PREDICTED: cytochrome P450 81D11-like              162   2e-42   
emb|CDP01254.1|  unnamed protein product                                156   2e-42   
ref|XP_002283523.3|  PREDICTED: cytochrome P450 81E8 isoform X2         162   2e-42   
emb|CAB38207.1|  cytochrome P450 monooxygenase-like protein             159   2e-42   
ref|XP_002524942.1|  cytochrome P450, putative                          161   2e-42   
ref|XP_010906301.1|  PREDICTED: cytochrome P450 81E8-like               162   2e-42   
gb|AHG97656.1|  isoflavone-2'-hydroxylase                               162   2e-42   
emb|CDP04688.1|  unnamed protein product                                161   2e-42   
ref|XP_006411900.1|  hypothetical protein EUTSA_v10025016mg             161   2e-42   
gb|KJB63920.1|  hypothetical protein B456_010G024400                    162   2e-42   
ref|XP_008644484.1|  PREDICTED: cytochrome P450 81D1-like               162   2e-42   
ref|XP_008812907.1|  PREDICTED: cytochrome P450 81D11-like              165   2e-42   
ref|XP_010105471.1|  Isoflavone 2'-hydroxylase                          161   2e-42   
ref|XP_011099348.1|  PREDICTED: cytochrome P450 81E8-like               161   3e-42   
ref|XP_010669387.1|  PREDICTED: cytochrome P450 81E8-like               161   3e-42   
ref|XP_010937897.1|  PREDICTED: cytochrome P450 81D11-like              154   3e-42   
ref|XP_008238624.1|  PREDICTED: cytochrome P450 81D11-like              161   3e-42   
ref|XP_010070611.1|  PREDICTED: isoflavone 2'-hydroxylase-like          161   3e-42   
ref|XP_010692664.1|  PREDICTED: isoflavone 2'-hydroxylase-like          161   3e-42   
ref|XP_010059714.1|  PREDICTED: isoflavone 2'-hydroxylase-like          161   3e-42   
ref|NP_195453.1|  cytochrome P450, family 81, subfamily D, polype...    161   3e-42   
ref|XP_008780951.1|  PREDICTED: isoflavone 2'-hydroxylase-like          161   3e-42   
ref|XP_010059891.1|  PREDICTED: isoflavone 2'-hydroxylase-like          161   3e-42   
ref|XP_009622945.1|  PREDICTED: isoflavone 2'-hydroxylase-like          161   3e-42   
ref|XP_010435498.1|  PREDICTED: cytochrome P450 81D1-like               161   3e-42   
ref|XP_009138491.1|  PREDICTED: cytochrome P450 81D11-like              161   3e-42   
ref|XP_004141394.1|  PREDICTED: isoflavone 2'-hydroxylase-like          161   3e-42   
ref|XP_010906666.1|  PREDICTED: cytochrome P450 81E8-like               157   4e-42   
ref|XP_009360222.1|  PREDICTED: isoflavone 2'-hydroxylase-like          161   4e-42   
dbj|BAE99553.1|  cytochrome P450 like protein                           160   4e-42   
gb|AEM42992.1|  cytochrome P450                                         160   4e-42   
gb|AJD25197.1|  cytochrome P450 CYP81Q41                                160   4e-42   
ref|XP_010531271.1|  PREDICTED: cytochrome P450 81F1-like               160   5e-42   
ref|XP_008459939.1|  PREDICTED: isoflavone 2'-hydroxylase-like          161   5e-42   
ref|XP_010437233.1|  PREDICTED: cytochrome P450 81F1-like               160   5e-42   
ref|XP_010440785.1|  PREDICTED: cytochrome P450 81D1-like               160   5e-42   
gb|KCW66329.1|  hypothetical protein EUGRSUZ_F00155                     160   5e-42   
ref|NP_195450.1|  cytochrome P450, family 81, subfamily D, polype...    160   5e-42   
ref|XP_012068398.1|  PREDICTED: cytochrome P450 81E8-like               160   5e-42   
ref|NP_195452.1|  cytochrome P450, family 81, subfamily D, polype...    160   5e-42   
ref|XP_004956717.1|  PREDICTED: isoflavone 2'-hydroxylase-like          160   6e-42   
gb|KHG06872.1|  Isoflavone 2'-hydroxylase                               160   6e-42   
ref|XP_011078366.1|  PREDICTED: cytochrome P450 81D11-like              160   6e-42   
ref|NP_001142304.1|  uncharacterized protein LOC100274473               160   6e-42   
ref|NP_001168824.1|  uncharacterized protein LOC100382629               158   7e-42   
ref|XP_007018585.1|  Cytochrome P450, putative                          160   7e-42   
ref|XP_008780952.1|  PREDICTED: isoflavone 2'-hydroxylase-like          160   7e-42   
ref|XP_007151697.1|  hypothetical protein PHAVU_004G0683001g            157   7e-42   
ref|XP_006285804.1|  hypothetical protein CARUB_v10007280mg             160   7e-42   
ref|XP_012079325.1|  PREDICTED: cytochrome P450 81D1-like               160   7e-42   
ref|XP_002866956.1|  CYP81D5                                            160   7e-42   
ref|XP_009136332.1|  PREDICTED: cytochrome P450 81F1                    160   8e-42   
gb|AJD25194.1|  cytochrome P450 CYP81B62                                160   8e-42   
ref|XP_011069765.1|  PREDICTED: isoflavone 2'-hydroxylase-like is...    160   8e-42   
ref|XP_006411896.1|  hypothetical protein EUTSA_v10027443mg             160   8e-42   
ref|XP_010548445.1|  PREDICTED: cytochrome P450 81F1-like               160   8e-42   
gb|AJD25198.1|  cytochrome P450 CYP81Q42                                160   8e-42   
ref|XP_009122038.1|  PREDICTED: cytochrome P450 81D1-like               160   9e-42   
gb|EYU44450.1|  hypothetical protein MIMGU_mgv1a005020mg                160   9e-42   
ref|XP_012068267.1|  PREDICTED: cytochrome P450 81D11-like              160   9e-42   
ref|XP_008455812.1|  PREDICTED: isoflavone 2'-hydroxylase-like          160   9e-42   
dbj|BAK00283.1|  predicted protein                                      160   9e-42   
ref|XP_009136769.1|  PREDICTED: cytochrome P450 81F1                    160   1e-41   
ref|XP_004963012.1|  PREDICTED: cytochrome P450 81D1-like               160   1e-41   
ref|XP_010446665.1|  PREDICTED: cytochrome P450 81F1-like               160   1e-41   
ref|XP_010446673.1|  PREDICTED: cytochrome P450 81D11-like              159   1e-41   
gb|KCW66327.1|  hypothetical protein EUGRSUZ_F00153                     156   1e-41   
gb|KCW66309.1|  hypothetical protein EUGRSUZ_F00134                     159   1e-41   
ref|XP_003579242.2|  PREDICTED: cytochrome P450 81D11-like              160   1e-41   
ref|XP_004504635.1|  PREDICTED: isoflavone 2'-hydroxylase-like          159   1e-41   
ref|XP_010059879.1|  PREDICTED: isoflavone 2'-hydroxylase-like          156   1e-41   
emb|CAB41490.1|  cytochrome P450 monooxygenase                          159   1e-41   
ref|XP_007156756.1|  hypothetical protein PHAVU_002G014800g             160   1e-41   
emb|CDY71851.1|  BnaCnng74800D                                          155   1e-41   
ref|XP_010451019.1|  PREDICTED: cytochrome P450 81D11-like              159   1e-41   
ref|XP_004287989.1|  PREDICTED: cytochrome P450 81E8-like               159   2e-41   
gb|ACG29853.1|  cytochrome P450 CYP81A3v2                               159   2e-41   
gb|KHN28917.1|  Isoflavone 2'-hydroxylase                               156   2e-41   
ref|XP_004141999.2|  PREDICTED: cytochrome P450 81E8-like               159   2e-41   
ref|XP_010064163.1|  PREDICTED: isoflavone 2'-hydroxylase-like          159   2e-41   
ref|XP_008812908.1|  PREDICTED: isoflavone 2'-hydroxylase-like          159   2e-41   
gb|EMT15747.1|  Cytochrome P450 81D1                                    156   2e-41   
gb|KJB48230.1|  hypothetical protein B456_008G059000                    159   2e-41   
gb|KJB58589.1|  hypothetical protein B456_009G217000                    159   2e-41   



>ref|XP_009597287.1| PREDICTED: isoflavone 2'-hydroxylase-like [Nicotiana tomentosiformis]
Length=530

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 172/211 (82%), Gaps = 1/211 (0%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AGTETTS+TI+WAM LLL++P+   KLR EID+ VG++ LLNESDLSKLPYLR VI
Sbjct  320  VLFVAGTETTSMTIQWAMRLLLAHPQAFTKLRAEIDSKVGNERLLNESDLSKLPYLRSVI  379

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYPP PLLLPH+S EDC VAGY VPKHT +M+NAWA+H DPK+W+EPEKFKPERF
Sbjct  380  NETLRLYPPVPLLLPHFSSEDCTVAGYQVPKHTILMINAWAIHRDPKLWDEPEKFKPERF  439

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            EA+   E EGFNYKF+PFG GRRAC   NMGLR VSL LG+ IQ FDWKN +E+  L A 
Sbjct  440  EAMDLGEKEGFNYKFIPFGMGRRACSGANMGLRTVSLMLGSLIQWFDWKNVEEENNLDAC  499

Query  234  YLSPSI-LQKDERLEAICTPRKNCLQFLSQL  145
            Y++  + L KD+ LE+IC PR+NC+Q LSQL
Sbjct  500  YINSKVNLNKDKPLESICIPRQNCIQLLSQL  530



>ref|XP_009780215.1| PREDICTED: isoflavone 2'-hydroxylase-like [Nicotiana sylvestris]
Length=527

 Score =   250 bits (639),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 167/208 (80%), Gaps = 0/208 (0%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AGTETTS+TI+WAM LLL++P+   KLR EID+ VG+K LLNESDL+KLPYL CVI
Sbjct  320  VLFVAGTETTSMTIQWAMRLLLAHPQAFQKLRSEIDSKVGNKRLLNESDLAKLPYLHCVI  379

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYPP PLLLPHYS E+C + GY VPKHT +MVNAWA+H DPK+W+EPEKFKPERF
Sbjct  380  NETLRLYPPVPLLLPHYSSENCTIGGYQVPKHTILMVNAWAIHRDPKLWDEPEKFKPERF  439

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            EA+   E EGFNYKF+PFG GRRAC   NMGLR VSL LG+ IQ FDWKN +E+  L A 
Sbjct  440  EAMELGEKEGFNYKFIPFGMGRRACSGANMGLRTVSLVLGSLIQWFDWKNVEEENNLDAC  499

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLS  151
            Y S   L KD+ LEAIC PR+NC+Q LS
Sbjct  500  YNSKVNLSKDKPLEAICIPRQNCIQLLS  527



>ref|XP_006359732.1| PREDICTED: isoflavone 2'-hydroxylase-like [Solanum tuberosum]
Length=513

 Score =   244 bits (622),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 173/210 (82%), Gaps = 3/210 (1%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AGTET+S TI+W M LLL++PEVLHKLR +IDN VG+K L+ ESDL+KLPYLRCV+
Sbjct  307  VIFVAGTETSSSTIQWVMRLLLAHPEVLHKLRADIDNKVGNKRLVRESDLTKLPYLRCVV  366

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NET+RLYPP PLLLPHYS EDC V GYDVPKHT +++NAWA+H DPKVW++PEKFKPERF
Sbjct  367  NETMRLYPPVPLLLPHYSTEDCTVGGYDVPKHTMLLINAWAVHRDPKVWDDPEKFKPERF  426

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            EA  GE  E FNYK +PFG GRRACP  +MGLR VSLALGA +QCFDW+  +E++ L A+
Sbjct  427  EATEGET-ERFNYKLIPFGMGRRACPGTDMGLRAVSLALGALVQCFDWQ-IEEEESLEAS  484

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
            Y +   +Q ++ L+A+CTPRK+ ++ LSQL
Sbjct  485  YHARMSMQ-NKPLKAVCTPRKDLVELLSQL  513



>ref|XP_004242874.1| PREDICTED: cytochrome P450 81D11-like [Solanum lycopersicum]
Length=512

 Score =   243 bits (619),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 172/210 (82%), Gaps = 3/210 (1%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            +VF AGTET+S TI+W M LLL++PEVLHKLR +IDN VG+K L+ ESDL+KLPYLRCV+
Sbjct  306  VVFVAGTETSSSTIQWVMRLLLAHPEVLHKLRADIDNKVGNKRLVRESDLTKLPYLRCVV  365

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NET+RLYPP PLLLPHYS EDC V GYDVPKHT +++NAWA+H DPKVW++PEKFKPERF
Sbjct  366  NETMRLYPPVPLLLPHYSTEDCTVGGYDVPKHTMLLINAWAVHRDPKVWDDPEKFKPERF  425

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            EA  G E E FNYK +PFG GRRACP  +MGLR VSLALGA IQCF+W+  +E++ L A+
Sbjct  426  EATQG-ETERFNYKLIPFGMGRRACPGTDMGLRAVSLALGALIQCFEWQ-IEEEESLEAS  483

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
            Y +   +Q ++ L+AICTPRK+ +  LSQL
Sbjct  484  YHARMSMQ-NKPLKAICTPRKDLVDLLSQL  512



>ref|XP_009760136.1| PREDICTED: isoflavone 2'-hydroxylase-like [Nicotiana sylvestris]
Length=520

 Score =   241 bits (614),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 167/208 (80%), Gaps = 2/208 (1%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AGTETTS+TI+WAM LLL++P+   KLR EID+ VG+  LLNESD+ KLPYL CVI
Sbjct  315  VLFIAGTETTSMTIQWAMRLLLAHPKAFTKLRAEIDSKVGNDGLLNESDIPKLPYLHCVI  374

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYPP PLLLPHYSLEDC V GY+VPKHT +MVNAWA+H DPK+W+EPEKFKPERF
Sbjct  375  NETLRLYPPVPLLLPHYSLEDCTVGGYEVPKHTILMVNAWAIHRDPKLWDEPEKFKPERF  434

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            EA+ GE+ EGFNYK VPFG GRRACP   MGLR VSL LG+ IQ FDWK+ +E+K L A 
Sbjct  435  EAMEGEK-EGFNYKLVPFGMGRRACPGAAMGLRTVSLVLGSLIQSFDWKSVEEEK-LDAC  492

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLS  151
            Y S   L KD+ LEA+C PR+N   FLS
Sbjct  493  YNSRITLNKDKPLEAVCIPRQNWRGFLS  520



>ref|XP_006367416.1| PREDICTED: isoflavone 2'-hydroxylase-like [Solanum tuberosum]
Length=510

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 168/210 (80%), Gaps = 2/210 (1%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AGT+T+S +++WAM LLL++PE LHKLR EID+ VG++HLLNESDL+KLPYL  VI
Sbjct  303  VIFIAGTDTSSTSLQWAMRLLLAHPEALHKLRAEIDSQVGNEHLLNESDLTKLPYLHSVI  362

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYPP PLLLPHYS EDC V GY+VPKHT ++VN WA+  DP+VW+EP +FKPERF
Sbjct  363  NETLRLYPPVPLLLPHYSSEDCTVGGYNVPKHTILLVNIWAIQRDPQVWKEPNEFKPERF  422

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            EA+ GE+ EGFNYK +PFG GRR+CP   MG R +SLALGA IQCFDW++  E+  L  +
Sbjct  423  EAMEGEK-EGFNYKLIPFGMGRRSCPGATMGTRAISLALGALIQCFDWQSAGEEN-LELS  480

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
            Y S   +QK + LEAICTPR N +Q LSQL
Sbjct  481  YNSRINIQKIKSLEAICTPRSNFVQLLSQL  510



>dbj|BAH84783.1| cytochrome P450 [Nicotiana tabacum]
Length=522

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 166/208 (80%), Gaps = 2/208 (1%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AGTETTS+TI+WAM LLL++P+   KLR EID+ VG+  LLNESD+ KLPYL  VI
Sbjct  317  VLFIAGTETTSMTIQWAMRLLLAHPKAFTKLRAEIDSKVGNDGLLNESDIPKLPYLHRVI  376

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYPP PLLLPHYSLEDC V GY+VPKHT +MVNAWA+H DPK+W+EPEKFKPERF
Sbjct  377  NETLRLYPPVPLLLPHYSLEDCTVGGYEVPKHTILMVNAWAIHRDPKLWDEPEKFKPERF  436

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            EA+ GE+ EGFNYK VPFG GRRACP   MGLR VSL LG+ IQ FDWK+ +E+K L A 
Sbjct  437  EAMEGEK-EGFNYKLVPFGMGRRACPGAAMGLRTVSLVLGSLIQSFDWKSVEEEK-LDAC  494

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLS  151
            Y S   L KD+ LEA+C PR+N   FLS
Sbjct  495  YNSRITLNKDKPLEAVCIPRQNWRGFLS  522



>ref|XP_011074387.1| PREDICTED: cytochrome P450 81E8-like [Sesamum indicum]
Length=506

 Score =   235 bits (599),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 164/210 (78%), Gaps = 3/210 (1%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AGTET++VTIEWAMSLLL++PE LHKL+ EIDN++GH HL+N++DL+KLPYLRC+I
Sbjct  300  ILFIAGTETSAVTIEWAMSLLLTHPEELHKLKQEIDNHIGHDHLINDADLAKLPYLRCII  359

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYPP PLLLPHYS E C V GYDVPK T +MVNAWAMH DP +WEEP+KF P RF
Sbjct  360  NETLRLYPPVPLLLPHYSSEKCTVGGYDVPKGTILMVNAWAMHRDPNIWEEPDKFNPRRF  419

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            +A+   E E   +KFVPFG GRRACP   MGLR +SLALGA++QCF+W+   E + + A 
Sbjct  420  QAM---EMEREAWKFVPFGMGRRACPGAAMGLRTISLALGAFVQCFEWEKLLEHEDMDAN  476

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
            Y S  +LQK + LEA+C PR      LS++
Sbjct  477  YNSRIMLQKGKPLEAVCVPRDPAADLLSRI  506



>ref|XP_009597427.1| PREDICTED: isoflavone 2'-hydroxylase-like [Nicotiana tomentosiformis]
Length=520

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 168/210 (80%), Gaps = 3/210 (1%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            +VF AGTET+S TI+W M LL+++PE L+KLR +ID+ VG+K LLNESDL+KLPYL CV+
Sbjct  314  VVFVAGTETSSTTIQWVMRLLVAHPEALYKLRADIDSKVGNKRLLNESDLNKLPYLHCVV  373

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NET+RLY P PLLLPHYS +DC+V GYDVPKHT + VNAWA+H DPKVWEEP+KFKPERF
Sbjct  374  NETMRLYTPIPLLLPHYSTKDCIVEGYDVPKHTMLFVNAWAIHRDPKVWEEPDKFKPERF  433

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            EA  G E E FNYK VPFG GRRACP  +MGLR VSLALGA IQCFDW+  +E + L  +
Sbjct  434  EATEG-ETERFNYKLVPFGIGRRACPGADMGLRAVSLALGALIQCFDWQ-IEEAESLEES  491

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
            Y S   +Q ++ L+A+CTPR++  Q LSQL
Sbjct  492  YNSRMTMQ-NKPLKAVCTPREDLGQLLSQL  520



>ref|XP_006367415.1| PREDICTED: isoflavone 2'-hydroxylase-like [Solanum tuberosum]
Length=516

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 162/203 (80%), Gaps = 4/203 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AGTETTS+TI+WAM LLL++P+   KLR EIDNNVG++ LLNESDL+ LPYL+CVI
Sbjct  315  VLFVAGTETTSMTIQWAMRLLLAHPKAFQKLRSEIDNNVGNERLLNESDLTNLPYLQCVI  374

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLY P PLLLPHYSLEDC V GYDVPK+T +MVNAWA+H DP +W+EPEKF PERF
Sbjct  375  NETLRLYSPVPLLLPHYSLEDCTVGGYDVPKNTILMVNAWAIHRDPALWDEPEKFMPERF  434

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDK---IL  244
            EA+ GE+ EGF+YKFVPFG GRRACP +NMG+R VSL LG+ +Q FDWKN + D+    +
Sbjct  435  EAMEGEK-EGFSYKFVPFGMGRRACPGDNMGMRTVSLVLGSLVQWFDWKNVELDENYSNM  493

Query  243  CATYLSPSILQKDERLEAICTPR  175
               Y S  I  KD+  EAIC PR
Sbjct  494  DEYYNSKVISSKDKPFEAICIPR  516



>gb|ABC69379.1| CYP81C6v2 [Nicotiana tabacum]
Length=520

 Score =   233 bits (594),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 167/210 (80%), Gaps = 3/210 (1%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            +VF AGTET+S TI+W M LL+++PE L+KLR +ID+ VG+K LLNESDL+KLPYL CV+
Sbjct  314  VVFVAGTETSSTTIQWVMRLLVAHPEALYKLRADIDSKVGNKRLLNESDLNKLPYLHCVV  373

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NET+RLY P PLLLPHYS +DC+V GYDVPKHT + VNAWA+H DPKVWEEP+KFKPERF
Sbjct  374  NETMRLYTPIPLLLPHYSTKDCIVEGYDVPKHTMLFVNAWAIHRDPKVWEEPDKFKPERF  433

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            EA  G E E FNYK VPFG GRRACP  +MGLR VSLALGA IQCFDW+  +E + L  +
Sbjct  434  EATEG-ETERFNYKLVPFGMGRRACPGADMGLRAVSLALGALIQCFDWQ-IEEAESLEES  491

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
            Y S   +Q ++ L+ +CTPR++  Q LSQL
Sbjct  492  YNSRMTMQ-NKPLKVVCTPREDLGQLLSQL  520



>gb|ABC69380.1| CYP81C6v2 [Nicotiana tabacum]
Length=520

 Score =   233 bits (594),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 167/210 (80%), Gaps = 3/210 (1%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            +VF AGTET+S TI+W M LL+++PE L+KLR +ID+ VG+K LLNESDL+KLPYL CV+
Sbjct  314  VVFVAGTETSSTTIQWVMRLLVAHPEALYKLRADIDSKVGNKRLLNESDLNKLPYLHCVV  373

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NET+RLY P PLLLPHYS +DC+V GYDVPKHT + VNAWA+H DPKVWEEP+KFKPERF
Sbjct  374  NETMRLYTPIPLLLPHYSTKDCIVEGYDVPKHTMLFVNAWAIHRDPKVWEEPDKFKPERF  433

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            EA  G E E FNYK VPFG GRRACP  +MGLR VSLALGA IQCFDW+  +E + L  +
Sbjct  434  EATEG-ETERFNYKLVPFGMGRRACPGADMGLRAVSLALGALIQCFDWQ-IEEAESLEES  491

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
            Y S   +Q ++ L+ +CTPR++  Q LSQL
Sbjct  492  YNSRMTMQ-NKPLKVVCTPREDLGQLLSQL  520



>ref|XP_009785012.1| PREDICTED: isoflavone 2'-hydroxylase-like isoform X1 [Nicotiana 
sylvestris]
Length=520

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 169/210 (80%), Gaps = 3/210 (1%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            +VF AGTET+S TI+W + LL+++P+ L+KLR +IDN VG+K LLNESDL+KLPYL CV+
Sbjct  314  VVFIAGTETSSTTIQWVIRLLVAHPDTLYKLRADIDNKVGNKRLLNESDLNKLPYLYCVV  373

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NET+RLYPP PLLLPH+S EDC+V GYDVPK+T + VNAWA+H DPKVWEEP+KFKPERF
Sbjct  374  NETMRLYPPVPLLLPHFSTEDCIVGGYDVPKNTLLFVNAWAIHRDPKVWEEPDKFKPERF  433

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            EA  GE  E FNYKFVPFG GRRACP  +MGLR VSLALGA IQCFDW+   E + L  +
Sbjct  434  EATEGET-ERFNYKFVPFGMGRRACPGADMGLRAVSLALGALIQCFDWQ-IGETESLEES  491

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
            Y S   +Q ++ L+A+CTPR++ +Q LS L
Sbjct  492  YNSRMTMQ-NKPLKAVCTPREDLVQHLSNL  520



>emb|CDP01251.1| unnamed protein product [Coffea canephora]
Length=408

 Score =   224 bits (571),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 126/210 (60%), Positives = 160/210 (76%), Gaps = 0/210 (0%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AG ET+++T EWAM LLL++P+ L KLR EIDN+VGH  L++ESD+ KLPYLRCV+
Sbjct  199  IMLTAGRETSTLTTEWAMLLLLNHPKALQKLRTEIDNSVGHGRLVDESDIPKLPYLRCVV  258

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYP APLL+PH++ EDC V GYD+PK T V+ NAWA+H DPK+WE+PEKF PERF
Sbjct  259  NETLRLYPAAPLLIPHHASEDCRVGGYDIPKGTIVLANAWAVHRDPKLWEQPEKFMPERF  318

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            EA    + E FN KF+PFG GRRACP  N+G+R VSLA+G +IQCFDW   +ED  L   
Sbjct  319  EAKGLMDKEEFNSKFLPFGIGRRACPGANLGIRNVSLAVGTFIQCFDWDKVEEDGELDVN  378

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
            + +   L+K   LEAIC+PR+  +Q LSQL
Sbjct  379  FSNRMSLKKANHLEAICSPRQESIQLLSQL  408



>gb|AHK60838.1| CYP81C13 [Catharanthus roseus]
Length=507

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 162/210 (77%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AGTET++V IEWAMSLLLS P+VL+KLR EID  +G+K L+NESD+ KLPYLRC+I
Sbjct  302  IMFVAGTETSAVIIEWAMSLLLSNPDVLNKLRIEIDKQIGNKRLINESDIPKLPYLRCII  361

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NET+RL+PP PLLLPH S EDC +AGYD+PK T + VNAWA H DPK+W+EPEKF PERF
Sbjct  362  NETMRLFPPVPLLLPHCSSEDCKIAGYDIPKGTVLFVNAWATHRDPKLWDEPEKFIPERF  421

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E +   E E   YKF+PFG GRRACP  +MG+R VSLALGA+IQCFDWK  +E + L  +
Sbjct  422  ENM---EVEKEGYKFIPFGIGRRACPGTSMGIRTVSLALGAFIQCFDWKKVEEYE-LNTS  477

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
            Y     LQK  +LEA C+PR++    LSQL
Sbjct  478  YDYRITLQKANQLEASCSPRQDFFPILSQL  507



>ref|XP_004238119.1| PREDICTED: cytochrome P450 81E8 [Solanum lycopersicum]
Length=507

 Score =   219 bits (559),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 163/210 (78%), Gaps = 2/210 (1%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F  GT+TTS TI+WAM LLL++PE LHKLR EID  VG+  LLNESDL+KLPYL  VI
Sbjct  300  VIFVTGTDTTSTTIQWAMRLLLAHPEALHKLRAEIDVQVGNTRLLNESDLTKLPYLHSVI  359

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYP  PLLLPHYS EDC V GY+VPKHT ++VNAWA+  DP+VW++P +FKPERF
Sbjct  360  NETLRLYPTVPLLLPHYSTEDCTVGGYNVPKHTILLVNAWAIQRDPQVWKDPNEFKPERF  419

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            EAI G + EG NYKF+PFG GRR+CP   M  R +SLALG+ IQCFDW++  ++  L  +
Sbjct  420  EAIEGGK-EGVNYKFIPFGMGRRSCPGAGMATRAISLALGSLIQCFDWQSVGKEN-LALS  477

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
            Y S   +QK++ LEAIC+PR N LQ LSQL
Sbjct  478  YNSRIKIQKNKSLEAICSPRSNFLQLLSQL  507



>emb|CDP01250.1| unnamed protein product [Coffea canephora]
Length=534

 Score =   220 bits (560),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 162/210 (77%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AGTET+ VT EWAMSLLLS+PE ++KLR EIDNN+GH+ LL+ESDL KLPYLRC++
Sbjct  329  IMFVAGTETSIVTTEWAMSLLLSHPEAMNKLRREIDNNIGHRRLLDESDLPKLPYLRCIV  388

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NET+RLYPPAPLLLPH   ED  V GY +PK +T++VNAWAM  DPKVWEEPE FKPERF
Sbjct  389  NETMRLYPPAPLLLPHCPSEDFTVGGYGIPKGSTLIVNAWAMQRDPKVWEEPEMFKPERF  448

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            EA+   E E   + FVPFG GRRACP  NMG+R +SLA+G++IQCFDW+  +ED+I   +
Sbjct  449  EAM---EMERERFNFVPFGVGRRACPGANMGIRNISLAVGSFIQCFDWRKIEEDEI-NTS  504

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
            + +   L   + LE +C PR+  +Q LSQL
Sbjct  505  HTTRITLSMAKPLEVMCIPRQESIQLLSQL  534



>emb|CDP01253.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 156/210 (74%), Gaps = 0/210 (0%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AG ET+++T EWAM LLL++P+ L KLR EIDN+VGH  L++ESD+ KLPYLRCV+
Sbjct  306  IMLTAGRETSTLTTEWAMLLLLNHPKALQKLRTEIDNSVGHGRLVDESDIPKLPYLRCVV  365

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYP APLLLPH + EDC V GYD+ K T V+ NAWA+H DPK+WEEPEKF PERF
Sbjct  366  NETLRLYPAAPLLLPHQASEDCRVGGYDIKKGTIVLANAWAVHRDPKLWEEPEKFMPERF  425

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E     + E FN KF+PFG GRRACP  N+G+R VSLA+G +IQCFDW   ++D  L   
Sbjct  426  EGKGLMDKEEFNSKFLPFGIGRRACPGANLGIRSVSLAVGTFIQCFDWDKVEQDGELDID  485

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
            + +   ++K   LEA+C PR+  +Q LSQL
Sbjct  486  FSNRITMKKSNHLEALCAPRQESIQLLSQL  515



>ref|XP_007018581.1| Cytochrome P450, family 81, subfamily D, polypeptide 2, putative 
[Theobroma cacao]
 gb|EOY15806.1| Cytochrome P450, family 81, subfamily D, polypeptide 2, putative 
[Theobroma cacao]
Length=210

 Score =   206 bits (524),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 156/209 (75%), Gaps = 4/209 (2%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            Q +F AGTETT+  +EWAMSLLL++PE + K+R EID +VGH  LL++SDL+ LPYLRCV
Sbjct  6    QTMFNAGTETTAAIMEWAMSLLLNHPESMQKVRAEIDAHVGHGRLLHDSDLANLPYLRCV  65

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
             NETL LYPP+PLLLPH+S EDCVV GY++P+ T +MVN WA+H DP +WE P KFKPER
Sbjct  66   ANETLGLYPPSPLLLPHFSSEDCVVGGYEIPRGTMLMVNVWAIHRDPSLWEGPSKFKPER  125

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
            FEA  GE+ EGF Y  +PFG GRR CP   MG+RL+ LALGA IQCF W+N  + K+  +
Sbjct  126  FEASFGEK-EGFRY--LPFGLGRRDCPGAAMGMRLIFLALGAAIQCFVWENVGQGKVDMS  182

Query  237  TYLSPSILQKDERLEAICTPRKNCLQFLS  151
            +    ++L K   LEA C PR+N ++ LS
Sbjct  183  SGSGITLL-KARPLEARCCPRRNSIKLLS  210



>ref|XP_011015740.1| PREDICTED: cytochrome P450 81D11-like [Populus euphratica]
Length=507

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 162/210 (77%), Gaps = 11/210 (5%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            M+F AGTET++VT+EWAM+LLL++P+ + KL+ EID +VGH  LLNESD+ KLPYLRCVI
Sbjct  303  MMFVAGTETSAVTLEWAMALLLNHPKAMQKLKAEIDEHVGHGRLLNESDIVKLPYLRCVI  362

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             ETLRLYPPAPLLLPH+S   C V G+D+P+ TT+MVNAWAMH DPK+WEE  +FKPERF
Sbjct  363  KETLRLYPPAPLLLPHFSSGACTVGGFDIPQGTTLMVNAWAMHRDPKLWEESNEFKPERF  422

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            EA VGE+ EGF Y  +PFGTGRRACP  +MGL++VS ALGA +QCF+W     DK+  A 
Sbjct  423  EAGVGEQ-EGFKY--IPFGTGRRACPGASMGLQIVSFALGAVVQCFEW-----DKVAPAE  474

Query  234  YL--SPSI-LQKDERLEAICTPRKNCLQFL  154
             +  SP I L K + LEA+C PR++    L
Sbjct  475  DMSHSPGITLSKAKPLEALCCPRRDLTTLL  504



>ref|XP_011017148.1| PREDICTED: cytochrome P450 81D11-like [Populus euphratica]
Length=507

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 162/210 (77%), Gaps = 11/210 (5%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            M+F AGTET++VT+EWAM+LLL++P+ + KL+ EID +VGH  LLNESD+ KLPYLRCVI
Sbjct  303  MMFVAGTETSAVTLEWAMALLLNHPKAMQKLKAEIDEHVGHGRLLNESDIVKLPYLRCVI  362

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             ETLRLYPPAPLLLPH+S   C V G+D+P+ TT+MVNAWAMH DPK+WEE  +FKPERF
Sbjct  363  KETLRLYPPAPLLLPHFSSGACTVGGFDIPQGTTLMVNAWAMHRDPKLWEESNEFKPERF  422

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            EA +GE+ EGF Y  +PFGTGRRACP  +MGL++VS ALGA +QCF+W     DK+  A 
Sbjct  423  EAGLGEQ-EGFKY--IPFGTGRRACPGASMGLQIVSFALGAVVQCFEW-----DKVAPAE  474

Query  234  YL--SPSI-LQKDERLEAICTPRKNCLQFL  154
             +  SP I L K + LEA+C PR++    L
Sbjct  475  DMSHSPGITLSKAKPLEALCCPRRDLTTLL  504



>gb|KJB29440.1| hypothetical protein B456_005G100700 [Gossypium raimondii]
Length=511

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 157/213 (74%), Gaps = 4/213 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            M+F AGTE+T++T+EW M+LLLS+PE L K R EI  +VGH+ LLNESDL KLPYLRCV+
Sbjct  300  MMFIAGTESTAITMEWTMALLLSHPEALQKARDEIIRHVGHERLLNESDLPKLPYLRCVV  359

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYP  PLLLPH   EDCVV GY++PK T ++V+AWA+  DP +WEEP KFKPERF
Sbjct  360  NETLRLYPATPLLLPHCPSEDCVVDGYEIPKGTILLVHAWAIQRDPSIWEEPTKFKPERF  419

Query  414  EAIVGEEGEGFNY--KFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI-L  244
                 E+ EGF Y  K++PFG GRRACP  NMGLR V LA+G +IQCF+W+N   DK+ +
Sbjct  420  YEGTLEDKEGFKYLPKYLPFGLGRRACPGRNMGLRSVLLAIGVFIQCFEWENVGSDKVDM  479

Query  243  CATYLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                +  SI  K   LEA+C PR + ++ LSQL
Sbjct  480  TPDTIGLSIF-KARPLEALCRPRPDVIKLLSQL  511



>gb|KJB29441.1| hypothetical protein B456_005G100700 [Gossypium raimondii]
Length=536

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 157/213 (74%), Gaps = 4/213 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            M+F AGTE+T++T+EW M+LLLS+PE L K R EI  +VGH+ LLNESDL KLPYLRCV+
Sbjct  325  MMFIAGTESTAITMEWTMALLLSHPEALQKARDEIIRHVGHERLLNESDLPKLPYLRCVV  384

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYP  PLLLPH   EDCVV GY++PK T ++V+AWA+  DP +WEEP KFKPERF
Sbjct  385  NETLRLYPATPLLLPHCPSEDCVVDGYEIPKGTILLVHAWAIQRDPSIWEEPTKFKPERF  444

Query  414  EAIVGEEGEGFNY--KFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI-L  244
                 E+ EGF Y  K++PFG GRRACP  NMGLR V LA+G +IQCF+W+N   DK+ +
Sbjct  445  YEGTLEDKEGFKYLPKYLPFGLGRRACPGRNMGLRSVLLAIGVFIQCFEWENVGSDKVDM  504

Query  243  CATYLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                +  SI  K   LEA+C PR + ++ LSQL
Sbjct  505  TPDTIGLSIF-KARPLEALCRPRPDVIKLLSQL  536



>ref|XP_006374861.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP52658.1| cytochrome P450 family protein [Populus trichocarpa]
Length=510

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 163/212 (77%), Gaps = 9/212 (4%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            M+F AGTET+++T+EWAM+LLL++P+V+ K++ EID +VGH  LLNESD+ KLPYLRCVI
Sbjct  306  MMFIAGTETSAITLEWAMTLLLNHPKVMQKVKAEIDEHVGHGRLLNESDIVKLPYLRCVI  365

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYPPAPLLLPH+S E C   G+D+P+ T ++VNAW MH DPK+WEEP +FKPERF
Sbjct  366  NETLRLYPPAPLLLPHFSSEACTAGGFDIPQGTMLVVNAWTMHRDPKLWEEPNEFKPERF  425

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKN--TKEDKILC  241
            EA +G EG+GF Y  +PFG GRR CP  +MGL++VSLALG  +QCF+W    T ED    
Sbjct  426  EAGLG-EGDGFKY--IPFGIGRRVCPGASMGLQIVSLALGVLVQCFEWDKVGTVED----  478

Query  240  ATYLSPSILQKDERLEAICTPRKNCLQFLSQL  145
             ++    IL K + LEA+C+PR++ +  LS L
Sbjct  479  TSHGLGMILSKAKPLEALCSPRRDLITLLSHL  510



>ref|XP_007018579.1| Cytochrome P450, family 81, subfamily K, polypeptide 2, putative 
[Theobroma cacao]
 gb|EOY15804.1| Cytochrome P450, family 81, subfamily K, polypeptide 2, putative 
[Theobroma cacao]
Length=511

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 165/214 (77%), Gaps = 12/214 (6%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            M+F AGTETT+VT+EWAMSLLL++PE L K+R EI ++VGH+ LLNESDL+KLPYLRCV+
Sbjct  306  MMFVAGTETTAVTMEWAMSLLLNHPEALQKVRAEIVSHVGHERLLNESDLAKLPYLRCVV  365

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRLYPPAP+LLPH S EDC+V GY++PK T ++VNAWA+H DP +WEEP KFKPERF
Sbjct  366  SETLRLYPPAPVLLPHCSSEDCMVGGYEIPKGTQLLVNAWAIHRDPSIWEEPTKFKPERF  425

Query  414  E-AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
            E A V +EG     K++PFG GRRACP   MG+RLV LALGA +QCF+W+    +K+   
Sbjct  426  EGAFVEKEG----LKYLPFGLGRRACPGATMGMRLVLLALGAAVQCFEWEKEGPEKV---  478

Query  237  TYLSP---SILQKDERLEAICTPRKNCLQFLSQL  145
              +SP   +++ +   LEA+C PR + ++ LSQ 
Sbjct  479  -DMSPGTGTVMSRARPLEALCCPRPDLIKLLSQF  511



>dbj|BAH84784.1| cytochrome P450 [Nicotiana tabacum]
Length=496

 Score =   209 bits (532),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AGTETTS+TI+WAM LLL++P+   KLR EID+ V +  LLNESD+ KLPYL CVI
Sbjct  312  VLFIAGTETTSMTIQWAMRLLLAHPKAFTKLRAEIDSKVENDRLLNESDIPKLPYLYCVI  371

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYPP PLLLPHYSLEDC V GY+VPKHT +M+NAWA+H DPK+W+EPEKFKPERF
Sbjct  372  NETLRLYPPVPLLLPHYSLEDCTVGGYEVPKHTILMINAWAIHRDPKLWDEPEKFKPERF  431

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKE  256
            EA+   E EGFNYKFVPFG GRRACP   MGLR VSL LG+ IQ FDW++ ++
Sbjct  432  EAMDLGEKEGFNYKFVPFGMGRRACPGATMGLRTVSLVLGSLIQWFDWESVEK  484



>emb|CDP20410.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   209 bits (531),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 150/210 (71%), Gaps = 0/210 (0%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AG ET+++TIEWAM LLL+    L KLR EID N+GH  LL ESD+ KLPYL CV+
Sbjct  302  IMFTAGRETSTLTIEWAMLLLLNNRTALQKLRTEIDINIGHGRLLRESDIPKLPYLHCVV  361

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NET+RLYP APLL PHY+ EDC V  YD+PK T V+ NAWA+H DPK+WEEPEKF PERF
Sbjct  362  NETMRLYPAAPLLQPHYASEDCKVGMYDIPKGTIVLANAWAVHRDPKLWEEPEKFMPERF  421

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E     + E FN KF+PFG GRRACP  N+ +R VSLA+G  IQCFDW   ++D  L   
Sbjct  422  EVKKLMDKEEFNSKFLPFGMGRRACPGANLAIRSVSLAIGTIIQCFDWDKVEQDGDLDIN  481

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
            + +   LQK + LEA+C PR+  +  LSQL
Sbjct  482  FSNRITLQKAKHLEALCVPRQESILLLSQL  511



>ref|XP_006374863.1| hypothetical protein POPTR_0014s02170g [Populus trichocarpa]
 gb|ERP52660.1| hypothetical protein POPTR_0014s02170g [Populus trichocarpa]
Length=506

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 164/215 (76%), Gaps = 15/215 (7%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            M+F AGTET+++T+EWA++LLL++P+V+ K++ EID +VGH  LLNESD+ KLPYL CVI
Sbjct  302  MMFVAGTETSAITLEWALTLLLNHPKVMQKVKAEIDEHVGHGRLLNESDIVKLPYLSCVI  361

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYPPAPLLLPH+S E C   G+D+P+ T ++VNAW MH DPK+WEEP +FKPERF
Sbjct  362  NETLRLYPPAPLLLPHFSSEACNAGGFDIPQGTMLVVNAWTMHRDPKLWEEPNEFKPERF  421

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            EA +G EG+GF  K++PFG GRR CP  +MGL++VSLALG  +QCF+W     DK+   T
Sbjct  422  EAGLG-EGDGF--KYIPFGIGRRVCPGASMGLQIVSLALGVLVQCFEW-----DKV--GT  471

Query  234  YLSPS-----ILQKDERLEAICTPRKNCLQFLSQL  145
               PS     IL K + LEA+C+PR++ +  LS L
Sbjct  472  VEDPSHGLGMILSKAKPLEALCSPRRDLITLLSHL  506


 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = -1

Query  723  MSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINETlrlyppaplllPHY  544
            MSLLL+ PE + K   EID  VG +H+L+E D++KL YL+ ++NET RL+PPAPLLLPH 
Sbjct  1    MSLLLNNPETMQKASEEIDAIVGTEHILDEVDVTKLSYLQNILNETFRLFPPAPLLLPHE  60

Query  543  SLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVW  448
            S EDC ++G+ VP+ T ++VN W++H D K+W
Sbjct  61   SSEDCTISGFHVPRGTMLLVNTWSIHRDTKLW  92



>gb|KHG18425.1| Isoflavone 2'-hydroxylase [Gossypium arboreum]
Length=500

 Score =   206 bits (523),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 153/210 (73%), Gaps = 2/210 (1%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            M+F AGTE+T++T+EW M+LLLS+PE L K R EI  +VG++ LLNESDL KLPYLRCV+
Sbjct  293  MMFIAGTESTAITMEWTMALLLSHPEALQKARDEIIRHVGNERLLNESDLPKLPYLRCVV  352

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYP APLLLPH   EDCVV GY++PK T ++V+AWA+  DP +WEEP KFKPERF
Sbjct  353  NETLRLYPAAPLLLPHCPSEDCVVDGYEIPKGTMLLVHAWAIQRDPSIWEEPTKFKPERF  412

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                 E+ EG   K++PFG GRRACP  NMGLR V LA+G +IQCF+W+N   DK+    
Sbjct  413  YEGTLEDKEGL--KYLPFGLGRRACPGRNMGLRSVLLAIGVFIQCFEWENVGSDKVDMTP  470

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                  + K   LEA+C PR + ++ LSQL
Sbjct  471  NTIGLTIHKARPLEALCRPRPDVIKLLSQL  500



>ref|XP_002301158.2| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE80431.2| cytochrome P450 family protein [Populus trichocarpa]
Length=510

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 161/210 (77%), Gaps = 11/210 (5%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            M+F AGTET++VT+EWAM+LLL++P+ + KL+ EID +VGH  LLNES++ KLPYLRCVI
Sbjct  306  MMFVAGTETSAVTLEWAMALLLNHPKAMQKLKAEIDEHVGHGRLLNESNIVKLPYLRCVI  365

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             ETLRLYPPAPLLLPH+S   C V G+D+P+ TT++VNAWAMH DPK+WEE  +FKPERF
Sbjct  366  KETLRLYPPAPLLLPHFSSGACTVGGFDIPQGTTLVVNAWAMHRDPKLWEESNEFKPERF  425

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            EA +GE+ EGF  K++PFGTGRR CP  +MGL++VS+ALGA +QCF+W     DK+    
Sbjct  426  EAGLGEQ-EGF--KYIPFGTGRRVCPGASMGLQMVSIALGALVQCFEW-----DKVAPVE  477

Query  234  YL--SPSI-LQKDERLEAICTPRKNCLQFL  154
             +  SP I L K + LEA+C PR +    L
Sbjct  478  DMSHSPGISLSKVKPLEALCCPRGDLTTLL  507



>ref|XP_012068271.1| PREDICTED: cytochrome P450 81E8-like [Jatropha curcas]
 gb|KDP41664.1| hypothetical protein JCGZ_16071 [Jatropha curcas]
Length=506

 Score =   204 bits (519),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 157/210 (75%), Gaps = 2/210 (1%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            +   AG ET++VT+EW +SLLL+ PEVL K++ EIDN+VG++HLLNE DL KLPYLRCVI
Sbjct  299  ITLIAGAETSAVTLEWVISLLLNNPEVLKKVKAEIDNHVGNRHLLNELDLVKLPYLRCVI  358

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYP  P+LLPH S E+C V G+++P  T ++VN  AMH DPKVWEEP +FKPERF
Sbjct  359  NETLRLYPAGPVLLPHLSSENCTVGGFEIPGGTMLLVNVLAMHRDPKVWEEPYEFKPERF  418

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E  +GE  +   ++F+PFG GRRACP   MG+R+VS+ALGA IQCF+W+N   +++  + 
Sbjct  419  EGDLGEHSQQ-GFRFIPFGMGRRACPGAGMGIRMVSVALGALIQCFEWENPGLEEVDMSQ  477

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                S L K + L A+C+PR+  ++ LSQL
Sbjct  478  TFGIS-LSKTKPLVALCSPRQELVELLSQL  506



>ref|XP_002285066.1| PREDICTED: isoflavone 3'-hydroxylase-like [Vitis vinifera]
Length=507

 Score =   201 bits (511),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 153/213 (72%), Gaps = 9/213 (4%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            +V  AGT+T+SVT+EWAMSLLL++PE L K R EID++V   HLL++SDL+KLPYLR V+
Sbjct  301  VVISAGTDTSSVTLEWAMSLLLNHPEALEKARAEIDSHVKPGHLLDDSDLAKLPYLRSVV  360

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYP APLLLPH S EDC V G+D+P+ TTVMVN WA+H DP+VWEE  KFKPERF
Sbjct  361  NETLRLYPTAPLLLPHLSSEDCSVGGFDIPRGTTVMVNVWALHRDPRVWEEATKFKPERF  420

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E +  EE E F  KF PFG GRRACP   + +++VSLALG  IQCF+W+  + +K+    
Sbjct  421  EGMENEEKEAF--KFAPFGIGRRACPGAALAMKIVSLALGGLIQCFEWERVEAEKV----  474

Query  234  YLSPS---ILQKDERLEAICTPRKNCLQFLSQL  145
             +SP     + K + LE I  PR      LSQL
Sbjct  475  DMSPGSGITMPKAKPLEIIFRPRPTMTSLLSQL  507



>ref|XP_002510136.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52323.1| cytochrome P450, putative [Ricinus communis]
Length=505

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 149/210 (71%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            M+F AG ET++V +EWAMSLLL +PE+L KLR EIDN VGH  LLN+ DL KLPYLRCV+
Sbjct  300  MMFIAGVETSAVALEWAMSLLLIHPEILQKLRAEIDNCVGHGRLLNDLDLVKLPYLRCVV  359

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYPP PL+LPH S E C V G+++ K T +MVN WAMH DP VWEEP +FKPERF
Sbjct  360  NETLRLYPPGPLMLPHLSSEICTVGGFEIQKGTLLMVNLWAMHRDPNVWEEPTEFKPERF  419

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E  +GEE     +KF+PFG GRRACP   MG R+VSLALGA IQ F+W+    +K+    
Sbjct  420  EGDLGEE---HAFKFMPFGMGRRACPGAGMGTRMVSLALGALIQSFEWEKDGLEKVDMNP  476

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                S L K + L  +C PR   ++ LSQL
Sbjct  477  RFGMS-LSKAKPLVVLCCPRPEMVEVLSQL  505



>ref|XP_010271770.1| PREDICTED: isoflavone 2'-hydroxylase-like [Nelumbo nucifera]
Length=511

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/208 (54%), Positives = 147/208 (71%), Gaps = 3/208 (1%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+T+S T+EWA+SLLL++P+VL K + E+DN+VG   LL+ESDLSKLPYLRC+IN
Sbjct  306  MIAAGTDTSSGTMEWALSLLLNHPDVLKKAQDEVDNHVGQGRLLDESDLSKLPYLRCIIN  365

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLR+YP  PLLLPH S EDCV+ G+D+P+ T ++VN WA+H+DPK+WEEP KFKPER  
Sbjct  366  ETLRMYPAGPLLLPHESSEDCVIGGFDIPRGTMLLVNLWAIHNDPKIWEEPRKFKPER--  423

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
               G EG    +K +PFG+GRR CP   +  R+V LALG+ IQCFDW+   +D +     
Sbjct  424  -FEGLEGRRDGFKLMPFGSGRRGCPGGGLAERVVGLALGSLIQCFDWERVGDDLVDMTEG  482

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQ  148
                 L K + L+A C PR   +  LSQ
Sbjct  483  AGGLTLPKAQALKAKCKPRPKMMNLLSQ  510



>emb|CDP21119.1| unnamed protein product [Coffea canephora]
Length=502

 Score =   195 bits (496),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 153/212 (72%), Gaps = 5/212 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHK-HLLNESDLSKLPYLRCV  598
            ++F AG  T+++T+EWAMSL+L++P+VL K R EIDNNV     L+ +SDLSKLPYLRC+
Sbjct  294  IMFTAGVHTSALTMEWAMSLMLNHPQVLKKARSEIDNNVTQSGQLIEDSDLSKLPYLRCI  353

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            I ETLRL+P AP LLPHYS EDC + G+ VPK TT++VNAWA+H DPKVWEEP KFKPER
Sbjct  354  IKETLRLFPAAPTLLPHYSSEDCTIGGFKVPKGTTLLVNAWAIHRDPKVWEEPAKFKPER  413

Query  417  fEAI-VGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILC  241
            FE I  G   EGF  KF+PFG GRRACP   +G+R +SL LG  +QCFDW+     +++ 
Sbjct  414  FEGINEGACDEGF--KFIPFGKGRRACPGAALGMRFISLTLGTMLQCFDWERVGP-QLVD  470

Query  240  ATYLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                S   L K + LEA+  PR + ++ +SQL
Sbjct  471  LEEKSGITLDKAKPLEALFRPRSSMIELVSQL  502



>emb|CDP15267.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 136/174 (78%), Gaps = 0/174 (0%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AG ET+++TIEWAM LLL+ P+ L KLR EID N+GH  LL ESD+ KLPYLRCV+
Sbjct  302  IMFTAGRETSTLTIEWAMLLLLNNPKALQKLRTEIDINIGHGRLLRESDIPKLPYLRCVV  361

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NET+RLYP APLLLPHY+ EDC V  YD+PK T V+ NAWA+H DPK+WEEPEKF PERF
Sbjct  362  NETMRLYPAAPLLLPHYASEDCKVGMYDIPKGTIVLANAWAVHRDPKLWEEPEKFMPERF  421

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKED  253
            EA    + E FN KF+PFG GRRACP  N+G+R VSLA+G +IQ FDW   ++D
Sbjct  422  EAKKLMDKEEFNSKFLPFGMGRRACPGVNLGVRSVSLAIGTFIQSFDWDKVEQD  475



>gb|KDO81589.1| hypothetical protein CISIN_1g020029mg [Citrus sinensis]
Length=332

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 153/210 (73%), Gaps = 7/210 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AG ETT+V +EWAMSLLL+ P+VL K+R EID NV +  +LN+ DL  LPYL CVI
Sbjct  127  LMFIAGVETTAVVLEWAMSLLLNNPDVLQKVRAEIDCNVANGRMLNDEDLVNLPYLCCVI  186

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             ETLRLYPPAPLLLPH+S E+C+V GY +P+ TT+MVNAWAMH D KVWEEP KFKPERF
Sbjct  187  KETLRLYPPAPLLLPHFSSENCIVGGYHIPRGTTIMVNAWAMHRDSKVWEEPNKFKPERF  246

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E I  E  EGF  K +PFG GRRACP   M +R +S ALG+ IQCF+W+    +  + A+
Sbjct  247  EGIHSER-EGF--KHIPFGMGRRACPGAAMAIRTISFALGSLIQCFEWEKIGPEVDMTAS  303

Query  234  Y-LSPSILQKDERLEAICTPRKNCLQFLSQ  148
            Y LS   L K   L A+C+PR++ +  L++
Sbjct  304  YGLS---LSKTVPLVAMCSPRQDMIGMLNR  330



>ref|XP_010271541.1| PREDICTED: isoflavone 3'-hydroxylase-like [Nelumbo nucifera]
Length=512

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 146/208 (70%), Gaps = 3/208 (1%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+T++ T+EWAMSLLL+ P+VL K + E+DN+VG   LL+ESDLSKLPYLRC+IN
Sbjct  307  LLSAGTDTSAGTMEWAMSLLLNNPDVLKKAQDEVDNHVGQGRLLDESDLSKLPYLRCIIN  366

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLR+YP  PLL+PH S EDCV+ G+D+P+ T ++VN WA+H+DPK+WEEP KF+PER  
Sbjct  367  ETLRMYPAGPLLVPHESSEDCVIGGFDIPRGTMLLVNLWAIHNDPKIWEEPGKFEPER--  424

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
               G EG    +K +PFG+GRR CP   +  R+V LALG+ IQCF+W+   +D +     
Sbjct  425  -FEGLEGRRDGFKLMPFGSGRRGCPGEGLAERVVGLALGSLIQCFEWERVGDDLVDMTEG  483

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQ  148
                 L K + L+A C PR   +  LSQ
Sbjct  484  AGGLTLPKAQALKAKCKPRPKMMNLLSQ  511



>ref|XP_010556108.1| PREDICTED: isoflavone 2'-hydroxylase-like isoform X2 [Tarenaya 
hassleriana]
Length=513

 Score =   194 bits (492),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 149/207 (72%), Gaps = 5/207 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AG +T +VT+EW MSLLLS PE L KLR EID NVG   L+ ++DL+KLPYLRCVI
Sbjct  300  VMFTAGADTVAVTLEWVMSLLLSNPEALLKLREEIDENVGPNRLVTDADLAKLPYLRCVI  359

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYPP PLLLPH S E C + GY VPK TT++VN+WAMH DP VWE+PE+F PERF
Sbjct  360  NETLRLYPPTPLLLPHSSSESCHIGGYTVPKGTTLIVNSWAMHRDPDVWEDPERFSPERF  419

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            + +VGE  +GF  +F+PFGTGRRACP  NM +RL SLA+G  +QCFDW+  + +  +   
Sbjct  420  QGVVGER-DGF--RFIPFGTGRRACPGANMAIRLASLAIGMLVQCFDWEKAEPE--IDMK  474

Query  234  YLSPSILQKDERLEAICTPRKNCLQFL  154
             ++   L +   LEA   PR+   + L
Sbjct  475  GVAGLTLSRARPLEARFLPRQGIDKLL  501



>ref|XP_010556107.1| PREDICTED: isoflavone 2'-hydroxylase-like isoform X1 [Tarenaya 
hassleriana]
Length=524

 Score =   194 bits (492),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 149/207 (72%), Gaps = 5/207 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AG +T +VT+EW MSLLLS PE L KLR EID NVG   L+ ++DL+KLPYLRCVI
Sbjct  300  VMFTAGADTVAVTLEWVMSLLLSNPEALLKLREEIDENVGPNRLVTDADLAKLPYLRCVI  359

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYPP PLLLPH S E C + GY VPK TT++VN+WAMH DP VWE+PE+F PERF
Sbjct  360  NETLRLYPPTPLLLPHSSSESCHIGGYTVPKGTTLIVNSWAMHRDPDVWEDPERFSPERF  419

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            + +VGE  +GF  +F+PFGTGRRACP  NM +RL SLA+G  +QCFDW+  + +  +   
Sbjct  420  QGVVGER-DGF--RFIPFGTGRRACPGANMAIRLASLAIGMLVQCFDWEKAEPE--IDMK  474

Query  234  YLSPSILQKDERLEAICTPRKNCLQFL  154
             ++   L +   LEA   PR+   + L
Sbjct  475  GVAGLTLSRARPLEARFLPRQGIDKLL  501



>ref|XP_011029147.1| PREDICTED: isoflavone 2'-hydroxylase-like [Populus euphratica]
 ref|XP_011029154.1| PREDICTED: isoflavone 2'-hydroxylase-like [Populus euphratica]
Length=512

 Score =   193 bits (490),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 150/209 (72%), Gaps = 4/209 (2%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +F AGT+T +VT+EWAMSLLL++PE+L K+R EID+ VGH  L+ E DL KL YLRCVIN
Sbjct  308  IFAAGTDTVAVTMEWAMSLLLNHPEILQKVREEIDSQVGHTRLVEELDLPKLNYLRCVIN  367

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRLYP  PLLLP    EDC VAGY VPK T ++VNA+AMH DPK+WE+P++FKPERFE
Sbjct  368  ETLRLYPVVPLLLPRCPSEDCTVAGYTVPKGTILLVNAFAMHRDPKMWEQPDRFKPERFE  427

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
            A   EE EG   KF+PFG GRRACP +NMGLR + LA+ A  QCF+W+ T  + +     
Sbjct  428  A-TEEEKEGI--KFIPFGMGRRACPGSNMGLRAIMLAMAALFQCFEWERTGPEMVDMTVA  484

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
             + S++ K + LEA C P  +     SQL
Sbjct  485  AAISMV-KAKPLEAFCKPYHSMANLFSQL  512



>gb|AAD32570.1| NT7 [Nicotiana tabacum]
Length=275

 Score =   186 bits (473),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 151/217 (70%), Gaps = 9/217 (4%)
 Frame = -1

Query  741  VTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINETlrlyppap  562
            VTI+WAM LLL++P+   KLR  I   V +  LLN SD+ KLPYL CVINETLRLYPP P
Sbjct  3    VTIQWAMRLLLAHPQAFTKLRAAIACKVENDRLLNVSDIPKLPYLYCVINETLRLYPPVP  62

Query  561  lllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfEAIVGEEGEGF  382
            LLLPHYSLEDC V GY VPKHT +M+ AWA+H DPK+W+EP KF PERF A+   E EGF
Sbjct  63   LLLPHYSLEDCTVGGYAVPKHTILMIIAWAIHRDPKLWDEPAKFTPERFAAMDLGEKEGF  122

Query  381  NYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSPSILQKDE  202
             YKFVPFG GRRACP   MGLR VSL LG+ +Q FDW++ +++K L A Y S   L KD+
Sbjct  123  LYKFVPFGMGRRACPGATMGLRTVSLVLGSLLQWFDWESVEKEK-LDACYNSRITLHKDK  181

Query  201  ---RLEAICTPRKNC-LQFL--SQL*IVFAYVFNVYF  109
               RL  I  PR NC L FL      IV   +++V+F
Sbjct  182  PSRRLFGI--PRHNCSLVFLPHEHRTIVLCSMYSVFF  216



>ref|XP_006374862.1| hypothetical protein POPTR_0014s02160g [Populus trichocarpa]
 gb|ERP52659.1| hypothetical protein POPTR_0014s02160g [Populus trichocarpa]
Length=512

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 138/209 (66%), Gaps = 4/209 (2%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +F AGT+T +VT+EWAMSLLL++PE+L K+R EID+ VGH  L+ E DL KL YLRCVIN
Sbjct  308  IFAAGTDTVAVTMEWAMSLLLNHPEILQKVREEIDSEVGHTRLVEELDLPKLKYLRCVIN  367

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRLYP  PLLLP    EDC VAGY VPK T ++VNA+AMH DPK+W E          
Sbjct  368  ETLRLYPVVPLLLPRCPSEDCTVAGYKVPKGTILLVNAFAMHRDPKMW-EQPDRFKPERF  426

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
             +  EE EG   KF+PFG GRRACP +NMG+R + LA+ A  QCF+W+ T  + +     
Sbjct  427  EVTEEEKEGI--KFIPFGMGRRACPGSNMGMRAIMLAMAALFQCFEWERTGPEMVDMTVA  484

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
             + S++ K   LEA C P  +     SQL
Sbjct  485  AAISMV-KATPLEAFCKPYHSMANLFSQL  512



>ref|XP_006374864.1| hypothetical protein POPTR_0014s02180g [Populus trichocarpa]
 gb|ERP52661.1| hypothetical protein POPTR_0014s02180g [Populus trichocarpa]
Length=506

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 152/209 (73%), Gaps = 4/209 (2%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +F AGT+T +VT+EWAM+LLL++PE+L K+R EID+ VGH  L+ E DL KL YLRCVIN
Sbjct  302  MFSAGTDTVAVTMEWAMALLLNHPEILQKVRVEIDSQVGHTRLVEEVDLPKLKYLRCVIN  361

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRLYP  PLLLP    EDC VAGY+VPK T ++VNA+AMH DPK+WE+P++FKPERFE
Sbjct  362  ETLRLYPVVPLLLPRCPSEDCTVAGYNVPKGTILLVNAFAMHRDPKMWEQPDRFKPERFE  421

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
            A V EE EG   KF+PFG GRRACP +NMG+R + LA+ A  QCF+ + T ++ +     
Sbjct  422  ATV-EEKEGI--KFIPFGMGRRACPGSNMGMRAIMLAMAALFQCFECERTGQEMVDMTVA  478

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
             + S++ K + LEA C P  +     SQL
Sbjct  479  AAISMV-KAKPLEAFCKPYHSMANLFSQL  506



>ref|XP_010271553.1| PREDICTED: isoflavone 2'-hydroxylase-like [Nelumbo nucifera]
Length=511

 Score =   190 bits (483),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 147/209 (70%), Gaps = 3/209 (1%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+T+S T+EWAMSLLL++P+VL K + EIDN+VG   L +ESDLSKLPYLRC+IN
Sbjct  306  LIAAGTDTSSGTMEWAMSLLLNHPDVLKKAQAEIDNHVGQGRLFHESDLSKLPYLRCIIN  365

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLR+YP APLL+PH S EDCVV G+D+P  T ++VN WA+H+DPK+WEEP KFKPER  
Sbjct  366  ETLRMYPAAPLLVPHESSEDCVVGGFDIPHGTLLLVNMWAIHNDPKIWEEPRKFKPER--  423

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
               G EG    +K +PFG+GRR+CP   +  R+V LALG+ IQCF+W+   +D +  +  
Sbjct  424  -FEGLEGRRDGFKLLPFGSGRRSCPVEGLAERMVGLALGSLIQCFEWEMVGDDLVDMSEG  482

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
                 L K   L+A   PR   +  LSQL
Sbjct  483  AGGLTLPKARVLKAKRKPRPTMVDLLSQL  511



>ref|XP_006472253.1| PREDICTED: cytochrome P450 81D1-like [Citrus sinensis]
Length=517

 Score =   190 bits (483),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 153/210 (73%), Gaps = 7/210 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AG ETT+V +EWAMSLLL+ P+VL K+R EID NV +  +LN+ DL  LPYL CVI
Sbjct  312  IMFIAGVETTAVALEWAMSLLLNNPDVLQKVRAEIDCNVANGRMLNDVDLVNLPYLCCVI  371

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             ETLRLYPPAPLLLPH+S E+C+V GY +P+ TT+MVNAWAMH D KVWEEP KFKPERF
Sbjct  372  KETLRLYPPAPLLLPHFSSENCIVGGYHIPRGTTIMVNAWAMHRDSKVWEEPNKFKPERF  431

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E I  E  EGF  K +PFG GRRACP   M +R +S ALG+ IQCF+W+    +  + A+
Sbjct  432  EGIHSER-EGF--KHIPFGMGRRACPGAAMAIRTISFALGSLIQCFEWEKIGAEVDMTAS  488

Query  234  Y-LSPSILQKDERLEAICTPRKNCLQFLSQ  148
            Y LS   L K   L A+C+PR+N +  L++
Sbjct  489  YGLS---LSKTVPLVAMCSPRQNMIGMLNR  515



>ref|XP_011069758.1| PREDICTED: isoflavone 2'-hydroxylase-like [Sesamum indicum]
Length=492

 Score =   189 bits (481),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 141/214 (66%), Gaps = 14/214 (7%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +F AGT TT++T+EWAMSLLL++P  L K+R EID+ V    LL++SDL KLPYLRCVIN
Sbjct  288  MFTAGTHTTAITMEWAMSLLLNHPNELGKVREEIDSIVAPGKLLDDSDLQKLPYLRCVIN  347

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRLYP  PLL+PH S +DC V G+DVP  TT++VNAWA+  DPK+W        E   
Sbjct  348  ETLRLYPVGPLLVPHLSSKDCTVGGFDVPAGTTLLVNAWAIQRDPKLW--------EEPG  399

Query  411  AIVGEEGEGFN-----YKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  247
            A   E   GF+     +KF+PFG GRRACP + M +RL+ LALG +IQCF+WK    + +
Sbjct  400  AFKPERFRGFDGGYDGFKFLPFGIGRRACPGSGMAMRLMGLALGTFIQCFEWKREGHNLV  459

Query  246  LCATYLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                +   + L K + LEA+  PR +    LSQL
Sbjct  460  DLDEFTGIT-LSKVKPLEALYRPRSSVTSLLSQL  492



>ref|XP_011029134.1| PREDICTED: isoflavone 2'-hydroxylase-like [Populus euphratica]
Length=512

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 148/209 (71%), Gaps = 4/209 (2%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +F AGT+T +VT+EWAMSLLL++PE+L K+R EID+ VGH  L+ E DL KL YLRCVIN
Sbjct  308  IFAAGTDTVAVTMEWAMSLLLNHPEILQKVREEIDSQVGHTRLVEELDLPKLKYLRCVIN  367

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRLYP  PLLLP    EDC VAGY VPK T + VNA+AMH DPK+WE+P++FKPERFE
Sbjct  368  ETLRLYPVVPLLLPRCPSEDCTVAGYKVPKGTILQVNAFAMHRDPKMWEQPDRFKPERFE  427

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
            A   EE EG   KF+PFG GRRACP +NMG+R + LA+ A  QCF+W+ T  + +     
Sbjct  428  A-TEEEKEGI--KFIPFGMGRRACPGSNMGMRAIMLAMAALFQCFEWERTGPEMVDMTVA  484

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
             + S++ K + LEA C P  +     S L
Sbjct  485  AAISMV-KAKPLEAFCKPYHSMANLFSLL  512



>ref|XP_006433586.1| hypothetical protein CICLE_v10000895mg [Citrus clementina]
 gb|ESR46826.1| hypothetical protein CICLE_v10000895mg [Citrus clementina]
Length=514

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 153/210 (73%), Gaps = 7/210 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AG ETT+V +EWAMSLLL+ P+VL K+R EID NV +  +LN+ DL  LPYL CVI
Sbjct  309  LMFIAGVETTAVVLEWAMSLLLNNPDVLQKVRAEIDCNVANGRMLNDEDLVNLPYLCCVI  368

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             ETLRLYPPAPLLLPH+S E+C+V GY +P+ TT+MVNAWAMH D KVWEEP KFKPERF
Sbjct  369  KETLRLYPPAPLLLPHFSSENCIVGGYHIPQGTTIMVNAWAMHRDSKVWEEPNKFKPERF  428

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E I  E  EGF  K +PFG GRRACP   M +R +S ALG+ IQCF+W+    +  + A+
Sbjct  429  EGIHSER-EGF--KHIPFGMGRRACPGAAMAIRTISFALGSLIQCFEWEKIGPEVDMTAS  485

Query  234  Y-LSPSILQKDERLEAICTPRKNCLQFLSQ  148
            Y LS   L K   L A+C+PR++ +  L++
Sbjct  486  YGLS---LSKTVPLVAMCSPRQDMIGMLNR  512



>ref|XP_010101691.1| Isoflavone 2'-hydroxylase [Morus notabilis]
 gb|EXB89257.1| Isoflavone 2'-hydroxylase [Morus notabilis]
Length=567

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 139/183 (76%), Gaps = 2/183 (1%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AGT+T++ TIEW +SLLL++P+VL KLR EID+NVGH  L+ ESDL KLPYLRCVI
Sbjct  301  IMFVAGTDTSANTIEWCISLLLNHPQVLQKLRNEIDSNVGHGRLVKESDLPKLPYLRCVI  360

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRLYP  PLLLPH+S EDC + GY +P+ TT++VNAWA+H D  VW+EP  FKPERF
Sbjct  361  HETLRLYPIVPLLLPHFSSEDCTLGGYQIPQGTTLLVNAWAIHRDSNVWDEPNTFKPERF  420

Query  414  EA--IVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILC  241
            E   ++  E EG N++F+PFG GRRACP   MG+R  SLA+G  +QCFDW+   ++  + 
Sbjct  421  EEHHMLEGEREGNNFRFIPFGIGRRACPGEGMGIRTASLAVGTLLQCFDWERVGKELDMS  480

Query  240  ATY  232
              Y
Sbjct  481  QGY  483



>ref|XP_010692652.1| PREDICTED: cytochrome P450 81E8-like [Beta vulgaris subsp. vulgaris]
Length=506

 Score =   188 bits (477),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 149/211 (71%), Gaps = 5/211 (2%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            Q++F  GTET+S T+EWA +LLL +PE+  K+R EI   VGH  L+ E DL  LPYL C+
Sbjct  301  QILFLTGTETSSSTVEWATALLLKHPEIQDKVRKEIIEQVGHDRLIEEHDLQHLPYLHCI  360

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            INETLR+YP AP++ PH S EDCVV GY +PK T + VN WA+ +DPKVW+EP +FKPER
Sbjct  361  INETLRMYPVAPIVPPHESSEDCVVGGYHIPKGTMLNVNLWAIQNDPKVWDEPRQFKPER  420

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
            FE +   EGE   YKF+PFG+GRR+CP  NM  R+V LALG+ IQCF+W+   E++I   
Sbjct  421  FENV---EGERIGYKFMPFGSGRRSCPGENMAKRVVGLALGSLIQCFEWEGG-EEEIDME  476

Query  237  TYLSPSILQKDERLEAICTPRKNCLQFLSQL  145
              +S S+ + +  L+A   PRK  ++ LSQ+
Sbjct  477  EQVSVSMWKANP-LQAKFKPRKQMIKLLSQI  506



>gb|AJD25195.1| cytochrome P450 CYP81C16 [Salvia miltiorrhiza]
Length=498

 Score =   187 bits (476),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 140/208 (67%), Gaps = 5/208 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T+++T EWAMS L+S PEVL KLR EID NVGH HLL+E+DL  LPYL  V+
Sbjct  295  VMLTAGTDTSALTTEWAMSNLVSQPEVLQKLRQEIDANVGHDHLLSEADLPNLPYLGRVV  354

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWee-pekfkper  418
             ETLRL+P APLLLPH S +DC V GY +PK T ++VNAWA+HHDP +W+E  +      
Sbjct  355  KETLRLHPAAPLLLPHLSSQDCRVGGYKIPKGTILLVNAWAVHHDPGLWDEPEKFDPERF  414

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
              A+  E G   N++F+PFG GRRACP   M LR VSLALGA++QCF+W++ + D     
Sbjct  415  EGAVEMEMGRDGNHRFLPFGIGRRACPGAGMALRTVSLALGAFVQCFEWEHVEMD---FG  471

Query  237  TYLSPSILQKDERLEAICTPRKNCLQFL  154
              L  + L K + LEA+C  R      L
Sbjct  472  ANLGVT-LHKAKPLEAVCLVRNQAAHLL  498



>emb|CDP19801.1| unnamed protein product [Coffea canephora]
Length=203

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 148/210 (70%), Gaps = 8/210 (4%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHK-HLLNESDLSKLPYLRCVI  595
            +F AGT T++ T+E AMS LL++P++L K + EID+ V +   LL +SDLSKLPYLRC+I
Sbjct  1    MFTAGTHTSAFTMERAMSCLLNHPDILQKAKNEIDDQVTYSGRLLEDSDLSKLPYLRCII  60

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLR++PPAP L+PHYS EDC++ GY V K TT+ VNAWA+H DP +WEEP +FKPERF
Sbjct  61   NETLRIFPPAPTLVPHYSSEDCIIGGYKVAKDTTLFVNAWAIHRDPNLWEEPSEFKPERF  120

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                  EG    +KF+PFG GRRACP   M +RLV LA+G  +QCF+W++  E +++   
Sbjct  121  ------EGLDEGFKFLPFGKGRRACPGAAMAMRLVGLAVGTLVQCFEWESA-ESQMVEFD  173

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
              S   L K + LEA+  PR + +  +SQL
Sbjct  174  EKSGVTLGKTKPLEALYKPRLSMISLVSQL  203



>ref|XP_009360167.1| PREDICTED: isoflavone 2'-hydroxylase-like [Pyrus x bretschneideri]
Length=508

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 147/200 (74%), Gaps = 3/200 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T+S +++WAM+LLL++PE + K+R EID NVG +  L E DL KL YL+ VI
Sbjct  305  VLLVAGTDTSSSSLDWAMALLLNHPEEMEKVRAEIDTNVGQERPLEEQDLPKLKYLQNVI  364

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ET RLYPP PLL+PH + EDCVV GYDVP+HT +++NAWA+H DP++WE+P KFKPERF
Sbjct  365  HETHRLYPPVPLLVPHEASEDCVVGGYDVPRHTMLVINAWAIHRDPEIWEDPTKFKPERF  424

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E   GE  +G  YK +PFG GRR CP   +G RLV LALG+ IQ F+W+   E+K+  + 
Sbjct  425  EGWSGEGSQG--YKLIPFGNGRRGCPGAGLGNRLVGLALGSLIQSFEWERVGEEKVDMSE  482

Query  234  YLSPSILQKDERLEAICTPR  175
             L   ++Q+ E LEAIC PR
Sbjct  483  GLG-LVMQRVEPLEAICKPR  501



>ref|XP_007018555.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY15780.1| Cytochrome P450 [Theobroma cacao]
Length=499

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 150/210 (71%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGTET+  T+EWA+SLLL+ PEVL K + EI N VGH+HL++ESDL++LPYLR +I
Sbjct  294  ILLMAGTETSINTMEWALSLLLNNPEVLKKAQIEIVNTVGHEHLIDESDLAQLPYLRSII  353

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLR+YPP PLL+PH S E+C+V G+ VP  T ++VNAWA+ +DP +WE+P  FKPERF
Sbjct  354  SETLRMYPPVPLLVPHESSEECIVEGFRVPSGTMLLVNAWAIQNDPSIWEDPASFKPERF  413

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E   G EG    +K++PFG+GRR CP   +GLR+V L LG+ IQCF+W     D ++   
Sbjct  414  E---GVEGARDGFKWMPFGSGRRGCPGEGLGLRIVGLTLGSLIQCFEWSRVG-DNMVDMR  469

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
              +   + K + L+A+C PR   L+ LSQL
Sbjct  470  AGTGFTMPKAQPLQAVCRPRTTVLELLSQL  499



>ref|XP_002267485.1| PREDICTED: isoflavone 3'-hydroxylase-like [Vitis vinifera]
Length=507

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 142/209 (68%), Gaps = 4/209 (2%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+TTS T+EWAMSLLL+ PEVL K + E+DN +G  HL+ ESDLS+LPYL C+I 
Sbjct  303  LLGAGTDTTSATLEWAMSLLLNNPEVLKKAQMEMDNQLGPNHLIEESDLSQLPYLHCIIR  362

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ET +   PA  ++PH S ++C+V GY +P+ T ++VN W + +DPKVW+EP KF PERFE
Sbjct  363  ET-QRMYPAGPIVPHESSKECMVGGYHIPRGTMLLVNIWGIQNDPKVWKEPRKFLPERFE  421

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
              VG EGEG   + +PFG+GRR CP   + +R+V L LG+ IQCFDW+   E K+  +  
Sbjct  422  --VGLEGEGHGLRLMPFGSGRRGCPGEGLAIRMVGLVLGSLIQCFDWERVGEGKVDMSEG  479

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
            +  + L K + L A C PR   +  LSQ+
Sbjct  480  IGLT-LPKAQPLLAKCRPRPALINVLSQI  507



>ref|XP_006387951.1| hypothetical protein POPTR_0458s00200g [Populus trichocarpa]
 gb|ERP46865.1| hypothetical protein POPTR_0458s00200g [Populus trichocarpa]
Length=360

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/211 (46%), Positives = 144/211 (68%), Gaps = 6/211 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT T+S T+EWA+SLLL++PEVL K + EID  +GH  L++E+DL++LPYLR V+
Sbjct  155  VILFAGTHTSSTTMEWALSLLLNHPEVLEKAKREIDEQIGHDRLMDEADLAQLPYLRSVL  214

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWee-pekfkper  418
            NETLR+YP APLL+PH S E+C+V G+ +P+ T + VN WA+ +DPK+W +  +      
Sbjct  215  NETLRMYPAAPLLVPHESSEECLVGGFRIPRGTMLSVNVWAIQNDPKIWRDPTKFRPERF  274

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
                V  +G    +K +PFG GRR+CP  +M LR++ LALG+ +QCF+W+    DK++  
Sbjct  275  DNPEVARDG----FKLMPFGYGRRSCPGESMALRVMGLALGSLLQCFEWQKIG-DKMVDM  329

Query  237  TYLSPSILQKDERLEAICTPRKNCLQFLSQL  145
            T  S   + K + L+ IC PR + L+ LSQ+
Sbjct  330  TEASGFTIPKAKPLKVICRPRPDMLRHLSQI  360



>ref|XP_010320311.1| PREDICTED: cytochrome P450 81D1-like [Solanum lycopersicum]
Length=203

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 139/199 (70%), Gaps = 3/199 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AG++T+++T+EWA S LL  PE+L   + EIDN VG   L++ESDL++LPY+RC+I
Sbjct  8    ILLQAGSDTSAITLEWAFSRLLDNPEILKTAQTEIDNQVGQDRLIDESDLAQLPYIRCII  67

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLR++P APLLLPH S E+C VAGY VP+ T ++VNAW +HHDPKVWE+PEKF P+R 
Sbjct  68   NETLRMHPAAPLLLPHLSSEECKVAGYRVPRGTILLVNAWGIHHDPKVWEDPEKFNPDR-  126

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
               +G E      KF+PFG+GRR CP  N+ + ++ LALG+ +QCF+W     + I  + 
Sbjct  127  --FIGFESVKEGCKFIPFGSGRRGCPGENLAIHVIGLALGSLLQCFEWDKPNSETIDMSE  184

Query  234  YLSPSILQKDERLEAICTP  178
                +I  K + L A C+P
Sbjct  185  GTGFTISPKVQPLLAKCSP  203



>gb|ABK96123.1| unknown [Populus trichocarpa]
Length=521

 Score =   183 bits (464),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 143/199 (72%), Gaps = 3/199 (2%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            ++ AG +T   T EWAM+ LL++PE L +++ EID  VGH+ L+ ESDL KL Y+RCV+N
Sbjct  316  LYLAGVDTVDFTTEWAMTFLLNHPERLERVKAEIDREVGHERLVQESDLPKLRYVRCVVN  375

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRLYPPAPLLLPH   EDC+V GY +P+ T VMVNAWA+H DPK+WE+PE FKPERFE
Sbjct  376  ETLRLYPPAPLLLPHAPSEDCIVGGYKIPRGTIVMVNAWAIHRDPKLWEDPESFKPERFE  435

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
               G   EG    F+PFG GRRACP N+M +R V LAL A IQCF+W+   ++ +  +  
Sbjct  436  ---GLNNEGEKQGFIPFGIGRRACPGNHMAMRRVMLALAALIQCFEWERVGKELVDMSIV  492

Query  231  LSPSILQKDERLEAICTPR  175
             +   +QK + LEAICTPR
Sbjct  493  DALISVQKAKPLEAICTPR  511



>dbj|BAF98467.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=503

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 145/211 (69%), Gaps = 6/211 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T++VT+EWAMSLLL+ P+V+ K + EIDNN+    L+NESD++KLPYL  +I
Sbjct  298  VLLAAGTDTSAVTMEWAMSLLLNNPQVIKKAQAEIDNNLEQGRLINESDVNKLPYLHSII  357

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             ETLR+YP  PLL+PH S E+C+V GY VP  T ++VN WA+  DP +W EP KFKPERF
Sbjct  358  TETLRIYPAGPLLVPHESSEECIVGGYKVPSGTMLLVNVWAIQQDPNIWVEPTKFKPERF  417

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            +   G EG    +K +PFG+GRR CP   + +R+V+LALGA IQCFDW+   E+ +  + 
Sbjct  418  D---GFEGTRDGFKLMPFGSGRRGCPGEGLAMRVVALALGALIQCFDWERVGEEMVDMSE  474

Query  234  YLSPSI-LQKDERLEAICTPRKNCLQFLSQL  145
               P + L K   LEA C PR   L F+SQ 
Sbjct  475  --GPGLTLPKVHPLEAKCRPRSTALNFISQF  503



>ref|XP_004238115.1| PREDICTED: cytochrome P450 81D1-like [Solanum lycopersicum]
Length=513

 Score =   183 bits (464),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 148/210 (70%), Gaps = 3/210 (1%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AG++T++VT+EWA S LL  PE+L   + EIDN VG   L++ESDL++LPY+RC+I
Sbjct  307  VLLQAGSDTSAVTLEWAFSHLLDNPEILKTAQTEIDNKVGQDRLIDESDLAQLPYIRCII  366

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLR++P APLL+PH S E+C VAGY VP+ T ++VNAW +HHDPKVW+EP+KF P+R 
Sbjct  367  NETLRMHPAAPLLVPHLSSEECKVAGYRVPRGTVLLVNAWGIHHDPKVWKEPQKFNPDR-  425

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
               +G EG     KF+PFG+GRR CP  N+ + ++ LALG+ +QCF+W     + I  + 
Sbjct  426  --FLGFEGVKEGCKFIPFGSGRRGCPGENLAIHVIGLALGSLLQCFEWDKPNREIIDMSE  483

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                ++  K + L A C+PR + ++ LS++
Sbjct  484  GTGFTLSPKVQPLLAKCSPRPHMVKLLSEI  513



>ref|XP_008337049.1| PREDICTED: cytochrome P450 81D1-like [Malus domestica]
Length=304

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 141/201 (70%), Gaps = 3/201 (1%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            ++V  AGT+TTS T++WAMSLLL++PE + K+R EID NVG + LL E DL KL Y+  V
Sbjct  100  RVVLVAGTDTTSTTLDWAMSLLLNHPEAMEKVRTEIDTNVGRERLLEEQDLPKLKYMENV  159

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            INET RLYP  PLL+PH + EDCVV G+DVP+HT V++NAWA+H DP+VWE+P+KFKPER
Sbjct  160  INETHRLYPAVPLLVPHEASEDCVVGGFDVPRHTIVVINAWAIHRDPEVWEDPDKFKPER  219

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
            F+    E  E   YK +PFG GRR CP + +  RL+ L LG+ +Q F+W     + +  +
Sbjct  220  FQGWSAEGAE--RYKLIPFGGGRRGCPGDVIANRLIGLTLGSLVQSFEWGRIGVEDVDMS  277

Query  237  TYLSPSILQKDERLEAICTPR  175
              L  S + + + LEA+C PR
Sbjct  278  EGLGRS-MPRVKPLEAMCKPR  297



>ref|XP_006372853.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP50650.1| cytochrome P450 family protein [Populus trichocarpa]
Length=521

 Score =   183 bits (464),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 143/199 (72%), Gaps = 3/199 (2%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            ++ AG +T   T EWAM+ LL++PE L +++ EID  VGH+ L+ ESDL KL Y+RCV+N
Sbjct  316  LYLAGVDTVDFTAEWAMTFLLNHPERLERVKAEIDREVGHERLVQESDLPKLRYVRCVVN  375

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRLYPPAPLLLPH   EDC+V GY +P+ T VMVNAWA+H DPK+WE+PE FKPERFE
Sbjct  376  ETLRLYPPAPLLLPHAPSEDCIVGGYKIPRGTIVMVNAWAIHRDPKLWEDPESFKPERFE  435

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
               G   EG    F+PFG GRRACP N+M +R V LAL A IQCF+W+   ++ +  +  
Sbjct  436  ---GLNNEGEKQGFIPFGIGRRACPGNHMAMRRVMLALAALIQCFEWERVGKELVDMSIV  492

Query  231  LSPSILQKDERLEAICTPR  175
             +   +QK + LEAICTPR
Sbjct  493  DALISVQKAKPLEAICTPR  511



>ref|XP_009620154.1| PREDICTED: isoflavone 2'-hydroxylase-like [Nicotiana tomentosiformis]
Length=513

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 149/210 (71%), Gaps = 3/210 (1%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AG++T++VT+EWA S LL   E+L K + EIDN+VG   L++ESDL++LPY+RC+I
Sbjct  307  VLLQAGSDTSAVTLEWAFSHLLDNLEILKKAQAEIDNHVGQDRLIDESDLAQLPYIRCII  366

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLR++P APLL+PH+S ++C VAGY VP+ T ++VNAW +HHDPKVWE+PEKF P+R 
Sbjct  367  NETLRMHPAAPLLVPHFSSKECKVAGYRVPRGTVLLVNAWGIHHDPKVWEDPEKFNPDR-  425

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
               +G EG     KF+PFG+GRR CP  N+   ++ LALG+ +QCF+W+      I  + 
Sbjct  426  --FIGFEGVKEGCKFIPFGSGRRGCPGENLAFHVIGLALGSLLQCFEWEKPNRGIIDMSE  483

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                ++  K + L A C+PR N ++ LS++
Sbjct  484  GTGFTLSPKVQPLLAKCSPRPNMVKLLSKI  513



>ref|XP_006372852.1| hypothetical protein POPTR_0017s05680g [Populus trichocarpa]
 gb|ERP50649.1| hypothetical protein POPTR_0017s05680g [Populus trichocarpa]
Length=521

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 143/199 (72%), Gaps = 3/199 (2%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            ++ AG +T   T EWAM+ LL++PE L +++ EID  VGH+ L+ ESDL KL Y+RCV+N
Sbjct  316  LYLAGVDTVDFTTEWAMTFLLNHPERLERVKAEIDREVGHERLVQESDLPKLRYVRCVVN  375

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRLYPPAPLLLPH   EDC+V GY +P+ T VMVNAWA+H DPK+WE+PE FKPERFE
Sbjct  376  ETLRLYPPAPLLLPHAPSEDCIVGGYKIPRGTIVMVNAWAIHRDPKLWEDPESFKPERFE  435

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
               G   EG    F+PFG GRRACP N+M +R V LAL A IQCF+W+   ++ +  +  
Sbjct  436  ---GLNNEGEKQGFIPFGIGRRACPGNHMAMRRVMLALAALIQCFEWERVGKELVDMSIV  492

Query  231  LSPSILQKDERLEAICTPR  175
             +   +QK + LEAICTPR
Sbjct  493  DALISVQKAKPLEAICTPR  511



>ref|XP_006362076.1| PREDICTED: cytochrome P450 81D1-like [Solanum tuberosum]
Length=513

 Score =   182 bits (462),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 147/210 (70%), Gaps = 3/210 (1%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AG++T++VT+EWA S LL  PE+L   + EIDN VG   L++ESDL++LPY+RC+I
Sbjct  307  VLLQAGSDTSAVTLEWAFSHLLDNPEILKTAQTEIDNQVGQDRLIDESDLAQLPYIRCII  366

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLR++P APLL+PH S E+C VAGY VP+ T ++VNAW +HHDPKVWEEP+KF P R 
Sbjct  367  NETLRMHPAAPLLVPHLSSEECKVAGYRVPRGTVLLVNAWGIHHDPKVWEEPQKFNPGR-  425

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
               +G EG     KF+PFG+GRR CP  N+ + ++ LALG+ +QCF+W     + I  + 
Sbjct  426  --FLGFEGVKEGCKFIPFGSGRRGCPGENLAIHVIGLALGSLLQCFEWDKPNREIIDMSE  483

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                ++  K + L A C+PR + ++ LS++
Sbjct  484  GTGFTLSPKVQPLLAKCSPRLHMVKLLSEI  513



>ref|XP_011037157.1| PREDICTED: cytochrome P450 81D11-like [Populus euphratica]
Length=527

 Score =   182 bits (462),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 143/199 (72%), Gaps = 3/199 (2%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            ++ AG +T   T EWAM+ LL++PE L +++ EID  VGH+ L+ ESDL KL Y+RCV+N
Sbjct  322  LYLAGVDTVDFTTEWAMTFLLNHPERLERVKAEIDREVGHERLVQESDLPKLRYVRCVVN  381

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRLYPPAPLLLPH   EDC++ GY +P+ T VMVNAWA+H DPK+WE+PE FKPERFE
Sbjct  382  ETLRLYPPAPLLLPHAPSEDCIIGGYKIPRGTIVMVNAWAIHRDPKLWEDPESFKPERFE  441

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
               G   EG    F+PFG GRRACP N+M +R V LAL A IQCF+W+   ++ +  +  
Sbjct  442  ---GLNNEGEKQGFIPFGIGRRACPGNHMAMRRVMLALAALIQCFEWERVGKELVDMSIV  498

Query  231  LSPSILQKDERLEAICTPR  175
             +   +QK + LEAICTPR
Sbjct  499  DALISVQKAKPLEAICTPR  517



>ref|XP_002267599.1| PREDICTED: isoflavone 2'-hydroxylase-like [Vitis vinifera]
Length=508

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 141/209 (67%), Gaps = 4/209 (2%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AG +TTS T+EWAMSLLL+ PEVL K + E+DN +G  HL+ ESDLS+LPYL C+I 
Sbjct  304  LLGAGIDTTSATLEWAMSLLLNNPEVLKKAQMEMDNQLGPNHLIEESDLSQLPYLHCIIR  363

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ET +   PA  ++PH S ++C+V GY +P+ T ++VN W + +DP+VW+EP KF PERFE
Sbjct  364  ET-QRMYPAGPIVPHESSKECMVGGYHIPRGTMLLVNIWGIQNDPEVWKEPRKFLPERFE  422

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
              VG EGEG   + +PFG+GRR CP   + +R+V L LG+ IQCFDWK   E K+  +  
Sbjct  423  --VGLEGEGHGLRLMPFGSGRRGCPGEGLAIRMVGLVLGSLIQCFDWKRVGEGKVDMSEG  480

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
            +  + L + + L A C PR   +  LSQ+
Sbjct  481  IGLT-LPRAQPLLAKCRPRPALINLLSQI  508



>ref|XP_009380098.1| PREDICTED: cytochrome P450 81D1 [Musa acuminata subsp. malaccensis]
Length=229

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 139/209 (67%), Gaps = 3/209 (1%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+T++VTIEWAM LLL +PEVLH  R E+D  +G   ++ E D+  LPYL C+IN
Sbjct  24   LMAAGTDTSAVTIEWAMCLLLIHPEVLHTARAELDARIGQGRMVEEEDIPNLPYLNCIIN  83

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRLY   PLL+PH S +DC V GYDVP  T ++ NAWA+H DP +W+EPE+FKPERF+
Sbjct  84   ETLRLYHAVPLLVPHESSQDCTVGGYDVPCGTMLLTNAWAIHRDPNIWDEPEEFKPERFQ  143

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
               G+E  G   + +PFG+GRR CP   + +RL+ LAL   I CF+W+    +++     
Sbjct  144  CEGGKEETGL--RMLPFGSGRRKCPGEGLAIRLIGLALAILIHCFEWEKLPGEEVDMTEG  201

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
               S + K + LE +CTPR+  L  LSQL
Sbjct  202  QGLS-MPKVKPLEVVCTPRRTMLHALSQL  229



>ref|XP_008393762.1| PREDICTED: cytochrome P450 81D1-like [Malus domestica]
 ref|XP_008393763.1| PREDICTED: cytochrome P450 81D1-like [Malus domestica]
 ref|XP_008393764.1| PREDICTED: cytochrome P450 81D1-like [Malus domestica]
 ref|XP_008367653.1| PREDICTED: cytochrome P450 81D1-like [Malus domestica]
 ref|XP_008367654.1| PREDICTED: cytochrome P450 81D1-like [Malus domestica]
Length=508

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 145/200 (73%), Gaps = 3/200 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T+S +++W+M+LLL++PE + K+R EID N+G +  L E DL KL YL+ VI
Sbjct  305  VLLVAGTDTSSSSLDWSMALLLNHPEEMEKVRAEIDTNIGQERPLEEQDLPKLKYLQNVI  364

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ET RLYPP PLL+PH + EDCVV GYDVP+HT +++NAWA+H DP++WE+P KFKPERF
Sbjct  365  HETHRLYPPVPLLVPHEASEDCVVGGYDVPRHTMLVINAWAIHRDPEIWEDPTKFKPERF  424

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E   GE  +G  YK +PFG GRR CP   +G RLV LALG+ IQ F+W+   E+K+    
Sbjct  425  EGWSGEGSQG--YKLIPFGNGRRGCPGAGLGNRLVGLALGSLIQSFEWERVGEEKVDMGE  482

Query  234  YLSPSILQKDERLEAICTPR  175
             L  + + + E LEAIC PR
Sbjct  483  GLGLA-MPRVEPLEAICKPR  501



>ref|XP_010274363.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 81D1-like [Nelumbo 
nucifera]
Length=197

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 139/205 (68%), Gaps = 9/205 (4%)
 Frame = -1

Query  759  GTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINETlr  580
            GT+T+++T+EWA SLLL++P  L K R EIDNN+G   LL+ESD++KLPYL C+INETLR
Sbjct  2    GTDTSALTMEWATSLLLNHPGTLLKAREEIDNNIGEGRLLDESDIAKLPYLNCIINETLR  61

Query  579  lyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfEAIVG  400
            LYP +  L+PH S EDC + G+++P  T  + NAWA+H DP +W +P  FKPERF  +  
Sbjct  62   LYPASSDLVPHVSSEDCTIGGFEIPSRTIPLANAWAVHRDPNLWVDPTSFKPERFHGVEW  121

Query  399  EEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSPS  220
            E+G    +KF+PFG GRR      +G+R+V+  +GA IQCFDWK    D +  +     +
Sbjct  122  EKG---GFKFMPFGLGRRX-----LGMRVVAETVGALIQCFDWKRVGHDLVDVSEGRGLT  173

Query  219  ILQKDERLEAICTPRKNCLQFLSQL  145
            I  K + LEA+  PR N ++ LSQL
Sbjct  174  I-PKAKPLEAMYRPRSNMMKLLSQL  197



>emb|CDP14452.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 146/211 (69%), Gaps = 3/211 (1%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            Q++  AGT TTS T+EWA+S LL++P VL K R E++  +   HLLN+SDLSKLPYLRC+
Sbjct  291  QIMLSAGTHTTSQTMEWALSSLLNHPNVLQKARDELEK-MQPGHLLNDSDLSKLPYLRCI  349

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            INETLRL+P AP L+PH+S EDC + GY+VPK TT++VN WA+H DP VWEEP K+KPER
Sbjct  350  INETLRLFPAAPTLVPHFSSEDCTIGGYEVPKGTTLLVNVWAIHRDPNVWEEPNKYKPER  409

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
            FE +  E G    +KF+PFG GRR CP   M +RLV L LG  IQCF+W+    + +   
Sbjct  410  FEGM-DEGGWNEGFKFLPFGKGRRICPGAAMAIRLVGLTLGTLIQCFEWERAGPEMVDLE  468

Query  237  TYLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                 + L K + LEA   PR + ++ +SQL
Sbjct  469  ENQG-ATLGKAKPLEASYKPRPSMIKTISQL  498



>emb|CBI33752.3| unnamed protein product [Vitis vinifera]
Length=316

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 142/205 (69%), Gaps = 12/205 (6%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            Q++  AGT+T++ T+EWAM+LLL++P+VL K + E+D +VG   L+ ESDL KL YLR +
Sbjct  113  QVLILAGTDTSAATMEWAMTLLLNHPDVLEKAKAELDMHVGKDRLIEESDLPKLRYLRSI  172

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            I+ETLR++P APLLLPH S +DC + G+D+P+ T ++VN WA+H DP+VWE+P  FKPER
Sbjct  173  ISETLRVFPVAPLLLPHMSSDDCQIGGFDIPRGTLLLVNVWALHRDPQVWEDPTSFKPER  232

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWK---NTKEDKI  247
            F     E GE  NYK VPFG GRRACP   +  R+V LALG+ IQC+DWK   NT  D I
Sbjct  233  F-----ENGERENYKLVPFGIGRRACPGAGLAQRVVGLALGSLIQCYDWKKISNTAIDTI  287

Query  246  LCATYLSPSILQKDERLEAICTPRK  172
                   P +    + LEA+C  R+
Sbjct  288  EGKGLTMPKL----QPLEAMCKARE  308



>ref|XP_006387952.1| hypothetical protein POPTR_0458s00200g [Populus trichocarpa]
 gb|ERP46866.1| hypothetical protein POPTR_0458s00200g [Populus trichocarpa]
Length=498

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 97/211 (46%), Positives = 144/211 (68%), Gaps = 6/211 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT T+S T+EWA+SLLL++PEVL K + EID  +GH  L++E+DL++LPYLR V+
Sbjct  293  VILFAGTHTSSTTMEWALSLLLNHPEVLEKAKREIDEQIGHDRLMDEADLAQLPYLRSVL  352

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWee-pekfkper  418
            NETLR+YP APLL+PH S E+C+V G+ +P+ T + VN WA+ +DPK+W +  +      
Sbjct  353  NETLRMYPAAPLLVPHESSEECLVGGFRIPRGTMLSVNVWAIQNDPKIWRDPTKFRPERF  412

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
                V  +G    +K +PFG GRR+CP  +M LR++ LALG+ +QCF+W+    DK++  
Sbjct  413  DNPEVARDG----FKLMPFGYGRRSCPGESMALRVMGLALGSLLQCFEWQKIG-DKMVDM  467

Query  237  TYLSPSILQKDERLEAICTPRKNCLQFLSQL  145
            T  S   + K + L+ IC PR + L+ LSQ+
Sbjct  468  TEASGFTIPKAKPLKVICRPRPDMLRHLSQI  498



>ref|XP_009760134.1| PREDICTED: cytochrome P450 81D11-like [Nicotiana sylvestris]
Length=494

 Score =   179 bits (455),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 147/210 (70%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AGT T++VT+EW M+LLL++PEV+ K + EI+N VG   LL ESD+ KLPYLRC+I
Sbjct  289  VMFTAGTHTSAVTMEWTMTLLLNHPEVMKKAKLEINNLVGEGRLLEESDILKLPYLRCII  348

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRL+P  PLL+PH+S +DC++ GY +PK T + VN W +  DPK+WEEP KFKPERF
Sbjct  349  NETLRLFPAGPLLVPHFSSQDCIIEGYGIPKGTILFVNVWEIQRDPKLWEEPNKFKPERF  408

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E   G EG     KF+PFG GRRACP + + +RL+ L LG +IQCF+W++     +    
Sbjct  409  E---GMEGGIEGCKFIPFGMGRRACPGSGLAMRLIGLVLGLFIQCFEWQSVGPALVGLDE  465

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                 +L+K + LEA+  PR++    LSQL
Sbjct  466  SFG-LMLKKRDPLEALYRPRESMAVSLSQL  494



>ref|XP_006389073.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP47987.1| cytochrome P450 family protein [Populus trichocarpa]
Length=506

 Score =   179 bits (455),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 141/206 (68%), Gaps = 3/206 (1%)
 Frame = -1

Query  768  FXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINE  589
            + AG +T   T EWAM+ LL++PE L +++ EID  VGH+ L+ ESDL KL YLRCV+NE
Sbjct  302  YLAGVDTVDFTTEWAMTFLLNHPERLERVKAEIDREVGHERLVQESDLPKLRYLRCVVNE  361

Query  588  TlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfEA  409
            TLRLYPPAPLLLPH   EDC + GY++P+ T VMVN WA+H DPK+WE+PE FKPERFE 
Sbjct  362  TLRLYPPAPLLLPHAPSEDCTIGGYEIPRGTIVMVNVWAIHRDPKLWEDPESFKPERFE-  420

Query  408  IVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYL  229
              G   EG    F+PFG GRRACP N+M +R V LAL A  QCF+W+   ++ I  +   
Sbjct  421  --GLNNEGEKQGFIPFGIGRRACPGNHMAMRRVMLALAALFQCFEWERVGQELIDMSIVK  478

Query  228  SPSILQKDERLEAICTPRKNCLQFLS  151
            +   +QK + LEA CTPR      +S
Sbjct  479  ALISVQKAKPLEATCTPRPFTTSLIS  504



>ref|XP_002320704.2| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE99019.2| cytochrome P450 family protein [Populus trichocarpa]
Length=499

 Score =   179 bits (454),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 151/210 (72%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T+S T+EWA+SLLL++PEVL K + EID ++GH  L++E DL++LPYLR ++
Sbjct  294  VLLLAGTDTSSTTMEWALSLLLNHPEVLEKAQREIDEHIGHDRLMDEGDLAQLPYLRSIL  353

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLR+YPPAPLL+PH S E+C+V G+ +P+ T + VN WA+ +DPK+W +P KF+PERF
Sbjct  354  NETLRMYPPAPLLVPHESSEECLVGGFRIPRGTMLSVNMWAIQNDPKIWRDPTKFRPERF  413

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            +     EG  + +K +PFG GRR+CP   + L++V LALG+ +QCF+W+    DK++  T
Sbjct  414  D---NPEGGRYEFKLMPFGHGRRSCPGEGLALKVVGLALGSLLQCFEWQKIG-DKMVDMT  469

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                  + K ++LEAIC  R   L  LSQ+
Sbjct  470  ESPGFTVPKAKQLEAICRARPRMLTLLSQI  499



>ref|XP_006367423.1| PREDICTED: isoflavone 2'-hydroxylase-like [Solanum tuberosum]
Length=484

 Score =   179 bits (454),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 144/210 (69%), Gaps = 7/210 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AGT T++VT+EWAMSLLL++PEV+ K R EIDN +G    L E D+ KLPYLRC+I
Sbjct  282  VMFTAGTHTSAVTMEWAMSLLLNHPEVMKKARLEIDNLIGETRPLEEPDILKLPYLRCII  341

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRL+P  PLL+PH+S +DC + GY +PK T + VN W +  D K+WEE  +FKPERF
Sbjct  342  NETLRLFPAGPLLVPHFSTQDCTIEGYHIPKGTILFVNIWEIQRDRKIWEEANEFKPERF  401

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                G EG     KF+PFG GRRACP + + +RL+ L LG +IQCF+W+    D+++   
Sbjct  402  VG--GIEG----CKFIPFGMGRRACPGSGLAMRLIGLVLGLFIQCFEWERIG-DELVGLD  454

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                 +L K E LEA+  PR++ +  LSQL
Sbjct  455  ESCGLMLSKLEPLEALYRPRESMVTLLSQL  484



>ref|XP_010672783.1| PREDICTED: cytochrome P450 81E8-like [Beta vulgaris subsp. vulgaris]
Length=498

 Score =   179 bits (454),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 143/204 (70%), Gaps = 8/204 (4%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AG+ETT+ T+EWAMS L+++P V  K R EID NVG   L+ + DLSKL Y+RC+I
Sbjct  287  VLILAGSETTARTLEWAMSNLINHPAVFAKARAEIDVNVGKGRLVEDCDLSKLSYIRCII  346

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             ETLRL+PPAPLL+PHYS +DC + GYDVPK T + VNAWA+H DP  W++P +FKPERF
Sbjct  347  YETLRLFPPAPLLVPHYSSQDCNIGGYDVPKGTILFVNAWALHRDPNQWDDPTEFKPERF  406

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E    +E EGF  KF+PFG GRRACP NN  LR VSL L   IQCFDW+ T+  K+    
Sbjct  407  E----KEKEGF--KFMPFGIGRRACPGNNFALRNVSLTLATLIQCFDWEATEAGKVDLTE  460

Query  234  YLSPS--ILQKDERLEAICTPRKN  169
              S    I+ K++ LEA C PR +
Sbjct  461  KCSAGAVIVPKEKPLEATCCPRSS  484



>gb|EYU35841.1| hypothetical protein MIMGU_mgv1a024949mg [Erythranthe guttata]
Length=467

 Score =   178 bits (452),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 135/210 (64%), Gaps = 15/210 (7%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AGTET+   +E AMSL+LS+PE L KL  EID NVGH  LL +SDL+KLPYLRC+I
Sbjct  273  VMFVAGTETSVTAMERAMSLILSHPEKLQKLSDEIDENVGHDRLLADSDLAKLPYLRCII  332

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYPP P +LPH S EDC V G+ +PK T ++VN WAMH DP+ W+ PE+F PERF
Sbjct  333  NETLRLYPPTPTVLPHVSSEDCTVGGHSIPKGTILLVNVWAMHRDPEQWDRPEEFVPERF  392

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            +    E      +KF+PFG GRR CP + M LR VSL L A +QCFDW+    D      
Sbjct  393  QF---ESERELGHKFLPFGMGRRGCPGSGMALRTVSLGLAALVQCFDWETLSGD------  443

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                  +   + LEA+C  R+       QL
Sbjct  444  ------VAAAKPLEAVCFAREQAAHIFEQL  467



>gb|AHF22081.1| CYP81B58 [Artemisia annua]
Length=500

 Score =   179 bits (454),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 136/211 (64%), Gaps = 5/211 (2%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            Q++  AGT+T+S T+EW +S LL+ PE L K   EID  VG   L+NESDL  LPYLRC+
Sbjct  295  QVLLSAGTDTSSGTMEWMLSHLLNNPEALKKAHAEIDCYVGDNRLINESDLPNLPYLRCI  354

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            INET     P   L+ H S +DC+V GY +P  T +++N WAMH+DPK WE+P+KFKPER
Sbjct  355  INET-MRINPPGPLVFHESAKDCIVGGYHIPSGTMLLMNLWAMHNDPKNWEDPKKFKPER  413

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
                VG EG    YK +PFG GRR CPA NM +R+V LALG  IQCF+W+ T  D+++  
Sbjct  414  ---FVGLEGSRDGYKLMPFGAGRRRCPAENMAMRMVGLALGTLIQCFEWETT-SDEMIDM  469

Query  237  TYLSPSILQKDERLEAICTPRKNCLQFLSQL  145
            T      + K + L A C PR    + +SQL
Sbjct  470  TEGKGLTMPKAKPLVAKCRPRGKMAKLISQL  500



>gb|AFO64617.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=502

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 146/210 (70%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T++ T+EWAMSLLL++P+VL K + EID  VG+  L++ESD+  LPYLRC+I
Sbjct  297  VLLSAGTDTSAGTMEWAMSLLLNHPQVLKKAQNEIDRVVGNDRLVDESDVVNLPYLRCII  356

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLR+ PP PLL+PH S EDCV+ GY++P+ T ++VN WA+HHDPK+W +PE FKPERF
Sbjct  357  NETLRICPPGPLLVPHESSEDCVIGGYNIPRGTMLLVNQWAIHHDPKLWTDPEMFKPERF  416

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E   G EG    +K +PFG+GRR+CP   + +R++   LG  IQCFDW+   E K++  +
Sbjct  417  E---GLEGTRDGFKLMPFGSGRRSCPGEGLAVRVIGSTLGLLIQCFDWERLSE-KMVDMS  472

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                  + K E L A C PR      LS+L
Sbjct  473  EAPGLTMPKAEPLVAKCKPRLEIQTLLSEL  502



>ref|XP_006453453.1| hypothetical protein CICLE_v10008060mg [Citrus clementina]
 ref|XP_006474131.1| PREDICTED: cytochrome P450 81D1-like [Citrus sinensis]
 gb|ESR66693.1| hypothetical protein CICLE_v10008060mg [Citrus clementina]
Length=506

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 142/211 (67%), Gaps = 4/211 (2%)
 Frame = -1

Query  774  MVFXAGTETTSV-TIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            +VF      TS+ TIEWAMSLLL+ P++L K R EIDN +G    ++E DL+KLPYLRC+
Sbjct  299  LVFLVAANDTSLGTIEWAMSLLLNNPDILEKARSEIDNQIGFDRFVDELDLTKLPYLRCI  358

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            I ETLRLYP  P LLPH S E+C V G+ +P+ T ++VN WA+ +DPK+WE P KF PER
Sbjct  359  ILETLRLYPAGPFLLPHESSEECTVGGFRIPRGTMLLVNIWAIQNDPKIWENPTKFNPER  418

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
            FE I G    GF  KF+PFG+GRR+CP   + +R+V L LG+ IQCF+W+   E K+   
Sbjct  419  FEGIEGARDHGF--KFMPFGSGRRSCPGEALSMRIVGLTLGSLIQCFEWERVGE-KMEDM  475

Query  237  TYLSPSILQKDERLEAICTPRKNCLQFLSQL  145
               S  +L K + L+A C PR   L+ LSQ+
Sbjct  476  AEASGLVLAKVQPLQAKCRPRPAMLKLLSQI  506



>gb|ACJ85868.1| unknown [Medicago truncatula]
 gb|AFK47557.1| unknown [Medicago truncatula]
Length=509

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 137/204 (67%), Gaps = 7/204 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++   GTET++ T+EWAMS LL++PEVL K R EID N+G  HL+ ESD+SKLPYL+ +I
Sbjct  302  VMILGGTETSATTLEWAMSALLNHPEVLKKARDEIDTNIGQDHLVEESDISKLPYLQNII  361

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ET RL+P   LL PH+S +DC + GY VPK+T ++VNAWA+H D ++W +P +FKPERF
Sbjct  362  HETFRLHPAFALLAPHFSSQDCTIGGYIVPKNTILLVNAWAIHRDSQLWSDPTQFKPERF  421

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                  + EG   K +PFG GRRACP  N+G R VSL L   IQCFDWK   E++I   T
Sbjct  422  ------DKEGEADKLIPFGLGRRACPGANLGQRTVSLTLALLIQCFDWKRISEEEI-DMT  474

Query  234  YLSPSILQKDERLEAICTPRKNCL  163
                +   K   LEA+C  R N +
Sbjct  475  EGKGATTPKLIPLEAMCKARSNVI  498



>ref|XP_011029060.1| PREDICTED: cytochrome P450 81D11-like [Populus euphratica]
Length=499

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 150/210 (71%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T+S T+EWA+SLLL++PEVL K + EID ++GH  L++E+DL++LPYLR ++
Sbjct  294  VLLLAGTDTSSTTMEWALSLLLNHPEVLEKAQREIDEHIGHDRLMDEADLAQLPYLRSIL  353

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLR+YPPAPLL+PH S E+C+V G+ +P+ T + VN WA+ +DPK+W +P KF+PERF
Sbjct  354  NETLRMYPPAPLLVPHESSEECLVGGFRIPRGTMLSVNMWAIQNDPKIWPDPTKFRPERF  413

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            +     EG    +K +PFG GRR+CP   + LR+V LALG+ +QCF+W+    DK++  T
Sbjct  414  D---NPEGGRDEFKLMPFGHGRRSCPGEGLALRVVGLALGSLLQCFEWQKIG-DKMVDMT  469

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                  L K + LEAIC  R   L  LSQ+
Sbjct  470  ESPGFTLPKAKPLEAICRARPRMLTHLSQI  499



>gb|KEH31510.1| cytochrome P450 family protein [Medicago truncatula]
Length=509

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 137/204 (67%), Gaps = 7/204 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++   GTET++ T+EWAMS LL++PEVL K R EID N+G  HL+ ESD+SKLPYL+ +I
Sbjct  302  VMILGGTETSATTLEWAMSALLNHPEVLKKARDEIDTNIGQDHLVEESDISKLPYLQNII  361

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ET RL+P   LL PH+S +DC + GY VPK+T ++VNAWA+H D ++W +P +FKPERF
Sbjct  362  HETFRLHPAFALLAPHFSSQDCTIGGYIVPKNTILLVNAWAIHRDSQLWSDPTQFKPERF  421

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                  + EG   K +PFG GRRACP  N+G R VSL L   IQCFDWK   E++I   T
Sbjct  422  ------DKEGEADKLIPFGLGRRACPGANLGQRTVSLTLALLIQCFDWKRISEEEI-DMT  474

Query  234  YLSPSILQKDERLEAICTPRKNCL  163
                +   K   LEA+C  R N +
Sbjct  475  EGKGATTPKLIPLEAMCKARSNVI  498



>ref|XP_004238572.1| PREDICTED: cytochrome P450 81E8-like [Solanum lycopersicum]
Length=484

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 144/210 (69%), Gaps = 7/210 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AGT T++VT+EWAMSLLL++PEV+ K R EIDN +G    L E D+ KLPYLRC+I
Sbjct  282  VMFTAGTHTSAVTMEWAMSLLLNHPEVMKKARLEIDNLIGETRPLEEPDILKLPYLRCII  341

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRL+P  PLL+PH+S ++C + GY +PK T + VN W +  D K+WE+  +FKPERF
Sbjct  342  NETLRLFPAGPLLVPHFSTQECTIEGYHIPKSTILFVNIWEIQRDSKIWEDANEFKPERF  401

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E   G EG     KF+PFG GRRACP   + +RL+ L LG +IQCF+W+    D+++   
Sbjct  402  EG--GIEG----CKFIPFGMGRRACPGYGLAIRLIGLVLGLFIQCFEWERIG-DELVSLD  454

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                 +L K E LEA+  PR++ +  LSQL
Sbjct  455  ESCGLMLSKLEPLEALYRPRESMVALLSQL  484



>emb|CDX85218.1| BnaC07g25290D [Brassica napus]
Length=453

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 144/200 (72%), Gaps = 6/200 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T++ T++WAMS LL++P+VL K + EID  +G   L+ E D+ KLPYL+ ++
Sbjct  247  VMILAGTDTSAATLDWAMSNLLNHPDVLKKAKTEIDEQIGSDRLIEEQDIVKLPYLQSIV  306

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRLYP  P+L+PH + EDC+VAGYDVP+ TT++VN WA+H DPK+WEEPEKFKPERF
Sbjct  307  SETLRLYPVVPMLVPHMASEDCMVAGYDVPRGTTLLVNVWAIHRDPKMWEEPEKFKPERF  366

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                  E EG + K +PFG GRRACP   + LRLV+LALG+ +QCF+W+   E+ +  + 
Sbjct  367  ------EKEGEDKKLMPFGMGRRACPGLGLALRLVTLALGSLVQCFEWERAGEEYVDMSE  420

Query  234  YLSPSILQKDERLEAICTPR  175
                  L++   LEA+C PR
Sbjct  421  DEKGITLRRATLLEAMCRPR  440



>ref|XP_009380096.1| PREDICTED: isoflavone 2'-hydroxylase-like [Musa acuminata subsp. 
malaccensis]
Length=524

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 142/209 (68%), Gaps = 3/209 (1%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+T++VT+EWAM LLL++PEVLH +R E+D  +G   +  E D+  LPYL CVIN
Sbjct  319  LLAAGTDTSAVTMEWAMCLLLNHPEVLHAVRAELDAKIGQGRMAEEEDIPDLPYLNCVIN  378

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRLYP  PLL+PH S +DC V GYDVP+ T ++VNAWA+H DP  W+EP++FKPERF+
Sbjct  379  ETLRLYPAGPLLVPHESSQDCTVGGYDVPRGTMLLVNAWAIHRDPNTWDEPQEFKPERFQ  438

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
               G+E  G   + +PFG+GRR CP   + +R++ LAL   I CF+W+    +++   T 
Sbjct  439  CEGGKEEAGL--RMLPFGSGRRKCPGEGLAMRVIGLALATLIHCFEWEKLPGEEV-DMTE  495

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
                 + K + LEA+CTPR   L  LSQL
Sbjct  496  GRGLTMPKAKPLEAMCTPRHTMLDALSQL  524



>emb|CDP14451.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 144/211 (68%), Gaps = 3/211 (1%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            Q++   GT TTS T+EWA+S LL++P VL K R E++  +   HLLN+SD+SKLPYLRC+
Sbjct  291  QIMLSGGTHTTSQTMEWALSSLLNHPNVLQKARDELEK-MQPGHLLNDSDISKLPYLRCI  349

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            INETLRL+P AP L+PH+S EDC + GY+VPK TT++VN WA+H DP +WEEP KFKPER
Sbjct  350  INETLRLFPAAPTLVPHFSSEDCTIGGYEVPKGTTLLVNVWAIHRDPNLWEEPNKFKPER  409

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
            FE +  E G    +KF+PFG GRR CP   M +RLV L LG  IQ FDW+    + +   
Sbjct  410  FEGM-DERGWNEGFKFLPFGKGRRICPGAAMAIRLVGLTLGTLIQFFDWERVGPEMVDLE  468

Query  237  TYLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                 S L K + LEA   PR + ++ +SQL
Sbjct  469  ENQG-STLGKAKPLEACYKPRPSMIKTISQL  498



>ref|XP_004238116.2| PREDICTED: isoflavone 2'-hydroxylase-like [Solanum lycopersicum]
Length=512

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 148/210 (70%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T+  T+EWA+SL+L++PE L K + EID  +GH+ L++ESD++ LPYLRC++
Sbjct  307  VLLAAGTDTSVGTMEWALSLMLNHPETLKKAQAEIDERIGHERLIDESDMNNLPYLRCIV  366

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NET R+YP  PLL+PH S E+  V GY VP+ T ++VN WA+H+DPK+W+EP KFKPERF
Sbjct  367  NETFRMYPAGPLLVPHESSEETTVGGYRVPRGTMLLVNLWAIHNDPKLWDEPRKFKPERF  426

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E   G EG    YK +PFG+GRR+CP   + +R+V+L+LG  IQCFDW+    D+++  T
Sbjct  427  E---GLEGVRDGYKMMPFGSGRRSCPGEGLAVRMVALSLGCIIQCFDWQRIG-DELVDMT  482

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
              +   L K + L A C+PR      LSQ+
Sbjct  483  EGTGLTLPKAQPLVAKCSPRPVMSNLLSQI  512



>emb|CAA04116.1| cytochrome P450 [Helianthus tuberosus]
Length=505

 Score =   177 bits (448),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 147/211 (70%), Gaps = 6/211 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AG++T++ T+EW MSLLL++P+VL K + EID+ +G   L++ESD+  LPYLRC+I
Sbjct  300  VLLAAGSDTSAGTMEWVMSLLLNHPQVLKKAQNEIDSVIGKNCLVDESDIPNLPYLRCII  359

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYP  PLL+PH +  DCVV GY+VP+ T ++VN WA+HHDPKVW+EPE FKPERF
Sbjct  360  NETLRLYPAGPLLVPHEASSDCVVGGYNVPRGTILIVNQWAIHHDPKVWDEPETFKPERF  419

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E   G EG    +K +PFG+GRR+CP   + +R++ + LG+ IQCFDW+ T E+  L   
Sbjct  420  E---GLEGTRDGFKLLPFGSGRRSCPGEGLAVRMLGMTLGSIIQCFDWERTSEE--LVDM  474

Query  234  YLSPSI-LQKDERLEAICTPRKNCLQFLSQL  145
               P + + K   L A C PR      LS+L
Sbjct  475  TEGPGLTMPKAIPLVAKCKPRVEMTNLLSEL  505



>emb|CBI33748.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   176 bits (447),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 142/205 (69%), Gaps = 12/205 (6%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            Q++  AGT+T++ T+EWAM+LLL++P+VL K + E+D +VG   L+ ESDL KL YL+ +
Sbjct  279  QVLILAGTDTSASTMEWAMTLLLNHPDVLEKAKAELDMHVGKDRLIEESDLPKLRYLQSI  338

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            I+ETLR++P  PLLLPH S +DC + G+D+P+ T ++VNAWA+H DP+VW +P  FKPER
Sbjct  339  ISETLRVFPVTPLLLPHMSSDDCQIGGFDIPRGTLLLVNAWALHRDPQVWVDPTSFKPER  398

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWK---NTKEDKI  247
            F     E GE  NYK VPFG GRRACP + +  R+V LALG+ IQC+DWK   NT  D I
Sbjct  399  F-----ENGERENYKLVPFGIGRRACPGSGLAQRVVGLALGSLIQCYDWKKISNTAIDTI  453

Query  246  LCATYLSPSILQKDERLEAICTPRK  172
                   P +    + LEA+C  R+
Sbjct  454  EGKGLTMPKL----QPLEAMCKARE  474



>ref|XP_010531165.1| PREDICTED: cytochrome P450 81E8-like [Tarenaya hassleriana]
Length=513

 Score =   177 bits (448),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 148/213 (69%), Gaps = 11/213 (5%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AGT+T+  T+EWAM +LL++P+ L KLR EI+ NV H  L+ +SDL  LPYLRCVI
Sbjct  309  LMFNAGTDTSPGTMEWAMFVLLNHPDKLEKLRAEIEANVKHDRLIRDSDLQNLPYLRCVI  368

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             ETLRLYP APLLLPHY+ +   + GY++P +T V+VNAWA+H D K+W+E E FKPERF
Sbjct  369  YETLRLYPAAPLLLPHYTSKKFSLDGYEIPANTMVLVNAWAVHRDGKLWDEAEAFKPERF  428

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E  VG+  +GF  +F+PFG GRRACP   MG+R V+L +GA +QCF+W     +KI  A 
Sbjct  429  EGFVGDR-DGF--RFLPFGVGRRACPGAGMGMRTVALTVGAMVQCFEW-----EKIGQAV  480

Query  234  YLSPSI---LQKDERLEAICTPRKNCLQFLSQL  145
             + P     + K E L A C PR   +Q LSQL
Sbjct  481  DMRPVFNVAMVKAEPLVARCRPRAEMVQVLSQL  513



>ref|XP_007018568.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY15793.1| Cytochrome P450, putative [Theobroma cacao]
Length=499

 Score =   176 bits (447),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 147/209 (70%), Gaps = 4/209 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGTET+S T+EWAMSLLL+ PEVL K + EIDN VGH  +++ESDL+KLPYL C+I
Sbjct  294  VLLNAGTETSSGTMEWAMSLLLNNPEVLKKAQMEIDNVVGHDRMMDESDLAKLPYLHCII  353

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             ET+R+YP  PLLLPH S ++C+V G+ VP+ TT++VN WA+ +DP +WEEP KFKPERF
Sbjct  354  CETMRMYPVTPLLLPHESSKECMVGGHRVPRGTTLLVNMWAIQNDPNIWEEPTKFKPERF  413

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                G EG    +K +PFG+GRR+CP   + + +V L LG+ IQCF+W+ T E+ ++  T
Sbjct  414  G---GFEGPRVGFKLLPFGSGRRSCPGEGLAISMVGLTLGSLIQCFEWERTSEE-MVDMT  469

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQ  148
              S   + K+  L A   PR+  +  LS+
Sbjct  470  QGSGLTMPKERALHAKGRPRQAMMNMLSR  498



>ref|XP_006362077.1| PREDICTED: isoflavone 2'-hydroxylase-like [Solanum tuberosum]
Length=539

 Score =   177 bits (448),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 145/210 (69%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T+  T+EWA+SL+L++PE L K + EID  +GH+ L++ESD++ LPYLRC+I
Sbjct  334  VLLAAGTDTSVGTMEWALSLMLNHPETLKKAQAEIDERIGHERLIDESDMNNLPYLRCII  393

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NET R+YP  PLL+PH S E+  V GY VP  T ++VN WA+H+DPK+W+EP KFKPER 
Sbjct  394  NETFRMYPAGPLLVPHESSEETTVGGYRVPGGTMLLVNLWAIHNDPKLWDEPRKFKPER-  452

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                G EG    YK +PFG+GRR+CP   + +R+V+L+LG  IQCFDW+    D+++  T
Sbjct  453  --FEGLEGVRDGYKMMPFGSGRRSCPGEGLAVRMVALSLGCIIQCFDWRRIG-DELVDMT  509

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
              +   L K + L A C+PR      LSQ+
Sbjct  510  EGTGLTLPKAQPLVAKCSPRPVMANLLSQI  539



>ref|XP_009796226.1| PREDICTED: isoflavone 2'-hydroxylase-like isoform X1 [Nicotiana 
sylvestris]
Length=513

 Score =   176 bits (447),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 146/210 (70%), Gaps = 3/210 (1%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AG++T++VT+EWA S LL   E+L K + EIDN+VG   L++ESDL++L Y+RC+I
Sbjct  307  VLLQAGSDTSAVTLEWAFSHLLDNLEILKKAQAEIDNHVGQDRLIDESDLAQLHYIRCII  366

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLR++P APLL+PH S E+C VA Y VP+ T ++VNAW +HHDPKVWE+PEKF P+R 
Sbjct  367  NETLRMHPAAPLLVPHLSSEECNVASYRVPRGTVLLVNAWGIHHDPKVWEDPEKFYPDR-  425

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
               +G EG     KF+PFG+GRR CP  N+   ++ LALG+ +QCF+W+      I  + 
Sbjct  426  --FIGFEGIKEGCKFIPFGSGRRGCPGENLAFHVIGLALGSLLQCFEWEKPNRGSIDMSE  483

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                ++  K + L A C+PR N ++ LS++
Sbjct  484  GTGFTLSPKVQPLLAKCSPRPNMVKLLSEI  513



>ref|XP_008453068.1| PREDICTED: cytochrome P450 81D1-like [Cucumis melo]
Length=516

 Score =   176 bits (447),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 144/200 (72%), Gaps = 4/200 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGTET+ VT+EWA+SL+L++PE L KL+ EID+ VGH  L++ESD++ LP LR +I
Sbjct  306  ILLAAGTETSVVTMEWALSLMLNHPEFLKKLQNEIDSQVGHDRLIDESDMANLPSLRGII  365

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NET R+YPPAPL++PH S +DC+V GY +P+ T + VN WA+H+DPK+W+ P KF P RF
Sbjct  366  NETFRMYPPAPLMVPHESSKDCIVGGYHIPRGTILYVNLWAIHNDPKIWDNPRKFNPNRF  425

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E++   E E F +  +PFG+GRR CP   +GLR++ L LG+ +QCF+W+   E+ +    
Sbjct  426  ESL---ESEKFGFNLMPFGSGRRGCPGEGLGLRVIGLVLGSLVQCFEWERPGEELVDMTE  482

Query  234  YLSPSILQKDERLEAICTPR  175
             ++ + + K   L+A CTPR
Sbjct  483  GIALT-MPKAHCLQAKCTPR  501



>ref|XP_007018567.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY15792.1| Cytochrome P450 [Theobroma cacao]
Length=498

 Score =   176 bits (446),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 146/205 (71%), Gaps = 4/205 (2%)
 Frame = -1

Query  759  GTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINETlr  580
            GT+TT  T+EWA SLLL++PEVL K + EI N VGH  L++ESDL++LPYL C+INETLR
Sbjct  298  GTDTTVNTMEWAFSLLLNHPEVLEKAQAEIANRVGHCRLIDESDLAQLPYLHCIINETLR  357

Query  579  lyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfEAIVG  400
            +Y PAPLLLPH S E+CV+ G+ +P+ TT++VN WA+ +DPK+W  P +F PERFE   G
Sbjct  358  MYSPAPLLLPHESSEECVLGGFRIPRGTTLLVNVWAIQNDPKLWTNPTRFMPERFE---G  414

Query  399  EEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSPS  220
             EG    ++ +PFG+GRR CP  ++GLR+V L LG+ IQCF+W    +D ++  T  +  
Sbjct  415  LEGTRDGFRLMPFGSGRRGCPGESLGLRMVGLTLGSLIQCFEWSRISDD-LVDMTDATGF  473

Query  219  ILQKDERLEAICTPRKNCLQFLSQL  145
             ++K + L+A C P    L+ +S++
Sbjct  474  TMRKAQLLQAKCKPCPAMLKLVSRI  498



>emb|CAA04117.1| cytochrome P450 [Helianthus tuberosus]
Length=520

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 147/211 (70%), Gaps = 6/211 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AG++T++ T+EW MSLLL++P+VL K + EID+ +G   L++ESD+  LPYLRC+I
Sbjct  315  VLLAAGSDTSAGTMEWVMSLLLNHPQVLKKAQNEIDSVIGKNCLVDESDIPNLPYLRCII  374

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYP  PLL+PH +  DCVV GY+VP+ T ++VN WA+HHDPKVW+EPE FKPERF
Sbjct  375  NETLRLYPAGPLLVPHEASSDCVVGGYNVPRGTILIVNQWAIHHDPKVWDEPETFKPERF  434

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E   G EG    +K +PFG+GRR+CP   + +R++ + LG+ IQCFDW+ T E+  L   
Sbjct  435  E---GLEGTRDGFKLLPFGSGRRSCPGEGLAVRMLGMTLGSIIQCFDWERTSEE--LVDM  489

Query  234  YLSPSI-LQKDERLEAICTPRKNCLQFLSQL  145
               P + + K   L A C PR      LS+L
Sbjct  490  TEGPGLTMPKAIPLVAKCKPRVEMTNLLSEL  520



>ref|XP_002283502.1| PREDICTED: cytochrome P450 81E8-like [Vitis vinifera]
Length=508

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 138/197 (70%), Gaps = 6/197 (3%)
 Frame = -1

Query  762  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINETl  583
             G +TT+VTIEWAMSLLL++PEVL K R E+D ++GH  L++E+DL KL YL+ +I+E+L
Sbjct  305  GGADTTAVTIEWAMSLLLNHPEVLKKARDELDTHIGHDCLIDETDLPKLQYLQSIISESL  364

Query  582  rlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfEAIV  403
            RL+P  PLL+PH+S EDC + G+DVP  T ++VNAWA+H DPK+W +P  FKPERF    
Sbjct  365  RLFPSTPLLVPHFSTEDCKLRGFDVPGGTMLLVNAWALHRDPKLWNDPTSFKPERF----  420

Query  402  GEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSP  223
             E GE   YK +PFG GRRACP   +  R++ L LG+ IQCFDWK   E +I  A     
Sbjct  421  -ETGESETYKLLPFGVGRRACPGIGLANRVMGLTLGSLIQCFDWKRVDEKEIDMAEGQGL  479

Query  222  SILQKDERLEAICTPRK  172
            + + K E LEA+C  R+
Sbjct  480  T-MPKVEPLEAMCKTRQ  495



>emb|CDP01233.1| unnamed protein product [Coffea canephora]
Length=324

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 143/210 (68%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T++VT+EWAMSLLL++PEVL K R E+DN VG   +++ESDL KL Y++ ++
Sbjct  119  ILLMAGTDTSAVTMEWAMSLLLNHPEVLRKARVELDNFVGQDRVVDESDLPKLTYIQAIV  178

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRL+P  PLL PH S  +C + GY V  +T ++VNAWA+H DP++W++P  FKPERF
Sbjct  179  NETLRLFPAVPLLSPHESSAECSIGGYYVSSNTMLLVNAWAIHRDPELWDDPTSFKPERF  238

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E   G E + +  K +PFG GRR CP   +  R+V+LALGA IQCFDW    +D +   T
Sbjct  239  E---GLEADTYKLKLIPFGMGRRGCPGAGLANRVVTLALGALIQCFDWDRVSQD-LEDMT  294

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
              S   + K + LEA+C  R+   + L +L
Sbjct  295  EGSGLTMPKAKPLEAMCRAREKMTKILKEL  324



>ref|XP_002283792.2| PREDICTED: isoflavone 2'-hydroxylase [Vitis vinifera]
Length=504

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 142/205 (69%), Gaps = 12/205 (6%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            Q++  AGT+T++ T+EWAM+LLL++P+VL K + E+D +VG   L+ ESDL KL YL+ +
Sbjct  301  QVLILAGTDTSASTMEWAMTLLLNHPDVLEKAKAELDMHVGKDRLIEESDLPKLRYLQSI  360

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            I+ETLR++P  PLLLPH S +DC + G+D+P+ T ++VNAWA+H DP+VW +P  FKPER
Sbjct  361  ISETLRVFPVTPLLLPHMSSDDCQIGGFDIPRGTLLLVNAWALHRDPQVWVDPTSFKPER  420

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWK---NTKEDKI  247
            F     E GE  NYK VPFG GRRACP + +  R+V LALG+ IQC+DWK   NT  D I
Sbjct  421  F-----ENGERENYKLVPFGIGRRACPGSGLAQRVVGLALGSLIQCYDWKKISNTAIDTI  475

Query  246  LCATYLSPSILQKDERLEAICTPRK  172
                   P +    + LEA+C  R+
Sbjct  476  EGKGLTMPKL----QPLEAMCKARE  496



>gb|ABC69377.1| CYP81B2v2 [Nicotiana tabacum]
Length=511

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 148/210 (70%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T+  T+EWA+SL+L++PE L K + EID ++GH+ L++ESD++ LPYLRC+I
Sbjct  306  VLLSAGTDTSVGTMEWALSLMLNHPETLKKAQAEIDEHIGHERLVDESDINNLPYLRCII  365

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NET R+YP  PLL+PH S E+  V GY VP  T ++VN WA+H+DPK+W+EP KFKPERF
Sbjct  366  NETFRMYPAGPLLVPHESSEETTVGGYRVPGGTMLLVNLWAIHNDPKLWDEPRKFKPERF  425

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            +   G +G    YK +PFG+GRR+CP   + +R+V+L+LG  IQCFDW+   E+ ++  T
Sbjct  426  Q---GLDGVRDGYKMMPFGSGRRSCPGEGLAVRMVALSLGCIIQCFDWQRIGEE-LVDMT  481

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
              +   L K + L A C+PR      LSQ+
Sbjct  482  EGTGLTLPKAQPLVAKCSPRPKMANLLSQI  511



>ref|XP_002283500.1| PREDICTED: isoflavone 3'-hydroxylase [Vitis vinifera]
Length=504

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 142/205 (69%), Gaps = 12/205 (6%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            Q++  AGT+T++ T+EWAM+LLL++P+VL K + E+D +VG   L+ ESDL KL YLR +
Sbjct  301  QVLILAGTDTSAATMEWAMTLLLNHPDVLEKAKAELDMHVGKDRLIEESDLPKLRYLRSI  360

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            I+ETLR++P APLLLPH S +DC + G+D+P+ T ++VN WA+H DP+VWE+P  FKPER
Sbjct  361  ISETLRVFPVAPLLLPHMSSDDCQIGGFDIPRGTLLLVNVWALHRDPQVWEDPTSFKPER  420

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWK---NTKEDKI  247
            F     E GE  NYK VPFG GRRACP   +  R+V LALG+ IQC+DWK   NT  D I
Sbjct  421  F-----ENGERENYKLVPFGIGRRACPGAGLAQRVVGLALGSLIQCYDWKKISNTAIDTI  475

Query  246  LCATYLSPSILQKDERLEAICTPRK  172
                   P +    + LEA+C  R+
Sbjct  476  EGKGLTMPKL----QPLEAMCKARE  496



>ref|XP_009796225.1| PREDICTED: isoflavone 2'-hydroxylase-like [Nicotiana sylvestris]
Length=518

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 147/210 (70%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T+  T+EWA+SL+L++P+ L K + EID  +GH+ LL+ESD++ LPYLRC+I
Sbjct  313  VLLSAGTDTSVGTMEWALSLMLNHPQTLKKAQAEIDERIGHERLLDESDINNLPYLRCII  372

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NET R+YP  PLL+PH S E+  V GY VP  T ++VN WA+H+DPK+W+EP KFKPERF
Sbjct  373  NETFRMYPAGPLLVPHESSEETTVGGYRVPGGTMLLVNLWAIHNDPKLWDEPRKFKPERF  432

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            +   G +G    YK +PFG+GRR+CP   + +R+V+L+LG  IQCFDW+   E+ ++  T
Sbjct  433  Q---GLDGVRDGYKMMPFGSGRRSCPGEGLAVRMVALSLGCIIQCFDWQRIGEE-LVDMT  488

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
              +   L K + L A C+PR      LSQ+
Sbjct  489  EGTGLTLPKAQPLVAKCSPRPKMANLLSQI  518



>ref|XP_011069766.1| PREDICTED: isoflavone 3'-hydroxylase-like [Sesamum indicum]
Length=513

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 142/210 (68%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T++ T+EWA+SLLL++P VL K + EIDN++GH  L++ESD++KLPYLRC++
Sbjct  308  VLLTAGTDTSAGTMEWALSLLLNHPHVLKKAQLEIDNHIGHDRLIDESDIAKLPYLRCIV  367

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYP  PLL+PH S E C V  Y +P  T ++VNAWA+H+DPK WE+  +FKPERF
Sbjct  368  NETLRLYPAGPLLVPHESSEQCTVGAYRIPAGTMLLVNAWAIHNDPKNWEDAREFKPERF  427

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E   G EG    +K +PFG+GRR CP   + +R+V   L + IQCFDW    ++ I    
Sbjct  428  E---GLEGNRDGFKLMPFGSGRRGCPGEALAVRMVGFGLASMIQCFDWGRVGKELIDMTE  484

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
             L  S + K E L A C  R    + LSQ+
Sbjct  485  GLGLS-MPKAEPLTAYCRARPVAAKLLSQI  513



>ref|XP_007033007.1| Cytochrome P450, family 81, subfamily D, polypeptide 8 [Theobroma 
cacao]
 gb|EOY03933.1| Cytochrome P450, family 81, subfamily D, polypeptide 8 [Theobroma 
cacao]
Length=501

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 144/200 (72%), Gaps = 6/200 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T++VT+EWAMS LL++PEVL K R EID+ +G ++L++E D+SKL YL+ VI
Sbjct  296  VMILAGTDTSAVTLEWAMSNLLNHPEVLKKARAEIDSQIGQENLIDEPDVSKLHYLQSVI  355

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRLYP  PLLLPH +  DC + GYDVP+ T VMVNAWA+H DPK+W++P  FKPERF
Sbjct  356  SETLRLYPALPLLLPHMASSDCTIGGYDVPRDTIVMVNAWAIHRDPKLWDDPTSFKPERF  415

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                 E  +G ++K +PFG GRRACP  ++  RLV L LG+ IQCF+W+   + K +  T
Sbjct  416  -----ENEKGESHKLMPFGLGRRACPGASLAQRLVGLTLGSLIQCFEWERV-DGKEIDMT  469

Query  234  YLSPSILQKDERLEAICTPR  175
              + S + K + LEA+C  R
Sbjct  470  EGTGSTMPKAQPLEAMCKAR  489



>ref|XP_004141398.1| PREDICTED: cytochrome P450 81E8-like [Cucumis sativus]
Length=512

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 141/209 (67%), Gaps = 4/209 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGTET+   +EWA+SLLL++PE+L K + EIDN VGHK L+ ESD+++LPYLR +I
Sbjct  301  LMLVAGTETSGSIMEWALSLLLNHPEILKKAQTEIDNQVGHKRLMEESDMARLPYLRGII  360

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLR+YPPAPLL+PH S +DC V GY VP+ T + +N WA+ +DPK W  P KF PERF
Sbjct  361  NETLRMYPPAPLLVPHESSQDCSVGGYHVPRGTMLYINIWAIQNDPKFWTHPRKFDPERF  420

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
              +   E E + +  + FG GRR CP   +GLR++ L LG+ IQCF+W+   E+ +    
Sbjct  421  NDV---ESENYKFNLMAFGLGRRGCPGEGLGLRMIGLVLGSLIQCFEWERPTEELVDLTE  477

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQ  148
             ++ + + K + L A C PR   +  LSQ
Sbjct  478  GIAIT-MPKAQNLHAKCRPRPMVVDILSQ  505



>gb|KGN55250.1| hypothetical protein Csa_4G642310 [Cucumis sativus]
Length=520

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 141/209 (67%), Gaps = 4/209 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGTET+   +EWA+SLLL++PE+L K + EIDN VGHK L+ ESD+++LPYLR +I
Sbjct  309  LMLVAGTETSGSIMEWALSLLLNHPEILKKAQTEIDNQVGHKRLMEESDMARLPYLRGII  368

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLR+YPPAPLL+PH S +DC V GY VP+ T + +N WA+ +DPK W  P KF PERF
Sbjct  369  NETLRMYPPAPLLVPHESSQDCSVGGYHVPRGTMLYINIWAIQNDPKFWTHPRKFDPERF  428

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
              +   E E + +  + FG GRR CP   +GLR++ L LG+ IQCF+W+   E+ +    
Sbjct  429  NDV---ESENYKFNLMAFGLGRRGCPGEGLGLRMIGLVLGSLIQCFEWERPTEELVDLTE  485

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQ  148
             ++ + + K + L A C PR   +  LSQ
Sbjct  486  GIAIT-MPKAQNLHAKCRPRPMVVDILSQ  513



>gb|ABC69378.1| CYP81B2v1 [Nicotiana tabacum]
 dbj|BAF91366.1| cytochrome P450 [Nicotiana tabacum]
Length=511

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 147/210 (70%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T+  T+EWA+SL+L++PE L K + EID ++GH+ L++ESD++ LPYLRC+I
Sbjct  306  VLLSAGTDTSVGTMEWALSLMLNHPETLKKAQAEIDEHIGHERLVDESDINNLPYLRCII  365

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NET R+YP  PLL+PH S E+  V GY VP  T ++VN WA+H+DPK+W+EP KFKPERF
Sbjct  366  NETFRMYPAGPLLVPHESSEETTVGGYRVPGGTMLLVNLWAIHNDPKLWDEPRKFKPERF  425

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E   G EG    YK +PFG+GRR+CP   + +R+V+L+LG  IQCFDW+   E  ++  T
Sbjct  426  E---GLEGVRDGYKMMPFGSGRRSCPGEGLAIRMVALSLGCIIQCFDWQRLGEG-LVDKT  481

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
              +   L K + L A C+PR      LSQ+
Sbjct  482  EGTGLTLPKAQPLVAKCSPRPIMANLLSQI  511



>emb|CDX86416.1| BnaA06g31330D [Brassica napus]
Length=453

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 143/200 (72%), Gaps = 6/200 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T++ T++WAMS LL++PEVL K + EID  +G   L+ E D+ KLPYL+ ++
Sbjct  247  VMILAGTDTSAATLDWAMSNLLNHPEVLKKAKTEIDEQIGSDRLIEEQDIVKLPYLQSIV  306

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRLYP  P+L+PH + EDC+VAGYDVP+ T ++VN WA+H DP++WEEPEKFKPERF
Sbjct  307  SETLRLYPVVPMLVPHMASEDCMVAGYDVPRGTNLLVNVWAIHRDPEMWEEPEKFKPERF  366

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                  E EG + K +PFG GRRACP   + LRLV+LALG+ +QCF+W+   ++ +  + 
Sbjct  367  ------EKEGEDKKLMPFGMGRRACPGLGLALRLVTLALGSLVQCFEWERAGQEYVDMSE  420

Query  234  YLSPSILQKDERLEAICTPR  175
                  L++   LEA+C PR
Sbjct  421  DEKGITLRRATLLEAVCRPR  440



>gb|KGN55242.1| hypothetical protein Csa_4G641740 [Cucumis sativus]
Length=205

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 139/209 (67%), Gaps = 4/209 (2%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+TTS TIEWAMSLLL++P V+ K   EI + +G   ++ E D+SKL YL  +I 
Sbjct  1    MLAAGTDTTSGTIEWAMSLLLNHPMVMEKAWIEIRDCIGENQMVEEGDVSKLKYLEAIIY  60

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLR++P APLL+PH   EDC + G+++PK T +MVNAWA+H DPKVWE+P  F+PERF 
Sbjct  61   ETLRMFPAAPLLVPHECSEDCSIEGFEIPKGTMLMVNAWAIHRDPKVWEDPTSFRPERFL  120

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
               G E    +YK++PFG GRRACP   +  R + L L   IQCF+W+   E++ +  + 
Sbjct  121  NWEGVE----SYKWIPFGMGRRACPGFALAQRSMGLTLATLIQCFEWEKVDENEQIDLSE  176

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
             S   + K + LEA+C PR + L  L+QL
Sbjct  177  GSGITMPKAKALEAMCKPRNSMLHLLAQL  205



>ref|XP_010277161.1| PREDICTED: cytochrome P450 81E8-like [Nelumbo nucifera]
Length=515

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 139/211 (66%), Gaps = 4/211 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            M+  AGTET++ TIEWAM+LL ++PEVL K R E+D  VG   L++E D+ KL YL+ V+
Sbjct  304  MMLIAGTETSATTIEWAMALLFNHPEVLKKARAELDAYVGQDRLMDEQDIPKLHYLQGVV  363

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYPPAPLL PH S EDC V GYDVP+ T + VNAWA+H DPK+W++P  FKPER 
Sbjct  364  NETLRLYPPAPLLAPHESSEDCSVGGYDVPRGTMLFVNAWAIHRDPKLWDDPTSFKPERH  423

Query  414  EAIVGEEGEGFN-YKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
                G+EG     +K +PFG GRR CP   +  R+V L LG  IQCF+W+   E  +   
Sbjct  424  HQ--GDEGVVVEPFKLIPFGLGRRGCPGAGLANRVVGLTLGTLIQCFEWERVSEHMVDMT  481

Query  237  TYLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                 S + K   LEA+C PR+   + LSQL
Sbjct  482  EGKGLS-MPKATPLEALCQPRQTMTKVLSQL  511



>ref|XP_010446678.1| PREDICTED: cytochrome P450 81D11-like, partial [Camelina sativa]
Length=331

 Score =   171 bits (432),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 137/196 (70%), Gaps = 7/196 (4%)
 Frame = -1

Query  762  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINETl  583
            AGTET+ VT+EWAMS LL++PE+L K+R EID+ +G   L+ ESD+  LPYL+  ++ETL
Sbjct  136  AGTETSEVTLEWAMSNLLNHPEILEKVRAEIDDKIGSDRLIEESDIVNLPYLQNTVSETL  195

Query  582  rlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfEAIV  403
            RLYP  PLLLPH+S ++C VAGYD+P+ T ++ N WAMH DP +WEEPE+FKPERF    
Sbjct  196  RLYPAVPLLLPHFSSDECKVAGYDMPRGTLLLTNVWAMHRDPDLWEEPERFKPERF----  251

Query  402  GEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSP  223
              E EG   K +PFG GRRACP   +G RLV+LALG+ IQCF+W+   E+ +L  T    
Sbjct  252  --EKEGEAQKLIPFGMGRRACPGAELGKRLVTLALGSLIQCFEWERVGEE-LLDMTEAEG  308

Query  222  SILQKDERLEAICTPR  175
              + K   L A+C  R
Sbjct  309  ITMPKATPLRAMCKTR  324



>ref|XP_009620153.1| PREDICTED: isoflavone 2'-hydroxylase-like [Nicotiana tomentosiformis]
Length=511

 Score =   174 bits (442),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 147/210 (70%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T+  T+EWA+SL+L++PE L K + EID  +GH+ L++ESD++ LPYLRC+I
Sbjct  306  VLLSAGTDTSVGTMEWALSLMLNHPETLKKAQAEIDERIGHERLVDESDINNLPYLRCII  365

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NET R+YP  PLL+PH S E+  V GY VP  T ++VN WA+H+DPK+W+EP KFKPERF
Sbjct  366  NETFRMYPAGPLLVPHESSEETTVGGYRVPGGTMLLVNLWAIHNDPKLWDEPRKFKPERF  425

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E   G EG    YK +PFG+GRR+CP   + +R+V+L+LG  IQCFDW+   ++ ++  T
Sbjct  426  E---GLEGVRDGYKMMPFGSGRRSCPGEGLAIRMVALSLGCIIQCFDWQRMGKE-LVDMT  481

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
              +   L K + L A C+PR      LSQ+
Sbjct  482  EGTGLTLPKAQPLVAKCSPRPIMANLLSQI  511



>ref|XP_002302425.2| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE81698.2| cytochrome P450 family protein [Populus trichocarpa]
Length=484

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 148/209 (71%), Gaps = 4/209 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T+S  +EWA+SLLL++ EVL K + EID  +G   L++E+DL++LPYLR +I
Sbjct  280  VLLFAGTDTSSSIMEWALSLLLNHSEVLLKAQKEIDEYIGPDRLIDEADLAQLPYLRSII  339

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLR+YPPAPLL+PH S E+C+V G+ +P+ T + VN WA+H+DPK+W +P KF+P+RF
Sbjct  340  NETLRMYPPAPLLVPHESSEECLVGGFRIPRGTMLFVNMWAIHNDPKIWLDPRKFRPDRF  399

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                G EG    ++ +PFG GRR+CP   + LR+V LALG+ IQCF+W+   +DK +  T
Sbjct  400  N---GLEGARDGFRLMPFGYGRRSCPGEGLALRMVGLALGSLIQCFEWQRI-DDKSVDMT  455

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQ  148
                  + K + L+AIC PR + L+  SQ
Sbjct  456  ERPGFTMAKAQPLKAICRPRLSMLKLFSQ  484



>ref|XP_008369127.1| PREDICTED: LOW QUALITY PROTEIN: isoflavone 2'-hydroxylase-like 
[Malus domestica]
Length=499

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 144/204 (71%), Gaps = 6/204 (3%)
 Frame = -1

Query  762  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINETl  583
            AGT+T++VT+EWAMS LL++P VL K + E+D  VG ++L++E D+SKLPYL+ +I+ETL
Sbjct  302  AGTDTSAVTLEWAMSNLLNHPRVLQKAKSELDAKVGKENLVDEPDISKLPYLQSIISETL  361

Query  582  rlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfEAIV  403
            RL P APLLLPH++ +DC++ G+DVP+ T V+VNAWA+H DP++W+EPE FKPERF    
Sbjct  362  RLCPAAPLLLPHFTSDDCIIGGFDVPRDTMVLVNAWAVHRDPELWDEPESFKPERF----  417

Query  402  GEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSP  223
             E GE F++K +PFG GRRACP   +  R+V L LG+ IQCFDW    E+ ++  T    
Sbjct  418  -ESGEDFSHKLIPFGMGRRACPGAGLAQRVVGLTLGSLIQCFDWNRVGEE-MVDMTEGKG  475

Query  222  SILQKDERLEAICTPRKNCLQFLS  151
                K   LEA+C  R    + LS
Sbjct  476  LTAPKAIPLEAMCKARIIVSKVLS  499



>ref|XP_002456656.1| hypothetical protein SORBIDRAFT_03g040280 [Sorghum bicolor]
 gb|EES01776.1| hypothetical protein SORBIDRAFT_03g040280 [Sorghum bicolor]
Length=523

 Score =   174 bits (442),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 143/209 (68%), Gaps = 6/209 (3%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGTETTS T+EWAMSLLL++P+VL K + EID+NVG   LL+++DL +LPYL C+I+
Sbjct  321  LLGAGTETTSTTMEWAMSLLLNHPDVLKKAQEEIDSNVGEGRLLDKNDLPRLPYLHCIIS  380

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRLYP AP+LLPH +  DC + GYDVP  + ++VNA+A+H DP  WE+PE+F+PERF 
Sbjct  381  ETLRLYPAAPMLLPHEASTDCKIHGYDVPAGSMILVNAYAIHRDPATWEDPEEFRPERF-  439

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
                E G       +PFG GRR CP  N+ +R + L LGA +QCFDW    + ++  AT 
Sbjct  440  ----EHGRAEGKFMMPFGMGRRRCPGENLAMRTMGLVLGALLQCFDWTRIGDAEVDMATA  495

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
             + +I+ K   LEA+C PR N    L ++
Sbjct  496  -TGTIMSKAVPLEALCKPRANMSAVLQKI  523



>emb|CBI33744.3| unnamed protein product [Vitis vinifera]
Length=234

 Score =   167 bits (424),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 133/200 (67%), Gaps = 6/200 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGTET++ T EWAM+LLL++P  L K   EID+ VG + +++E+DL  LPYL+ ++
Sbjct  27   VLILAGTETSATTTEWAMALLLNHPNSLKKAIAEIDDRVGQERIMDETDLPNLPYLQNIV  86

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             ETLRLYPP PLL+PH S E+C + GY +PKHT VMVNAWA+  DPK+W +   F+PERF
Sbjct  87   RETLRLYPPGPLLVPHVSSEECEIGGYHIPKHTMVMVNAWAIQRDPKLWPDATSFRPERF  146

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                 E G+   YKF+P+G GRRACP  +M  RL+ L LG  IQC+ W+    DK +  +
Sbjct  147  -----ETGKAETYKFLPYGVGRRACPGASMANRLIGLTLGTLIQCYSWERVS-DKEVDMS  200

Query  234  YLSPSILQKDERLEAICTPR  175
                  + K   LEA+C PR
Sbjct  201  GAEGLTMPKKTPLEAMCKPR  220



>ref|XP_004292745.1| PREDICTED: isoflavone 2'-hydroxylase-like [Fragaria vesca subsp. 
vesca]
Length=523

 Score =   174 bits (441),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 143/212 (67%), Gaps = 8/212 (4%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AG++T+S T+EW +SLLL+ PE L K R EIDN +G   L+ ESDL+ LPYL+C+I
Sbjct  318  IMLTAGSDTSSGTMEWGLSLLLNNPEALAKARTEIDNRIGQSRLIEESDLANLPYLQCII  377

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLR+YP  PLL PH S EDC V GY VP+ T ++VN WA+ +DP++W EPE+FKPERF
Sbjct  378  NETLRMYPATPLLPPHESSEDCTVGGYHVPRGTMLLVNVWAIQNDPRLWAEPEQFKPERF  437

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKED--KILC  241
            + + GE  +GF +  +PFG GRR C    +  R+V LALG+ +QCF+WK   E+   I  
Sbjct  438  QNVQGER-DGFMW--LPFGAGRRGCAGEGLAYRVVGLALGSLVQCFEWKRPSEEMIDISV  494

Query  240  ATYLSPSILQKDERLEAICTPRKNCLQFLSQL  145
             T L+   + K + L A C PR   L  LSQL
Sbjct  495  GTGLT---MHKVQPLLAKCRPRPTMLALLSQL  523



>ref|XP_011069764.1| PREDICTED: cytochrome P450 81E8-like isoform X1 [Sesamum indicum]
Length=510

 Score =   174 bits (440),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 142/210 (68%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T++ T+EWA+SLLL++P VL K + EIDN++GH  L++ESD+++LPYLRC++
Sbjct  305  VLLIAGTDTSAGTMEWALSLLLNHPHVLKKAQLEIDNHIGHDRLIDESDIAELPYLRCIL  364

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYP  PLL+PH S E C V GY VP  T ++VN WA+H+DPK WE+  +FKPERF
Sbjct  365  NETLRLYPAGPLLVPHESSEQCTVGGYRVPAGTMLLVNVWAIHNDPKNWEDAREFKPERF  424

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E   G EG    +K +PFG+GRR CP   + +R+V   L + IQCFDW    ++ I    
Sbjct  425  E---GLEGNRDGFKLMPFGSGRRGCPGEALAVRMVGFGLASMIQCFDWGRVGKELIDMTE  481

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
             L  S + K E L A C  R    + LSQ+
Sbjct  482  GLGLS-MPKAEPLLAYCKSRPVAAKLLSQI  510



>ref|XP_008220355.1| PREDICTED: cytochrome P450 81D11-like [Prunus mume]
Length=208

 Score =   166 bits (421),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 136/200 (68%), Gaps = 3/200 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            +V  AGT+T++ TI WAM+LLL++PE + K+R EI+  VG K  L E D  KL YL+ VI
Sbjct  7    VVLGAGTDTSATTIGWAMALLLNHPEKMQKVRAEIETKVGEKCALEEQDFPKLSYLQNVI  66

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETL LYPP PLLLPH + EDCVV G+DVP+HT + +NAWA+H DP++WE+P +F+PERF
Sbjct  67   NETLLLYPPTPLLLPHEASEDCVVGGFDVPRHTMLFINAWAIHRDPELWEDPTEFRPERF  126

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E   G+  EG  YK +  G GRR CP   +  +L+ LALG  IQ FDW+   ED +    
Sbjct  127  EGWSGDGSEG--YKLITLGAGRRGCPGAGLANKLIVLALGNLIQSFDWERIGEDDVDMTE  184

Query  234  YLSPSILQKDERLEAICTPR  175
             L  + + + E LEA+C PR
Sbjct  185  GLGLN-MPRAEPLEAMCKPR  203



>ref|XP_010059864.1| PREDICTED: isoflavone 2'-hydroxylase-like [Eucalyptus grandis]
 gb|KCW66313.1| hypothetical protein EUGRSUZ_F00139 [Eucalyptus grandis]
Length=504

 Score =   174 bits (440),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 139/209 (67%), Gaps = 4/209 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T++ TIEWAMS +L++PE+L K + EID  VGH  L+ ESDL KL YL CV+
Sbjct  299  VLLSAGTDTSAATIEWAMSAMLNHPEILKKAQAEIDEVVGHNRLITESDLPKLLYLHCVM  358

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NET+R+YP  PLL+PH S E+C V GY VP+ T +++N +++ +DPK W +  KFKPER 
Sbjct  359  NETMRMYPVGPLLVPHESAEECCVGGYRVPQGTMLLINLFSIQNDPKYWPDAAKFKPER-  417

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                G EG    YK +PFG+GRR CP  N+ LR+V L LG+ IQCF+W N   D+++  T
Sbjct  418  --FQGMEGVRDGYKMMPFGSGRRGCPGENLALRMVGLTLGSLIQCFEW-NRISDELIDMT  474

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQ  148
              +   + K + L A C PR   L  LSQ
Sbjct  475  EGTGLTMPKAQPLLAKCRPRSFTLDLLSQ  503



>ref|XP_009372454.1| PREDICTED: isoflavone 2'-hydroxylase-like [Pyrus x bretschneideri]
Length=499

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 144/208 (69%), Gaps = 6/208 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T++VT+EWAMS LL++P VL K   E+D  VG ++L++E D+SKLPYL+ +I
Sbjct  298  VMLLAGTDTSAVTLEWAMSNLLNHPRVLQKANSELDAKVGRENLVDEPDISKLPYLQSII  357

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRL P AP+L+PH S +DC++ G+DVP+ T V+VNAWA+H DP++W+EPE FKPERF
Sbjct  358  SETLRLCPAAPMLVPHLSSDDCIIGGFDVPRDTMVLVNAWAVHRDPELWDEPESFKPERF  417

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                 E GE F++K +PFG GRRACP   +  R+V   LG+ IQCFDW    E+ ++  T
Sbjct  418  -----ESGEDFSHKLIPFGMGRRACPGAGLAQRVVGFTLGSLIQCFDWNRVGEE-MVDMT  471

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLS  151
                +   K   LEA+C  R    + LS
Sbjct  472  EGKGTTTPKAIPLEAMCKARPIVSKVLS  499



>ref|XP_004231887.1| PREDICTED: cytochrome P450 81D1-like [Solanum lycopersicum]
Length=500

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 147/209 (70%), Gaps = 6/209 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGTET+SVTIEWAMSLLL++PEVL K R EIDN+VG   L++E+DL KL YL+ +I
Sbjct  296  VMLNAGTETSSVTIEWAMSLLLNHPEVLEKARNEIDNHVGKDRLMDEADLPKLKYLQSII  355

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRL+P APLL+PH S EDC VAG+ +P+ T ++VNAW++H DP +WE+PE FKPERF
Sbjct  356  SETLRLFPAAPLLVPHESSEDCKVAGFHIPRGTMLLVNAWSIHRDPLLWEDPESFKPERF  415

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
              +  E     ++K +PFG GRRACP + +  R+V LALG  +QCF+WK   ++K+   T
Sbjct  416  YGVEVE-----SWKLLPFGMGRRACPGSGLAQRVVGLALGTLVQCFEWKRVSDEKV-DLT  469

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQ  148
                  + K E L A C  R+   + LS+
Sbjct  470  EGKGLTMPKAEPLMARCKAREIVHKVLSE  498



>ref|XP_004290943.1| PREDICTED: cytochrome P450 81D11-like [Fragaria vesca subsp. 
vesca]
Length=505

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 130/211 (62%), Gaps = 6/211 (3%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            Q++  AGT+T++  +EW +SLLL+ PE L K + EID  +G   L+ ESDL+ LPYL C+
Sbjct  301  QIMLTAGTDTSAGNMEWTLSLLLNNPEALAKAQTEIDTKIGQSRLIVESDLANLPYLHCI  360

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            I ET  L    P  + H S ED  V G++VP+ T +++NAWA+HHDPK+W E  +     
Sbjct  361  IRET--LRMYPPATILHESSEDSTVGGFNVPRGTMLIMNAWAIHHDPKLW-EQPEQFKPE  417

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
               I  EE +GF  K++PFGTGRR CP   +  R+V LA+G+ IQCF+W+ + E+ +   
Sbjct  418  RFQIEQEERDGF--KYMPFGTGRRGCPGEGLANRIVGLAIGSVIQCFEWERSGEEMVDMT  475

Query  237  TYLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                 +I  K   L A C PR+  L FLSQL
Sbjct  476  EGTGLTIF-KAHPLLAKCRPRQTMLPFLSQL  505



>ref|XP_006472256.1| PREDICTED: isoflavone 2'-hydroxylase-like [Citrus sinensis]
Length=507

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 146/211 (69%), Gaps = 3/211 (1%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            Q++  AG++T++ T+EWA+S LL+ PE+L + + EID NVG   L+ ESDL+ LPYL  V
Sbjct  300  QVLLGAGSDTSAATMEWALSSLLNNPEILVQAQSEIDTNVGQSRLIEESDLTALPYLHGV  359

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            I ETLR+YP APLL+PH S E+C + G+ VP+ T ++VN+WA+ +DP++WEEP KFKPER
Sbjct  360  IKETLRMYPAAPLLVPHESSEECTIGGFKVPRGTMLLVNSWAIQNDPRIWEEPSKFKPER  419

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
            F  + G+  +   Y  +PFGTGRR CP   + +RLV LALG+ +QCF+W  T  D+++  
Sbjct  420  FREMAGKSDK---YMLLPFGTGRRVCPGEGLAMRLVGLALGSLVQCFEWVRTGGDELVDM  476

Query  237  TYLSPSILQKDERLEAICTPRKNCLQFLSQL  145
            +  +   + + + L A+C PR   +  LSQL
Sbjct  477  SEGTGLTMPRSQPLLAMCRPRPAMVTLLSQL  507



>emb|CDP01236.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 145/210 (69%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AG++TT+ T+EWAM+ LL  PEVL K + EID  VGH   + E DL +LPYL C+I
Sbjct  298  VLLQAGSDTTASTMEWAMAYLLDNPEVLKKAQAEIDQEVGHGRFIGECDLPQLPYLHCII  357

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRL P  PLL+PH + +DC+V GY VP+ T + VNAW + H+ + W++P+KF P+RF
Sbjct  358  NETLRLQPVTPLLMPHKASQDCIVGGYRVPRGTVLFVNAWDIQHNSRYWDDPDKFMPQRF  417

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            EA+VG + E   +KF+PFG+GRR CP NN+ + ++ LALG+ +Q F+W+ TK+ K +  +
Sbjct  418  EALVGGKEE---FKFIPFGSGRRGCPGNNLAIHVLGLALGSLLQSFNWE-TKDGKKMDMS  473

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                  + + + L A C PR N L+ LSQ+
Sbjct  474  EGIGVPVHRVQPLVAKCCPRPNMLKLLSQI  503



>ref|XP_004290944.1| PREDICTED: cytochrome P450 81D11-like [Fragaria vesca subsp. 
vesca]
Length=505

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 144/211 (68%), Gaps = 5/211 (2%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            Q++  AG++T++ T+EWA+SLLL+ PE L K + EID  +G   L+ ESDL+ LPYL C+
Sbjct  300  QVMLSAGSDTSAGTMEWALSLLLNNPEALAKAQTEIDEKIGKSRLIEESDLANLPYLHCI  359

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            I+ETLR+  PA L+ PH S EDC V G++VP+ T ++VNAWA+HHDPK+WE PE+FKPER
Sbjct  360  ISETLRMCSPAALIPPHESSEDCTVGGFNVPRGTMLLVNAWAIHHDPKLWEHPEQFKPER  419

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
            F+    +E + F Y  +PFG GRR CP   +  R+V LALG+ IQCF+W+   E+ ++  
Sbjct  420  FQN--AQERDVFMY--LPFGIGRRGCPGEGLANRIVGLALGSVIQCFNWERNGEE-MVDM  474

Query  237  TYLSPSILQKDERLEAICTPRKNCLQFLSQL  145
            T  +   + K   L A C+PR   L  LSQL
Sbjct  475  TEGTGLAMPKAHPLLAKCSPRPTMLALLSQL  505



>ref|XP_012082300.1| PREDICTED: cytochrome P450 81E8-like [Jatropha curcas]
 gb|KDP45416.1| hypothetical protein JCGZ_09665 [Jatropha curcas]
Length=506

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 138/206 (67%), Gaps = 6/206 (3%)
 Frame = -1

Query  762  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINETl  583
             GTET+SVT+EWAMSLLL+ PEVL K R E+D  +G   L++ESD SKLPYL+ +INETL
Sbjct  307  GGTETSSVTMEWAMSLLLNNPEVLKKARAELDEIIGQDRLVDESDFSKLPYLQSIINETL  366

Query  582  rlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfEAIV  403
            RLYP AP L+PH S +DC + GY VP+ T ++VNAWA+H DP VW +P KFKPERFE + 
Sbjct  367  RLYPVAPFLVPHESSDDCTIGGYYVPRGTMLLVNAWAIHRDPTVWSDPTKFKPERFEGLG  426

Query  402  GEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSP  223
             E      YK +PFG GRRACP   +  R++ LAL   I CF+W    E+ ++  T  + 
Sbjct  427  NEA-----YKLIPFGVGRRACPGAGLANRVMGLALAELIHCFEWGRPSEE-LIDMTEGTG  480

Query  222  SILQKDERLEAICTPRKNCLQFLSQL  145
              + K + LEA+C  R++ +  L  L
Sbjct  481  GTMPKSQPLEAMCRARESMINILQDL  506



>ref|XP_007224527.1| hypothetical protein PRUPE_ppa024021mg, partial [Prunus persica]
 gb|EMJ25726.1| hypothetical protein PRUPE_ppa024021mg, partial [Prunus persica]
Length=469

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/212 (48%), Positives = 144/212 (68%), Gaps = 6/212 (3%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            Q++  AGTET++ T+EWA+SLLL+ PE L K + EID  +G   L+ E+D ++LPYL  +
Sbjct  263  QVMLSAGTETSAGTMEWALSLLLNNPEALAKAQTEIDIEIGQSRLIEEADFARLPYLHGI  322

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            INETLR+YP  P+L+PH S E+C V GY VP+ T ++VN WA+ ++PK+W +P++FKPER
Sbjct  323  INETLRMYPADPMLVPHESSEECTVGGYHVPRGTMLLVNMWAIQNNPKLWSQPKQFKPER  382

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
            F  + GE  +GF    +PFGTGRR CP   + +R+V LALG+ +QCF+W+   E+K+  +
Sbjct  383  FLNVQGER-DGF--MLLPFGTGRRGCPGEGLAIRMVGLALGSLVQCFEWERIGEEKVDMS  439

Query  237  TYLSPSI-LQKDERLEAICTPRKNCLQFLSQL  145
                P + + K   L A C PR   L  LSQL
Sbjct  440  E--GPGLTMPKAHPLLAKCRPRPKMLALLSQL  469



>ref|XP_010911513.1| PREDICTED: cytochrome P450 81D11-like [Elaeis guineensis]
Length=358

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 139/209 (67%), Gaps = 5/209 (2%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AG  TT+ T EW MSLLL+ PE L K+R EID  VG++ LL ESDLS LP+L+CVI 
Sbjct  155  LLGAGVGTTAETTEWVMSLLLNNPEALKKMRDEIDAQVGNERLLEESDLSNLPHLQCVIT  214

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLR+YP +PLLLPH S +DC V G+ +P+   ++VNA+A+H DPKVWEEP KF PERF 
Sbjct  215  ETLRMYPTSPLLLPHESSQDCSVGGFHIPRGMMLLVNAYAVHRDPKVWEEPTKFMPERF-  273

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
                E G+G     +PFG GRR CP   + +R+V LALG  IQCF+W+   ++++   T 
Sbjct  274  ----EGGKGEGKLMLPFGMGRRRCPGEGLAMRVVGLALGTLIQCFEWEGIGKEEVDMTTQ  329

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
             S   L K   LEA+  PR++ L  L +L
Sbjct  330  GSGLTLAKAIPLEAMYRPRQSMLDALKKL  358



>ref|XP_010491736.1| PREDICTED: isoflavone 2'-hydroxylase-like [Camelina sativa]
Length=500

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 148/210 (70%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AG++T+ VT+EWAMSLLL++P  L K+R EI +NV HK L+ +SDLS LPYLRCVI
Sbjct  295  LMFNAGSDTSPVTMEWAMSLLLNHPYQLQKVREEIKSNVKHKGLIQDSDLSSLPYLRCVI  354

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             ETLRLYP APLL PH S +   +  Y++P++T ++VNAWA+H D ++WEE + FKPERF
Sbjct  355  YETLRLYPAAPLLPPHCSSKKFKLGNYEIPENTVLLVNAWAVHRDSELWEEADVFKPERF  414

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E  VG+  +GF  +F+PFG GRRACPA  + +RLVSL +GA +QCF+WK  + + I    
Sbjct  415  EGFVGDR-DGF--RFLPFGVGRRACPAAGLAMRLVSLVVGALVQCFEWKKVENEDIDMRP  471

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
              S + + + E L A+  P    +  LSQL
Sbjct  472  AFSVA-MSRAEPLAALPKPWPEMVPILSQL  500



>ref|XP_007018554.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY15779.1| Cytochrome P450 [Theobroma cacao]
Length=499

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 143/211 (68%), Gaps = 6/211 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T++ T+EWAMS LL++PEVL K + E+D  VG   L++ESDL  LPYL C+I
Sbjct  294  VLLLAGTDTSAGTLEWAMSFLLNHPEVLEKAQTEMDTVVGQARLMDESDLVNLPYLHCII  353

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             ET+R+ P  PLL+PH S +DCVV GY +P  T +MVN WA+H+DP  WEEP KFKPERF
Sbjct  354  RETMRIKPVGPLLIPHESSKDCVVGGYHIPCGTMLMVNLWAIHNDPNNWEEPTKFKPERF  413

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E   G EG    +KF+PFG+GRR+CP   + +R+V L LG+ IQCF W+   ++ +    
Sbjct  414  E---GLEGTKVGFKFMPFGSGRRSCPGEGLAMRMVGLTLGSLIQCFHWERIGKEMVDMTE  470

Query  234  YLSPSI-LQKDERLEAICTPRKNCLQFLSQL  145
               P + + K + L+A C PR+  +  LSQ+
Sbjct  471  --GPGLTMPKAQPLQAKCRPRQPMVNLLSQI  499



>ref|XP_002285061.2| PREDICTED: cytochrome P450 81E8-like [Vitis vinifera]
Length=510

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 144/209 (69%), Gaps = 6/209 (3%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+T++VT+EWAMSLLL++P VL K++ E+D  +GH+ L+ E DLS LPYLR ++N
Sbjct  308  LLTAGTDTSAVTMEWAMSLLLNHPTVLDKVKTELDCKIGHQRLVEEPDLSDLPYLRAIVN  367

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRL+P APLL+ H S +DC + GYDV   T ++VNAWA+H D KVWE+P  F+PERF 
Sbjct  368  ETLRLFPAAPLLVAHESSDDCSIGGYDVRGGTMLLVNAWAIHRDAKVWEDPTSFRPERF-  426

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
                E GEG   +F+PFG GRR CP   +  R++ LAL A +QCF+W+   E ++  +  
Sbjct  427  ----EGGEGEACRFIPFGLGRRGCPGAGLANRVMGLALAALVQCFEWQRVGEVEVDMSEG  482

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
               + + K + LEA+C  R + ++ LS+L
Sbjct  483  KGLT-MPKAQPLEAMCRARNSMIKVLSEL  510



>gb|KFK25349.1| hypothetical protein AALP_AA8G101100 [Arabis alpina]
Length=494

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 150/210 (71%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AGT+T+++T+EWAMS+LL++P+ L K+R EI  NV H  ++ +SDLS+LPYLRCVI
Sbjct  289  LMFNAGTDTSALTMEWAMSVLLNHPDKLEKVREEIKANVKHNGIVQDSDLSRLPYLRCVI  348

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             ETLRLYP APLLLPHYS +   +  Y++P++T ++VNAWA+H D + WE+ + FKPERF
Sbjct  349  YETLRLYPVAPLLLPHYSSKRFSLGNYEIPENTMLLVNAWAVHRDGEFWEDADVFKPERF  408

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E  VG+  +GF  +F+PFG GRRACPA  +G+R+V+LA+GA +QCF+W+  +E  I    
Sbjct  409  EGFVGDR-DGF--RFLPFGVGRRACPAAGLGMRVVALAVGALVQCFEWEKVEEGDIDMRP  465

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                  + K E L A+  P    +  LSQL
Sbjct  466  LFGVG-MSKAEPLVALPKPWPEMVPILSQL  494



>ref|XP_004509096.1| PREDICTED: isoflavone 2'-hydroxylase-like [Cicer arietinum]
Length=506

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 136/207 (66%), Gaps = 7/207 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++   GTET++ T+EWAMS LL++PE+L+K R EID N+G   L+ ESD+S LPYL+ +I
Sbjct  295  VMLLGGTETSATTLEWAMSALLNHPEILNKAREEIDTNIGLDRLVEESDISNLPYLQNII  354

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NET RL+P   LL PH+S +DC + GY+VP+ T ++VNAWA+H D K+W +P +FKPERF
Sbjct  355  NETFRLHPAFALLAPHFSSKDCTIGGYNVPQGTILLVNAWAIHRDSKLWNDPTQFKPERF  414

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                  E EG   K +PFG GRRACP  ++G R V L L  +IQCF+WK   E +I   T
Sbjct  415  ------EKEGETDKLIPFGLGRRACPGASLGQRTVGLTLALFIQCFEWKRISEKEI-DMT  467

Query  234  YLSPSILQKDERLEAICTPRKNCLQFL  154
                +   K   LEA+C  R N +  L
Sbjct  468  EGKGATTPKLIPLEAMCKARSNVINKL  494



>ref|XP_008367651.1| PREDICTED: cytochrome P450 81D11-like [Malus domestica]
Length=508

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 143/201 (71%), Gaps = 4/201 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKH-LLNESDLSKLPYLRCV  598
            ++  AGT+TTS  ++WAM+LLL++P+ + KLR EID  +G  H +L E DL  L YL+ V
Sbjct  304  VLLVAGTDTTSTALQWAMALLLNHPDAMEKLRAEIDTKIGPDHRVLKEQDLPNLSYLQNV  363

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            INET RLYP  P+L+PH + EDCVV G+DVP+HT +++NAWA+H +P++WE+PEKFKPER
Sbjct  364  INETHRLYPSFPILVPHENSEDCVVGGFDVPRHTMLVINAWAIHRNPEIWEDPEKFKPER  423

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
            FE   GE  EG  YK +PFG GRR CP   +  RL+ LALG+ +Q F+W+   E+++  +
Sbjct  424  FEGWSGEGSEG--YKLIPFGAGRRGCPGAGLANRLIGLALGSLVQSFEWERIGEEEVDMS  481

Query  237  TYLSPSILQKDERLEAICTPR  175
              L  + + + + LEAIC PR
Sbjct  482  EGLGLT-MPRVKPLEAICKPR  501



>gb|KHG05117.1| Isoflavone 2'-hydroxylase [Gossypium arboreum]
Length=501

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 142/211 (67%), Gaps = 6/211 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T+S TIEWAMS LL++P+VL+K R EID  VG   L+ ESDL  LPYL C+I
Sbjct  296  VLLLAGTDTSSGTIEWAMSFLLNHPQVLNKARIEIDTVVGQNRLIEESDLPNLPYLHCII  355

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NET R+ P  PLL+PH S ++C+V GY +P+ T ++VNAWA+ +DP  WEEP  FKPERF
Sbjct  356  NETFRIKPTGPLLVPHESSKECLVGGYRIPRGTMLLVNAWAIQNDPNNWEEPNVFKPERF  415

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E   G +   F ++ +PFG GRR CP   + +R+V L LG+ IQCF+W+   E+ +  + 
Sbjct  416  E---GLDPSNFAFRLMPFGNGRRRCPGEGLAMRMVGLTLGSLIQCFEWERKGEEMVDMSE  472

Query  234  YLSPSI-LQKDERLEAICTPRKNCLQFLSQL  145
               P + + K + L+A C PR+  +  LSQ+
Sbjct  473  --GPGLTMPKAQPLQAKCRPRQPFVPLLSQI  501



>ref|XP_011099312.1| PREDICTED: cytochrome P450 81E8-like [Sesamum indicum]
 dbj|BAE48234.1| cytochrome P450 [Sesamum indicum]
Length=506

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 139/209 (67%), Gaps = 6/209 (3%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+ + VT EWAMSLLL++P+VL K R E+D  VGH+ +++E DL KL YL C++ 
Sbjct  301  LIIAGTDASVVTTEWAMSLLLNHPKVLEKARKELDTLVGHERMVDEHDLPKLRYLHCIVL  360

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRL+P  P L+PH   EDC + GY+VPK T V+VNAWA+H DPKVW++P  FKP+RFE
Sbjct  361  ETLRLFPSVPTLVPHEPSEDCKIGGYNVPKGTMVLVNAWAIHRDPKVWDDPLSFKPDRFE  420

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
             +  E      +K +PFG GRRACP   +  + V LALG+ IQCFDW+ T  +KI     
Sbjct  421  IMEVE-----THKLLPFGMGRRACPGAGLAQKFVGLALGSLIQCFDWERTSPEKIDLNEG  475

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
             S   L K + LEA+C PR    + L Q+
Sbjct  476  -SGITLPKAKTLEAMCKPRHVMEKVLRQV  503



>ref|NP_001269247.1| isoflavone 2'-hydroxylase-like [Cicer arietinum]
 emb|CAB43505.1| cytochrome P450 [Cicer arietinum]
Length=499

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 140/196 (71%), Gaps = 6/196 (3%)
 Frame = -1

Query  762  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINETl  583
            AGTET+SVT+EWAMS LL++PE+L K + E+DN++G +HL+ E++ +KL YL+ +I+ETL
Sbjct  302  AGTETSSVTLEWAMSNLLNHPEILEKAKIELDNHIGQEHLIEEAEATKLQYLQNIISETL  361

Query  582  rlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfEAIV  403
            RL+PP  +LLPH S  DC + GYDVP++T +MVNAWA+H DP +W +P  FKPERF    
Sbjct  362  RLHPPVTMLLPHLSSHDCTIGGYDVPRNTMLMVNAWAIHRDPNLWADPMSFKPERF----  417

Query  402  GEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSP  223
             E G+G    F+PFG GRRACP + + LR + L LG+ IQCF+WK   ++++  +   S 
Sbjct  418  -ENGQGDIGGFIPFGMGRRACPGSGLALRTLGLTLGSLIQCFEWKRIGKEEVDMSEG-SG  475

Query  222  SILQKDERLEAICTPR  175
            +++ K   LEA C  R
Sbjct  476  TVVPKAIPLEAQCKAR  491



>ref|XP_009151853.1| PREDICTED: cytochrome P450 81D11 [Brassica rapa]
Length=499

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 142/200 (71%), Gaps = 6/200 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T++ T++WAMS LL++PEVL K + EID  +G   L+   D+ KLPYL+ ++
Sbjct  293  VMILAGTDTSAATLDWAMSNLLNHPEVLKKAKTEIDEQIGSDRLIEGQDIVKLPYLQSIV  352

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRLYP  P+L+PH + EDC+VAGYDVP+ T ++VN WA+H DP++WEEPEKFKPERF
Sbjct  353  SETLRLYPVVPMLVPHMASEDCMVAGYDVPRGTNLLVNVWAIHRDPEMWEEPEKFKPERF  412

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                  E EG + K +PFG GRRACP   + LRLV+LALG+ +QCF+W+   E+ +  + 
Sbjct  413  ------EKEGEDKKLMPFGMGRRACPGLGLALRLVTLALGSLVQCFEWERAGEEYVDMSE  466

Query  234  YLSPSILQKDERLEAICTPR  175
                  L++   LEA+C PR
Sbjct  467  DEKGITLRRATLLEAVCRPR  486



>ref|XP_011029079.1| PREDICTED: cytochrome P450 81D1-like [Populus euphratica]
Length=499

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/207 (46%), Positives = 137/207 (66%), Gaps = 6/207 (3%)
 Frame = -1

Query  762  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINETl  583
            AGT T+S T+EWA+SLLL+ PEVL K + EID  +GH   ++E+DL+ LPYLR +++ETL
Sbjct  298  AGTHTSSTTMEWALSLLLNNPEVLEKAQREIDEQIGHDRFMDEADLAHLPYLRSILSETL  357

Query  582  rlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWee-pekfkperfEAI  406
            R+YP APLL+PH S E+C+V G+ +P+ T + VNAWA+ +DPK+W +  +          
Sbjct  358  RMYPAAPLLVPHESSEECLVGGFRIPRGTMLFVNAWAIQNDPKIWSDPEKFRPERFDNPE  417

Query  405  VGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLS  226
            V  +G    +K +PFG GRR+CP   M LR++ LALG+ +QCF+W+    DK++  T   
Sbjct  418  VARDG----FKLMPFGYGRRSCPGEAMALRVMGLALGSLLQCFEWQKIG-DKMVDMTEAL  472

Query  225  PSILQKDERLEAICTPRKNCLQFLSQL  145
               + K + LE IC PR   L+ LSQ+
Sbjct  473  GFTVPKAKPLEVICRPRPGMLRHLSQI  499



>ref|XP_002524941.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF37438.1| cytochrome P450, putative [Ricinus communis]
Length=503

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 142/208 (68%), Gaps = 5/208 (2%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+T++VT+EWAM+ LL++P  L K + EID+ VG   LL+E DLS+LPYLR ++ 
Sbjct  299  LLFAGTDTSAVTLEWAMTNLLNHPSTLMKAKDEIDSQVGRDSLLDEPDLSRLPYLRNIVL  358

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRLYP APLL+PH S EDC + GY VP+ T V+VNAWA+H DP +W+EP  FKPERF+
Sbjct  359  ETLRLYPVAPLLIPHVSSEDCTIGGYKVPRDTMVLVNAWAIHRDPTLWDEPLSFKPERFD  418

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
               GEE E F  K +PFG GRR+CP   +  R++SL LG+ IQCF+WK   ED++     
Sbjct  419  N--GEESESF--KLLPFGLGRRSCPGAGLAHRVISLTLGSLIQCFEWKRVSEDEVDVKEG  474

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQ  148
               + L K E LEA+C       + LSQ
Sbjct  475  RGLT-LPKAEPLEALCRSHPIMNKILSQ  501



>emb|CDY47253.1| BnaA02g29390D [Brassica napus]
Length=502

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 140/201 (70%), Gaps = 6/201 (3%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            +++  AGT+T++ T+EWAMS LL++PEVL K + EID  +G   L+ E D+ KLPYL+ +
Sbjct  294  EVMILAGTDTSAATLEWAMSNLLNHPEVLKKAKTEIDEQIGLDRLIEEQDIVKLPYLQSI  353

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            + ETLRLYP  P+LLPH + +DC+VAGYDVP+ T ++VN WA+H DPK+WEEPEKFKPER
Sbjct  354  VAETLRLYPVVPMLLPHMASKDCMVAGYDVPRKTILLVNVWAIHRDPKMWEEPEKFKPER  413

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
            F      E EG + K + FG GRRACP   +G RLV+LALG+ +QCF+W+ T E+ +   
Sbjct  414  F------EKEGEDKKLMSFGMGRRACPGLGLGQRLVTLALGSLVQCFEWERTGEEYVDMT  467

Query  237  TYLSPSILQKDERLEAICTPR  175
                   + K   LEA+C  R
Sbjct  468  EAAKGITMHKSTSLEAMCRTR  488



>ref|XP_008220288.1| PREDICTED: isoflavone 2'-hydroxylase-like [Prunus mume]
Length=507

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 143/212 (67%), Gaps = 6/212 (3%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            Q++  AGTET+S T+EWA+SLLL+ PE L K + EID ++G   L+ ESDL KLP+L  +
Sbjct  301  QVMLAAGTETSSGTMEWALSLLLNNPEALVKAQSEIDIHIGQSRLIEESDLGKLPHLHGI  360

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            INETLR+YP  PLL+PH S +DC V G+DVP+ T ++VN WA+ ++PK+W +P +F+PER
Sbjct  361  INETLRMYPAGPLLVPHESSDDCTVGGFDVPRGTMLLVNIWAIQNNPKLWSQPAQFRPER  420

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
            F  + GE  +GF    +PFGTGRR CP   +  R++ LALG+ IQCFDW+   E+ +  +
Sbjct  421  FLNVQGER-DGF--LLLPFGTGRRGCPGEGLANRILGLALGSLIQCFDWERIGEEMVDMS  477

Query  237  TYLSPSI-LQKDERLEAICTPRKNCLQFLSQL  145
                P + + K   L A C PR   L  LSQL
Sbjct  478  E--GPGLTMPKAHPLLAKCRPRPTMLNLLSQL  507



>ref|XP_008220356.1| PREDICTED: cytochrome P450 81D11-like [Prunus mume]
Length=491

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 142/204 (70%), Gaps = 1/204 (0%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AG++T+S T+EWAM+LLL++PE + K+R EI+  VG K  L E DL KL YL+ VI
Sbjct  286  LMLVAGSDTSSTTLEWAMALLLNHPEEMEKVRDEIETKVGEKRALEEQDLPKLCYLQNVI  345

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYPP P+L+P  + EDCVV G+DVP+H  ++VNAWA+H DP+VWE+P KFKPERF
Sbjct  346  NETLRLYPPFPILVPREAPEDCVVGGFDVPRHAMLVVNAWAIHRDPEVWEDPTKFKPERF  405

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E  + E G    Y+ +PFG GRR CP   +  RLV LALG+ +Q F+W+   ED +  + 
Sbjct  406  ERWISEGGLEGGYRVIPFGAGRRGCPGAGLANRLVELALGSLVQSFEWERIGEDMVDMSE  465

Query  234  YLSPSILQKDERLEAICTPRKNCL  163
             L   ++ + + LEA+C PR   L
Sbjct  466  GLG-LMMPRVKPLEAMCKPRPFTL  488



>ref|XP_002510130.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52317.1| cytochrome P450, putative [Ricinus communis]
Length=500

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 141/210 (67%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T++ T+EWAMSLL++ PE L K + EID+ +GH  L+NESD SKLPYL C+I
Sbjct  295  VLLAAGTDTSAATMEWAMSLLVNNPEALKKAQTEIDSVIGHDRLINESDTSKLPYLNCII  354

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NE +R+YP  PLL+PH S E+C + GY VP  T ++VN W++ +DP+VWEEP  FKPER 
Sbjct  355  NEVMRMYPAGPLLVPHESSEECFIGGYRVPAGTMLLVNLWSIQNDPRVWEEPRNFKPER-  413

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                G EG    ++ +PFG+GRR+CP   + LR+V L +G  +QCFDW+   ++ I    
Sbjct  414  --FEGCEGVRDGFRLMPFGSGRRSCPGEGLALRMVGLGIGTLLQCFDWERVGKEMIDMTE  471

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
             +  + + K + L   C+PR + +  LSQL
Sbjct  472  GVGLT-MPKAQPLVVQCSPRPSMVNLLSQL  500



>ref|XP_007227313.1| hypothetical protein PRUPE_ppa016513mg, partial [Prunus persica]
 gb|EMJ28512.1| hypothetical protein PRUPE_ppa016513mg, partial [Prunus persica]
Length=497

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 130/176 (74%), Gaps = 2/176 (1%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T+S T+EWAM+LLL++PE + K+R EID  VG + LL E DL KL YL+ VI
Sbjct  306  VMLVAGTDTSSATLEWAMALLLNHPEAMEKVRAEIDTKVGQERLLEEQDLPKLTYLQNVI  365

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYPP PLL+PH + EDCVV G+DVP+HT + +NAWA+H DP++WE+P KFKPERF
Sbjct  366  NETLRLYPPTPLLVPHEASEDCVVRGFDVPRHTMLFINAWAIHRDPELWEDPTKFKPERF  425

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  247
            E   GE  EG  YK + FG GRR CP   +  RLV LALG+ +Q F+W+   E+ +
Sbjct  426  EGWSGEGSEG--YKLIAFGAGRRGCPGAGLASRLVRLALGSLVQSFEWERIGEENV  479



>ref|XP_008452620.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 81D1-like [Cucumis 
melo]
Length=516

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 142/209 (68%), Gaps = 4/209 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGTET+   +EWA+SLLL++PE+L K + EIDN VG++  + ESD+++LPYLR +I
Sbjct  305  LMLVAGTETSGSIMEWALSLLLNHPEILKKAQIEIDNQVGNQRPIEESDMARLPYLRGII  364

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLR+YPPAPLL+PH S +DC V GY VP+ T + +N WA+ +DPK+W  P++F P+RF
Sbjct  365  NETLRMYPPAPLLVPHESSQDCSVGGYHVPRGTMLYINIWAIQNDPKIWAHPKEFDPDRF  424

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
              +   E E + +  +PFG GRR CP   +GLR++ L LG+ IQCF+W+   E+ +    
Sbjct  425  NDV---ESEKYKFNLMPFGLGRRGCPGEGLGLRMIGLVLGSLIQCFEWERPTEELVDLTE  481

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQ  148
             ++ + + K + L A C PR   +  L Q
Sbjct  482  GIAIT-MPKAQNLHAKCRPRPMIVNILPQ  509



>ref|XP_011099320.1| PREDICTED: cytochrome P450 81D1-like [Sesamum indicum]
Length=502

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 137/205 (67%), Gaps = 6/205 (3%)
 Frame = -1

Query  762  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINETl  583
            AGT+T++VTIEWAMSLLL++PEVL K + EID+ VGH+ L+ E DL  LPYL  +I ET 
Sbjct  298  AGTDTSAVTIEWAMSLLLNHPEVLQKAKLEIDSRVGHQRLVEEQDLPNLPYLHSIIFETF  357

Query  582  rlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfEAIV  403
            RL+P  PL++P  S  DC V GYD+P  T ++VNAWA+H DPKVW +P  FKPER     
Sbjct  358  RLFPAGPLVVPRESSADCRVGGYDIPCGTMLLVNAWAIHRDPKVWPQPTSFKPERL----  413

Query  402  GEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSP  223
             +  E   +K +PFG GRRACP   +G R+V LAL ++IQCF+W+    +++     +  
Sbjct  414  -DRREVETHKLMPFGLGRRACPGAGLGQRMVGLALASFIQCFEWERVSSEEVDLTEGVGL  472

Query  222  SILQKDERLEAICTPRKNCLQFLSQ  148
            + + K + LEA C PR+  L+ L +
Sbjct  473  T-MPKLKPLEAKCRPRQIMLKVLQE  496



>ref|XP_012079327.1| PREDICTED: cytochrome P450 81E8-like [Jatropha curcas]
 gb|KDP32013.1| hypothetical protein JCGZ_12474 [Jatropha curcas]
Length=505

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 147/211 (70%), Gaps = 11/211 (5%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            M+F AGT+T++VT+EWAMS LL++P +L+K R EI+  +G   LL+ESD SKLPYL+ +I
Sbjct  302  MIF-AGTDTSAVTLEWAMSNLLNHPSILNKARDEIETQIGEDCLLDESDFSKLPYLKNII  360

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +E+LRLYP APLL PH S +DC + GY+VP+ T ++VNAWA+H DP +W++P  FKPERF
Sbjct  361  SESLRLYPAAPLLAPHMSSDDCTIGGYNVPRGTMLLVNAWAIHRDPTLWDDPLSFKPERF  420

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI--LC  241
                 + GEG ++K +PFG GRR+CP   +  R+V LALG  IQCF+WK   E+++  + 
Sbjct  421  -----DNGEGESFKLMPFGLGRRSCPGAGLANRVVGLALGTLIQCFEWKRVTEEEVDMVE  475

Query  240  ATYLSPSILQKDERLEAICTPRKNCLQFLSQ  148
               L+  I    E LEA+C  R    Q LSQ
Sbjct  476  GRGLTMPIA---EPLEAMCKARPIMKQTLSQ  503



>emb|CBI33745.3| unnamed protein product [Vitis vinifera]
Length=457

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 139/208 (67%), Gaps = 20/208 (10%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++   GT+T++ T+EWAM+LLL++P+VL K + E+D +VG   L+ ESDL KL YL+ +I
Sbjct  257  VLILGGTDTSAATMEWAMTLLLNHPDVLEKAKVELDMHVGKDRLIEESDLPKLRYLQSII  316

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ET+R +P  PLL+PH S +DC + G+D+P+ T ++VNAWA+H DP+VWE+P  FKPERF
Sbjct  317  SETMRAFPVGPLLVPHMSSDDCQIGGFDIPRGTLLLVNAWALHRDPQVWEDPTSFKPERF  376

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWK-------NTKE  256
                 E GE  +YK VPFG GRRACP   +  R+V LALG+ IQC+DWK       +T E
Sbjct  377  -----ENGEREDYKLVPFGIGRRACPGAGLAQRVVGLALGSLIQCYDWKKISNTAIDTTE  431

Query  255  DKILCATYLSPSILQKDERLEAICTPRK  172
             K L    L P        LEA+C  R+
Sbjct  432  GKGLSMPKLEP--------LEAMCKARE  451



>gb|KDO79057.1| hypothetical protein CISIN_1g019895mg [Citrus sinensis]
Length=334

 Score =   168 bits (425),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 130/175 (74%), Gaps = 5/175 (3%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AG +T+++T+EWAM+ L+++PEVL   R E++  VG + L++ESDLSKLPYLR +++
Sbjct  124  LIIAGIDTSAITLEWAMANLVNHPEVLKNARAELNAQVGQECLIDESDLSKLPYLRNIVS  183

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRL P APLL+PH S +DC V GYDVP+ TT++VNAWA+H DP++W+EP  FKPERF 
Sbjct  184  ETLRLNPAAPLLIPHRSSDDCTVGGYDVPRDTTLLVNAWAIHRDPELWDEPTCFKPERF-  242

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  247
                E  +   +K +PFG GRRACP  ++  RLV L LG+ +QCF+WK   EDKI
Sbjct  243  ----ESSDSEAHKLMPFGLGRRACPGASLAQRLVGLTLGSLLQCFEWKRIGEDKI  293



>emb|CDY44041.1| BnaA08g15650D [Brassica napus]
Length=496

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 141/196 (72%), Gaps = 4/196 (2%)
 Frame = -1

Query  762  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINETl  583
            AGT+T++VT+EWAM+ LL++PE L K + EID  +G + L++E DL KLPYL+ +++ET 
Sbjct  295  AGTDTSAVTLEWAMACLLNHPESLEKAKQEIDEKIGQERLIDEPDLEKLPYLQNIVSETF  354

Query  582  rlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfEAIV  403
            RLYP APLL+P  + +D  V GYDVP+ T VMVNAWA+H DP +W EPEKFKPERF   +
Sbjct  355  RLYPAAPLLVPRSTTDDIKVGGYDVPRGTMVMVNAWAIHRDPSLWNEPEKFKPERFN--I  412

Query  402  GEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSP  223
            GE GE   +K +PFG GRRACP   +G R+V+LALG+ IQCFDW+   ++KI   T    
Sbjct  413  GEGGEDV-HKLMPFGNGRRACPGTGLGQRIVTLALGSLIQCFDWEKVNDEKI-DMTETPG  470

Query  222  SILQKDERLEAICTPR  175
              ++K E L A+C+ R
Sbjct  471  MAMRKKEPLWALCSSR  486



>ref|XP_009129360.1| PREDICTED: cytochrome P450 81D11-like [Brassica rapa]
 emb|CDY47252.1| BnaA02g29380D [Brassica napus]
Length=500

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 139/200 (70%), Gaps = 6/200 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT T+  T+EWAM+ LL++PEVL + R EI+  +G   L+ E D+ KLPYL+ + 
Sbjct  295  VMIIAGTNTSGGTLEWAMANLLNHPEVLERARTEIEEQIGSDRLIEEQDIVKLPYLQNIT  354

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRLYP  P+LLPH + EDC+VAGYDVP+ T VMVNAWA+H DP +WEEPEKFKPERF
Sbjct  355  SETLRLYPVVPMLLPHMASEDCIVAGYDVPRGTMVMVNAWAIHRDPNMWEEPEKFKPERF  414

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                  E EG + K + FG GRRACP + +  RLV+LALG+ +QCFDW+   E  +    
Sbjct  415  ------EKEGEDKKMLSFGMGRRACPGSGLAQRLVTLALGSLVQCFDWERDGEKYVDLTE  468

Query  234  YLSPSILQKDERLEAICTPR  175
                +I++K E L+A+C  R
Sbjct  469  AEKGTIMRKAEPLKAMCRAR  488



>ref|XP_009129359.1| PREDICTED: cytochrome P450 81D11-like [Brassica rapa]
Length=511

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 140/201 (70%), Gaps = 6/201 (3%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            +++  AGT+T++ T+EWAMS LL++PEVL K + EID  +G   L+ E D+ KLPYL+ +
Sbjct  303  EVMILAGTDTSAATLEWAMSNLLNHPEVLKKAKTEIDEQIGLDRLIEEQDIVKLPYLQSI  362

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            + ETLRLYP  P+LLPH + +DC+VAGYDVP+ T ++VN WA+H DPK+WEEPEKFKPER
Sbjct  363  VAETLRLYPVVPMLLPHMASKDCMVAGYDVPRKTILLVNVWAIHRDPKMWEEPEKFKPER  422

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
            F      E EG + K + FG GRRACP   +G RLV+LALG+ +QCF+W+ T E+ +   
Sbjct  423  F------EKEGEDKKLMSFGMGRRACPGLGLGQRLVTLALGSLVQCFEWERTGEEYVDMT  476

Query  237  TYLSPSILQKDERLEAICTPR  175
                   + K   LEA+C  R
Sbjct  477  EAAKGITMHKSTSLEAMCRTR  497



>ref|XP_009109368.1| PREDICTED: cytochrome P450 81F1-like [Brassica rapa]
Length=496

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 141/196 (72%), Gaps = 4/196 (2%)
 Frame = -1

Query  762  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINETl  583
            AGT+T++VT+EWAM+ LL++PE L K + EID  +G + L++E DL KLPYL+ +++ET 
Sbjct  295  AGTDTSAVTLEWAMACLLNHPESLEKAKQEIDEKIGQERLIDEPDLEKLPYLQNIVSETF  354

Query  582  rlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfEAIV  403
            RLYP APLL+P  + +D  V GYDVP+ T VMVNAWA+H DP +W EPEKFKPERF   +
Sbjct  355  RLYPAAPLLVPRSTTDDIKVGGYDVPRGTMVMVNAWAIHRDPSLWNEPEKFKPERFN--I  412

Query  402  GEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSP  223
            GE GE   +K +PFG GRRACP   +G R+V+LALG+ IQCFDW+   ++KI   T    
Sbjct  413  GEGGEDV-HKLMPFGNGRRACPGTGLGQRIVTLALGSLIQCFDWEKVNDEKI-DMTETPG  470

Query  222  SILQKDERLEAICTPR  175
              ++K E L A+C+ R
Sbjct  471  MAMRKKEPLWALCSSR  486



>emb|CBI38503.3| unnamed protein product [Vitis vinifera]
Length=321

 Score =   167 bits (424),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 137/197 (70%), Gaps = 6/197 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T++ T+EWAM+LLL++P+VL K + E+D +VG   L+ ESDL KL YL+ +I
Sbjct  114  VLILAGTDTSAATVEWAMTLLLNHPDVLKKAKAELDIHVGKDRLIEESDLPKLRYLQSII  173

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRL+P APLL+PH S +DC + G+D+P  T +++NAWA+H DP+VWE+P  F PERF
Sbjct  174  SETLRLFPVAPLLVPHMSSDDCQIGGFDIPGGTFLLINAWAIHRDPQVWEDPTSFIPERF  233

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                 E G+  NYK +PFG GRRACP   +  R+V LALG+ IQC+DWK   E  I   T
Sbjct  234  -----ENGQRENYKLLPFGIGRRACPGAGLAHRVVGLALGSLIQCYDWKRISETTI-DTT  287

Query  234  YLSPSILQKDERLEAIC  184
                  + K E LEA+C
Sbjct  288  EGKGLTMPKLEPLEAMC  304



>gb|AGC29950.1| CYP81B56, partial [Sinopodophyllum hexandrum]
Length=344

 Score =   168 bits (425),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 140/209 (67%), Gaps = 4/209 (2%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+T++ T+EWAMSLLL+ PEV+ K + E+DNN+    L+ ESD+SKLPYL+C+I 
Sbjct  139  MLSAGTDTSAGTMEWAMSLLLNNPEVIKKAQLEMDNNIEPGRLIQESDMSKLPYLQCIIT  198

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLR+YP  PLLLPH S  DCVV GY +P  T ++VN WA+ +DP +W EP KFKPERFE
Sbjct  199  ETLRMYPAGPLLLPHESSHDCVVGGYTIPGGTMLLVNLWAIQNDPSLWNEPTKFKPERFE  258

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
             +  E  +GF  K +PFG+GRR CP   + + ++ L LG  IQCFDW+   +D ++  T 
Sbjct  259  GLK-ETRDGF--KLMPFGSGRRRCPGEGLAMHVLGLVLGTLIQCFDWERVGDD-LVDMTE  314

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
             S   L K + L A C PR      +SQL
Sbjct  315  GSGLTLPKAQPLVAKCMPRAKMANLISQL  343



>ref|XP_010059867.1| PREDICTED: isoflavone 2'-hydroxylase-like [Eucalyptus grandis]
 gb|KCW66314.1| hypothetical protein EUGRSUZ_F00140 [Eucalyptus grandis]
Length=503

 Score =   171 bits (434),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 98/209 (47%), Positives = 137/209 (66%), Gaps = 4/209 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T+++T+EWAMS +L+ PE+L K R EID  VGH  L+NESDL KL YL CV+
Sbjct  298  VLLLAGTDTSALTMEWAMSAMLNQPEILKKARAEIDEVVGHDRLVNESDLPKLSYLHCVV  357

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NET+R+YP  PLL+PH S ++C V GY VP+ T +++N +++ +DP  W    KF+PER 
Sbjct  358  NETMRMYPVLPLLIPHESAKECCVGGYRVPRGTILLINLFSIQNDPNYWPNAAKFRPER-  416

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                G EG    YK +PFG+GRR CP  N+ LR++ L LG+ IQCF+W N   D+++  T
Sbjct  417  --FTGMEGVRDGYKMMPFGSGRRGCPGENLALRMIGLTLGSLIQCFEW-NRISDELIDMT  473

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQ  148
              +   + K + L A C PR      LSQ
Sbjct  474  EGTGLTMPKAQPLLAKCRPRSFTSDLLSQ  502



>ref|XP_004141397.1| PREDICTED: cytochrome P450 81D1-like [Cucumis sativus]
 gb|KGN55249.1| hypothetical protein Csa_4G642300 [Cucumis sativus]
Length=516

 Score =   172 bits (435),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 141/200 (71%), Gaps = 4/200 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGTET+   +EWA+SL+L++P+ L KL+ EIDN VGH  L++ESD++ LP LR +I
Sbjct  306  VLLAAGTETSVAAMEWALSLMLNHPKFLKKLQNEIDNQVGHDRLIDESDMANLPSLRGII  365

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLR+YPPAPL++PH S +DC + GY +P+ T + VN WA+H+DPK+W+ P KF P RF
Sbjct  366  NETLRMYPPAPLVVPHESSKDCTIGGYHIPRGTILFVNLWAIHNDPKIWDNPRKFNPNRF  425

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E++   E E F +  +PFG+GRR CP   + LR++ L LGA +QCF+W+   E+ +    
Sbjct  426  ESL---ENEKFGFNLIPFGSGRRGCPGEGLALRVIGLVLGALVQCFEWERPGEELVDMTE  482

Query  234  YLSPSILQKDERLEAICTPR  175
             ++ + + K   L+A CTPR
Sbjct  483  GVALT-MPKAHCLQAKCTPR  501



>ref|XP_009372456.1| PREDICTED: cytochrome P450 81D11-like [Pyrus x bretschneideri]
Length=499

 Score =   171 bits (433),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 140/200 (70%), Gaps = 6/200 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T++VT+EWAMS LL++P VL K R E+D  +G +HL+ E D+SKLPYL+ ++
Sbjct  297  VMLLAGTDTSAVTLEWAMSNLLNHPRVLKKARSELDAQLGQEHLMEEPDISKLPYLQSIV  356

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ET RL P APLL+PH S EDC + G+DVP+ T V++NAWA+H DPK+W++PE FKPERF
Sbjct  357  SETFRLCPAAPLLVPHLSSEDCTIEGFDVPRGTIVLINAWAIHRDPKLWDDPESFKPERF  416

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                 E GE  ++K + FG+GRRACP   +  R+V L LG+ IQCF+W+   E+++   T
Sbjct  417  -----ESGEDMSHKLITFGSGRRACPGAGLAQRVVGLTLGSLIQCFEWERVGEEEV-DMT  470

Query  234  YLSPSILQKDERLEAICTPR  175
                  + K   LEA+C  R
Sbjct  471  EGKGLTMPKAVPLEAMCKTR  490



>ref|XP_010095334.1| Cytochrome P450 81D1 [Morus notabilis]
 gb|EXB59545.1| Cytochrome P450 81D1 [Morus notabilis]
Length=450

 Score =   170 bits (431),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 140/210 (67%), Gaps = 7/210 (3%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            +++  AGT+T+SVT+EWA+S LL++P VL K + E+D  VG +HLL E DLSKL YL+ +
Sbjct  244  RVLLLAGTDTSSVTLEWALSNLLNHPHVLKKAKQELDAQVGEQHLLEEQDLSKLHYLQSI  303

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            I+ETLRLYP APLLLPHYS +DC + GYDVP+ T V+VNAWA+H DP +W+  E FKPER
Sbjct  304  ISETLRLYPAAPLLLPHYSSDDCTIGGYDVPRDTIVLVNAWAIHRDPNLWDVAESFKPER  363

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
            F     E GEG  +  +PFG GRRACP      R+V L LG+ IQCF+W +T   K +  
Sbjct  364  F-----EMGEGEAHILMPFGIGRRACPGAGFAQRVVGLTLGSLIQCFEWDST--GKKVDM  416

Query  237  TYLSPSILQKDERLEAICTPRKNCLQFLSQ  148
            T      + K   LEA+C  R      LS+
Sbjct  417  TEGKGLTMPKAVPLEAMCKARPIMNAVLSE  446



>ref|XP_010059866.1| PREDICTED: isoflavone 2'-hydroxylase-like [Eucalyptus grandis]
 gb|KCW66311.1| hypothetical protein EUGRSUZ_F00137 [Eucalyptus grandis]
Length=504

 Score =   171 bits (433),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 139/209 (67%), Gaps = 4/209 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T++ T+EWAMS +L++PE+L K + EID  VGH  L++ESDL KL YL CV+
Sbjct  299  VLLSAGTDTSAATMEWAMSAMLNHPEILKKAQAEIDEVVGHNRLISESDLPKLLYLHCVM  358

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NET+R+YP  PLL+PH S E+C V GY VP+ T +++N +++ +DPK W +  KFKPER 
Sbjct  359  NETMRMYPVGPLLVPHESAEECRVGGYRVPQGTMLLINLFSIQNDPKYWPDAAKFKPER-  417

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                G EG    YK +PFG+GRR CP  N+ LR+V L LG+ IQCF+W    E+ ++  T
Sbjct  418  --FEGMEGVRDGYKMMPFGSGRRGCPGENLALRMVGLTLGSLIQCFEWNRISEE-LIDMT  474

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQ  148
              +   + K + L A C PR   L  LSQ
Sbjct  475  EGTGLTMPKAQPLLAKCRPRSFALGLLSQ  503



>gb|AJD25193.1| cytochrome P450 CYP81B61 [Salvia miltiorrhiza]
Length=510

 Score =   171 bits (434),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 102/212 (48%), Positives = 137/212 (65%), Gaps = 5/212 (2%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            Q++  AGT+T+S T+EWAMSLLL+ P+ L K R EID  VGH  L+++SDL  LPYL+CV
Sbjct  303  QVMLSAGTDTSSSTMEWAMSLLLNNPDALIKARAEIDRQVGHSRLVDDSDLPHLPYLQCV  362

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            I ET R+ P  P+L+PH S   C V GY VP+ T ++VN WA+  DPKVW+ P +FKPER
Sbjct  363  IKETFRVCPVGPMLVPHESSAACTVGGYQVPRGTMLLVNTWAIQRDPKVWDHPMEFKPER  422

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
            F  I  EE +  ++  +PFG GRR CP  NM LR++ LAL + IQCF+W   + DK +  
Sbjct  423  FIGI--EEKKEGSFALMPFGYGRRGCPGENMALRVIGLALASLIQCFEW--ARLDKEMVD  478

Query  237  TYLSPSI-LQKDERLEAICTPRKNCLQFLSQL  145
               SP + + K + L A C PR    + L  +
Sbjct  479  MAGSPGLTMPKTQPLVARCRPRLAVAELLKHI  510



>ref|XP_009796227.1| PREDICTED: isoflavone 2'-hydroxylase-like isoform X2 [Nicotiana 
sylvestris]
Length=508

 Score =   171 bits (434),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 140/202 (69%), Gaps = 3/202 (1%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AG++T++VT+EWA S LL   E+L K + EIDN+VG   L++ESDL++L Y+RC+I
Sbjct  307  VLLQAGSDTSAVTLEWAFSHLLDNLEILKKAQAEIDNHVGQDRLIDESDLAQLHYIRCII  366

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLR++P APLL+PH S E+C VA Y VP+ T ++VNAW +HHDPKVWE+PEKF P+R 
Sbjct  367  NETLRMHPAAPLLVPHLSSEECNVASYRVPRGTVLLVNAWGIHHDPKVWEDPEKFYPDR-  425

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
               +G EG     KF+PFG+GRR CP  N+   ++ LALG+ +QCF+W+      I  + 
Sbjct  426  --FIGFEGIKEGCKFIPFGSGRRGCPGENLAFHVIGLALGSLLQCFEWEKPNRGSIDMSE  483

Query  234  YLSPSILQKDERLEAICTPRKN  169
                ++  K + L A C+PR N
Sbjct  484  GTGFTLSPKVQPLLAKCSPRPN  505



>ref|XP_006283601.1| hypothetical protein CARUB_v10004657mg [Capsella rubella]
 gb|EOA16499.1| hypothetical protein CARUB_v10004657mg [Capsella rubella]
Length=495

 Score =   171 bits (433),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 136/196 (69%), Gaps = 7/196 (4%)
 Frame = -1

Query  762  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINETl  583
            AGT+T+SVT+EWAMS LL++PEVL K+R EID+ +G   L+ ESD+  LPYL+  ++ET 
Sbjct  300  AGTDTSSVTLEWAMSNLLNHPEVLEKVRAEIDDKIGSGRLMEESDIVNLPYLQNTVSETF  359

Query  582  rlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfEAIV  403
            RL+P  PLLLPHYS ++C VAGYD+P+ T ++ NAWAMH DP +WEEPE FKPERF    
Sbjct  360  RLHPAVPLLLPHYSSDECKVAGYDMPRGTMLLTNAWAMHRDPGLWEEPEMFKPERF----  415

Query  402  GEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSP  223
              E EG   K +PFG GRRACP   +G RLV LALG+ IQCF+W+   E+ +L  T    
Sbjct  416  --EKEGEAQKLMPFGMGRRACPGAELGKRLVCLALGSLIQCFEWERVGEE-LLDMTEAKG  472

Query  222  SILQKDERLEAICTPR  175
              + K   L A+C  R
Sbjct  473  ITMPKATPLRAMCKTR  488



>ref|XP_008781034.1| PREDICTED: cytochrome P450 81D1-like [Phoenix dactylifera]
Length=236

 Score =   165 bits (417),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 140/211 (66%), Gaps = 6/211 (3%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            Q +  AGT+T+S T+EWAMSLLL+ P+ L K R EID  VG   LL E+D S LPYL+CV
Sbjct  32   QSLLAAGTDTSSDTVEWAMSLLLNNPQTLKKAREEIDACVGKGRLLEEADFSNLPYLQCV  91

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            I ETLRLYP  PLLLPH S ++C V G+ +P    ++VNA+++H DPKVWEEP +F PER
Sbjct  92   ITETLRLYPTTPLLLPHESSQECSVGGFHIPHGMMMLVNAYSVHRDPKVWEEPTRFMPER  151

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
            F     E G+G     +PFG GRR CP   + +R+VSLALGA IQCF+W+ T ++++   
Sbjct  152  F-----EGGKGEGKLMIPFGMGRRRCPGEGLAVRVVSLALGALIQCFEWERTGKEEV-DM  205

Query  237  TYLSPSILQKDERLEAICTPRKNCLQFLSQL  145
            T  S   L K   LEA+  P ++ L  L +L
Sbjct  206  TEGSGLTLPKAIPLEAMYRPHQSMLDTLKKL  236



>ref|XP_006425998.1| hypothetical protein CICLE_v10025370mg [Citrus clementina]
 gb|ESR39238.1| hypothetical protein CICLE_v10025370mg [Citrus clementina]
Length=518

 Score =   171 bits (433),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 139/202 (69%), Gaps = 7/202 (3%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            + +  AGT+TT+VT+EWAMS L+++P+VL K R E+D +VG +HL +E DLSKL YL C+
Sbjct  312  KTMLLAGTDTTAVTMEWAMSNLVNHPDVLQKARAELDTHVGQQHLFDEPDLSKLKYLHCI  371

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            I+ETLRLYP APLL+PH S +DCVV G+DVP+ TT++VN WA+H DP +W+EP KF+P R
Sbjct  372  ISETLRLYPTAPLLVPHRSSDDCVVGGFDVPRDTTLLVNVWAIHRDPGLWDEPTKFEPAR  431

Query  417  fEAIVGEEGEGFNYKF-VPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILC  241
            F     E GE    K  +PFG GRR+CP   +  RLV L LG+ IQCF+W+     KI  
Sbjct  432  F-----ENGESEARKLMMPFGLGRRSCPGMGLAQRLVGLTLGSLIQCFEWERIGCQKI-D  485

Query  240  ATYLSPSILQKDERLEAICTPR  175
             T      + K E LE +C PR
Sbjct  486  MTEGKGITMPKAEALEVLCKPR  507



>ref|XP_010936572.1| PREDICTED: cytochrome P450 81D1-like [Elaeis guineensis]
Length=266

 Score =   165 bits (418),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 135/211 (64%), Gaps = 6/211 (3%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            + +F AGT+T++ T EWAMSLLL+ PE L K R EID  V  K LL E+DL KLPYL  +
Sbjct  62   KTLFVAGTDTSTETTEWAMSLLLNNPEALQKARLEIDACVKEKRLLEENDLPKLPYLNGI  121

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            INETLRL   APLLLPH S EDCVV GYD+P+ T ++VNA A+H DP VW EP KF PER
Sbjct  122  INETLRLCSAAPLLLPHESHEDCVVGGYDIPRGTILLVNARAIHRDPNVWVEPTKFMPER  181

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
            F  + G E  G     +PFG GRR CP   + +R++ LALG  IQCF+WK     ++   
Sbjct  182  F--LDGREEGGMA---LPFGMGRRKCPGEGLAMRVIGLALGTMIQCFEWKWVGGGEVDMR  236

Query  237  TYLSPSILQKDERLEAICTPRKNCLQFLSQL  145
               S   L K   LEA+C PR+   + L +L
Sbjct  237  EG-SAVTLPKVVPLEAMCRPRERMKEVLVRL  266



>ref|XP_006399557.1| hypothetical protein EUTSA_v10016031mg [Eutrema salsugineum]
 gb|ESQ41010.1| hypothetical protein EUTSA_v10016031mg [Eutrema salsugineum]
Length=500

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 147/210 (70%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AGT+T+ V +EWAMS+LL++P+ L KLR EI +NV H  L+ +SDLS LPYLRCVI
Sbjct  295  LMFNAGTDTSPVVMEWAMSVLLNHPDKLEKLREEIKSNVKHNGLIQDSDLSSLPYLRCVI  354

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             ETLRLYP APLLLPHYS +   +  Y++P++T ++VNAWA+H D K+WE+ + FKPERF
Sbjct  355  YETLRLYPAAPLLLPHYSSKRFNLGDYEIPENTMLLVNAWAVHRDGKLWEDADVFKPERF  414

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E  VG+  +GF  +F+PFG GRRACP    G+R V+LA+GA +QCF+W+  +E  +    
Sbjct  415  EGFVGDR-DGF--RFLPFGVGRRACPGAGFGMRTVALAVGALVQCFEWEKLEEGDVDMRP  471

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                + + K E L A+  P    +  LSQL
Sbjct  472  VFGVA-MAKAEPLVALPKPWPEMVPILSQL  500



>emb|CDP12912.1| unnamed protein product [Coffea canephora]
Length=741

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 145/220 (66%), Gaps = 4/220 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AG++T+S TIEWAMSLLL++P+ L + R E+D N+G   L+ E DL KLPYL+ +I
Sbjct  411  ILLAAGSDTSSSTIEWAMSLLLNHPKELERARAELDKNIGQNRLVEEEDLPKLPYLQSII  470

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             E+ RL+P AP+LLP  S  DC +  Y +P  TT+MVNAWA+H DP++W++PE FKPER 
Sbjct  471  YESQRLHPAAPILLPRASSSDCTIGNYTIPSKTTLMVNAWAIHRDPQLWDDPESFKPER-  529

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
               +G E + + +KF+PFG GRR CP   +  R+V L LG+ IQCF+W+    ++++  +
Sbjct  530  --FLGLENDAYKHKFIPFGLGRRKCPGAGLANRMVGLTLGSLIQCFEWERI-SNELVDLS  586

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL*IVFAYVFNV  115
              +   + K   LEAIC PR++ + F       F Y++ +
Sbjct  587  EGTGITMPKASPLEAICKPRESMMLFFPITYTRFNYIYKI  626



>gb|ADD84651.1| CYP81B36 [Scoparia dulcis]
Length=502

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 145/209 (69%), Gaps = 4/209 (2%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+TT+ T+EW +SLLL+ P V+ K + EIDN++GH HL++ESD++ LPYLRC++N
Sbjct  298  LLVAGTDTTAGTMEWVVSLLLNNPHVIKKAQVEIDNHIGHGHLIDESDITDLPYLRCIVN  357

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRLYP  PLL+PH S E C+V GY VP  T ++VN WA+  DPK W+EPEKFKPERFE
Sbjct  358  ETLRLYPAGPLLVPHESSEQCIVGGYRVPAGTMLLVNLWAIQRDPKYWDEPEKFKPERFE  417

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
               G EG    +KF PFG+GRR CP   + +R+++ ++G+ IQCFDW+   ++ +  +  
Sbjct  418  ---GLEGNRDGFKFSPFGSGRRGCPGEGLAVRMLASSIGSIIQCFDWERVGKELVDMSEG  474

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
            +  + L K + L A C  R    + LSQ+
Sbjct  475  VGLT-LPKAQPLMAYCRARPLAAKLLSQI  502



>ref|XP_004292746.2| PREDICTED: isoflavone 3'-hydroxylase-like [Fragaria vesca subsp. 
vesca]
Length=522

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 145/210 (69%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+TT+ T+EWA+SLLL+ PE L K + EID  +G   L+ E+DL+KLPYL C+I
Sbjct  317  VMLSAGTDTTAGTMEWALSLLLNNPEALAKAQNEIDEQIGQSRLVEEADLAKLPYLSCII  376

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             ETLR+YP APLL PH + EDC V G+ VP+ T ++VNAWA+ +DP++W +PE+FKPERF
Sbjct  377  YETLRMYPAAPLLPPHEASEDCTVGGFHVPRGTMLLVNAWAIQNDPELWAKPEQFKPERF  436

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            + + GE  +GF  K++PFGTGRR CP   +  R+V L LG+ IQCF+W+ + E+ ++  T
Sbjct  437  QNVQGER-DGF--KWLPFGTGRRGCPGEGLATRIVGLTLGSLIQCFEWERSGEE-MVDMT  492

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
              +   + K   L A C PR      LSQL
Sbjct  493  EGAGLAMPKAHPLLAKCRPRPTMPALLSQL  522



>emb|CBI33746.3| unnamed protein product [Vitis vinifera]
Length=408

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 133/196 (68%), Gaps = 6/196 (3%)
 Frame = -1

Query  762  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINETl  583
            AGT+TT+ TIEWAMSLLL++P+VL K R E+D +VG   L+ ESD  KL YLR +I+ETL
Sbjct  212  AGTDTTATTIEWAMSLLLNHPDVLKKARAELDTHVGKDRLMEESDFPKLQYLRSIISETL  271

Query  582  rlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfEAIV  403
            RL+P  PLL+PH S ++C + GYD+P+ T ++VNAWA+H DPK W++   FKPERF    
Sbjct  272  RLFPATPLLIPHISSDNCQIGGYDIPRGTILLVNAWAIHRDPKSWKDATSFKPERF----  327

Query  402  GEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSP  223
             E GE   YK +PFG GRRACP   +  R++ L LG  IQC++W+   E ++  A     
Sbjct  328  -ENGESEAYKLLPFGFGRRACPGAGLANRVIGLTLGLLIQCYEWERVSEKEVDMAEGKGV  386

Query  222  SILQKDERLEAICTPR  175
            + + K E LEA+C  R
Sbjct  387  T-MPKLEPLEAMCKAR  401



>ref|XP_010647303.1| PREDICTED: cytochrome P450 81E8-like [Vitis vinifera]
Length=365

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 137/197 (70%), Gaps = 6/197 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T++ T+EWAM+LLL++P+VL K + E+D +VG   L+ ESDL KL YL+ +I
Sbjct  158  VLILAGTDTSAATVEWAMTLLLNHPDVLKKAKAELDIHVGKDRLIEESDLPKLRYLQSII  217

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRL+P APLL+PH S +DC + G+D+P  T +++NAWA+H DP+VWE+P  F PERF
Sbjct  218  SETLRLFPVAPLLVPHMSSDDCQIGGFDIPGGTFLLINAWAIHRDPQVWEDPTSFIPERF  277

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                 E G+  NYK +PFG GRRACP   +  R+V LALG+ IQC+DWK   E  I   T
Sbjct  278  -----ENGQRENYKLLPFGIGRRACPGAGLAHRVVGLALGSLIQCYDWKRISETTI-DTT  331

Query  234  YLSPSILQKDERLEAIC  184
                  + K E LEA+C
Sbjct  332  EGKGLTMPKLEPLEAMC  348



>ref|XP_010502943.1| PREDICTED: cytochrome P450 81D11-like isoform X2 [Camelina sativa]
Length=327

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 142/200 (71%), Gaps = 6/200 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T++ T+EWAMS LL++P+VL K + EIDN +G   L+ E D+ KLPYL+ ++
Sbjct  123  VMILAGTDTSAGTLEWAMSNLLNHPDVLQKAKTEIDNQIGLDSLIEEQDIVKLPYLQNIV  182

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRLYP AP+LLPH + EDCV+ GYDVP+ T ++VNAWA+H DPK+WEEP KFKPERF
Sbjct  183  SETLRLYPVAPMLLPHLASEDCVLDGYDVPRGTIILVNAWAIHRDPKLWEEPGKFKPERF  242

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                  E +G + K + FG GRRACP + +  RLV+LALG+ IQ F+W+   E+ +    
Sbjct  243  ------EKKGEDKKLMAFGIGRRACPGSGLAQRLVTLALGSLIQSFEWERVGEEHLDMRE  296

Query  234  YLSPSILQKDERLEAICTPR  175
                + ++K + L+A+C  R
Sbjct  297  SEKGTTMRKAKSLQAMCRAR  316



>emb|CAN72520.1| hypothetical protein VITISV_040350 [Vitis vinifera]
Length=502

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 139/208 (67%), Gaps = 20/208 (10%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++   GT+T++ T+EWAM+LLL++P+VL K + E+D +VG   L+ ESDL KL YL+ +I
Sbjct  302  VLILGGTDTSAATMEWAMTLLLNHPDVLEKAKVELDMHVGKDRLIEESDLPKLRYLQSII  361

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ET+R +P  PLL+PH S +DC + G+D+P+ T ++VNAWA+H DP+VWE+P  FKPERF
Sbjct  362  SETMRAFPVGPLLVPHMSSDDCQIGGFDIPRGTLLLVNAWALHRDPQVWEDPTSFKPERF  421

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWK-------NTKE  256
                 E GE  +YK VPFG GRRACP   +  R+V LALG+ IQC+DWK       +T E
Sbjct  422  -----ENGEREDYKLVPFGIGRRACPGAGLAQRVVGLALGSLIQCYDWKKISNTAIDTTE  476

Query  255  DKILCATYLSPSILQKDERLEAICTPRK  172
             K L    L P        LEA+C  R+
Sbjct  477  GKGLSMPKLEP--------LEAMCKARE  496



>ref|XP_012079329.1| PREDICTED: cytochrome P450 81D1-like [Jatropha curcas]
 gb|KDP32017.1| hypothetical protein JCGZ_12478 [Jatropha curcas]
Length=506

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 141/200 (71%), Gaps = 6/200 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T+SVT+EWAMS L+++P+ L+K + E+D  +G +HLL ESDLSKLPYL  +I
Sbjct  302  IMLLAGTDTSSVTLEWAMSNLVNHPDTLNKAKIELDAIIGQEHLLEESDLSKLPYLHNII  361

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRLYP APLL+PH++ +DC + GY+VP+ T V+VNAWA+H D  VW++P  FKPERF
Sbjct  362  SETLRLYPSAPLLVPHFTSDDCTIGGYNVPRGTIVLVNAWAIHRDSSVWDDPISFKPERF  421

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                 E+G+   YK++PFG GRRACP   M  R+V L LG+ IQCF+W+   E  +    
Sbjct  422  -----EQGQTEAYKYLPFGLGRRACPGATMAQRVVGLTLGSLIQCFEWRRIDEKLVDMTE  476

Query  234  YLSPSILQKDERLEAICTPR  175
             +  S + K E L+ +C  R
Sbjct  477  GIGIS-MPKAEPLKVMCKSR  495



>emb|CAN60309.1| hypothetical protein VITISV_015004 [Vitis vinifera]
Length=990

 Score =   174 bits (442),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 137/197 (70%), Gaps = 6/197 (3%)
 Frame = -1

Query  762  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINETl  583
             G +TT+VTIEWAMSLLL++PEVL K R E+D ++GH  L++E+DL KL YL+ +I+E+L
Sbjct  787  GGADTTAVTIEWAMSLLLNHPEVLKKARDELDTHIGHDCLIDETDLPKLQYLQSIISESL  846

Query  582  rlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfEAIV  403
            RL+P  PLL+PH+S EDC + G+DVP  T ++VNAWA+H DPK+W +P  FKPERF    
Sbjct  847  RLFPSTPLLVPHFSTEDCKLGGFDVPGGTMLLVNAWALHRDPKLWNDPTSFKPERF----  902

Query  402  GEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSP  223
             E GE   YK +PFG GRRACP   +  R++ L LG+ IQCFDWK   E +I        
Sbjct  903  -ETGESETYKLLPFGVGRRACPGIGLANRVMGLTLGSLIQCFDWKRVDEKEIDMXEGQGL  961

Query  222  SILQKDERLEAICTPRK  172
            + + K E LEA+C  R+
Sbjct  962  T-MPKVEPLEAMCKTRQ  977


 Score =   159 bits (401),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 141/200 (71%), Gaps = 10/200 (5%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            +VF AGT+T +VT+EWAMSLLL++P+VL K + E+D  VG + LL E+DL KL YL+ +I
Sbjct  300  LVF-AGTDTAAVTMEWAMSLLLNHPDVLKKAKVELDTXVGQERLLEEADLPKLHYLQNII  358

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ET RL PPAPL LPH S  +C + G+D+P+   ++VN+W +H DPK+W++P  FKPERF
Sbjct  359  SETFRLCPPAPLWLPHMSSANCQLGGFDIPRDXMLLVNSWTLHRDPKLWDDPTSFKPERF  418

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI--LC  241
            E   GE GE   YK +PFGTGRRACP + +  ++V L LG+ IQC++W+   E K+  + 
Sbjct  419  EG--GERGE--TYKLLPFGTGRRACPGSGLANKVVGLTLGSLIQCYEWERISEKKVDMME  474

Query  240  ATYLSPSILQKDERLEAICT  181
               L+   + K E LEA+C+
Sbjct  475  GKGLT---MPKMEPLEAMCS  491



>ref|XP_002279038.1| PREDICTED: isoflavone 2'-hydroxylase [Vitis vinifera]
Length=502

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 139/208 (67%), Gaps = 20/208 (10%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++   GT+T++ T+EWAM+LLL++P+VL K + E+D +VG   L+ ESDL KL YL+ +I
Sbjct  302  VLILGGTDTSAATMEWAMTLLLNHPDVLEKAKVELDMHVGKDRLIEESDLPKLRYLQSII  361

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ET+R +P  PLL+PH S +DC + G+D+P+ T ++VNAWA+H DP+VWE+P  FKPERF
Sbjct  362  SETMRAFPVGPLLVPHMSSDDCQIGGFDIPRGTLLLVNAWALHRDPQVWEDPTSFKPERF  421

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWK-------NTKE  256
                 E GE  +YK VPFG GRRACP   +  R+V LALG+ IQC+DWK       +T E
Sbjct  422  -----ENGEREDYKLVPFGIGRRACPGAGLAQRVVGLALGSLIQCYDWKKISNTAIDTTE  476

Query  255  DKILCATYLSPSILQKDERLEAICTPRK  172
             K L    L P        LEA+C  R+
Sbjct  477  GKGLSMPKLEP--------LEAMCKARE  496



>ref|XP_007206766.1| hypothetical protein PRUPE_ppa025296mg [Prunus persica]
 gb|EMJ07965.1| hypothetical protein PRUPE_ppa025296mg [Prunus persica]
Length=496

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 140/201 (70%), Gaps = 6/201 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T++VT+EWAMS LL++P+VL + R E+D  VG + L+ E D+SKLPYL+ +I
Sbjct  297  VMLLAGTDTSAVTLEWAMSNLLNHPDVLKRARAELDAQVGQERLVEEHDISKLPYLQSII  356

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRLYP AP+LL H+S +DC + G+DVP+ T V+VNAWA+H DPK+W++PE F PERF
Sbjct  357  SETLRLYPAAPMLLSHFSSDDCTIGGFDVPRGTMVLVNAWAIHRDPKLWDDPESFIPERF  416

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
             +     GE  +++ +PFG GRR+CP + +  R V L LG+ IQCFDW    E +I  A 
Sbjct  417  RS-----GEDLSHQLMPFGLGRRSCPGSGLAQRTVGLTLGSLIQCFDWMRVSEKEIDMAE  471

Query  234  YLSPSILQKDERLEAICTPRK  172
                + + K   LE +C  R+
Sbjct  472  GKGLT-MPKLVPLEVMCKARR  491



>gb|ACG29835.1| cytochrome P450 CYP81A1 [Zea mays]
Length=520

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 143/209 (68%), Gaps = 6/209 (3%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGTETTS T+EWAMSLLL++P+VL + + EI++NVG   LL+++DL +LPYL C+I+
Sbjct  318  LLAAGTETTSTTLEWAMSLLLNHPDVLKRAQEEIESNVGRDRLLDKNDLPRLPYLHCIIS  377

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRLYPP P+LLPH +  DC + GYDVP  + V+VNA+A+H DP +WE+PE+F+PERF 
Sbjct  378  ETLRLYPPTPMLLPHEASTDCKIHGYDVPAGSMVLVNAYAIHRDPAMWEDPEEFRPERF-  436

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
                E G       +PFG GRR CP  N+ +R + L LGA +QCFDW    + ++  AT 
Sbjct  437  ----ELGRAEGKFMMPFGMGRRRCPGENLAMRTMGLVLGALLQCFDWTRVGDREVDMATA  492

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
             + +I+ K   LEA C PR N    L ++
Sbjct  493  -TGTIMSKAVPLEAQCKPRANMSAVLQKI  520



>gb|AIM45245.1| flavonoid 3' hydroxylase-like protein [Fagopyrum tataricum]
Length=508

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 141/210 (67%), Gaps = 3/210 (1%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            +++ AGT+T++  +EWAMSLLL++P +L K R EID +V    L+ +SDLS LPYLRC+I
Sbjct  302  VMYTAGTDTSARIMEWAMSLLLNHPTILRKARAEIDAHVPTTRLVEDSDLSNLPYLRCII  361

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             ETLRLYP   LL+PH+S  +  + GY VPK T ++VNAWA+H +P+VW EP +F+PERF
Sbjct  362  YETLRLYPVVSLLIPHFSSSETTIDGYRVPKGTVLVVNAWALHRNPEVWPEPLEFRPERF  421

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E   G EG    +KF+PFG GRRACP  N+G+++V+L L   IQ F+W+N +  ++    
Sbjct  422  E---GVEGNRDGFKFMPFGVGRRACPGANLGVKMVALTLATMIQGFEWENVEAGEVDVEE  478

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                  + K   L+A CTPR   L  LS +
Sbjct  479  EGGGITMPKRSPLKAFCTPRSCMLDVLSMI  508



>gb|AHK60837.1| CYP81Q32 [Catharanthus roseus]
Length=499

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 133/200 (67%), Gaps = 6/200 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T++VT+EWAMSLLL++PE L K R EI+  VG   L+ E DL KL YL  +I
Sbjct  295  VLLLAGTDTSAVTVEWAMSLLLNHPETLEKARTEIETQVGSNRLIEEQDLPKLTYLHNII  354

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ET RL P AP+L+PH S +DC V GYDVPK T ++VNAWA+H DP+ W+EP  FKPER 
Sbjct  355  SETFRLCPAAPMLVPHESSDDCKVQGYDVPKGTILLVNAWAIHRDPEFWDEPTLFKPERH  414

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
              +  E       K +PFG GRR+CP + +  R+V L LGA IQCF+WK   E KI  A 
Sbjct  415  GGVELEPS-----KLMPFGMGRRSCPGSGLAQRVVGLTLGALIQCFEWKRIGEAKIDMAE  469

Query  234  YLSPSILQKDERLEAICTPR  175
              S   + K + LEA+C PR
Sbjct  470  G-SGLTMPKAQPLEALCKPR  488



>ref|XP_012068397.1| PREDICTED: isoflavone 3'-hydroxylase-like [Jatropha curcas]
 gb|KDP41665.1| hypothetical protein JCGZ_16072 [Jatropha curcas]
Length=508

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 143/210 (68%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T+++T+EWAMSLLL++PE L K R E+D  +G   L++ESD SKLPYL+ +I
Sbjct  303  VMIVAGTDTSALTMEWAMSLLLNHPEALKKARAELDKIIGQDRLVDESDYSKLPYLQSII  362

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRLYP APLLLPH S  DC+V GY VP+ T ++ NAWA+H DP VW +P KF+PER 
Sbjct  363  NETLRLYPVAPLLLPHESSNDCLVGGYYVPRGTMLLANAWAIHRDPTVWNDPTKFRPER-  421

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                G + +   YKF+PFG GRR CP   +  R++ LAL A IQCF+W+   E++I  + 
Sbjct  422  --FEGLDKDAHKYKFIPFGLGRRVCPGIPLANRVMGLALAALIQCFEWERPSEEQIDMSE  479

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
                S + K + L+A+C  R++ +  L  L
Sbjct  480  GEGLS-MPKSQPLKAMCRARESTINILRDL  508



>ref|XP_010910128.1| PREDICTED: cytochrome P450 81E8-like [Elaeis guineensis]
Length=505

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 138/209 (66%), Gaps = 6/209 (3%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+T+S TIEWAMSLLL+ PE L K + EID  VG++ LL ESDLS LPYL+C+I 
Sbjct  303  LLLAGTDTSSSTIEWAMSLLLNNPEKLQKAQTEIDERVGNERLLKESDLSDLPYLQCIIR  362

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLR+  PAPLL+PH S  DCVV G+DVP+ T ++VNA+ +H DPK+WEEP KFKPERF 
Sbjct  363  ETLRICSPAPLLVPHESTNDCVVGGFDVPRGTMLLVNAYYIHRDPKIWEEPTKFKPERF-  421

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
                E+G+      +PFG GRR CP   + +  V L LG  IQCFDWK   E+ +   T 
Sbjct  422  ----EDGKDEGKLMIPFGMGRRRCPGEGLAMTEVGLTLGTLIQCFDWKRMGEEPV-DMTE  476

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
             S   + K   LEA+  PR+  +  LS L
Sbjct  477  GSGLTMPKAVPLEAMYRPRRAMVHVLSGL  505



>ref|XP_009406660.1| PREDICTED: isoflavone 2'-hydroxylase-like [Musa acuminata subsp. 
malaccensis]
Length=512

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 137/211 (65%), Gaps = 6/211 (3%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
             ++  AGT++T+ TIEWA+SLLL++P  + K R EID  VG+  LL+ESDL  LPYL CV
Sbjct  308  SILLSAGTDSTARTIEWALSLLLNHPNAMDKTRAEIDARVGNGRLLDESDLPNLPYLHCV  367

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            + ETLR+YP  PLL+PH S ++CVV G+ VP+ T ++VNA+AMH DPK W+EP +F PER
Sbjct  368  VAETLRMYPAGPLLVPHESSDECVVGGFHVPRGTILLVNAYAMHRDPKTWDEPARFMPER  427

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
            F     E G+G   +  PFG GRR CP   +  R++ LALG  IQCF+W    + ++  A
Sbjct  428  F-----EGGKGEGKRMAPFGKGRRKCPGEGLAARMMGLALGTLIQCFEWGRVGDKEVDMA  482

Query  237  TYLSPSILQKDERLEAICTPRKNCLQFLSQL  145
               S   L K   LEA C PR+     LS++
Sbjct  483  EG-SGLTLPKAVPLEATCRPRQTLAHLLSEI  512



>ref|XP_006395346.1| hypothetical protein EUTSA_v10004055mg [Eutrema salsugineum]
 gb|ESQ32632.1| hypothetical protein EUTSA_v10004055mg [Eutrema salsugineum]
Length=501

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 141/200 (71%), Gaps = 6/200 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T++ T+EWA+S LL++PEVL K R EID  +G   L+ E D++KLPYLR ++
Sbjct  295  VMILAGTDTSAGTLEWALSNLLNHPEVLKKARSEIDEQIGLDRLIEEQDIAKLPYLRSIM  354

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRLYP AP+LLPH + EDC+VAGYDVP+ T ++VNAWA+H DP  WEEPEKFKPERF
Sbjct  355  SETLRLYPVAPMLLPHLASEDCMVAGYDVPRGTIILVNAWAIHRDPNTWEEPEKFKPERF  414

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                  + EG + K + FG GRRACP + +  RLV+LALG+ +QCF+W+   E+      
Sbjct  415  ------DKEGEDKKLMSFGIGRRACPGSGLAQRLVALALGSLVQCFEWERAGEEHADMRE  468

Query  234  YLSPSILQKDERLEAICTPR  175
                + ++K   L+A+C  R
Sbjct  469  SEKGTTMRKATSLQAMCRAR  488



>ref|XP_010446676.1| PREDICTED: cytochrome P450 81D11-like [Camelina sativa]
 ref|XP_010446677.1| PREDICTED: cytochrome P450 81D11-like [Camelina sativa]
Length=495

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 137/196 (70%), Gaps = 7/196 (4%)
 Frame = -1

Query  762  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINETl  583
            AGTET+ VT+EWAMS LL++PE+L K+R EID+ +G   L+ ESD+  LPYL+  ++ETL
Sbjct  300  AGTETSEVTLEWAMSNLLNHPEILEKVRAEIDDKIGSDRLIEESDIVNLPYLQNTVSETL  359

Query  582  rlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfEAIV  403
            RLYP  PLLLPH+S ++C VAGYD+P+ T ++ N WAMH DP +WEEPE+FKPERF    
Sbjct  360  RLYPAVPLLLPHFSSDECKVAGYDMPRGTLLLTNVWAMHRDPDLWEEPERFKPERF----  415

Query  402  GEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSP  223
              E EG   K +PFG GRRACP   +G RLV+LALG+ IQCF+W+   E+ +L  T    
Sbjct  416  --EKEGEAQKLIPFGMGRRACPGAELGKRLVTLALGSLIQCFEWERVGEE-LLDMTEAEG  472

Query  222  SILQKDERLEAICTPR  175
              + K   L A+C  R
Sbjct  473  ITMPKATPLRAMCKTR  488



>emb|CDX72625.1| BnaC07g46470D [Brassica napus]
Length=498

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 128/170 (75%), Gaps = 6/170 (4%)
 Frame = -1

Query  762  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINETl  583
            AGT+T+S+T+EWA+S LL++P++L K R EID+ +G   L++ESD+  LPYL+ +++ETL
Sbjct  300  AGTDTSSITLEWALSNLLNHPKILEKARAEIDDKIGSDRLIDESDIENLPYLQYIVSETL  359

Query  582  rlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfEAIV  403
            RLYPP PLLLPHYS +DC VAGYD+P+ T ++ N WAMH DP VWEE E+FKPERF    
Sbjct  360  RLYPPVPLLLPHYSSDDCKVAGYDMPRGTMLLTNVWAMHRDPGVWEEAERFKPERF----  415

Query  402  GEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKED  253
              E EG   K +PFG GRRACP   +G RLVSLALG  IQCF+W+   E+
Sbjct  416  --EKEGEAQKLMPFGMGRRACPGVELGKRLVSLALGCLIQCFEWERVGEE  463



>gb|KCW45256.1| hypothetical protein EUGRSUZ_L010952, partial [Eucalyptus grandis]
Length=239

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 137/195 (70%), Gaps = 9/195 (5%)
 Frame = -1

Query  762  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINETl  583
            AGT+T++VTIEWAMSLLL++P+V+ K + E+D+ VG   L++E D  KLPYL  +INE L
Sbjct  50   AGTDTSAVTIEWAMSLLLNHPDVMKKAQAELDDVVGRDRLVDEVDTHKLPYLHNIINEAL  109

Query  582  rlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfEAIV  403
            RL+PP PLL+PH S EDC V+G+DVP+ T ++VN WA+  DPKVW++P  FKPER+E + 
Sbjct  110  RLFPPGPLLVPHESAEDCTVSGFDVPRGTMILVNVWAIQRDPKVWDDPTSFKPERYEGLE  169

Query  402  GEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA--TYL  229
            G+      Y+ +PFG GRR+CP   +  R+VSLAL   IQC +WK   E+ +  +  T L
Sbjct  170  GDHA----YRLLPFGMGRRSCPGAGLANRVVSLALAVLIQCLEWKRVSEEPMDLSEGTGL  225

Query  228  SPSILQKDERLEAIC  184
            +   + K E LEA+C
Sbjct  226  T---MPKREPLEAMC  237



>dbj|BAF96951.1| flavone synthase II [Iris x hollandica]
Length=501

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 141/209 (67%), Gaps = 6/209 (3%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+T+S TIEWAMSLLL+  + L K R EID  VG + LL ESDL  LPYL+CVI 
Sbjct  299  LLQAGTDTSSDTIEWAMSLLLNNRDKLKKARDEIDARVGKERLLRESDLPNLPYLQCVIT  358

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRLYP APLL+PH S E+C V GY VP+ T ++VNA+A+H DP  W EPEKF+PERF 
Sbjct  359  ETLRLYPAAPLLVPHESAEECTVGGYAVPQGTMLLVNAYAIHRDPSTWVEPEKFEPERF-  417

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
                E+ EG   K + FG GRR CP   +G+R+VS+ LG  IQCF+W+   E+++   T 
Sbjct  418  ----EDREGEGNKTLAFGMGRRRCPGEGLGIRVVSIVLGTLIQCFEWERVGEEEV-DMTE  472

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
             S   L +   LEAIC PR++ +  L+ L
Sbjct  473  GSGLTLPRANPLEAICRPRQSMISVLAGL  501



>gb|KCW66347.1| hypothetical protein EUGRSUZ_F001732, partial [Eucalyptus grandis]
Length=206

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 140/200 (70%), Gaps = 5/200 (3%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+T++VTIEWAMSLLL++ +V+ K + E+D+ VG   L++E+D  KLP L  +IN
Sbjct  2    IIGAGTDTSAVTIEWAMSLLLNHLDVMKKAQVELDDIVGRDRLVDEADTHKLPCLHNIIN  61

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            E LRL+PP PLL+PH S EDC +AG+DVP+ T ++VNAWA+  DPKVW++P  FKPER+E
Sbjct  62   EALRLFPPGPLLVPHESAEDCTIAGFDVPRGTMILVNAWAIQRDPKVWDDPTNFKPERYE  121

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
             + G+      Y+ +PFG GRR+CP   +  R+VSLAL A IQCF+W+   E+ +  +  
Sbjct  122  GLEGDHA----YRLLPFGMGRRSCPGAGLANRVVSLALAALIQCFEWERVGEELVDLSEG  177

Query  231  LSPSILQKDERLEAICTPRK  172
               + + K E LEA+C  R+
Sbjct  178  TGLT-MPKREPLEALCKARE  196



>ref|XP_006339843.1| PREDICTED: cytochrome P450 81D1-like [Solanum tuberosum]
Length=500

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 135/176 (77%), Gaps = 5/176 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGTET+SVTIEWAMSLLL++PEVL K R EIDN+VG   L++E+DL KL YL+ +I
Sbjct  296  VMLNAGTETSSVTIEWAMSLLLNHPEVLEKARNEIDNHVGKDRLMDEADLPKLKYLQSII  355

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRL+P APLL+PH S +DC VAG+ +P+ T ++VNAW++H DP +WE+PE FKPERF
Sbjct  356  SETLRLFPAAPLLVPHESSDDCKVAGFHIPRGTMLLVNAWSIHRDPLLWEDPESFKPERF  415

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  247
            + +  E     ++K +PFG GRRACP + +  R+V LALG  IQCF+WK   E+++
Sbjct  416  DGVEVE-----SWKLLPFGMGRRACPGSGLAQRVVGLALGTMIQCFEWKRVGEEEV  466



>ref|XP_010437237.1| PREDICTED: cytochrome P450 81D11-like [Camelina sativa]
Length=498

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 143/208 (69%), Gaps = 7/208 (3%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+T++VT+EWA+S LL++PEVL+K R EID  +G   L++ESD+S LPYL+ +++
Sbjct  296  LILAGTDTSAVTLEWALSNLLNHPEVLNKARDEIDRTIGLDRLMDESDISNLPYLQNIVS  355

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRLYP  P+LLPH + EDC V GYD+P+ T ++ NAWA+H DP++W++P  FKPERF 
Sbjct  356  ETLRLYPAVPMLLPHVASEDCKVGGYDMPQGTILLTNAWAIHRDPQLWDDPTSFKPERF-  414

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
                 E EG  +K +PFG GRRACP + + LRLVSL LG  IQC +WK   E+++  +  
Sbjct  415  -----EKEGEAHKLMPFGLGRRACPGSVLALRLVSLTLGTLIQCLEWKRIGEEEVDMSES  469

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQ  148
                 + K + LEA+C  R    +F  +
Sbjct  470  -KGGTMPKAKPLEAMCRSRAFVGKFFHE  496



>gb|KHN12964.1| Cytochrome P450 81D1 [Glycine soja]
Length=343

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 133/199 (67%), Gaps = 6/199 (3%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            ++ AGTET++V +EWAMS LL+ PEVL K R E+D  VG   L+ E+D++KL YL+ +I+
Sbjct  144  LYVAGTETSAVALEWAMSNLLNSPEVLEKARVELDTQVGQDRLIEEADVTKLQYLQNIIS  203

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRL+PP  +LLPH S EDC V  YDVP++T +MVNAWA+H DPK+W +P  FKPERF 
Sbjct  204  ETLRLHPPLSMLLPHLSSEDCTVGSYDVPRNTMLMVNAWAIHRDPKIWADPTSFKPERF-  262

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
                E G    +K + FG GRRACP   M  R + L LG+ IQCF+WK   E+K+   T 
Sbjct  263  ----ENGPVDAHKLISFGLGRRACPGAGMAQRTLGLTLGSLIQCFEWKRIGEEKV-DMTE  317

Query  231  LSPSILQKDERLEAICTPR  175
               +I+ K   L+A C  R
Sbjct  318  GGGTIVPKAIPLDAQCKAR  336



>emb|CDP19800.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 140/211 (66%), Gaps = 8/211 (4%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT TTS T+EWA+S LL++P VL K R E++  +   HLLN+SDLSKLPYLRC+I
Sbjct  265  LMLSAGTHTTSQTMEWALSSLLNHPNVLQKARDELEK-MQPGHLLNDSDLSKLPYLRCII  323

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLRL+P AP L+PH+S EDC +  Y+VPK TT++VN WA+H DP VWEEP K+KPERF
Sbjct  324  NETLRLFPAAPTLVPHFSSEDCTIGRYEVPKGTTLLVNVWAIHRDPNVWEEPNKYKPERF  383

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E +  E G    +KF+PFG GRR CP   M +RL  L LG  IQCF+W+    + +    
Sbjct  384  EGM-DEGGWNEGFKFLPFGKGRRICPGAAMAIRLAGLTLGTLIQCFEWQRVGPE-MKTGI  441

Query  234  YLSPSILQ-----KDERLEAICTPRKNCLQF  157
            +  P++ +     K ER E I     N L F
Sbjct  442  HGDPNVWEEANKFKPERFEVIYDEGSNFLPF  472



>ref|XP_006466538.1| PREDICTED: isoflavone 2'-hydroxylase-like [Citrus sinensis]
Length=518

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 139/200 (70%), Gaps = 7/200 (4%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+TT+VT+EWAMS L+++P+VL K   E+D +VG +HL +E DLSKL YL C+I+
Sbjct  314  MLLAGTDTTAVTMEWAMSNLVNHPDVLQKATAELDTHVGQQHLFDEPDLSKLKYLHCIIS  373

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRLYP APLL+PH S +DCVV G+DVP+ TT++VN WA+H DP +W+EP KFKPERF 
Sbjct  374  ETLRLYPTAPLLVPHRSSDDCVVGGFDVPRDTTLLVNVWAIHRDPGLWDEPTKFKPERF-  432

Query  411  AIVGEEGEGFNYKF-VPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                E GE   +K  +PFG GRRACP   +  RLV L LG+ IQCF+W+     KI   T
Sbjct  433  ----ENGESEAHKLMMPFGLGRRACPGMGLAQRLVGLTLGSLIQCFEWERIGCQKI-DMT  487

Query  234  YLSPSILQKDERLEAICTPR  175
                  + K E LE +C PR
Sbjct  488  EGKGITMPKAEALEVMCKPR  507



>dbj|BAN19900.1| cytochrome P450 [Echinochloa phyllopogon]
Length=524

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 140/209 (67%), Gaps = 6/209 (3%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGTETTS T+EW MSLLL++P+VL K + EID+NVG   LL+++D+  LPYL C+IN
Sbjct  322  LLSAGTETTSTTMEWTMSLLLNHPDVLKKAQEEIDSNVGGGRLLDKNDIPHLPYLHCIIN  381

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRLYP  P+LLPH +  DC + GYDVP  + V+VNA+A+H DP +WE+PE+F+PERF 
Sbjct  382  ETLRLYPVVPMLLPHEASTDCKIHGYDVPAGSMVLVNAYAIHRDPVIWEDPEEFRPERF-  440

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
                E G       +PFG GRR CP  N+ +R + L LG  +QCFDW    + ++  AT 
Sbjct  441  ----EHGRAEGKFIMPFGMGRRKCPGENLAMRTMGLVLGVLLQCFDWSRIGDGEVDMATG  496

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
             + +I+ K   LEA+C PR N    L ++
Sbjct  497  -TGAIMFKAVPLEALCKPRANMSALLQEI  524



>ref|XP_011099321.1| PREDICTED: cytochrome P450 81D1-like [Sesamum indicum]
Length=498

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 142/205 (69%), Gaps = 6/205 (3%)
 Frame = -1

Query  762  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINETl  583
            AGT+T++VTIEWAMSLLL++P+VL K + E+D+ VGH  L++E DL  L YLR +I ET 
Sbjct  294  AGTDTSTVTIEWAMSLLLNHPQVLQKAKLELDSQVGHHRLVDEQDLPNLHYLRNIILETF  353

Query  582  rlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfEAIV  403
            RL+P  PL++P  S  DC V GYD+P+ T ++VNAWA+H DP+VW EP  FKPERF+   
Sbjct  354  RLFPAGPLVVPRESSADCRVGGYDIPRGTILLVNAWAIHRDPEVWSEPMSFKPERFD---  410

Query  402  GEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSP  223
            G+E E    K +PFG GRRACP   +G R+V LAL + IQCF+W+    +++  A  +  
Sbjct  411  GKEVE--TQKLMPFGMGRRACPGAGLGQRMVGLALASLIQCFEWERVGLEEVDLAEGVGL  468

Query  222  SILQKDERLEAICTPRKNCLQFLSQ  148
            + + K + LEA+C PR+  L+ L +
Sbjct  469  T-MPKFKPLEAVCRPRQVMLKVLQE  492



>ref|XP_010424701.1| PREDICTED: cytochrome P450 81D1-like [Camelina sativa]
Length=426

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 148/210 (70%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AG++T+ VT+EWAMSLLL++P+ L K+R EI +NV HK L+ +SDLS LPYLRCV+
Sbjct  221  LMFNAGSDTSPVTMEWAMSLLLNHPDQLEKVREEIKSNVKHKGLIQDSDLSSLPYLRCVM  280

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             ETLRLYP APLL PH S +   +  Y+ P++T ++VNAWA+H D ++WEE + FKPERF
Sbjct  281  YETLRLYPAAPLLPPHCSSKKFNLGNYEFPENTVLLVNAWAVHRDSELWEEADVFKPERF  340

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E  VG+  +GF  +F+PFG GRRACPA  + +RLVSL +GA +QCF+W+  + + I    
Sbjct  341  EGFVGDR-DGF--RFLPFGVGRRACPAAGLAMRLVSLVVGALVQCFEWEKVENEDIDMRP  397

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
              S + + + E L A+  P    +  LSQL
Sbjct  398  AFSVA-MTRAEPLVALPKPWPEMVPILSQL  426



>ref|NP_189516.1| cytochrome P450 CYP81D11 [Arabidopsis thaliana]
 sp|Q9LHA1.1|C8D11_ARATH RecName: Full=Cytochrome P450 81D11 [Arabidopsis thaliana]
 dbj|BAB03171.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAK92784.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AAM44917.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AEE77485.1| cytochrome P450 CYP81D11 [Arabidopsis thaliana]
Length=509

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 144/200 (72%), Gaps = 6/200 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T++ T+EWAMS LL++PEVL K + EID+ +G   L+ E D+ KLPYL+ ++
Sbjct  304  VMILAGTDTSAGTLEWAMSNLLNHPEVLRKAKTEIDDQIGVDRLVEEQDIVKLPYLQHIV  363

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRLYP AP+LLPH + EDC+V GYDVP+ T ++VNAWA+H DPK+WEEPEKFKPERF
Sbjct  364  SETLRLYPVAPMLLPHLASEDCIVDGYDVPRGTIILVNAWAIHRDPKLWEEPEKFKPERF  423

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                  E +G + K +PFG GRR+CP + +  RLV+LALG+ +QCF+W+  +E  +    
Sbjct  424  ------EKKGEDKKLMPFGIGRRSCPGSGLAQRLVTLALGSLVQCFEWERVEEKYLDMRE  477

Query  234  YLSPSILQKDERLEAICTPR  175
                + ++K   L+A+C  R
Sbjct  478  SEKGTTMRKATSLQAMCKAR  497



>ref|XP_010692651.1| PREDICTED: cytochrome P450 81D1-like [Beta vulgaris subsp. vulgaris]
Length=391

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 98/209 (47%), Positives = 141/209 (67%), Gaps = 4/209 (2%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            + +  AGTET+S T+EWA++LLL+ PEVL+K + EID +     L+ ESDL  LPYL C+
Sbjct  187  ETLLLAGTETSSTTMEWALALLLNNPEVLNKAQKEIDQHTRSDRLIEESDLVHLPYLHCI  246

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            INETLR+YP AP+L P  S  DCVV GY VP+ T + +N WAM +DP +W+ P KF PER
Sbjct  247  INETLRMYPAAPILPPRESSSDCVVGGYHVPQGTMLTLNIWAMQNDPNIWDNPSKFCPER  306

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
            FE I   +GE   Y+F+PFG+GRRACP  N+ +R++ L LG+ IQCF+W+   ++++   
Sbjct  307  FENI---KGERIGYQFIPFGSGRRACPGENLAMRIIGLTLGSLIQCFEWEKLGKEEVDMK  363

Query  237  TYLSPSILQKDERLEAICTPRKNCLQFLS  151
              +  + + K   L+A C  R + ++ L+
Sbjct  364  ETVGVT-MWKSSPLQAKCRRRSSMIKLLA  391



>ref|XP_010095331.1| Cytochrome P450 81D1 [Morus notabilis]
 gb|EXB59542.1| Cytochrome P450 81D1 [Morus notabilis]
Length=503

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 131/179 (73%), Gaps = 5/179 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  A T+T++VT+EWAMS LL++P +L K + E+D  +G + L+ ESDLSKL YL+ +I
Sbjct  296  ILLLAATDTSAVTLEWAMSNLLNHPNILKKAKAELDAQIGQQQLVEESDLSKLNYLQNII  355

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRLYP AP+L+PHYS +DC + GYDVP+ T ++VNAWA+H DPK+W++ E F PERF
Sbjct  356  SETLRLYPAAPMLVPHYSSDDCTIGGYDVPRGTILLVNAWAIHRDPKLWDDAESFIPERF  415

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
                 E GE  +YK  PFG GRR+CP   +  R+V L LG+ IQCF+W+ T E+++  A
Sbjct  416  -----ENGESESYKLFPFGLGRRSCPGIGLAQRVVGLTLGSLIQCFEWERTSEEEVDMA  469



>emb|CDP01241.1| unnamed protein product [Coffea canephora]
Length=505

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 142/208 (68%), Gaps = 4/208 (2%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+T+S T+EWA+SLLL+ P+VL K + EID   G   L+N+SDL +LPYL  +IN
Sbjct  301  MLSAGTDTSSGTMEWALSLLLNNPQVLKKAQQEIDAYGGQSRLINDSDLGQLPYLHAIIN  360

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLR+ P AP+L+PH S + C V GY++P  T ++VN WAM +DPKVWEEP KF+PERF 
Sbjct  361  ETLRICPVAPILVPHVSSQQCSVGGYNIPGGTLLLVNLWAMQNDPKVWEEPTKFRPERFI  420

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
            ++   EG+   + F+PFG GRR CP  N+ +R+V L LG  IQCF+W+   E+ ++  T 
Sbjct  421  SL---EGQRDGFAFMPFGFGRRGCPGENLAMRVVGLTLGLLIQCFEWERVGEE-LVDMTE  476

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQ  148
             +   + + + L A C PR+  ++ LSQ
Sbjct  477  GAGLTMPRAKELMAKCKPRQEMVKLLSQ  504



>gb|KCW66326.1| hypothetical protein EUGRSUZ_F00151 [Eucalyptus grandis]
Length=403

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 142/200 (71%), Gaps = 5/200 (3%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+T++VTIEWAMSLLL++P+V+ K + ++D+ VG   L NE+D+ KLP L+ +IN
Sbjct  199  ILSAGTDTSTVTIEWAMSLLLNHPDVMKKAQAKLDDIVGRDRLANEADIQKLPCLQNIIN  258

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            E LRL+PPAPLL+PH S EDC+V G++VP+ T ++VNAWA+  DPKVW++P  F P+R++
Sbjct  259  EVLRLFPPAPLLVPHESAEDCMVGGFNVPRGTMILVNAWAIQRDPKVWDDPTSFIPKRYQ  318

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
             +     E   Y+ +PFG GRR+CP   +  R+VSLAL A IQCF+W+   E+ +  +  
Sbjct  319  GL----EEDHAYRLLPFGMGRRSCPGAGLANRVVSLALAALIQCFEWERIGEEPVDLSEG  374

Query  231  LSPSILQKDERLEAICTPRK  172
            +  + + K E LEA+C  R+
Sbjct  375  MGIT-MPKREPLEALCKVRE  393



>ref|XP_002510140.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52327.1| cytochrome P450, putative [Ricinus communis]
Length=504

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 135/207 (65%), Gaps = 14/207 (7%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+T++VTIEWAMSLLL++P+ L K R E+D +VG   L++E DL KL YL C+IN
Sbjct  303  MLTAGTDTSAVTIEWAMSLLLNHPKALTKARAELDIHVGQDRLVDEQDLPKLQYLHCIIN  362

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRL+P APLL+PH S +DC + G+D+P+ T + VNAWA+H DPK+W        E   
Sbjct  363  ETLRLFPAAPLLVPHKSSDDCKIGGFDIPQGTVLSVNAWALHRDPKIW--------EDPN  414

Query  411  AIVGEEGEGFNYK---FVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILC  241
            +   E  EG  Y+    VPFG GRR+CP   +  R+V LAL A IQCFDW+   E++I  
Sbjct  415  SFRPERFEGIKYETCLLVPFGLGRRSCPGAGLANRVVGLALAALIQCFDWERITEEEI--  472

Query  240  ATYLSPSI-LQKDERLEAICTPRKNCL  163
                 P + + K + LEA+C  R++ +
Sbjct  473  DMLEGPGLTMPKVQPLEAMCKIRESMI  499



>dbj|BAP46307.1| cytochrome P450 [Phryma leptostachya]
Length=505

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 135/209 (65%), Gaps = 6/209 (3%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+ + VT EW MSLLL++PE++ K R E+D  VGH  L+ E DL KL YL C+I 
Sbjct  300  LIIAGTDASVVTSEWVMSLLLNHPEIMEKARKELDTLVGHDRLVEEHDLQKLRYLHCIIL  359

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRLYP  P L+PH   +DC + GY++PK T ++VNAWA+H DPKVW+EP  FKPERFE
Sbjct  360  ETLRLYPSVPTLVPHVPSQDCQIGGYNIPKGTMILVNAWAIHRDPKVWDEPLSFKPERFE  419

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
             +  E      +K +PFG GRRACP   +  + V LA+ + IQCFDW+    DKI     
Sbjct  420  TLEVE-----THKLLPFGMGRRACPGAGLAQKYVGLAVASLIQCFDWERPSADKIDMTEG  474

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
               + L K + LEA+C PR   ++ L QL
Sbjct  475  FG-TTLPKAKTLEALCKPRNVMVKVLHQL  502



>ref|XP_011097392.1| PREDICTED: cytochrome P450 81E8-like [Sesamum indicum]
Length=488

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 140/206 (68%), Gaps = 6/206 (3%)
 Frame = -1

Query  762  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINETl  583
            AGT+ + V  EWAMSLLL++PEVL+K R E+D  +GH  L+ E DL KL YL C+I ETL
Sbjct  285  AGTDASVVASEWAMSLLLNHPEVLNKARQELDTQIGHDRLVEEQDLPKLNYLHCIILETL  344

Query  582  rlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfEAIV  403
            RL+PP P L+PH S +D  + GYD+P+ T ++VNAWA+H DPK+W++P  F+PERFE   
Sbjct  345  RLFPPVPTLVPHVSSQDFELGGYDIPRGTMIIVNAWAIHKDPKIWDDPLTFRPERFE---  401

Query  402  GEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSP  223
            G + E   +K +PFG GRRACP   +  + V LALG+ IQCFDW+ T  +KI   T  + 
Sbjct  402  GRQVE--THKLLPFGMGRRACPGAGLAQKFVGLALGSLIQCFDWERTSVEKI-DLTEGTG  458

Query  222  SILQKDERLEAICTPRKNCLQFLSQL  145
              L K + LEA+C PR    + L+Q+
Sbjct  459  ITLPKAKTLEAMCKPRTVMGKALAQV  484



>ref|XP_007207372.1| hypothetical protein PRUPE_ppa004635mg [Prunus persica]
 gb|EMJ08571.1| hypothetical protein PRUPE_ppa004635mg [Prunus persica]
Length=499

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 145/208 (70%), Gaps = 6/208 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T+++T+EWA+S LL+ P VL K++ E+D  +G ++L++E DLSKLPYL+ +I
Sbjct  298  VLLLAGTDTSAMTLEWALSNLLNNPHVLKKVKAELDAQLGQENLVDEPDLSKLPYLQSII  357

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRL P APLL+PH S EDC++ G+DVP+ T V++NAWA+H DP++W++PE F PERF
Sbjct  358  SETLRLCPAAPLLVPHLSSEDCIIGGFDVPRDTMVLINAWALHRDPQLWDDPESFMPERF  417

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                 E G+ F++K +PFG GRR+CP   +  R+V L LG+ IQCF+W+   E +I   T
Sbjct  418  -----ESGDNFSHKLLPFGLGRRSCPGVGLAQRVVGLTLGSLIQCFEWERVSEKEI-DMT  471

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLS  151
                  + K   LEA+C  R    + LS
Sbjct  472  EDKGLTMPKAVPLEAMCKSRLIARKVLS  499



>ref|XP_010679549.1| PREDICTED: isoflavone 2'-hydroxylase-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010679550.1| PREDICTED: isoflavone 2'-hydroxylase-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=503

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 140/201 (70%), Gaps = 7/201 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T+S T+EWAMSLLL+ P V++KL+ EID  +G   L+NE DL K+PYL+ VI
Sbjct  302  VLLVAGTDTSSATMEWAMSLLLNNPHVMNKLKSEIDIQIGQDELINELDLPKIPYLQNVI  361

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             ETLRL+P  PLLLPH S ++C + G+D+P  T +MVNAWA+H D   W+EP +FKPERF
Sbjct  362  LETLRLFPSVPLLLPHMSSDECQIGGFDIPSETMLMVNAWAIHRDTHQWDEPTQFKPERF  421

Query  414  EAIVGEEGEGFN-YKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
                 E+G+  + YK +PFG GRRACP  N+G R+V LALG+ IQCFDWK   +D++  A
Sbjct  422  -----EKGDVIDQYKLLPFGVGRRACPGANLGNRMVGLALGSLIQCFDWKRVGDDEVDMA  476

Query  237  TYLSPSILQKDERLEAICTPR  175
                 + + K   LEA+C  R
Sbjct  477  EGRGLN-MPKAHPLEALCKAR  496



>emb|CBI33749.3| unnamed protein product [Vitis vinifera]
Length=227

 Score =   162 bits (411),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 134/200 (67%), Gaps = 6/200 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+TT+ TIEWAMSLLL++P+VL K R E+D +VG   L  ESD  KL YLR +I
Sbjct  27   ILIFAGTDTTATTIEWAMSLLLNHPDVLKKARAELDTHVGKDRLTEESDFPKLQYLRSII  86

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRL+P  PLL+PH S ++C + G+D+P+ T ++VNAWA+H DPK W++P  FKPERF
Sbjct  87   SETLRLFPATPLLMPHISSDNCQIGGFDIPRGTILLVNAWAIHRDPKSWKDPTSFKPERF  146

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                 E  EG  YK +PFG GRRACP   +  R++ L LG  IQC++ +   E ++  A 
Sbjct  147  -----ENEEGEAYKLLPFGLGRRACPGAGLANRVIGLTLGLLIQCYELERASEKEVDMAE  201

Query  234  YLSPSILQKDERLEAICTPR  175
                + + K E LEA+C  R
Sbjct  202  GKGVT-MPKLEPLEAMCKAR  220



>ref|XP_002877127.1| cytochrome P450 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53386.1| cytochrome P450 family protein [Arabidopsis lyrata subsp. lyrata]
Length=501

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 143/200 (72%), Gaps = 6/200 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T++ T+EWAM+ LL++PEVL K + EID+ +G   L+ E D+ KLPYL+ ++
Sbjct  296  VMILAGTDTSAGTLEWAMANLLNHPEVLRKAKTEIDDQIGVDRLIEEQDIVKLPYLQNIV  355

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRLYP AP+LLPH + EDC+VAGYDVP+ T ++VNAWA+H DPK+WEEPEKFKPERF
Sbjct  356  SETLRLYPVAPMLLPHLASEDCMVAGYDVPRGTIILVNAWAIHRDPKLWEEPEKFKPERF  415

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                  E EG + K + FG GRR+CP + +  RLV+LALG+ +QCF+W+   E  +    
Sbjct  416  ------EKEGEDKKLISFGIGRRSCPGSGLAQRLVTLALGSLVQCFEWERVGEKFVDMRE  469

Query  234  YLSPSILQKDERLEAICTPR  175
                + ++K   L+A+C  R
Sbjct  470  SERGTTMRKATSLQAMCKTR  489



>ref|XP_004290938.1| PREDICTED: isoflavone 3'-hydroxylase-like [Fragaria vesca subsp. 
vesca]
Length=543

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 139/200 (70%), Gaps = 3/200 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGTET S T+EWAM+LLL++P+ ++K+R EID  VG   L+NE DL KL YL+ VI
Sbjct  340  VLLVAGTETASTTMEWAMALLLNHPDKMNKVRTEIDAKVGEHRLMNEQDLPKLNYLQNVI  399

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             E LR+YPP PLL+P  + EDCVV G+DVP+ T +M+NAWA+H DP+ WE+P +FKPERF
Sbjct  400  TEALRVYPPVPLLVPREASEDCVVGGFDVPRGTMLMINAWAIHRDPEFWEDPTEFKPERF  459

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E   GE GE   YK VPFG GRR CP + +  R ++LA+G  +Q F+W+   E+K+  + 
Sbjct  460  EGWSGEGGEA--YKIVPFGAGRRGCPGDVLAKRFIALAIGTLVQSFEWERISEEKVDMSE  517

Query  234  YLSPSILQKDERLEAICTPR  175
             L  S + +   L+A C PR
Sbjct  518  GLGIS-MPRIHPLDAFCKPR  536



>ref|XP_010047103.1| PREDICTED: isoflavone 2'-hydroxylase-like [Eucalyptus grandis]
Length=509

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 142/215 (66%), Gaps = 16/215 (7%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+TT+VTIEWAMSLLL++P V+ K + E+D+ +G   L NE+D+ KLPYL+ +IN
Sbjct  305  MLSAGTDTTAVTIEWAMSLLLNHPNVMKKAQAELDDVIGRDRLANEADIHKLPYLQNIIN  364

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            E LRL+PPAPLL+PH S EDC++ G++VP+ T ++VNAWA+  DPKVW        +   
Sbjct  365  EALRLFPPAPLLVPHESTEDCMIGGFNVPRGTMILVNAWAIQRDPKVW--------DEPT  416

Query  411  AIVGEEGEGFN----YKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKIL  244
            + + +  EG      Y+ +PFG GRR+CP   +  R++SLAL A IQCF+W+   E+ + 
Sbjct  417  SFIPKRYEGLEDDHAYRLLPFGMGRRSCPGAGLANRVLSLALAALIQCFEWERIGEEPVD  476

Query  243  CATYLSPSILQKDERLEAICTPRKNCL--QFLSQL  145
             +     ++  K E LEA+C  R+ C+    L+QL
Sbjct  477  LSEGTGITV-PKREPLEALCKVRE-CMIANVLTQL  509



>ref|XP_010936527.1| PREDICTED: isoflavone 2'-hydroxylase-like isoform X1 [Elaeis 
guineensis]
Length=528

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 136/209 (65%), Gaps = 6/209 (3%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +F AGT+T++ T EWAMSLLL+ PE LHK R EID  V  K LL E DL KLPYL  +IN
Sbjct  326  LFVAGTDTSTETTEWAMSLLLNNPEALHKARQEIDACVEQKRLLEEYDLPKLPYLNGIIN  385

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRLYP APLLLPH S EDCV+ GYD+P+ T ++VNAWA+H D  VW EP KF PERF 
Sbjct  386  ETLRLYPAAPLLLPHESHEDCVMGGYDIPRGTILLVNAWAIHRDANVWAEPTKFMPERFL  445

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
                E G       +PFG GRR CP   + +RL+ LALG  IQCF+W+     ++     
Sbjct  446  DGRAEGGMA-----LPFGMGRRKCPGEGLAMRLIGLALGTMIQCFEWERVGGGEVDMREG  500

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
             S   L K   LEA+C PR++ ++ L+ L
Sbjct  501  -SALTLPKFVPLEAMCRPRESMVEVLAWL  528



>emb|CDY04030.1| BnaC02g37450D [Brassica napus]
Length=502

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 139/201 (69%), Gaps = 6/201 (3%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            +++  AGT+T++ T+EWAMS LL++PEVL K + EID  +G   L+ E D+ KLPYL+ +
Sbjct  294  EVMILAGTDTSAATLEWAMSNLLNHPEVLKKAKTEIDEQIGLDRLIEEQDIVKLPYLQSI  353

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            ++ETLRLYP  P+LLPH + +DC+VA YDVP+ T ++VN WA+H DPK+WEEPEKFKPER
Sbjct  354  VSETLRLYPVVPMLLPHMASKDCMVADYDVPRKTILLVNVWAIHRDPKMWEEPEKFKPER  413

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
            F      E EG + K + FG GRRACP   +G RLV+LALG  +QCF+W+ T E+ +   
Sbjct  414  F------EKEGEDKKLMSFGMGRRACPGLGLGQRLVTLALGLLVQCFEWERTGEEYVDMT  467

Query  237  TYLSPSILQKDERLEAICTPR  175
                   + K   LEA+C  R
Sbjct  468  EAAKGITMHKSTSLEAMCRAR  488



>ref|XP_008780931.1| PREDICTED: isoflavone 2'-hydroxylase-like [Phoenix dactylifera]
Length=505

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 138/209 (66%), Gaps = 6/209 (3%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +F AGT+T+S TIEWAMSLLL+ PE L K + EID  VG++ LL ESD+S LPYL C+I 
Sbjct  303  LFLAGTDTSSSTIEWAMSLLLNNPEKLQKAQAEIDERVGNERLLEESDVSNLPYLHCIIR  362

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLR+ P  PLLLPH S  +CVV G++VP+ T ++VNA  +H DPKVW+EP KFKPERF 
Sbjct  363  ETLRICPAGPLLLPHESTNECVVGGFNVPRGTMLLVNAHYIHRDPKVWQEPTKFKPERF-  421

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
                E+GE      +PFG GRR CP   + +R V L LG  IQCF+WK   E+++   T 
Sbjct  422  ----EDGEDEGKLMIPFGMGRRRCPGEGLAMREVGLTLGTLIQCFEWKRVGEEQV-DMTE  476

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
             S   + K   LE +  PR+  ++ LS L
Sbjct  477  GSGLTMPKAVPLEGMYRPRRAMVRVLSGL  505



>ref|XP_010446668.1| PREDICTED: cytochrome P450 81D11-like [Camelina sativa]
 ref|XP_010446669.1| PREDICTED: cytochrome P450 81D11-like [Camelina sativa]
 ref|XP_010446670.1| PREDICTED: cytochrome P450 81D11-like [Camelina sativa]
 ref|XP_010446671.1| PREDICTED: cytochrome P450 81D11-like [Camelina sativa]
Length=499

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 143/208 (69%), Gaps = 7/208 (3%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+T++VT+EWA+S LL++PEVL+K R EID  VG   L++ESD+S LPYL+ +++
Sbjct  296  LILAGTDTSAVTLEWALSNLLNHPEVLNKARDEIDRTVGLDRLMDESDISNLPYLQNIVS  355

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRLYP  P+LLPH + EDC V GYD+P+ T ++ NAWA+H DP++W++P  FKPERF 
Sbjct  356  ETLRLYPAVPMLLPHVASEDCKVGGYDMPQGTILLTNAWAIHRDPQLWDDPTSFKPERF-  414

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
                 E EG  +K +PFG GRRACP + + LRLV+L LG  IQC +W+   E+K+  +  
Sbjct  415  -----EKEGEAHKLMPFGLGRRACPGSVLALRLVNLTLGTLIQCLEWERIGEEKVDMSES  469

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQ  148
                 + K + LEA+C  R    +F  +
Sbjct  470  -KGGTMPKAKPLEAMCRSRAFVGKFFHE  496



>ref|XP_008238634.1| PREDICTED: cytochrome P450 81D11-like [Prunus mume]
Length=496

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 139/201 (69%), Gaps = 6/201 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T++VT+EWAMS LL+ P+VL + R E+D  VG + L+ E D+SKLPYL+ +I
Sbjct  297  IMLLAGTDTSAVTLEWAMSNLLNRPDVLQRARAELDAQVGQERLVEEHDISKLPYLQSII  356

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ET RLYP AP+LLPH+S +DC + G+DVP+ T V++NAWA+H DPK+W++PE F PERF
Sbjct  357  SETFRLYPAAPMLLPHFSSDDCTIGGFDVPRGTMVLINAWAIHRDPKLWDDPESFIPERF  416

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
             +     GE  +++ +PFG GRR+CP + +  R V L LG+ IQCFDW    E +I  A 
Sbjct  417  RS-----GEDLSHQLMPFGLGRRSCPGSGLAQRTVGLTLGSLIQCFDWVRVSEKEIDMAE  471

Query  234  YLSPSILQKDERLEAICTPRK  172
                + + K   LE +C  R+
Sbjct  472  GKGLT-MPKLVPLEVMCKARR  491



>ref|XP_010531288.1| PREDICTED: isoflavone 2'-hydroxylase-like [Tarenaya hassleriana]
Length=500

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 125/177 (71%), Gaps = 4/177 (2%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            Q +  AGT+T+ VT+ WAM+ LL+YP VL K R EID+ VG   L++ESDL  LPYL+ +
Sbjct  294  QAMMLAGTDTSIVTLTWAMANLLNYPHVLDKARQEIDDRVGQTRLIDESDLPNLPYLQNI  353

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            I+ET RL PP P LLPHYS  DC V GY VP+ T ++VN WA+H DP VW +P+ F+PER
Sbjct  354  ISETFRLCPPGPFLLPHYSSADCTVGGYHVPRDTILLVNTWAIHRDPSVWPDPDSFRPER  413

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKI  247
            FE   GEE +   YK +PFG GRRACP   +GLR+V L LG+ +QCF+WK   ++ +
Sbjct  414  FEG--GEEVDA--YKLIPFGIGRRACPGGTLGLRIVGLTLGSLVQCFEWKTIGDEPV  466



>gb|KGN63299.1| hypothetical protein Csa_2G425760 [Cucumis sativus]
Length=372

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 139/208 (67%), Gaps = 4/208 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AG +T+SVT++WAM+ LL++PEVL K + EID  +G    + E+D++ L YL+ +I
Sbjct  165  VLLRAGIDTSSVTLDWAMTELLNHPEVLAKAKAEIDTKIGQDRTVEETDVANLNYLQAII  224

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ET RL+PPAP+LL HYS +DCVVAGY++P+ T ++VNA A+H DPK W++P  F+PER 
Sbjct  225  SETFRLHPPAPMLLTHYSSDDCVVAGYNIPRGTMLLVNASAIHRDPKSWDDPTSFRPER-  283

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
               +G   E    K +PFG GRRACP   MGLR+V L LG  IQC++WK    D +    
Sbjct  284  --FLGAGNELQTNKLIPFGVGRRACPGEIMGLRVVGLTLGLLIQCYEWKKHGYDNVDTTE  341

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLS  151
            Y   +IL K + +E +C PR    + LS
Sbjct  342  YGGITIL-KVKPVETMCKPRPVMAKLLS  368



>ref|XP_010652757.1| PREDICTED: isoflavone 2'-hydroxylase-like [Vitis vinifera]
Length=506

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 133/196 (68%), Gaps = 6/196 (3%)
 Frame = -1

Query  762  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINETl  583
            AGT+TT+ TIEWAMSLLL++P+VL K R E+D +VG   L+ ESD  KL YLR +I+ETL
Sbjct  310  AGTDTTATTIEWAMSLLLNHPDVLKKARAELDTHVGKDRLMEESDFPKLQYLRSIISETL  369

Query  582  rlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfEAIV  403
            RL+P  PLL+PH S ++C + GYD+P+ T ++VNAWA+H DPK W++   FKPERF    
Sbjct  370  RLFPATPLLIPHISSDNCQIGGYDIPRGTILLVNAWAIHRDPKSWKDATSFKPERF----  425

Query  402  GEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSP  223
             E GE   YK +PFG GRRACP   +  R++ L LG  IQC++W+   E ++  A     
Sbjct  426  -ENGESEAYKLLPFGFGRRACPGAGLANRVIGLTLGLLIQCYEWERVSEKEVDMAEGKGV  484

Query  222  SILQKDERLEAICTPR  175
            + + K E LEA+C  R
Sbjct  485  T-MPKLEPLEAMCKAR  499



>ref|XP_007018553.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY15778.1| Cytochrome P450 [Theobroma cacao]
Length=501

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 139/211 (66%), Gaps = 6/211 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T + T+EWAMS LL++PEVL   + E+D  VG   L++ESDL  LPYL C+I
Sbjct  296  VLLLAGTDTLAATLEWAMSFLLNHPEVLENAQTEMDAVVGQGRLMDESDLPNLPYLHCII  355

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             ET+R+ P  PLL+PH S +DCVV GY +P+ T +MVN WA+H+D   WEEP KFKPER 
Sbjct  356  RETMRIKPVGPLLIPHESSKDCVVGGYHIPRGTMLMVNLWAIHNDSNNWEEPTKFKPER-  414

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                G EG    +KF+PFG+GRR+CP   + +R+V L LG+ IQCF W+   ++ +    
Sbjct  415  --FEGLEGTKDGFKFMPFGSGRRSCPGEGLAMRMVGLTLGSLIQCFHWERIGKEMVDMTE  472

Query  234  YLSPSI-LQKDERLEAICTPRKNCLQFLSQL  145
               P + + K + L+A C PR+  +  LSQ+
Sbjct  473  --GPGLTMPKAQPLQAKCRPRQPMVNLLSQI  501



>emb|CDY04029.1| BnaC02g37440D [Brassica napus]
Length=500

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 137/200 (69%), Gaps = 6/200 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T+  T+EWAM+ LL++PEV  K R EI+  +G   L+ E D+ KLPYL+ ++
Sbjct  295  VMIIAGTDTSGGTLEWAMANLLNHPEVSKKARTEIEEQIGSDRLIEEQDIVKLPYLQNIM  354

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRLYP  P+LLPH + EDC+VAGYDVP+ T VMVNAWA H DP  WEEPEKFKPERF
Sbjct  355  SETLRLYPVVPMLLPHMASEDCIVAGYDVPRGTMVMVNAWAFHRDPNTWEEPEKFKPERF  414

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                  E EG + K + FG GRRACP + +  RLV+LALG+ +QCFDW+   E  +    
Sbjct  415  ------EKEGEDKKMLTFGMGRRACPGSGLAQRLVTLALGSLVQCFDWERADEKYVDMTE  468

Query  234  YLSPSILQKDERLEAICTPR  175
                +I++K   L+A+C  R
Sbjct  469  AEKGTIMRKATPLKAMCRAR  488



>dbj|BAN19901.1| cytochrome P450 [Echinochloa phyllopogon]
Length=522

 Score =   169 bits (428),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 139/205 (68%), Gaps = 6/205 (3%)
 Frame = -1

Query  759  GTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINETlr  580
            GTET+S T+EW M+LLL++PEVL K + EID+NVG   LL+++DL  LPYL C+INETLR
Sbjct  324  GTETSSTTMEWTMTLLLNHPEVLKKAQEEIDSNVGRGRLLDKNDLPHLPYLHCIINETLR  383

Query  579  lyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfEAIVG  400
            LYP AP+LLPH +  DC + GYDVP  + V+VNA+A+H DP +WE+PE+F+PERF     
Sbjct  384  LYPAAPMLLPHEASTDCKIHGYDVPAGSMVLVNAYAIHRDPAIWEDPEEFRPERF-----  438

Query  399  EEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSPS  220
            E G       +PFG GRR CP  N+ +R + L LG  +QCFDW    + +I  AT  + +
Sbjct  439  EHGRAEGKFMMPFGMGRRKCPGENLAMRTMGLVLGVLLQCFDWNRIGDGQIDMATG-TGT  497

Query  219  ILQKDERLEAICTPRKNCLQFLSQL  145
            I+ K   LEA+C PR +    L ++
Sbjct  498  IMFKAVPLEALCKPRTDMSALLKKI  522



>ref|XP_010095329.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXB59540.1| putative receptor-like protein kinase [Morus notabilis]
Length=1473

 Score =   173 bits (439),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 139/200 (70%), Gaps = 6/200 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T+SVT+EWAMS LL++P +L K + E+D  VG +HL+ ESDLSKL YL+ +I
Sbjct  297  IMLLAGTDTSSVTLEWAMSNLLNHPSILKKAKAELDAQVGQQHLVEESDLSKLNYLQNII  356

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRLYP  PLL+PHYS  DC V GYDVP+ T + +NAWA+H DPK+WE+ E FKPERF
Sbjct  357  SETLRLYPAVPLLVPHYSSGDCTVGGYDVPRGTVLFINAWAIHRDPKLWEDAESFKPERF  416

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                 E GE  +YK  PFG GRR+CP   +  R+V L LG+ IQCF+W+   E+++  A 
Sbjct  417  -----ENGESESYKLFPFGLGRRSCPGIGLAQRVVGLTLGSLIQCFEWERIGEEEVDMAE  471

Query  234  YLSPSILQKDERLEAICTPR  175
                + + K   LEA+C  R
Sbjct  472  GKGLT-MPKAVPLEALCKAR  490



>ref|XP_004970623.1| PREDICTED: isoflavone 2'-hydroxylase-like [Setaria italica]
Length=521

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 140/209 (67%), Gaps = 6/209 (3%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGTETTS T+EW M+LLL++P+VL K + EID+NVG   LL+++DL  LPYL C+IN
Sbjct  319  ILGAGTETTSTTMEWTMTLLLNHPDVLKKAQEEIDSNVGGDRLLDKNDLPHLPYLHCIIN  378

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRLYP AP+LLPH +  DC + GYDVP  + V+VNA+A+H DP +WE PE+F+PERF 
Sbjct  379  ETLRLYPAAPMLLPHEASTDCKIHGYDVPVGSMVLVNAYAIHRDPAIWENPEEFRPERF-  437

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
                E G       +PFG GRR CP  N+ +R + L LG  +QCFDW    + ++  AT 
Sbjct  438  ----EHGRAEGKFMMPFGMGRRKCPGENLAMRTMGLVLGVLLQCFDWSRIGDGEVDMATG  493

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
             + +I+ K   LEA+C PR +    L ++
Sbjct  494  -TGTIMFKAVPLEALCKPRAHMYAVLQKI  521



>ref|XP_010502942.1| PREDICTED: cytochrome P450 81D11-like isoform X1 [Camelina sativa]
Length=391

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 142/200 (71%), Gaps = 6/200 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T++ T+EWAMS LL++P+VL K + EIDN +G   L+ E D+ KLPYL+ ++
Sbjct  187  VMILAGTDTSAGTLEWAMSNLLNHPDVLQKAKTEIDNQIGLDSLIEEQDIVKLPYLQNIV  246

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRLYP AP+LLPH + EDCV+ GYDVP+ T ++VNAWA+H DPK+WEEP KFKPERF
Sbjct  247  SETLRLYPVAPMLLPHLASEDCVLDGYDVPRGTIILVNAWAIHRDPKLWEEPGKFKPERF  306

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
                  E +G + K + FG GRRACP + +  RLV+LALG+ IQ F+W+   E+ +    
Sbjct  307  ------EKKGEDKKLMAFGIGRRACPGSGLAQRLVTLALGSLIQSFEWERVGEEHLDMRE  360

Query  234  YLSPSILQKDERLEAICTPR  175
                + ++K + L+A+C  R
Sbjct  361  SEKGTTMRKAKSLQAMCRAR  380



>ref|XP_010432066.1| PREDICTED: cytochrome P450 81D11-like [Camelina sativa]
Length=498

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 143/208 (69%), Gaps = 7/208 (3%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+T++VT+EWA+S LL++PEVL+K R EID  VG   L++ESD+S LPYL+ +++
Sbjct  296  LILAGTDTSAVTLEWALSNLLNHPEVLNKTRDEIDRTVGLDRLIDESDISNLPYLQNIVS  355

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRLYP  P+LLPH + EDC V GYD+P+ T ++ NAWA+H DP++W+ P  FKPERF 
Sbjct  356  ETLRLYPAVPMLLPHVASEDCKVGGYDMPQGTILLTNAWAIHRDPQLWDNPTSFKPERF-  414

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
                 E EG  +K +PFG GRRACP + + LRLV+L LG  IQC +W+   E+++  +  
Sbjct  415  -----EKEGEAHKLMPFGLGRRACPGSVLALRLVNLTLGTLIQCLEWERIGEEEVDMSES  469

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQ  148
                 + K + LEA+C  R    +F ++
Sbjct  470  -KGGTMPKAKPLEAMCRSRAFVGKFFNE  496



>emb|CDP04571.1| unnamed protein product [Coffea canephora]
Length=500

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 139/200 (70%), Gaps = 6/200 (3%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T+SVTIEWA+SLLL++PEVL K R E+D  VG   L+ E DLS LPYL  +I
Sbjct  299  VMLTAGTDTSSVTIEWALSLLLNHPEVLEKARAELDAQVGTDRLIEEHDLSNLPYLHNII  358

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRLYPP P+L+PH S +DC + GY++P+ T ++VNAWA+H DP VW++P  FKP+RF
Sbjct  359  SETLRLYPPTPMLVPHESSDDCKIGGYNIPRGTILLVNAWAVHRDPNVWDDPISFKPDRF  418

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            + +  E  +      +PFG GRR+CP + +  R+V LALG+ IQ FDWK   +D+I  A 
Sbjct  419  DGLQVEPSQ-----LIPFGMGRRSCPGSGLARRVVGLALGSLIQSFDWKRISDDEIDLAE  473

Query  234  YLSPSILQKDERLEAICTPR  175
                S + K + LEA+C  R
Sbjct  474  GTGVS-MPKAKPLEAMCRAR  492



>ref|XP_011017526.1| PREDICTED: cytochrome P450 81D1-like [Populus euphratica]
Length=560

 Score =   169 bits (428),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 104/215 (48%), Positives = 150/215 (70%), Gaps = 4/215 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T+S  +EWA+SLLL++ EVL K + EID  +G   L++E+DL++LPYLR +I
Sbjct  290  VLLFAGTDTSSSIMEWALSLLLNHSEVLLKAQKEIDEYIGPDRLIDEADLAQLPYLRSII  349

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLR+YPPAPLL+PH S E+C+V G+ +P  T + VN WA+ +DPK+W +P+KF+PERF
Sbjct  350  NETLRMYPPAPLLVPHESSEECLVGGFRIPCGTMLFVNMWAIQNDPKIWLDPKKFRPERF  409

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
              + G   +GF  + +PFG GRR+CP   + LR+V LALG+ IQCF+W+    DK +  T
Sbjct  410  NGLKGAR-DGF--RLMPFGYGRRSCPGEGLALRMVGLALGSLIQCFEWQKMG-DKSVDMT  465

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL*IVFA  130
                  + K + L+AIC PR + L+  SQ  +VF 
Sbjct  466  ERPGFTMAKAQPLKAICRPRPSMLKLFSQPSLVFV  500



>ref|XP_010911255.1| PREDICTED: isoflavone 2'-hydroxylase-like [Elaeis guineensis]
Length=507

 Score =   168 bits (426),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 141/209 (67%), Gaps = 5/209 (2%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+T+S T+EWAMSLLL+ P+ L K R EID +VG+  LL E D+S LPYL+CVI 
Sbjct  304  LLAAGTDTSSDTVEWAMSLLLNNPQTLKKAREEIDAHVGNGRLLEEVDISNLPYLQCVIT  363

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLR+YP APLLLPH S ++C V G+ +P+   ++VNA+A+H DPKVWEEP KF PERF 
Sbjct  364  ETLRMYPAAPLLLPHESSQECSVGGFHIPRGMMLLVNAYAVHRDPKVWEEPTKFMPERF-  422

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
                E G+G     +PFG GRR CP   +G+ +V LALG  IQCF+W+   ++++     
Sbjct  423  ----EGGKGEGKLMIPFGMGRRRCPGEGLGMGVVGLALGTLIQCFEWEGIGKEEVDMTAG  478

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
             S   L K   LEA+  PR++ L  L++L
Sbjct  479  GSSLTLAKAIPLEALYRPRQSMLDTLTKL  507



>gb|KFK28144.1| hypothetical protein AALP_AA8G478000 [Arabis alpina]
Length=499

 Score =   168 bits (426),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 140/199 (70%), Gaps = 3/199 (2%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGTET++VT+EWAM+ LL +PEVL K R EID  +G   L++E D++ LPYL+ +++
Sbjct  296  MMLAGTETSAVTLEWAMTNLLKHPEVLKKARLEIDEKIGEDRLIDEPDIAILPYLQNIVS  355

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ET RL+P APLL+P    ED  + GYDVP++T V+VNAWA+H DP++WE+PEKF P+R++
Sbjct  356  ETFRLFPVAPLLIPRTPTEDMKIGGYDVPRNTIVLVNAWAIHRDPELWEDPEKFDPDRYD  415

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
               G   + + +K +PFG GRR CP   +G R+V+LALG+ IQCFDW+N KE +I  +  
Sbjct  416  DRCG--SDYYVHKLMPFGNGRRTCPGAGLGQRIVTLALGSLIQCFDWENLKEGEIDMSES  473

Query  231  LSPSILQKDERLEAICTPR  175
                + + D  L A+C PR
Sbjct  474  AGLGMRKMDP-LRAMCRPR  491



>dbj|BAF00654.1| cytochrome P450 like protein [Arabidopsis thaliana]
Length=485

 Score =   168 bits (425),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 151/210 (72%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AG++T+ VT+EWAM+LLL++P+ L K+R EI +NV HK ++ +SDLS LPYLRCVI
Sbjct  280  LMFNAGSDTSPVTMEWAMALLLNHPDKLDKVREEIKSNVKHKGIIQDSDLSSLPYLRCVI  339

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             ETLRL+P AP+L PH S +   +  Y++P++T ++VNAWA+H D ++WEE + FKPERF
Sbjct  340  YETLRLHPAAPILPPHCSSKRFNLGNYEIPENTVLLVNAWAVHRDGELWEEADVFKPERF  399

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E  VG+  +GF  +F+PFG GRRACPA  + +R+VSLA+GA +QCF+W+  +++ I    
Sbjct  400  EEFVGDR-DGF--RFLPFGVGRRACPAAGLAMRVVSLAVGALVQCFEWEKVEKEDIDMRP  456

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
              S + + + E L A+  P    +  LSQL
Sbjct  457  AFSVA-MDRAEPLIALLKPCPEMVPILSQL  485



>ref|XP_006374853.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP52650.1| cytochrome P450 family protein [Populus trichocarpa]
Length=511

 Score =   168 bits (426),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 142/200 (71%), Gaps = 4/200 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T+S T+EWA+SLLL++P VL K + EID ++GH  L++E DL++LPYLR ++
Sbjct  305  VLLLAGTDTSSATMEWALSLLLNHPRVLEKAQREIDEHIGHDRLMDEGDLAQLPYLRSIL  364

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            NETLR+YPPAPLL+PH S E+C+V G+ +P+ T + VN WA+ +DPK+W +P KF+PERF
Sbjct  365  NETLRMYPPAPLLIPHESSEECLVGGFRIPRGTMLSVNMWAIQNDPKIWPDPTKFRPERF  424

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            +     EG    +K +PFG GRR+CP   + L++V LALG+ +QCF W+    DK++  T
Sbjct  425  D---NPEGARDGFKLMPFGHGRRSCPGEGLALKVVGLALGSLLQCFKWQKI-SDKMVDMT  480

Query  234  YLSPSILQKDERLEAICTPR  175
                    K + LEAIC PR
Sbjct  481  EGPGFTSTKAQPLEAICRPR  500



>emb|CDY29547.1| BnaA03g53920D [Brassica napus]
Length=498

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 127/170 (75%), Gaps = 6/170 (4%)
 Frame = -1

Query  762  AGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINETl  583
            AGT+T+S+T+EWA++ LL++P++L K R EID+ +G   L++E D+  LPYL+ +++ETL
Sbjct  300  AGTDTSSITLEWALANLLNHPKILEKARAEIDDKIGSDRLIDEPDIENLPYLQYIVSETL  359

Query  582  rlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfEAIV  403
            RLYPP PLLLPHYS +DC VAGYD+P+ T ++ N WAMH DP VWEE E+FKPERF    
Sbjct  360  RLYPPVPLLLPHYSSDDCKVAGYDMPRGTMLLTNVWAMHRDPGVWEEAERFKPERF----  415

Query  402  GEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKED  253
              E EG   K +PFG GRRACP   +G RLVSLALG  IQCF+WK   E+
Sbjct  416  --EKEGDAQKLMPFGMGRRACPGVELGKRLVSLALGCLIQCFEWKRVGEE  463



>gb|KDO81584.1| hypothetical protein CISIN_1g015593mg [Citrus sinensis]
Length=404

 Score =   166 bits (421),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 138/197 (70%), Gaps = 4/197 (2%)
 Frame = -1

Query  735  IEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVINETlrlyppapll  556
            +EWA+SLLL++PE+L   + EIDN VGH  L++ESD+++LPYL  +INETLR+YPPAP+L
Sbjct  212  MEWALSLLLNHPEILKNAQREIDNQVGHGRLMDESDMARLPYLGSIINETLRMYPPAPML  271

Query  555  lPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfEAIVGEEGEGFNY  376
            +PH S ++C V GY +P+ TT++VN WA+ +DPK+WE+P KFKPER     G +G    +
Sbjct  272  MPHESSDECTVLGYSIPRGTTLLVNIWAIQNDPKIWEDPRKFKPER---FQGHQGARDGF  328

Query  375  KFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATYLSPSILQKDERL  196
            + +PFG+GRR CP   +GL++V LALG+ IQCF+W+   E+ +        + + K   L
Sbjct  329  RMMPFGSGRRGCPGEGLGLKMVGLALGSLIQCFEWERIGEEMVDMREGTGVT-MPKARPL  387

Query  195  EAICTPRKNCLQFLSQL  145
            +A C PR   +  LSQ+
Sbjct  388  QAKCLPRPTMVSLLSQI  404



>ref|XP_010070610.1| PREDICTED: isoflavone 2'-hydroxylase-like [Eucalyptus grandis]
 gb|KCW59498.1| hypothetical protein EUGRSUZ_H02246 [Eucalyptus grandis]
Length=506

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 144/209 (69%), Gaps = 5/209 (2%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCV  598
            Q +  AGT+T+SVT+EWA++ LL++  +L K R EID+ +G  HL++E DL+KLPYL+ +
Sbjct  303  QTILIAGTDTSSVTMEWALANLLNHSNILEKARMEIDSQIGQDHLIDELDLAKLPYLQNI  362

Query  597  INETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkper  418
            I ETLRL+PP PLL+PH+S +DC + GYDVP+ T VM+NAWA+H DP+ W +P  FKPER
Sbjct  363  ITETLRLHPPVPLLIPHHSSDDCTIGGYDVPRDTIVMINAWAIHRDPEQWPDPTAFKPER  422

Query  417  fEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCA  238
            FE+  G+     N   +PFG GRRACP   +  ++V L L + IQCF+WK T E+++   
Sbjct  423  FESGGGQ----MNRLMLPFGMGRRACPGAPLAHKMVGLTLASLIQCFEWKRTGEEEVDMG  478

Query  237  TYLSPSILQKDERLEAICTPRKNCLQFLS  151
                 + + K++ LEA+C  R+   + LS
Sbjct  479  EGEGLT-MPKEKPLEALCKAREILNRVLS  506



>ref|XP_010095332.1| Isoflavone 2'-hydroxylase [Morus notabilis]
 gb|EXB59543.1| Isoflavone 2'-hydroxylase [Morus notabilis]
Length=504

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 140/200 (70%), Gaps = 4/200 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGTET+SVT+EWAMS LL++P VL K++ E+D  VG ++L+ E DLSKL YL+  I
Sbjct  295  VLLLAGTETSSVTLEWAMSNLLNHPHVLKKVKAELDTQVGQQNLVEEPDLSKLQYLQNTI  354

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
            +ETLRLYP  PLL+PHYS +DC +AGY+VP+ T ++VNAWA+H DPK+W++ E FKPERF
Sbjct  355  SETLRLYPATPLLVPHYSSDDCTIAGYNVPRDTILLVNAWAIHRDPKLWDDAESFKPERF  414

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E     EG+  N K +PFG GRRACP   +  R+V L L + IQCFDW    ++K+  A 
Sbjct  415  E--THHEGDQIN-KLLPFGLGRRACPGAGLAQRVVGLTLASLIQCFDWGRVNDEKVDMAE  471

Query  234  YLSPSILQKDERLEAICTPR  175
                + + K   LEA+C  R
Sbjct  472  GRGLT-MPKAVPLEAMCKAR  490



>ref|XP_009354137.1| PREDICTED: cytochrome P450 81D11-like [Pyrus x bretschneideri]
Length=507

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 144/212 (68%), Gaps = 5/212 (2%)
 Frame = -1

Query  777  QMVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHK-HLLNESDLSKLPYLRC  601
            Q++  AGT+T+S T+EWA+SLLL+ PE L K + EIDN++G    LL ESDL KLPYL+ 
Sbjct  300  QVMLTAGTDTSSGTMEWALSLLLNNPEALAKAQTEIDNHIGQSCRLLEESDLPKLPYLQG  359

Query  600  VINETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkpe  421
            +I+ETLR+YP  PLL PH S EDC V G+ VP+ T ++VN WA+ H+PK+W +P++FKPE
Sbjct  360  IISETLRMYPTGPLLAPHESSEDCTVGGFHVPRRTMLLVNIWAIQHNPKLWAQPDQFKPE  419

Query  420  rfEAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILC  241
            RF  +  EE +GF +  +PFG GRR CP   +  R+V LALG+ IQCF+W+   E+ +  
Sbjct  420  RFHNL-QEERDGFVW--LPFGAGRRGCPGEGLATRIVGLALGSLIQCFEWERIGEEMVDM  476

Query  240  ATYLSPSILQKDERLEAICTPRKNCLQFLSQL  145
            +     + + + + L A C PR   L  LSQL
Sbjct  477  SEGTGLT-MPRAQPLLAKCRPRPKMLALLSQL  507



>ref|XP_008787116.1| PREDICTED: isoflavone 2'-hydroxylase-like [Phoenix dactylifera]
Length=512

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 134/209 (64%), Gaps = 6/209 (3%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +F AGT+T++ T+EWAMSLLL+ PE L K R EID  V  K LL E DL KLPYL  +IN
Sbjct  310  LFVAGTDTSTETLEWAMSLLLNNPEALQKARLEIDAWVAEKRLLEEHDLPKLPYLNGIIN  369

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRL P APLLLPH S ED V+ GYD+P+   ++VNAWA+H DP VW EP KF PERF 
Sbjct  370  ETLRLCPVAPLLLPHESQEDSVLGGYDIPRGAILLVNAWAIHRDPNVWAEPTKFMPERFL  429

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
                E G       +PFG GRR CP   + +R+  LALGA IQCF+W+    +++  +  
Sbjct  430  GGRAERGMA-----LPFGMGRRKCPGEGLAMRVTGLALGAMIQCFEWERVGGEEVDMSEG  484

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
             S   L K   L A+C PR++  + L +L
Sbjct  485  -SAVTLPKAIPLVAMCRPRQSTAEVLGRL  512



>dbj|BAE48235.1| cytochrome P450 [Sesamum radiatum]
Length=506

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 137/209 (66%), Gaps = 6/209 (3%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+ + VT EWAMSL+L++P+VL K R E+D  VGH+ +++E DL KL YL C++ 
Sbjct  301  LIIAGTDASVVTTEWAMSLILNHPQVLEKARKELDTLVGHERMVDEHDLPKLRYLHCIVL  360

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRL+P  P L+PH   EDC + GY+VPK T ++VNAWA+H DPKVW++P  FKP+RF 
Sbjct  361  ETLRLFPSVPTLVPHEPSEDCKIGGYNVPKGTMILVNAWAIHRDPKVWDDPLSFKPDRF-  419

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
                E  E   +K +PFG GRRACP   +  + V LALG+ IQCF+W+    +KI     
Sbjct  420  ----ETMEVETHKLLPFGMGRRACPGAGLAQKFVGLALGSLIQCFEWERMSAEKIDLNEG  475

Query  231  LSPSILQKDERLEAICTPRKNCLQFLSQL  145
             S   L K + LEA+C PR    + L Q+
Sbjct  476  -SGITLPKAKTLEAMCKPRHIMERVLRQV  503



>ref|XP_008444122.1| PREDICTED: cytochrome P450 81D1-like [Cucumis melo]
Length=506

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 134/200 (67%), Gaps = 1/200 (1%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AGT+T+  T+EWAMSLLL++P+VL K + EID  VG K  + ESDL KLPYL+CVI
Sbjct  301  VMLSAGTDTSVGTMEWAMSLLLNHPDVLGKAQEEIDEIVGKKRHIEESDLEKLPYLQCVI  360

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             ET+R+YP  PLL+PH S  DC V GY +P+ T +MVNAWA+H+D  +WEE   FKPERF
Sbjct  361  KETMRMYPAGPLLVPHESSADCTVGGYHIPRGTMLMVNAWAIHNDAGLWEEAAVFKPERF  420

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
             A    EG+G   K++ FG GRR CP   + +++V L LG+ IQCF+W+   E+ +    
Sbjct  421  LAAAAAEGDGTGLKYMVFGAGRRGCPGEGLAMKVVGLVLGSLIQCFEWERIGEEMVDMGE  480

Query  234  YLSPSILQKDERLEAICTPR  175
                S + K   L+A C+PR
Sbjct  481  GTGLS-MPKACPLQAKCSPR  499



>ref|NP_196622.2| cytochrome P450, family 81, subfamily K, polypeptide 2 [Arabidopsis 
thaliana]
 gb|AED91568.1| cytochrome P450, family 81, subfamily K, polypeptide 2 [Arabidopsis 
thaliana]
Length=516

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 151/210 (72%), Gaps = 4/210 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++F AG++T+ VT+EWAM+LLL++P+ L K+R EI +NV HK ++ +SDLS LPYLRCVI
Sbjct  311  LMFNAGSDTSPVTMEWAMALLLNHPDKLDKVREEIKSNVKHKGIIQDSDLSSLPYLRCVI  370

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             ETLRL+P AP+L PH S +   +  Y++P++T ++VNAWA+H D ++WEE + FKPERF
Sbjct  371  YETLRLHPAAPILPPHCSSKRFNLGNYEIPENTVLLVNAWAVHRDGELWEEADVFKPERF  430

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            E  VG+  +GF  +F+PFG GRRACPA  + +R+VSLA+GA +QCF+W+  +++ I    
Sbjct  431  EEFVGDR-DGF--RFLPFGVGRRACPAAGLAMRVVSLAVGALVQCFEWEKVEKEDIDMRP  487

Query  234  YLSPSILQKDERLEAICTPRKNCLQFLSQL  145
              S + + + E L A+  P    +  LSQL
Sbjct  488  AFSVA-MDRAEPLIALLKPCPEMVPILSQL  516



>ref|XP_010105470.1| Cytochrome P450 81D1 [Morus notabilis]
 gb|EXC04826.1| Cytochrome P450 81D1 [Morus notabilis]
Length=541

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 141/211 (67%), Gaps = 5/211 (2%)
 Frame = -1

Query  774  MVFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVI  595
            ++  AG +T+S T+EWAMSLLL++PEVL K   E++N VG++ L+ ESDL  LPYL C++
Sbjct  335  VLLAAGIDTSSGTMEWAMSLLLNHPEVLKKAHIELENCVGNERLVEESDLKNLPYLHCIL  394

Query  594  NETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperf  415
             ETLRLYP   LL+PH S ++C V+G+++P+ T + VN WAM  DPK+W++P  FKPERF
Sbjct  395  KETLRLYPAGTLLVPHESSDECKVSGFNIPRGTMLFVNLWAMQRDPKLWDDPTTFKPERF  454

Query  414  EAIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCAT  235
            + +  EEG    YK +PFG+GRR CP  N+ +R+V L LG  IQCF+W+   ++  L   
Sbjct  455  KDM--EEGMRDGYKLMPFGSGRRGCPGENLAVRIVELTLGLLIQCFEWERVGKE--LVDM  510

Query  234  YLSPSI-LQKDERLEAICTPRKNCLQFLSQL  145
               P + + K   L+A C PR      LSQ+
Sbjct  511  TEGPGLTMPKAHPLQAKCRPRPTMANILSQI  541



>ref|XP_012079324.1| PREDICTED: cytochrome P450 81E8-like [Jatropha curcas]
 gb|KDP32012.1| hypothetical protein JCGZ_12473 [Jatropha curcas]
Length=500

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 137/199 (69%), Gaps = 6/199 (3%)
 Frame = -1

Query  771  VFXAGTETTSVTIEWAMSLLLSYPEVLHKLRYEIDNNVGHKHLLNESDLSKLPYLRCVIN  592
            +  AGT+T+SVT+EWAMS LL++P  L + R EIDN +G   L++ESDLSKLPYL+ +I 
Sbjct  301  ILFAGTDTSSVTLEWAMSNLLNHPSKLRRARDEIDNQIGQDCLIDESDLSKLPYLQKIIL  360

Query  591  ETlrlyppaplllPHYSLEDCVVAGYDVPKHTTVMVNAWAMHHDPKVWeepekfkperfE  412
            ETLRLYP APLL+PH S +D  + GYDVP+ T ++VNAWA+H DP  W++P  +KPERF 
Sbjct  361  ETLRLYPAAPLLVPHMSSDDSTIGGYDVPRGTILLVNAWAIHRDPTQWDDPSSYKPERFG  420

Query  411  AIVGEEGEGFNYKFVPFGTGRRACPANNMGLRLVSLALGAYIQCFDWKNTKEDKILCATY  232
                  GE  N+K +PFG GRR+CP + +  RL+ L LG  IQCF+WK T E+++     
Sbjct  421  -----NGEEENFKLMPFGLGRRSCPGDGLAHRLMGLTLGLLIQCFEWKRTTEEEVDMVEG  475

Query  231  LSPSILQKDERLEAICTPR  175
                I+ K + LEA+C  R
Sbjct  476  RG-LIMPKAKPLEAMCRAR  493



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1566421839775