BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4057

Length=924
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009790276.1|  PREDICTED: bifunctional purple acid phosphat...    397   3e-132   Nicotiana sylvestris
ref|XP_009790275.1|  PREDICTED: bifunctional purple acid phosphat...    397   4e-132   Nicotiana sylvestris
emb|CDP10471.1|  unnamed protein product                                395   2e-131   Coffea canephora [robusta coffee]
ref|XP_009604288.1|  PREDICTED: bifunctional purple acid phosphat...    394   4e-131   Nicotiana tomentosiformis
gb|KDO73458.1|  hypothetical protein CISIN_1g011679mg                   384   3e-129   Citrus sinensis [apfelsine]
ref|XP_004251734.1|  PREDICTED: bifunctional purple acid phosphat...    389   3e-129   Solanum lycopersicum
gb|KDO73459.1|  hypothetical protein CISIN_1g011679mg                   382   5e-129   Citrus sinensis [apfelsine]
ref|XP_010557615.1|  PREDICTED: bifunctional purple acid phosphat...    388   5e-129   Tarenaya hassleriana [spider flower]
ref|XP_009631333.1|  PREDICTED: bifunctional purple acid phosphat...    388   7e-129   Nicotiana tomentosiformis
ref|XP_006350121.1|  PREDICTED: bifunctional purple acid phosphat...    386   3e-128   Solanum tuberosum [potatoes]
ref|XP_004287267.1|  PREDICTED: bifunctional purple acid phosphat...    385   6e-128   Fragaria vesca subsp. vesca
ref|XP_006359491.1|  PREDICTED: bifunctional purple acid phosphat...    384   2e-127   Solanum tuberosum [potatoes]
ref|XP_006474401.1|  PREDICTED: bifunctional purple acid phosphat...    382   7e-127   
gb|KDO73456.1|  hypothetical protein CISIN_1g011679mg                   383   8e-127   Citrus sinensis [apfelsine]
ref|XP_006453106.1|  hypothetical protein CICLE_v10008153mg             382   9e-127   Citrus clementina [clementine]
ref|NP_001275256.1|  purple acid phosphatase 3 precursor                382   9e-127   Solanum tuberosum [potatoes]
ref|XP_009799030.1|  PREDICTED: bifunctional purple acid phosphat...    382   1e-126   Nicotiana sylvestris
ref|XP_006403101.1|  hypothetical protein EUTSA_v10003451mg             382   2e-126   Eutrema salsugineum [saltwater cress]
ref|XP_004242741.1|  PREDICTED: bifunctional purple acid phosphat...    380   5e-126   Solanum lycopersicum
ref|XP_006389431.1|  hypothetical protein POPTR_0025s00640g             380   7e-126   Populus trichocarpa [western balsam poplar]
ref|XP_010050094.1|  PREDICTED: bifunctional purple acid phosphat...    380   1e-125   Eucalyptus grandis [rose gum]
ref|XP_007013582.1|  Purple acid phosphatase 26 isoform 1               380   1e-125   
ref|XP_008242837.1|  PREDICTED: bifunctional purple acid phosphat...    380   1e-125   Prunus mume [ume]
ref|XP_007013583.1|  Purple acid phosphatase 26 isoform 2               379   2e-125   
ref|XP_007202018.1|  hypothetical protein PRUPE_ppa004955mg             379   2e-125   Prunus persica
ref|XP_007013584.1|  Purple acid phosphatase 26 isoform 3               379   2e-125   
ref|XP_010687874.1|  PREDICTED: bifunctional purple acid phosphat...    379   2e-125   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006381099.1|  hypothetical protein POPTR_0006s06250g             379   4e-125   Populus trichocarpa [western balsam poplar]
ref|XP_008242841.1|  PREDICTED: bifunctional purple acid phosphat...    377   7e-125   
ref|XP_007202017.1|  hypothetical protein PRUPE_ppa004955mg             375   8e-125   
ref|XP_010241604.1|  PREDICTED: bifunctional purple acid phosphat...    377   1e-124   
ref|XP_010241603.1|  PREDICTED: bifunctional purple acid phosphat...    377   1e-124   Nelumbo nucifera [Indian lotus]
ref|XP_011017866.1|  PREDICTED: bifunctional purple acid phosphat...    375   1e-124   Populus euphratica
ref|NP_198334.1|  purple acid phosphatase 26                            377   2e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870408.1|  ATPAP26/PAP26                                      377   2e-124   
ref|XP_010435389.1|  PREDICTED: bifunctional purple acid phosphat...    377   2e-124   Camelina sativa [gold-of-pleasure]
gb|KJB64666.1|  hypothetical protein B456_010G060100                    376   4e-124   Gossypium raimondii
ref|XP_012081169.1|  PREDICTED: bifunctional purple acid phosphat...    376   4e-124   Jatropha curcas
gb|KJB64663.1|  hypothetical protein B456_010G060100                    376   4e-124   Gossypium raimondii
gb|KJB64662.1|  hypothetical protein B456_010G060100                    375   4e-124   Gossypium raimondii
ref|XP_011017864.1|  PREDICTED: bifunctional purple acid phosphat...    375   6e-124   Populus euphratica
ref|XP_010440687.1|  PREDICTED: bifunctional purple acid phosphat...    375   1e-123   Camelina sativa [gold-of-pleasure]
ref|XP_003609435.1|  Purple acid phosphatase-like protein               374   2e-123   Medicago truncatula
gb|AFK47719.1|  unknown                                                 374   2e-123   Medicago truncatula
ref|XP_010450337.1|  PREDICTED: bifunctional purple acid phosphat...    373   4e-123   
ref|XP_011020214.1|  PREDICTED: bifunctional purple acid phosphat...    373   4e-123   Populus euphratica
gb|AGL44396.1|  calcineurin-like phosphoesterase                        372   5e-123   Manihot esculenta [manioc]
ref|XP_010435390.1|  PREDICTED: bifunctional purple acid phosphat...    372   7e-123   
gb|AAW29950.1|  putative purple acid phosphatase                        372   8e-123   Arabidopsis thaliana [mouse-ear cress]
gb|EYU40133.1|  hypothetical protein MIMGU_mgv1a005618mg                372   1e-122   Erythranthe guttata [common monkey flower]
gb|KHG11290.1|  Bifunctional purple acid phosphatase 26 -like pro...    372   2e-122   Gossypium arboreum [tree cotton]
gb|KJB64668.1|  hypothetical protein B456_010G060100                    372   2e-122   Gossypium raimondii
ref|XP_008362885.1|  PREDICTED: bifunctional purple acid phosphat...    371   3e-122   
ref|XP_010250242.1|  PREDICTED: bifunctional purple acid phosphat...    372   4e-122   Nelumbo nucifera [Indian lotus]
gb|KJB83219.1|  hypothetical protein B456_013G236000                    370   4e-122   Gossypium raimondii
ref|XP_010440689.1|  PREDICTED: bifunctional purple acid phosphat...    369   6e-122   
ref|XP_010450339.1|  PREDICTED: bifunctional purple acid phosphat...    369   1e-121   
ref|XP_006283714.1|  hypothetical protein CARUB_v10004784mg             369   1e-121   
gb|AET86956.1|  PAP26                                                   370   1e-121   Gossypium hirsutum [American cotton]
ref|XP_010648745.1|  PREDICTED: bifunctional purple acid phosphat...    369   2e-121   Vitis vinifera
gb|AGV54598.1|  acid phosphatase                                        369   2e-121   Phaseolus vulgaris [French bean]
gb|KCW79137.1|  hypothetical protein EUGRSUZ_C00583                     366   2e-121   Eucalyptus grandis [rose gum]
emb|CAN71549.1|  hypothetical protein VITISV_030234                     369   2e-121   Vitis vinifera
ref|XP_002264680.1|  PREDICTED: bifunctional purple acid phosphat...    369   2e-121   Vitis vinifera
ref|XP_007155068.1|  hypothetical protein PHAVU_003G170500g             369   3e-121   Phaseolus vulgaris [French bean]
emb|CBI25544.3|  unnamed protein product                                368   3e-121   Vitis vinifera
ref|XP_008362886.1|  PREDICTED: bifunctional purple acid phosphat...    368   3e-121   
ref|XP_002530765.1|  Iron(III)-zinc(II) purple acid phosphatase p...    367   1e-120   Ricinus communis
ref|XP_007155069.1|  hypothetical protein PHAVU_003G170500g             366   1e-120   Phaseolus vulgaris [French bean]
ref|XP_008336971.1|  PREDICTED: bifunctional purple acid phosphat...    367   2e-120   
ref|XP_002515485.1|  Iron(III)-zinc(II) purple acid phosphatase p...    366   2e-120   Ricinus communis
emb|CDY12397.1|  BnaC08g08080D                                          366   2e-120   Brassica napus [oilseed rape]
ref|XP_010047261.1|  PREDICTED: bifunctional purple acid phosphat...    365   3e-120   Eucalyptus grandis [rose gum]
ref|XP_009358556.1|  PREDICTED: bifunctional purple acid phosphat...    366   4e-120   Pyrus x bretschneideri [bai li]
ref|XP_009363959.1|  PREDICTED: bifunctional purple acid phosphat...    365   5e-120   Pyrus x bretschneideri [bai li]
ref|XP_004508439.1|  PREDICTED: bifunctional purple acid phosphat...    364   1e-119   Cicer arietinum [garbanzo]
ref|XP_009108064.1|  PREDICTED: bifunctional purple acid phosphat...    365   1e-119   Brassica rapa
emb|CDY47560.1|  BnaA08g07270D                                          364   1e-119   Brassica napus [oilseed rape]
ref|XP_011078422.1|  PREDICTED: bifunctional purple acid phosphat...    363   3e-119   
ref|XP_004508441.1|  PREDICTED: bifunctional purple acid phosphat...    363   4e-119   Cicer arietinum [garbanzo]
ref|XP_009108063.1|  PREDICTED: bifunctional purple acid phosphat...    364   4e-119   Brassica rapa
gb|EYU34962.1|  hypothetical protein MIMGU_mgv1a005843mg                362   7e-119   Erythranthe guttata [common monkey flower]
gb|AFY06665.1|  purple acid phosphatase                                 362   1e-118   Citrus trifoliata [hardy orange]
ref|XP_008373401.1|  PREDICTED: bifunctional purple acid phosphat...    361   2e-118   
ref|XP_011078424.1|  PREDICTED: bifunctional purple acid phosphat...    360   2e-118   
ref|XP_006371754.1|  hypothetical protein POPTR_0018s01990g             360   2e-118   
ref|XP_002324876.1|  hypothetical protein POPTR_0018s01990g             361   3e-118   
ref|XP_006483400.1|  PREDICTED: bifunctional purple acid phosphat...    360   4e-118   Citrus sinensis [apfelsine]
ref|XP_006450380.1|  hypothetical protein CICLE_v10008150mg             360   4e-118   Citrus clementina [clementine]
emb|CAD30328.1|  acid phosphatase                                       360   6e-118   Lupinus luteus
ref|NP_001236677.1|  purple acid phosphatase-like protein               361   7e-118   Glycine max [soybeans]
ref|XP_011036592.1|  PREDICTED: bifunctional purple acid phosphat...    360   9e-118   Populus euphratica
gb|AGL44397.1|  calcineurin-like phosphoesterase                        358   4e-117   Manihot esculenta [manioc]
dbj|BAJ92186.1|  predicted protein                                      355   4e-116   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008443931.1|  PREDICTED: bifunctional purple acid phosphat...    354   2e-115   Cucumis melo [Oriental melon]
ref|XP_011655340.1|  PREDICTED: bifunctional purple acid phosphat...    353   3e-115   Cucumis sativus [cucumbers]
gb|ACR23330.1|  mitochondrial acid phosphatase                          351   1e-114   Triticum aestivum [Canadian hard winter wheat]
gb|AET22430.1|  acid phosphatase                                        341   3e-114   Citrus maxima [buntan]
ref|XP_003563304.2|  PREDICTED: phosphoenolpyruvate phosphatase         352   7e-114   Brachypodium distachyon [annual false brome]
ref|XP_007011812.1|  Purple acid phosphatase 26 isoform 2               349   8e-114   
ref|XP_006593472.1|  PREDICTED: uncharacterized protein LOC100818...    349   1e-113   
ref|XP_007011811.1|  Purple acid phosphatase 26 isoform 1               349   1e-113   
gb|KHN47108.1|  Bifunctional purple acid phosphatase 26                 348   2e-113   Glycine soja [wild soybean]
gb|KDO73457.1|  hypothetical protein CISIN_1g011679mg                   348   2e-113   Citrus sinensis [apfelsine]
gb|AET22413.1|  acid phosphatase                                        338   3e-113   Citrus sinensis [apfelsine]
ref|XP_011626417.1|  PREDICTED: bifunctional purple acid phosphat...    348   5e-113   Amborella trichopoda
ref|XP_008795838.1|  PREDICTED: phosphoenolpyruvate phosphatase         347   7e-113   Phoenix dactylifera
gb|ERN14342.1|  hypothetical protein AMTR_s00033p00208170               348   7e-113   Amborella trichopoda
ref|NP_001239650.1|  uncharacterized protein LOC100818438 precursor     346   8e-113   Glycine max [soybeans]
ref|XP_009392136.1|  PREDICTED: phosphoenolpyruvate phosphatase-like    346   1e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010696563.1|  PREDICTED: bifunctional purple acid phosphat...    346   1e-112   
sp|Q93WP4.1|PEPP_ALLCE  RecName: Full=Phosphoenolpyruvate phospha...    346   2e-112   Allium cepa
ref|XP_004965755.1|  PREDICTED: phosphoenolpyruvate phosphatase-like    345   2e-112   Setaria italica
gb|EEC81063.1|  hypothetical protein OsI_23873                          345   4e-112   Oryza sativa Indica Group [Indian rice]
ref|NP_001058182.1|  Os06g0643900                                       345   4e-112   
ref|XP_009418189.1|  PREDICTED: phosphoenolpyruvate phosphatase-like    345   6e-112   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGT16393.1|  purple acid phosphatase precursor                       343   7e-112   Saccharum hybrid cultivar R570
ref|XP_006656291.1|  PREDICTED: phosphoenolpyruvate phosphatase-l...    344   8e-112   Oryza brachyantha
ref|NP_001147979.1|  purple acid phosphatase precursor                  343   2e-111   Zea mays [maize]
gb|ACF84615.1|  unknown                                                 343   2e-111   Zea mays [maize]
ref|XP_010913337.1|  PREDICTED: phosphoenolpyruvate phosphatase i...    343   3e-111   Elaeis guineensis
gb|KJB65855.1|  hypothetical protein B456_010G116200                    340   3e-111   Gossypium raimondii
gb|AGT15919.1|  purple acid phosphatase precursor                       343   3e-111   Saccharum hybrid cultivar R570
ref|XP_010913336.1|  PREDICTED: phosphoenolpyruvate phosphatase i...    343   4e-111   Elaeis guineensis
dbj|BAB88215.1|  putative secretory acid phosphatase precursor          342   5e-111   Oryza sativa Japonica Group [Japonica rice]
gb|AGT16225.1|  purple acid phosphatase precursor                       342   6e-111   Saccharum hybrid cultivar R570
gb|KJB65854.1|  hypothetical protein B456_010G116200                    341   2e-110   Gossypium raimondii
gb|AGT17175.1|  acid phosphatase precursor                              340   2e-110   Saccharum hybrid cultivar R570
gb|KHG06954.1|  Bifunctional purple acid phosphatase 26 -like pro...    340   3e-110   Gossypium arboreum [tree cotton]
gb|EPS64420.1|  hypothetical protein M569_10360                         340   4e-110   Genlisea aurea
ref|XP_009363960.1|  PREDICTED: bifunctional purple acid phosphat...    340   4e-110   Pyrus x bretschneideri [bai li]
gb|EMS63219.1|  Bifunctional purple acid phosphatase 26                 337   3e-109   Triticum urartu
gb|KJB83221.1|  hypothetical protein B456_013G236000                    336   8e-109   Gossypium raimondii
gb|AGT17000.1|  acid phosphatase precursor                              335   5e-108   Saccharum hybrid cultivar R570
ref|XP_002530767.1|  Purple acid phosphatase precursor, putative        329   3e-106   
gb|ABK24726.1|  unknown                                                 324   1e-103   Picea sitchensis
gb|EMT07067.1|  Bifunctional purple acid phosphatase 26                 319   3e-101   
ref|XP_010687873.1|  PREDICTED: bifunctional purple acid phosphat...    314   3e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007155070.1|  hypothetical protein PHAVU_003G170600g             313   3e-100   Phaseolus vulgaris [French bean]
ref|XP_008361111.1|  PREDICTED: bifunctional purple acid phosphat...    308   8e-98    
gb|KEH16424.1|  purple acid phosphatase superfamily protein             297   1e-93    Medicago truncatula
ref|XP_004970155.1|  PREDICTED: purple acid phosphatase 2-like          297   2e-93    Setaria italica
ref|XP_003564342.1|  PREDICTED: purple acid phosphatase 2               296   2e-93    Brachypodium distachyon [annual false brome]
ref|NP_001141970.1|  hypothetical protein precursor                     295   1e-92    Zea mays [maize]
ref|XP_010061256.1|  PREDICTED: purple acid phosphatase-like isof...    293   1e-92    
dbj|BAJ85173.1|  predicted protein                                      294   3e-92    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010531065.1|  PREDICTED: purple acid phosphatase 25              293   6e-92    Tarenaya hassleriana [spider flower]
ref|XP_002972138.1|  hypothetical protein SELMODRAFT_96478              293   7e-92    
ref|XP_010061253.1|  PREDICTED: purple acid phosphatase-like isof...    293   8e-92    Eucalyptus grandis [rose gum]
emb|CDM84477.1|  unnamed protein product                                292   9e-92    Triticum aestivum [Canadian hard winter wheat]
ref|XP_002880886.1|  secreted purple acid phosphatase precursor         292   9e-92    Arabidopsis lyrata subsp. lyrata
ref|XP_002458586.1|  hypothetical protein SORBIDRAFT_03g036210          293   1e-91    Sorghum bicolor [broomcorn]
ref|XP_002993027.1|  hypothetical protein SELMODRAFT_136432             292   1e-91    
ref|XP_002971914.1|  hypothetical protein SELMODRAFT_96415              292   2e-91    
ref|NP_001239689.1|  uncharacterized protein LOC100794124               290   3e-91    Glycine max [soybeans]
ref|XP_002874764.1|  secreted purple acid phosphatase precursor         291   3e-91    
ref|XP_002993062.1|  hypothetical protein SELMODRAFT_187173             291   3e-91    Selaginella moellendorffii
ref|XP_010510800.1|  PREDICTED: fe(3+)-Zn(2+) purple acid phospha...    290   1e-90    Camelina sativa [gold-of-pleasure]
ref|XP_006838700.1|  PREDICTED: purple acid phosphatase 2               289   1e-90    Amborella trichopoda
ref|XP_004506328.1|  PREDICTED: purple acid phosphatase-like            290   1e-90    Cicer arietinum [garbanzo]
ref|XP_010933142.1|  PREDICTED: purple acid phosphatase-like            289   1e-90    Elaeis guineensis
ref|XP_010672424.1|  PREDICTED: purple acid phosphatase-like            289   2e-90    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010473111.1|  PREDICTED: fe(3+)-Zn(2+) purple acid phospha...    289   2e-90    Camelina sativa [gold-of-pleasure]
ref|XP_011088457.1|  PREDICTED: purple acid phosphatase 2               288   3e-90    Sesamum indicum [beniseed]
ref|XP_012078392.1|  PREDICTED: purple acid phosphatase 2 isoform X1    287   3e-90    
ref|XP_010910529.1|  PREDICTED: purple acid phosphatase-like            288   3e-90    Elaeis guineensis
ref|XP_006294169.1|  hypothetical protein CARUB_v10023164mg             288   3e-90    Capsella rubella
emb|CAA06921.1|  purple acid phosphatase                                288   3e-90    Ipomoea batatas [batate]
gb|EMS54176.1|  Purple acid phosphatase 2                               289   3e-90    Triticum urartu
gb|EYU37834.1|  hypothetical protein MIMGU_mgv1a005856mg                288   4e-90    Erythranthe guttata [common monkey flower]
ref|XP_007222938.1|  hypothetical protein PRUPE_ppa005293mg             288   4e-90    Prunus persica
ref|NP_001044416.1|  Os01g0776600                                       288   5e-90    
gb|KDP32671.1|  hypothetical protein JCGZ_13669                         288   5e-90    Jatropha curcas
ref|XP_008793996.1|  PREDICTED: purple acid phosphatase 2-like          288   7e-90    Phoenix dactylifera
gb|AAX20028.1|  purple acid phosphatase                                 287   7e-90    Medicago truncatula
ref|XP_011093857.1|  PREDICTED: purple acid phosphatase 5-like          286   8e-90    
ref|XP_007017663.1|  Purple acid phosphatase 10 isoform 2               283   9e-90    
ref|XP_010664753.1|  PREDICTED: purple acid phosphatase 2 isoform X2    287   1e-89    Vitis vinifera
ref|XP_002280883.1|  PREDICTED: purple acid phosphatase 2 isoform X1    287   1e-89    Vitis vinifera
ref|XP_006487340.1|  PREDICTED: purple acid phosphatase 2-like          287   1e-89    Citrus sinensis [apfelsine]
ref|NP_195353.1|  purple acid phosphatase 25                            287   1e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008387992.1|  PREDICTED: purple acid phosphatase 2-like          288   2e-89    
ref|XP_011093859.1|  PREDICTED: purple acid phosphatase 2-like is...    284   2e-89    
ref|XP_009335656.1|  PREDICTED: purple acid phosphatase 2               288   2e-89    Pyrus x bretschneideri [bai li]
gb|KEH44359.1|  purple acid phosphatase superfamily protein             286   2e-89    Medicago truncatula
ref|XP_010315506.1|  PREDICTED: LOW QUALITY PROTEIN: purple acid ...    286   3e-89    
gb|KFK32700.1|  hypothetical protein AALP_AA6G277500                    286   3e-89    Arabis alpina [alpine rockcress]
dbj|BAC55156.1|  purple acid phosphatase                                286   4e-89    Nicotiana tabacum [American tobacco]
emb|CDX77044.1|  BnaC04g38390D                                          286   4e-89    
ref|XP_004291401.1|  PREDICTED: purple acid phosphatase 2               286   4e-89    Fragaria vesca subsp. vesca
ref|XP_010113480.1|  Purple acid phosphatase 25                         285   4e-89    
ref|XP_009787761.1|  PREDICTED: purple acid phosphatase 2-like          285   4e-89    Nicotiana sylvestris
sp|Q9SDZ9.1|PPAF2_IPOBA  RecName: Full=Purple acid phosphatase 2;...    285   5e-89    Ipomoea batatas [batate]
ref|XP_006487339.1|  PREDICTED: purple acid phosphatase 2-like is...    284   5e-89    Citrus sinensis [apfelsine]
gb|ERN01270.1|  hypothetical protein AMTR_s00002p00249330               285   5e-89    Amborella trichopoda
gb|KHN22216.1|  Purple acid phosphatase 2                               283   6e-89    Glycine soja [wild soybean]
ref|XP_010417871.1|  PREDICTED: fe(3+)-Zn(2+) purple acid phospha...    285   8e-89    Camelina sativa [gold-of-pleasure]
ref|XP_006473581.1|  PREDICTED: purple acid phosphatase 2-like is...    285   8e-89    Citrus sinensis [apfelsine]
ref|XP_006487338.1|  PREDICTED: purple acid phosphatase 2-like is...    285   8e-89    Citrus sinensis [apfelsine]
ref|XP_010028626.1|  PREDICTED: purple acid phosphatase-like            285   8e-89    Eucalyptus grandis [rose gum]
ref|XP_002307690.1|  Iron(III)-zinc(II) purple acid phosphatase p...    285   1e-88    Populus trichocarpa [western balsam poplar]
ref|XP_009112387.1|  PREDICTED: purple acid phosphatase 10-like i...    284   1e-88    Brassica rapa
ref|XP_011093858.1|  PREDICTED: purple acid phosphatase 5-like is...    284   1e-88    Sesamum indicum [beniseed]
emb|CDY26770.1|  BnaC09g08970D                                          284   1e-88    Brassica napus [oilseed rape]
gb|EMT18687.1|  Purple acid phosphatase 2                               285   1e-88    
gb|ABV89745.1|  purple acid phosphatase 12 protein family isoform 4     286   1e-88    Brassica napus [oilseed rape]
gb|KDO84712.1|  hypothetical protein CISIN_1g040421mg                   282   1e-88    Citrus sinensis [apfelsine]
ref|XP_007017664.1|  Purple acid phosphatase 12 isoform 1               284   1e-88    
ref|XP_009112386.1|  PREDICTED: purple acid phosphatase 10-like i...    284   1e-88    Brassica rapa
ref|XP_002280873.1|  PREDICTED: purple acid phosphatase 2               284   1e-88    Vitis vinifera
ref|XP_010320409.1|  PREDICTED: LOW QUALITY PROTEIN: purple acid ...    284   2e-88    
ref|XP_002867021.1|  ATPAP25/PAP25                                      284   2e-88    Arabidopsis lyrata subsp. lyrata
emb|CDY47461.1|  BnaA09g08700D                                          284   2e-88    Brassica napus [oilseed rape]
ref|XP_012071955.1|  PREDICTED: purple acid phosphatase 2-like          284   2e-88    
ref|XP_002510464.1|  Iron(III)-zinc(II) purple acid phosphatase p...    284   2e-88    Ricinus communis
gb|AAA91803.1|  secreted purple acid phosphatase precursor              283   2e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010107842.1|  Purple acid phosphatase 2                          283   3e-88    Morus notabilis
ref|NP_180287.2|  Fe(3+)-Zn(2+) purple acid phosphatase 12              283   3e-88    Arabidopsis thaliana [mouse-ear cress]
gb|AAM15913.1|AF492664_1  purple acid phosphatase                       283   3e-88    Arabidopsis thaliana [mouse-ear cress]
dbj|BAC55154.1|  purple acid phosphatase                                283   3e-88    Nicotiana tabacum [American tobacco]
ref|XP_009794994.1|  PREDICTED: purple acid phosphatase 2-like          283   3e-88    Nicotiana sylvestris
ref|XP_009611298.1|  PREDICTED: purple acid phosphatase 2-like          283   3e-88    Nicotiana tomentosiformis
ref|XP_006362022.1|  PREDICTED: purple acid phosphatase 2-like          283   3e-88    Solanum tuberosum [potatoes]
ref|XP_006423399.1|  hypothetical protein CICLE_v10028320mg             284   3e-88    Citrus clementina [clementine]
ref|XP_010549271.1|  PREDICTED: fe(3+)-Zn(2+) purple acid phospha...    283   3e-88    Tarenaya hassleriana [spider flower]
ref|XP_003527865.2|  PREDICTED: purple acid phosphatase 2-like          283   3e-88    Glycine max [soybeans]
ref|XP_007201003.1|  hypothetical protein PRUPE_ppa005275mg             283   4e-88    Prunus persica
gb|KJB58171.1|  hypothetical protein B456_009G197600                    281   4e-88    Gossypium raimondii
gb|KHG20719.1|  Purple acid phosphatase 2                               283   4e-88    Gossypium arboreum [tree cotton]
ref|XP_011048849.1|  PREDICTED: purple acid phosphatase 2-like is...    283   4e-88    Populus euphratica
ref|XP_004290282.1|  PREDICTED: purple acid phosphatase                 283   5e-88    Fragaria vesca subsp. vesca
ref|XP_008377263.1|  PREDICTED: purple acid phosphatase-like            283   5e-88    
ref|XP_009398390.1|  PREDICTED: purple acid phosphatase 2-like          283   5e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006423402.1|  hypothetical protein CICLE_v10028369mg             280   6e-88    
ref|XP_004963326.1|  PREDICTED: purple acid phosphatase 2-like          282   6e-88    Setaria italica
gb|ABV89741.1|  purple acid phosphatase 12 protein family isoform 2     283   6e-88    Brassica napus [oilseed rape]
ref|XP_008236957.1|  PREDICTED: purple acid phosphatase-like            282   7e-88    Prunus mume [ume]
ref|XP_009408475.1|  PREDICTED: purple acid phosphatase 2-like          282   7e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002512962.1|  Purple acid phosphatase precursor, putative        282   8e-88    
emb|CDP19119.1|  unnamed protein product                                282   8e-88    Coffea canephora [robusta coffee]
gb|ABV89739.1|  purple acid phosphatase 12 protein family isoform 1     282   8e-88    Brassica napus [oilseed rape]
ref|XP_010028628.1|  PREDICTED: purple acid phosphatase 2-like          283   8e-88    Eucalyptus grandis [rose gum]
ref|XP_007017662.1|  Purple acid phosphatase 10 isoform 1               282   9e-88    
gb|KCW55391.1|  hypothetical protein EUGRSUZ_I01302                     282   1e-87    Eucalyptus grandis [rose gum]
ref|XP_009614460.1|  PREDICTED: purple acid phosphatase 2-like          282   1e-87    Nicotiana tomentosiformis
ref|NP_176033.1|  purple acid phosphatase 6                             282   1e-87    Arabidopsis thaliana [mouse-ear cress]
gb|ABV89757.1|  purple acid phosphatase 12 protein family isoform 7     282   1e-87    Brassica napus [oilseed rape]
emb|CDY48179.1|  BnaA04g15430D                                          282   1e-87    Brassica napus [oilseed rape]
ref|XP_009140744.1|  PREDICTED: fe(3+)-Zn(2+) purple acid phospha...    282   1e-87    Brassica rapa
ref|NP_001240926.1|  uncharacterized protein LOC100807555 precursor     281   1e-87    Glycine max [soybeans]
gb|KCW55390.1|  hypothetical protein EUGRSUZ_I01300                     280   1e-87    Eucalyptus grandis [rose gum]
gb|KHN11683.1|  Purple acid phosphatase                                 281   1e-87    Glycine soja [wild soybean]
ref|XP_010480244.1|  PREDICTED: purple acid phosphatase 6-like          281   1e-87    Camelina sativa [gold-of-pleasure]
ref|XP_009762746.1|  PREDICTED: purple acid phosphatase 2-like          282   2e-87    Nicotiana sylvestris
ref|XP_006301757.1|  hypothetical protein CARUB_v10022218mg             281   2e-87    Capsella rubella
ref|XP_006435085.1|  hypothetical protein CICLE_v10003671mg             279   2e-87    
ref|XP_006396899.1|  hypothetical protein EUTSA_v10028786mg             277   2e-87    
gb|ABV89749.1|  purple acid phosphatase 12 protein family isoform 5     281   2e-87    Brassica napus [oilseed rape]
ref|XP_010489510.1|  PREDICTED: purple acid phosphatase 5-like          281   2e-87    Camelina sativa [gold-of-pleasure]
gb|KJB58167.1|  hypothetical protein B456_009G197600                    281   2e-87    Gossypium raimondii
ref|XP_007131378.1|  hypothetical protein PHAVU_011G008700g             281   2e-87    Phaseolus vulgaris [French bean]
ref|XP_006423401.1|  hypothetical protein CICLE_v10028369mg             281   2e-87    Citrus clementina [clementine]
ref|XP_006360542.1|  PREDICTED: purple acid phosphatase 6-like          281   2e-87    Solanum tuberosum [potatoes]
emb|CDY48178.1|  BnaA04g15420D                                          281   2e-87    Brassica napus [oilseed rape]
gb|EYU37832.1|  hypothetical protein MIMGU_mgv1a005923mg                281   3e-87    Erythranthe guttata [common monkey flower]
ref|XP_002894643.1|  ATPAP6/PAP6                                        281   3e-87    
ref|XP_010414981.1|  PREDICTED: purple acid phosphatase 6               281   3e-87    Camelina sativa [gold-of-pleasure]
ref|XP_002534135.1|  Purple acid phosphatase precursor, putative        280   3e-87    Ricinus communis
ref|XP_010030674.1|  PREDICTED: purple acid phosphatase 2-like          281   3e-87    Eucalyptus grandis [rose gum]
ref|XP_002886149.1|  ATPAP11/PAP11                                      280   3e-87    Arabidopsis lyrata subsp. lyrata
gb|KJB58173.1|  hypothetical protein B456_009G197700                    281   3e-87    Gossypium raimondii
ref|XP_006586710.1|  PREDICTED: uncharacterized protein LOC100815...    280   3e-87    
gb|AFH08750.1|  purple acid phosphatase 14                              280   4e-87    Glycine max [soybeans]
dbj|BAC55155.1|  purple acid phosphatase                                281   4e-87    Nicotiana tabacum [American tobacco]
ref|XP_010511279.1|  PREDICTED: purple acid phosphatase 6-like          280   4e-87    Camelina sativa [gold-of-pleasure]
dbj|BAH20399.1|  AT2G16430                                              276   4e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009777041.1|  PREDICTED: purple acid phosphatase 2 isoform X1    280   4e-87    Nicotiana sylvestris
ref|XP_009777042.1|  PREDICTED: purple acid phosphatase 2 isoform X2    280   4e-87    Nicotiana sylvestris
ref|XP_006299600.1|  hypothetical protein CARUB_v10015778mg             280   4e-87    Capsella rubella
ref|XP_010690822.1|  PREDICTED: purple acid phosphatase 2               280   4e-87    
ref|NP_849960.1|  purple acid phosphatase 10                            276   5e-87    
ref|XP_009397025.1|  PREDICTED: purple acid phosphatase 2               280   5e-87    
emb|CDP07456.1|  unnamed protein product                                279   5e-87    
ref|XP_010467619.1|  PREDICTED: purple acid phosphatase 5-like          280   6e-87    
gb|ABV89755.1|  purple acid phosphatase 12 protein family isoform 6     281   7e-87    
gb|KHG15250.1|  Purple acid phosphatase 2                               280   7e-87    
pdb|1XZW|A  Chain A, Sweet Potato Purple Acid PhosphatasePHOSPHAT...    278   7e-87    
ref|XP_006414050.1|  hypothetical protein EUTSA_v10025132mg             280   7e-87    
ref|XP_011037173.1|  PREDICTED: purple acid phosphatase 2-like          280   7e-87    
ref|XP_006646385.1|  PREDICTED: purple acid phosphatase 2-like          285   8e-87    
dbj|BAC55157.1|  purple acid phosphatase                                280   8e-87    
ref|XP_010413945.1|  PREDICTED: purple acid phosphatase 5               279   9e-87    
ref|XP_002263937.1|  PREDICTED: purple acid phosphatase                 280   9e-87    
ref|XP_010437359.1|  PREDICTED: purple acid phosphatase 25              280   9e-87    
ref|XP_010271524.1|  PREDICTED: purple acid phosphatase                 280   9e-87    
sp|Q9SE00.1|PPAF1_IPOBA  RecName: Full=Purple acid phosphatase 1;...    280   9e-87    
ref|XP_011083627.1|  PREDICTED: purple acid phosphatase 2-like          280   9e-87    
gb|EYU25836.1|  hypothetical protein MIMGU_mgv1a026196mg                281   1e-86    
gb|KJB79117.1|  hypothetical protein B456_013G034000                    279   1e-86    
ref|XP_009610724.1|  PREDICTED: purple acid phosphatase 2-like          279   1e-86    
ref|XP_009140743.1|  PREDICTED: fe(3+)-Zn(2+) purple acid phospha...    281   1e-86    
ref|XP_008236961.1|  PREDICTED: purple acid phosphatase-like            279   1e-86    
ref|XP_010028627.1|  PREDICTED: purple acid phosphatase 2-like          279   1e-86    
gb|KFK40196.1|  purple acid phosphatase                                 279   1e-86    
ref|XP_008236959.1|  PREDICTED: purple acid phosphatase-like            279   1e-86    
ref|XP_010516721.1|  PREDICTED: purple acid phosphatase 10-like         279   2e-86    
gb|ABV89743.1|  purple acid phosphatase 12 protein family isoform 3     279   2e-86    
sp|Q09131.2|PPAF_SOYBN  RecName: Full=Purple acid phosphatase; Al...    279   2e-86    
ref|XP_006362021.1|  PREDICTED: purple acid phosphatase 2-like          279   2e-86    
gb|KHG20720.1|  Purple acid phosphatase 2                               279   2e-86    
ref|NP_179405.1|  purple acid phosphatase 11                            278   2e-86    
ref|XP_006664780.1|  PREDICTED: purple acid phosphatase 2-like          278   2e-86    
gb|KFK40055.1|  hypothetical protein AALP_AA3G324700                    278   2e-86    
ref|XP_007042078.1|  Purple acid phosphatase 10                         278   2e-86    
ref|XP_004243825.2|  PREDICTED: LOW QUALITY PROTEIN: purple acid ...    277   2e-86    
ref|XP_002274392.1|  PREDICTED: purple acid phosphatase                 278   3e-86    
ref|XP_011028929.1|  PREDICTED: purple acid phosphatase 2-like is...    279   3e-86    
ref|XP_008796614.1|  PREDICTED: purple acid phosphatase 2-like          278   3e-86    
ref|XP_010678957.1|  PREDICTED: purple acid phosphatase 6-like is...    276   4e-86    
gb|AET86953.1|  PAP1                                                    278   4e-86    
ref|XP_010530813.1|  PREDICTED: purple acid phosphatase 10              278   5e-86    
ref|NP_179235.1|  purple acid phosphatase 10                            278   5e-86    
gb|AAW29947.1|  putative purple acid phosphatase                        278   5e-86    
ref|XP_010489216.1|  PREDICTED: purple acid phosphatase 10              278   5e-86    
dbj|BAO58596.1|  purple acid phosphatase                                277   7e-86    
ref|XP_010467373.1|  PREDICTED: purple acid phosphatase 10-like         278   7e-86    
ref|XP_010028629.1|  PREDICTED: purple acid phosphatase 2-like          277   7e-86    
ref|XP_004230906.1|  PREDICTED: purple acid phosphatase 2               277   7e-86    
gb|KJB63551.1|  hypothetical protein B456_010G007100                    273   9e-86    
gb|AAM16283.1|  truncated putative purple acid phosphatase              273   9e-86    
ref|XP_010690820.1|  PREDICTED: purple acid phosphatase 2-like is...    277   9e-86    
ref|XP_006664779.1|  PREDICTED: purple acid phosphatase 2-like          276   9e-86    
gb|AAT37527.1|  purple acid phosphatase 2                               276   9e-86    
ref|XP_010690819.1|  PREDICTED: purple acid phosphatase 2-like is...    277   1e-85    
ref|XP_011047731.1|  PREDICTED: purple acid phosphatase 2               277   1e-85    
ref|XP_002313026.2|  hypothetical protein POPTR_0009s12400g             277   1e-85    
emb|CBI38021.3|  unnamed protein product                                275   1e-85    
ref|XP_010432181.1|  PREDICTED: purple acid phosphatase 25-like         276   1e-85    
ref|XP_002886226.1|  predicted protein                                  277   1e-85    
ref|XP_006412012.1|  hypothetical protein EUTSA_v10027366mg             276   1e-85    
gb|KFK30263.1|  hypothetical protein AALP_AA7G238500                    276   2e-85    
ref|XP_012067204.1|  PREDICTED: purple acid phosphatase 2-like          276   2e-85    
ref|XP_002264113.1|  PREDICTED: purple acid phosphatase                 276   2e-85    
gb|EMT06363.1|  Purple acid phosphatase 2                               276   2e-85    
emb|CDY53278.1|  BnaC09g09650D                                          276   3e-85    
ref|XP_012067203.1|  PREDICTED: purple acid phosphatase 2-like          275   3e-85    
gb|EMS66649.1|  Purple acid phosphatase 2                               276   3e-85    
gb|KHG11060.1|  Purple acid phosphatase 2                               275   4e-85    
gb|KJB32558.1|  hypothetical protein B456_005G246800                    276   4e-85    
dbj|BAB88216.1|  secretory acid phosphatase precursor                   275   4e-85    
ref|NP_001067369.1|  Os12g0637100                                       275   4e-85    
ref|XP_009138418.1|  PREDICTED: purple acid phosphatase 6               275   4e-85    
ref|XP_006297614.1|  hypothetical protein CARUB_v10013635mg             275   5e-85    
gb|KDO71056.1|  hypothetical protein CISIN_1g046207mg                   275   5e-85    
ref|XP_002306126.2|  Fe(III)-Zn(II) purple acid phosphatase famil...    276   5e-85    
ref|XP_002300736.2|  hypothetical protein POPTR_0002s03080g             275   5e-85    
ref|XP_006409436.1|  hypothetical protein EUTSA_v10022673mg             275   6e-85    
gb|KJB63547.1|  hypothetical protein B456_010G007100                    275   7e-85    
ref|XP_010105263.1|  Purple acid phosphatase 2                          278   8e-85    
gb|ADM16565.2|  purple acid phosphatase precursor                       274   8e-85    
dbj|BAK05953.1|  predicted protein                                      274   9e-85    
ref|XP_010446806.1|  PREDICTED: purple acid phosphatase 25-like         274   9e-85    
dbj|BAK03468.1|  predicted protein                                      274   1e-84    
gb|EPS60425.1|  hypothetical protein M569_14376                         274   1e-84    
ref|XP_009102276.1|  PREDICTED: purple acid phosphatase 5-like is...    274   1e-84    
ref|XP_009112469.1|  PREDICTED: purple acid phosphatase 5-like          274   1e-84    
gb|AAD20634.1|  purple acid phosphatase precursor                       274   1e-84    
dbj|BAJ99889.1|  predicted protein                                      274   1e-84    
emb|CAA07280.1|  purple acid phosphatase                                272   2e-84    
gb|EAY84038.1|  hypothetical protein OsI_39268                          273   2e-84    
emb|CDY59721.1|  BnaA03g59200D                                          273   3e-84    
emb|CDO97010.1|  unnamed protein product                                273   3e-84    
emb|CDY46314.1|  BnaA07g01870D                                          273   3e-84    
ref|XP_006425589.1|  hypothetical protein CICLE_v10027113mg             272   4e-84    
gb|KHN28032.1|  Purple acid phosphatase 2                               273   4e-84    
ref|XP_006409435.1|  hypothetical protein EUTSA_v10022681mg             273   4e-84    
ref|XP_011459641.1|  PREDICTED: purple acid phosphatase-like            272   4e-84    
emb|CDY59690.1|  BnaC07g51090D                                          272   4e-84    
ref|XP_008448074.1|  PREDICTED: purple acid phosphatase 2               273   5e-84    
ref|NP_001067370.2|  Os12g0637200                                       266   7e-84    
ref|NP_001242198.1|  purple acid phosphatase 2-like                     271   7e-84    
ref|XP_006467153.1|  PREDICTED: purple acid phosphatase 2-like          270   8e-84    
gb|KHN36789.1|  Purple acid phosphatase 2                               271   8e-84    
ref|XP_004149978.1|  PREDICTED: purple acid phosphatase 5               271   1e-83    
ref|XP_006594791.1|  PREDICTED: purple acid phosphatase 2-like          271   1e-83    
dbj|BAA92365.1|  purple acid phosphatase                                271   1e-83    
emb|CDX89713.1|  BnaC03g46270D                                          271   1e-83    
ref|XP_007149618.1|  hypothetical protein PHAVU_005G084900g             271   2e-83    
pdb|2QFP|A  Chain A, Crystal Structure Of Red Kidney Bean Purple ...    269   3e-83    
gb|ABA99980.1|  expressed protein                                       266   3e-83    
gb|AET86954.1|  PAP12                                                   270   3e-83    
emb|CDX89726.1|  BnaC03g46400D                                          270   4e-83    
pdb|4DSY|A  Chain A, Crystal Structure Of Red Kidney Bean Purple ...    269   4e-83    
emb|CDY35464.1|  BnaC03g61960D                                          268   4e-83    
gb|EEE53671.1|  hypothetical protein OsJ_37000                          270   5e-83    
gb|EEC69741.1|  hypothetical protein OsI_39267                          270   5e-83    
ref|XP_008440780.1|  PREDICTED: purple acid phosphatase 5               270   5e-83    
emb|CDY02257.1|  BnaA03g39100D                                          270   5e-83    
sp|P80366.3|PPAF_PHAVU  RecName: Full=Fe(3+)-Zn(2+) purple acid p...    270   5e-83    
gb|EMT29608.1|  hypothetical protein F775_52563                         268   5e-83    
ref|NP_001136973.1|  uncharacterized protein LOC100217133 precursor     270   5e-83    
gb|ABA99978.1|  expressed protein                                       270   5e-83    
ref|XP_009136308.1|  PREDICTED: purple acid phosphatase 10              270   5e-83    
pdb|1KBP|A  Chain A, Kidney Bean Purple Acid Phosphatase                268   6e-83    
ref|XP_003560127.1|  PREDICTED: purple acid phosphatase 2-like is...    269   6e-83    
gb|ACG26714.1|  purple acid phosphatase precursor                       271   6e-83    
ref|XP_006371757.1|  hypothetical protein POPTR_0018s01990g             268   7e-83    
ref|XP_009109316.1|  PREDICTED: purple acid phosphatase 6-like          269   9e-83    
emb|CDY24789.1|  BnaA08g15210D                                          269   1e-82    
ref|XP_004955085.1|  PREDICTED: purple acid phosphatase 2-like          268   1e-82    
gb|AFY06664.1|  purple acid phosphatase                                 268   1e-82    
ref|NP_001242830.1|  uncharacterized protein LOC100815854 precursor     268   2e-82    
gb|EAY84039.1|  hypothetical protein OsI_39269                          268   2e-82    
ref|XP_003579083.1|  PREDICTED: purple acid phosphatase 2-like          268   3e-82    
emb|CDY02259.1|  BnaA03g39080D                                          266   5e-82    
ref|XP_008236962.1|  PREDICTED: purple acid phosphatase-like            267   7e-82    
ref|XP_009136307.1|  PREDICTED: purple acid phosphatase 10-like         266   8e-82    
ref|XP_007200121.1|  hypothetical protein PRUPE_ppa018522mg             266   2e-81    
ref|XP_007199139.1|  hypothetical protein PRUPE_ppa019514mg             266   2e-81    
ref|XP_007199264.1|  hypothetical protein PRUPE_ppa022682mg             266   2e-81    
gb|KHG24062.1|  Purple acid phosphatase 2                               276   2e-81    
ref|XP_004148530.1|  PREDICTED: purple acid phosphatase 2               266   3e-81    
gb|KHG24063.1|  Purple acid phosphatase 2                               275   3e-81    
gb|KGN43158.1|  hypothetical protein Csa_7G004110                       266   4e-81    
ref|XP_004152670.1|  PREDICTED: purple acid phosphatase 2               265   6e-81    
ref|XP_008444763.1|  PREDICTED: purple acid phosphatase-like            264   8e-81    
ref|XP_008382344.1|  PREDICTED: purple acid phosphatase 2-like          266   9e-81    
ref|XP_009373026.1|  PREDICTED: LOW QUALITY PROTEIN: purple acid ...    263   1e-80    
ref|XP_008236963.1|  PREDICTED: purple acid phosphatase 2-like is...    263   2e-80    
ref|XP_008236964.1|  PREDICTED: purple acid phosphatase 2-like is...    263   2e-80    
ref|XP_009373020.1|  PREDICTED: purple acid phosphatase 2-like          265   3e-80    
dbj|BAA97038.2|  acid phosphatase precursor                             262   4e-80    
emb|CAD44185.1|  putative acid phosphatase                              262   5e-80    
gb|EMT02488.1|  Purple acid phosphatase 2                               260   3e-79    
gb|KCW79138.1|  hypothetical protein EUGRSUZ_C00583                     258   4e-79    
gb|AFB18640.1|  PAP10                                                   259   5e-79    
gb|KJB32560.1|  hypothetical protein B456_005G246900                    259   6e-79    
ref|XP_008804563.1|  PREDICTED: purple acid phosphatase 2-like          249   1e-78    
ref|XP_003578743.2|  PREDICTED: purple acid phosphatase 2-like          258   1e-78    
ref|XP_004963327.1|  PREDICTED: purple acid phosphatase 2-like          259   1e-78    
ref|XP_008237014.1|  PREDICTED: purple acid phosphatase 2-like          258   2e-78    
ref|NP_001149655.1|  purple acid phosphatase                            256   7e-78    
gb|EMS53150.1|  Purple acid phosphatase 2                               261   1e-77    
gb|ACN28207.1|  unknown                                                 256   1e-77    
dbj|BAJ94392.1|  predicted protein                                      256   1e-77    
gb|ACU23485.1|  unknown                                                 247   2e-77    
ref|XP_006285738.1|  hypothetical protein CARUB_v10007211mg             255   2e-77    
dbj|BAA97745.1|  secretory acid phosphatase precursor                   255   2e-77    
ref|XP_007200250.1|  hypothetical protein PRUPE_ppa015069mg             255   3e-77    
gb|AAK51700.1|AF317218_1  secreted acid phosphatase                     254   3e-77    
ref|XP_002440350.1|  hypothetical protein SORBIDRAFT_09g030100          254   4e-77    
ref|XP_001778270.1|  predicted protein                                  254   4e-77    
ref|XP_008350498.1|  PREDICTED: purple acid phosphatase-like            246   6e-77    
ref|XP_001758586.1|  predicted protein                                  253   1e-76    
gb|AGL44395.1|  calcineurin-like phosphoesterase                        254   3e-76    
emb|CDX89717.1|  BnaC03g46310D                                          249   6e-75    
ref|XP_008237013.1|  PREDICTED: purple acid phosphatase 10-like         241   1e-74    
emb|CDX67523.1|  BnaA07g15630D                                          241   1e-73    
ref|XP_012078393.1|  PREDICTED: purple acid phosphatase 5 isoform X2    242   5e-73    
ref|XP_007017665.1|  Purple acid phosphatase 10 isoform 2               239   2e-72    
ref|XP_011621720.1|  PREDICTED: purple acid phosphatase 2               239   9e-72    
ref|XP_002984175.1|  hypothetical protein SELMODRAFT_120052             237   1e-70    
ref|XP_002972261.1|  hypothetical protein SELMODRAFT_97551              236   3e-70    
ref|XP_010678958.1|  PREDICTED: purple acid phosphatase 5-like is...    234   6e-70    
gb|AAP81218.1|  secreted acid phosphatase PAP11                         226   7e-70    
gb|EYU32881.1|  hypothetical protein MIMGU_mgv11b016615mg               224   2e-69    
ref|NP_564619.1|  purple acid phosphatase 5                             231   5e-69    
ref|XP_010230374.1|  PREDICTED: purple acid phosphatase 2-like is...    229   3e-68    
emb|CAN75519.1|  hypothetical protein VITISV_011076                     229   4e-68    
ref|XP_012078394.1|  PREDICTED: purple acid phosphatase 19 isofor...    224   1e-66    
ref|XP_006409193.1|  hypothetical protein EUTSA_v10022710mg             225   2e-66    
ref|XP_008237016.1|  PREDICTED: purple acid phosphatase 2-like          223   6e-66    
dbj|BAA82130.1|  acid phosphatase                                       229   7e-66    
ref|XP_006581009.1|  PREDICTED: uncharacterized protein LOC100794...    221   1e-64    
ref|NP_190198.1|  purple acid phosphatase 19                            219   2e-64    
ref|XP_008237012.1|  PREDICTED: purple acid phosphatase 2-like          213   1e-62    
gb|KJB63549.1|  hypothetical protein B456_010G007100                    213   8e-62    
ref|XP_009630255.1|  PREDICTED: LOW QUALITY PROTEIN: purple acid ...    214   2e-61    
ref|XP_008366769.1|  PREDICTED: LOW QUALITY PROTEIN: purple acid ...    208   5e-61    
gb|KJB58170.1|  hypothetical protein B456_009G197600                    211   5e-61    
ref|XP_009102277.1|  PREDICTED: purple acid phosphatase 5-like is...    209   4e-60    
ref|XP_007131379.1|  hypothetical protein PHAVU_011G008800g             206   4e-59    
gb|ABR17398.1|  unknown                                                 197   7e-59    
gb|KDO62623.1|  hypothetical protein CISIN_1g013955mg                   204   2e-58    
ref|XP_006475153.1|  PREDICTED: purple acid phosphatase 18-like         204   3e-58    
ref|XP_006452298.1|  hypothetical protein CICLE_v10008345mg             204   4e-58    
ref|XP_011097894.1|  PREDICTED: purple acid phosphatase 18-like         204   5e-58    
gb|AAM64882.1|  unknown                                                 193   1e-57    
ref|XP_002528722.1|  hydrolase, putative                                196   3e-57    
ref|XP_009804739.1|  PREDICTED: LOW QUALITY PROTEIN: purple acid ...    201   4e-57    
emb|CDP05746.1|  unnamed protein product                                199   4e-56    
gb|KCW67037.1|  hypothetical protein EUGRSUZ_F00806                     196   8e-56    
ref|XP_009378488.1|  PREDICTED: purple acid phosphatase 18-like         198   8e-56    
gb|EPS59886.1|  hypothetical protein M569_14917                         197   9e-56    
ref|XP_004294370.1|  PREDICTED: purple acid phosphatase 18              198   9e-56    
ref|XP_002278488.2|  PREDICTED: purple acid phosphatase 18              197   1e-55    
ref|XP_006430234.1|  hypothetical protein CICLE_v10013402mg             198   1e-55    
gb|KDO61117.1|  hypothetical protein CISIN_1g017588mg                   195   2e-55    
ref|XP_007020894.1|  Purple acid phosphatase 18                         196   3e-55    
ref|XP_010064340.1|  PREDICTED: purple acid phosphatase 18-like         197   3e-55    



>ref|XP_009790276.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X2 [Nicotiana sylvestris]
Length=476

 Score =   397 bits (1019),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 196/232 (84%), Positives = 216/232 (93%), Gaps = 0/232 (0%)
 Frame = -2

Query  923  FRYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPW  744
            +RYPTPY+ASKS++ LWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREEL  VDREKTPW
Sbjct  245  YRYPTPYQASKSSSPLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELKNVDREKTPW  304

Query  743  LIVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNV  564
            LIVLMHVPIYN+NVAHFMEGESMR+V+E WFV++KVDV+FAGHVHAYERSYR+SNIHYNV
Sbjct  305  LIVLMHVPIYNTNVAHFMEGESMRSVFEGWFVEHKVDVIFAGHVHAYERSYRVSNIHYNV  364

Query  563  SSGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHA  384
            SSG  YPVPDK+APVYITVGDGGNQEGLA RFRDPQP+YSAFREASYGHSTLEIKNRTHA
Sbjct  365  SSGDPYPVPDKAAPVYITVGDGGNQEGLASRFRDPQPDYSAFREASYGHSTLEIKNRTHA  424

Query  383  FYHWNRNDDGKRVATDAFVLHNQFWGnnrrrrklnksrLQSVIVSRYSTAPL  228
             YHWNRNDDGK+V  D+FVLHNQ+WG+N  RRKLNK+ L SVI++R STA L
Sbjct  425  LYHWNRNDDGKKVKIDSFVLHNQYWGSNHHRRKLNKNHLHSVILNRASTAQL  476



>ref|XP_009790275.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X1 [Nicotiana sylvestris]
Length=500

 Score =   397 bits (1020),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 196/232 (84%), Positives = 216/232 (93%), Gaps = 0/232 (0%)
 Frame = -2

Query  923  FRYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPW  744
            +RYPTPY+ASKS++ LWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREEL  VDREKTPW
Sbjct  269  YRYPTPYQASKSSSPLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELKNVDREKTPW  328

Query  743  LIVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNV  564
            LIVLMHVPIYN+NVAHFMEGESMR+V+E WFV++KVDV+FAGHVHAYERSYR+SNIHYNV
Sbjct  329  LIVLMHVPIYNTNVAHFMEGESMRSVFEGWFVEHKVDVIFAGHVHAYERSYRVSNIHYNV  388

Query  563  SSGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHA  384
            SSG  YPVPDK+APVYITVGDGGNQEGLA RFRDPQP+YSAFREASYGHSTLEIKNRTHA
Sbjct  389  SSGDPYPVPDKAAPVYITVGDGGNQEGLASRFRDPQPDYSAFREASYGHSTLEIKNRTHA  448

Query  383  FYHWNRNDDGKRVATDAFVLHNQFWGnnrrrrklnksrLQSVIVSRYSTAPL  228
             YHWNRNDDGK+V  D+FVLHNQ+WG+N  RRKLNK+ L SVI++R STA L
Sbjct  449  LYHWNRNDDGKKVKIDSFVLHNQYWGSNHHRRKLNKNHLHSVILNRASTAQL  500



>emb|CDP10471.1| unnamed protein product [Coffea canephora]
Length=478

 Score =   395 bits (1014),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 196/225 (87%), Positives = 211/225 (94%), Gaps = 0/225 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTPY ASKS++ LWYAIRR SAH+IVLS+YSPFVKYTPQW+WL EEL RVDR+KTPWL
Sbjct  248  RYPTPYPASKSSDPLWYAIRRGSAHVIVLSSYSPFVKYTPQWRWLAEELKRVDRKKTPWL  307

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHFMEGESMRTV+E WFVKYKVDVVFAGHVHAYERSYRISNIHYNVS
Sbjct  308  IVLMHVPIYNSNEAHFMEGESMRTVFESWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  367

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHA 
Sbjct  368  SGYPYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAL  427

Query  380  YHWNRNDDGKRVATDAFVLHNQFWGnnrrrrklnksrLQSVIVSR  246
            YHWNRNDDGK+VATDAF+L+NQ+WG ++RRR L K+RL SVIV+R
Sbjct  428  YHWNRNDDGKKVATDAFMLYNQYWGTSKRRRNLRKNRLYSVIVNR  472



>ref|XP_009604288.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Nicotiana 
tomentosiformis]
 ref|XP_009604289.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Nicotiana 
tomentosiformis]
 ref|XP_009604290.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Nicotiana 
tomentosiformis]
Length=476

 Score =   394 bits (1011),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 194/232 (84%), Positives = 215/232 (93%), Gaps = 0/232 (0%)
 Frame = -2

Query  923  FRYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPW  744
            +RYPTPY+ASKS++ LWYAIRRASAHIIVLSTYS FVKYTPQWKWLREEL  VDREKTPW
Sbjct  245  YRYPTPYQASKSSSPLWYAIRRASAHIIVLSTYSSFVKYTPQWKWLREELKNVDREKTPW  304

Query  743  LIVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNV  564
            LIVLMHVPIYNSNVAHFMEGESMR+V+E WFV++KVDV+FAGHVHAYERSYR+SNIHYNV
Sbjct  305  LIVLMHVPIYNSNVAHFMEGESMRSVFEGWFVEHKVDVIFAGHVHAYERSYRVSNIHYNV  364

Query  563  SSGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHA  384
            SSG  YP+PDK+APVYITVGDGGNQEGLA +FRDPQP+YSAFREASYGHSTLEIKNRTHA
Sbjct  365  SSGDPYPIPDKAAPVYITVGDGGNQEGLASKFRDPQPDYSAFREASYGHSTLEIKNRTHA  424

Query  383  FYHWNRNDDGKRVATDAFVLHNQFWGnnrrrrklnksrLQSVIVSRYSTAPL  228
             YHWNRNDDGK+V  D+FVLHNQ+WG+N  RRKLNK+ L SVI++R STA L
Sbjct  425  LYHWNRNDDGKKVKIDSFVLHNQYWGSNHHRRKLNKNHLHSVILNRASTAQL  476



>gb|KDO73458.1| hypothetical protein CISIN_1g011679mg [Citrus sinensis]
Length=356

 Score =   384 bits (987),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTP+ ASKS++ LWYAIRRASAHIIVLS+YSPFVKYTPQW+WLREEL +VDREKTPWL
Sbjct  130  RYPTPHLASKSSSPLWYAIRRASAHIIVLSSYSPFVKYTPQWEWLREELKKVDREKTPWL  189

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHFMEGESMR  +E WFV+YKVDVVFAGHVHAYERSYRISN+HYN+S
Sbjct  190  IVLMHVPIYNSNEAHFMEGESMRAAFESWFVRYKVDVVFAGHVHAYERSYRISNLHYNIS  249

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPDKSAPVYITVGDGGNQEGLAG+FR PQP+YSAFREASYGHSTLEIKNRTHAF
Sbjct  250  SGDCFPVPDKSAPVYITVGDGGNQEGLAGKFRYPQPDYSAFREASYGHSTLEIKNRTHAF  309

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK+VATD+F+LHNQ+W 
Sbjct  310  YHWNRNDDGKKVATDSFILHNQYWA  334



>ref|XP_004251734.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Solanum 
lycopersicum]
 ref|XP_010313806.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Solanum 
lycopersicum]
 ref|XP_010313807.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Solanum 
lycopersicum]
Length=477

 Score =   389 bits (998),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 185/232 (80%), Positives = 213/232 (92%), Gaps = 0/232 (0%)
 Frame = -2

Query  923  FRYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPW  744
            +RYPTPY+AS ST+ LWY+IRRASAHIIVLSTYSPFVKYTPQWKWLREE   +DREKTPW
Sbjct  246  YRYPTPYQASNSTSPLWYSIRRASAHIIVLSTYSPFVKYTPQWKWLREEFKNIDREKTPW  305

Query  743  LIVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNV  564
            LIVLMHVPIYNSNVAHFMEGESMR+V+E WF+++KVDV+FAGHVHAYERSYRISNIH+N+
Sbjct  306  LIVLMHVPIYNSNVAHFMEGESMRSVFEAWFIEHKVDVIFAGHVHAYERSYRISNIHFNI  365

Query  563  SSGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHA  384
            SSG  YPVPD++APVYITVGDGGN+EGLA RFRDPQP+YSAFRE+SYGHSTLEIKNRTHA
Sbjct  366  SSGDPYPVPDETAPVYITVGDGGNKEGLAARFRDPQPDYSAFRESSYGHSTLEIKNRTHA  425

Query  383  FYHWNRNDDGKRVATDAFVLHNQFWGnnrrrrklnksrLQSVIVSRYSTAPL  228
            FYHWNRNDDGK+V  D+FVLHN +WG N  +RK  ++RL+S+I++R STA L
Sbjct  426  FYHWNRNDDGKKVKIDSFVLHNLYWGQNHHQRKSKQNRLRSLILNRASTAQL  477



>gb|KDO73459.1| hypothetical protein CISIN_1g011679mg [Citrus sinensis]
Length=298

 Score =   382 bits (980),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTP+ ASKS++ LWYAIRRASAHIIVLS+YSPFVKYTPQW+WLREEL +VDREKTPWL
Sbjct  72   RYPTPHLASKSSSPLWYAIRRASAHIIVLSSYSPFVKYTPQWEWLREELKKVDREKTPWL  131

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHFMEGESMR  +E WFV+YKVDVVFAGHVHAYERSYRISN+HYN+S
Sbjct  132  IVLMHVPIYNSNEAHFMEGESMRAAFESWFVRYKVDVVFAGHVHAYERSYRISNLHYNIS  191

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPDKSAPVYITVGDGGNQEGLAG+FR PQP+YSAFREASYGHSTLEIKNRTHAF
Sbjct  192  SGDCFPVPDKSAPVYITVGDGGNQEGLAGKFRYPQPDYSAFREASYGHSTLEIKNRTHAF  251

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK+VATD+F+LHNQ+W 
Sbjct  252  YHWNRNDDGKKVATDSFILHNQYWA  276



>ref|XP_010557615.1| PREDICTED: bifunctional purple acid phosphatase 26 [Tarenaya 
hassleriana]
Length=476

 Score =   388 bits (997),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 189/223 (85%), Positives = 208/223 (93%), Gaps = 0/223 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R+PTPY ASKS+N LWYAIRRASAHIIVLS+YSPFVKYTPQW+WLREEL RVDREKTPWL
Sbjct  249  RFPTPYLASKSSNPLWYAIRRASAHIIVLSSYSPFVKYTPQWEWLREELKRVDREKTPWL  308

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH+P+YNSN AHFMEGESMR V+EEWFVK+KVD++FAGHVHAYERSYRISN+ YNVS
Sbjct  309  IVLMHIPLYNSNEAHFMEGESMRAVFEEWFVKHKVDIIFAGHVHAYERSYRISNVRYNVS  368

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPDKSAPVYITVGDGGNQEGLAGRFRDPQP+YSAFREASYGHSTLEIKNRTHA 
Sbjct  369  SGDRFPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPDYSAFREASYGHSTLEIKNRTHAI  428

Query  380  YHWNRNDDGKRVATDAFVLHNQFWGnnrrrrklnksrLQSVIV  252
            YHWNRNDDGK+V TD FVLHNQ+WG N RRRKL K+ ++SV+V
Sbjct  429  YHWNRNDDGKKVPTDEFVLHNQYWGRNTRRRKLKKNVIKSVVV  471



>ref|XP_009631333.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Nicotiana 
tomentosiformis]
Length=477

 Score =   388 bits (996),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 190/230 (83%), Positives = 212/230 (92%), Gaps = 0/230 (0%)
 Frame = -2

Query  923  FRYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPW  744
            +RYPTPY+AS+S+N LWYAIRRASAHIIVLS+YSPFVKYTPQW WL++EL  V+REKTPW
Sbjct  246  YRYPTPYQASRSSNPLWYAIRRASAHIIVLSSYSPFVKYTPQWHWLKQELKNVNREKTPW  305

Query  743  LIVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNV  564
            LIVLMHVPIYNSN AHFMEGESMR+V+E WF+K++VDV+FAGHVHAYERSYRISNIHYNV
Sbjct  306  LIVLMHVPIYNSNEAHFMEGESMRSVFERWFIKHRVDVIFAGHVHAYERSYRISNIHYNV  365

Query  563  SSGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHA  384
            S G AYPVPDK+AP+YITVGDGGNQEGLA RFRDPQP+YSAFREASYGHSTLEIKNRTHA
Sbjct  366  SGGDAYPVPDKTAPIYITVGDGGNQEGLASRFRDPQPDYSAFREASYGHSTLEIKNRTHA  425

Query  383  FYHWNRNDDGKRVATDAFVLHNQFWGnnrrrrklnksrLQSVIVSRYSTA  234
            FYHWNRNDDG +V TD+F LHNQ+WG+ RRRRKLNK+ L SVI  R STA
Sbjct  426  FYHWNRNDDGNKVTTDSFTLHNQYWGSARRRRKLNKNHLHSVISERPSTA  475



>ref|XP_006350121.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Solanum 
tuberosum]
Length=477

 Score =   386 bits (992),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 185/232 (80%), Positives = 215/232 (93%), Gaps = 0/232 (0%)
 Frame = -2

Query  923  FRYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPW  744
            +RYPTPY+AS ST+ LWY+IRRASAHIIVLSTYSPFVKYTPQWKWLREE   VDREKTPW
Sbjct  246  YRYPTPYQASNSTSPLWYSIRRASAHIIVLSTYSPFVKYTPQWKWLREEFKNVDREKTPW  305

Query  743  LIVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNV  564
            LIVLMHVPIYNSNVAHFMEGESMR+V+E WF+++KVDV+FAGHVHAYERSYRISNIH+N+
Sbjct  306  LIVLMHVPIYNSNVAHFMEGESMRSVFEAWFIEHKVDVIFAGHVHAYERSYRISNIHFNI  365

Query  563  SSGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHA  384
            SSG  YPVPD++APVYITVGDGGN+EGLA RFRDPQP+YSAFRE+SYGHSTLEIKNR+HA
Sbjct  366  SSGDPYPVPDETAPVYITVGDGGNKEGLAARFRDPQPDYSAFRESSYGHSTLEIKNRSHA  425

Query  383  FYHWNRNDDGKRVATDAFVLHNQFWGnnrrrrklnksrLQSVIVSRYSTAPL  228
            FYHWNRNDDGK+V  D+FVLHN +WG N ++RK N++RL+S+I++R ST+ L
Sbjct  426  FYHWNRNDDGKKVKIDSFVLHNLYWGQNHQQRKSNQNRLRSLILNRASTSLL  477



>ref|XP_004287267.1| PREDICTED: bifunctional purple acid phosphatase 26 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457743.1| PREDICTED: bifunctional purple acid phosphatase 26 [Fragaria 
vesca subsp. vesca]
Length=482

 Score =   385 bits (990),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R+ TPY  SKS+N LWYAIRRASAHIIVLS+YSPFVKYTPQW WLREEL RVDREKTPWL
Sbjct  256  RFATPYYTSKSSNPLWYAIRRASAHIIVLSSYSPFVKYTPQWMWLREELNRVDREKTPWL  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AH+MEGESMR  +E WFV+YKVDV+FAGHVHAYERSYRISNIHYNVS
Sbjct  316  IVLMHVPIYNSNDAHYMEGESMRAAFESWFVQYKVDVIFAGHVHAYERSYRISNIHYNVS  375

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YP+PDKSAPVYITVGDGGNQEGLAG+FRDPQPEYSAFREASYGHSTLEI NRTHA 
Sbjct  376  SGDQYPIPDKSAPVYITVGDGGNQEGLAGKFRDPQPEYSAFREASYGHSTLEIHNRTHAL  435

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK++ATDAFVLHNQFWG
Sbjct  436  YHWNRNDDGKKMATDAFVLHNQFWG  460



>ref|XP_006359491.1| PREDICTED: bifunctional purple acid phosphatase 26 [Solanum tuberosum]
Length=477

 Score =   384 bits (986),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 188/229 (82%), Positives = 205/229 (90%), Gaps = 0/229 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTPY+ASKS+N LWYAIRRASAHIIVLS+YSPFVKYTPQW WL++E  +V+REKTPWL
Sbjct  247  RYPTPYRASKSSNPLWYAIRRASAHIIVLSSYSPFVKYTPQWHWLKQEFKKVNREKTPWL  306

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHFMEGESMR+ YE WFVKYKVDV+FAGHVHAYERSYRISNIHYNVS
Sbjct  307  IVLMHVPIYNSNAAHFMEGESMRSAYERWFVKYKVDVIFAGHVHAYERSYRISNIHYNVS  366

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
             G AYPVPDK+AP+YITVGDGGN EGLA RFRDPQPEYSAFREASYGHSTL+IKNRTHA 
Sbjct  367  GGDAYPVPDKAAPIYITVGDGGNSEGLASRFRDPQPEYSAFREASYGHSTLDIKNRTHAI  426

Query  380  YHWNRNDDGKRVATDAFVLHNQFWGnnrrrrklnksrLQSVIVSRYSTA  234
            YHWNRNDDG  + TD+F LHNQ+WG+  RRRKLNK+ L SVI  R  TA
Sbjct  427  YHWNRNDDGNNITTDSFTLHNQYWGSGLRRRKLNKNHLNSVISKRPFTA  475



>ref|XP_006474401.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X2 
[Citrus sinensis]
Length=456

 Score =   382 bits (981),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 177/204 (87%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTP+ ASKS++ LWYAIRRASAHIIVLS+YSPFVKYTPQW+WLREEL +VDREKTPWL
Sbjct  253  RYPTPHLASKSSSPLWYAIRRASAHIIVLSSYSPFVKYTPQWEWLREELKKVDREKTPWL  312

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHFMEGESMR  +E WFV+YKVDVVFAGHVHAYERSYRISN+HYN+S
Sbjct  313  IVLMHVPIYNSNEAHFMEGESMRAAFESWFVRYKVDVVFAGHVHAYERSYRISNLHYNIS  372

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPDKSAPVYITVGDGGNQEGLAG+FR PQP+YSAFREASYGHSTLEIKNRTHAF
Sbjct  373  SGDCFPVPDKSAPVYITVGDGGNQEGLAGKFRYPQPDYSAFREASYGHSTLEIKNRTHAF  432

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGK+VATD+F+LHNQ+W
Sbjct  433  YHWNRNDDGKKVATDSFILHNQYW  456



>gb|KDO73456.1| hypothetical protein CISIN_1g011679mg [Citrus sinensis]
Length=479

 Score =   383 bits (983),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTP+ ASKS++ LWYAIRRASAHIIVLS+YSPFVKYTPQW+WLREEL +VDREKTPWL
Sbjct  253  RYPTPHLASKSSSPLWYAIRRASAHIIVLSSYSPFVKYTPQWEWLREELKKVDREKTPWL  312

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHFMEGESMR  +E WFV+YKVDVVFAGHVHAYERSYRISN+HYN+S
Sbjct  313  IVLMHVPIYNSNEAHFMEGESMRAAFESWFVRYKVDVVFAGHVHAYERSYRISNLHYNIS  372

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPDKSAPVYITVGDGGNQEGLAG+FR PQP+YSAFREASYGHSTLEIKNRTHAF
Sbjct  373  SGDCFPVPDKSAPVYITVGDGGNQEGLAGKFRYPQPDYSAFREASYGHSTLEIKNRTHAF  432

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK+VATD+F+LHNQ+W 
Sbjct  433  YHWNRNDDGKKVATDSFILHNQYWA  457



>ref|XP_006453106.1| hypothetical protein CICLE_v10008153mg [Citrus clementina]
 ref|XP_006474400.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X1 
[Citrus sinensis]
 gb|ESR66346.1| hypothetical protein CICLE_v10008153mg [Citrus clementina]
Length=479

 Score =   382 bits (982),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTP+ ASKS++ LWYAIRRASAHIIVLS+YSPFVKYTPQW+WLREEL +VDREKTPWL
Sbjct  253  RYPTPHLASKSSSPLWYAIRRASAHIIVLSSYSPFVKYTPQWEWLREELKKVDREKTPWL  312

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHFMEGESMR  +E WFV+YKVDVVFAGHVHAYERSYRISN+HYN+S
Sbjct  313  IVLMHVPIYNSNEAHFMEGESMRAAFESWFVRYKVDVVFAGHVHAYERSYRISNLHYNIS  372

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPDKSAPVYITVGDGGNQEGLAG+FR PQP+YSAFREASYGHSTLEIKNRTHAF
Sbjct  373  SGDCFPVPDKSAPVYITVGDGGNQEGLAGKFRYPQPDYSAFREASYGHSTLEIKNRTHAF  432

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK+VATD+F+LHNQ+W 
Sbjct  433  YHWNRNDDGKKVATDSFILHNQYWA  457



>ref|NP_001275256.1| purple acid phosphatase 3 precursor [Solanum tuberosum]
 gb|AAT37528.1| purple acid phosphatase 3 [Solanum tuberosum]
Length=477

 Score =   382 bits (982),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 188/231 (81%), Positives = 206/231 (89%), Gaps = 0/231 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTPY+ASKS+N LWYAIRRASAHIIVLS+YSPFVKYTPQW WL++E  +V+REKTPWL
Sbjct  247  RYPTPYRASKSSNPLWYAIRRASAHIIVLSSYSPFVKYTPQWHWLKQEFKKVNREKTPWL  306

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHFMEGESMR+ YE WFVKYKVDV+FAGHVHAYERSYRISNIHYNVS
Sbjct  307  IVLMHVPIYNSNEAHFMEGESMRSAYERWFVKYKVDVIFAGHVHAYERSYRISNIHYNVS  366

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
             G AYPVPDK+AP+YITVGDGGN EGLA RFRDPQPEYSAFREASYGHSTL+IKNRTHA 
Sbjct  367  GGDAYPVPDKAAPIYITVGDGGNSEGLASRFRDPQPEYSAFREASYGHSTLDIKNRTHAI  426

Query  380  YHWNRNDDGKRVATDAFVLHNQFWGnnrrrrklnksrLQSVIVSRYSTAPL  228
            YHWNRNDDG  + TD+F LHNQ+WG+  RRRKLNK+ L SVI  R  +A L
Sbjct  427  YHWNRNDDGNNITTDSFTLHNQYWGSGLRRRKLNKNHLNSVISERPFSARL  477



>ref|XP_009799030.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Nicotiana 
sylvestris]
Length=477

 Score =   382 bits (981),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 187/230 (81%), Positives = 211/230 (92%), Gaps = 0/230 (0%)
 Frame = -2

Query  923  FRYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPW  744
            +RYPTPY+ S+S+N LWYAIRRAS+HIIVLS+YSPFVKYTPQW WL++EL  V+REKTPW
Sbjct  246  YRYPTPYQVSRSSNPLWYAIRRASSHIIVLSSYSPFVKYTPQWHWLKQELKNVNREKTPW  305

Query  743  LIVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNV  564
            LIVLMHVPIYNSN AHFMEGESMR+V+E WF+K++VDV+FAGHVHAYERSYRISNIHYNV
Sbjct  306  LIVLMHVPIYNSNEAHFMEGESMRSVFERWFIKHRVDVIFAGHVHAYERSYRISNIHYNV  365

Query  563  SSGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHA  384
            S G AYPVPDK+AP+YITVGDGGNQEGLA RFRDPQP+YSAFREASYGHSTLEIKNRTHA
Sbjct  366  SGGDAYPVPDKTAPIYITVGDGGNQEGLASRFRDPQPDYSAFREASYGHSTLEIKNRTHA  425

Query  383  FYHWNRNDDGKRVATDAFVLHNQFWGnnrrrrklnksrLQSVIVSRYSTA  234
             YHWNRNDDG +V+TD+F LHNQ+WG+ RRRRKLNK+ L SVI  R STA
Sbjct  426  IYHWNRNDDGIKVSTDSFTLHNQYWGSARRRRKLNKNHLHSVISERPSTA  475



>ref|XP_006403101.1| hypothetical protein EUTSA_v10003451mg [Eutrema salsugineum]
 ref|XP_006403102.1| hypothetical protein EUTSA_v10003451mg [Eutrema salsugineum]
 gb|ESQ44554.1| hypothetical protein EUTSA_v10003451mg [Eutrema salsugineum]
 gb|ESQ44555.1| hypothetical protein EUTSA_v10003451mg [Eutrema salsugineum]
Length=474

 Score =   382 bits (980),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 188/223 (84%), Positives = 205/223 (92%), Gaps = 0/223 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS+N LWYA+RRASAHIIVLS+YSPFVKYTPQW+WL EEL RVDREKTPWL
Sbjct  247  RYTTPYLASKSSNPLWYAVRRASAHIIVLSSYSPFVKYTPQWRWLDEELKRVDREKTPWL  306

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHFMEGESMR  +EEWFV+++VDV+FAGHVHAYERSYRISN+ YNVS
Sbjct  307  IVLMHVPIYNSNEAHFMEGESMRAAFEEWFVEHRVDVIFAGHVHAYERSYRISNVRYNVS  366

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPDKSAPVYITVGDGGNQEGLAGRFR+PQP+YSAFREASYGHSTLEIKNRTHA 
Sbjct  367  SGDRFPVPDKSAPVYITVGDGGNQEGLAGRFREPQPDYSAFREASYGHSTLEIKNRTHAI  426

Query  380  YHWNRNDDGKRVATDAFVLHNQFWGnnrrrrklnksrLQSVIV  252
            YHWNRNDDGK+VATD FVLHNQ+WG N RRRKL K  L+SV+V
Sbjct  427  YHWNRNDDGKKVATDEFVLHNQYWGKNIRRRKLKKHYLKSVVV  469



>ref|XP_004242741.1| PREDICTED: bifunctional purple acid phosphatase 26 [Solanum lycopersicum]
 ref|XP_004242742.1| PREDICTED: bifunctional purple acid phosphatase 26 [Solanum lycopersicum]
Length=477

 Score =   380 bits (977),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 187/229 (82%), Positives = 204/229 (89%), Gaps = 0/229 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTPY+ASKS+N LWYAIRRASAHIIVLS+YSPFVKYTPQW WL++E  +V+REKTPWL
Sbjct  247  RYPTPYRASKSSNPLWYAIRRASAHIIVLSSYSPFVKYTPQWHWLKQEFKKVNREKTPWL  306

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHFMEGESMR+ YE WFVKYKVDV+FAGHVHAYERSYRISNIHYNVS
Sbjct  307  IVLMHVPIYNSNEAHFMEGESMRSSYERWFVKYKVDVIFAGHVHAYERSYRISNIHYNVS  366

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
             G AYPVPDK AP+YITVGDGGN EGLA +FRDPQPEYSAFREASYGHSTL+IKNRTHA 
Sbjct  367  GGDAYPVPDKKAPIYITVGDGGNSEGLASKFRDPQPEYSAFREASYGHSTLDIKNRTHAI  426

Query  380  YHWNRNDDGKRVATDAFVLHNQFWGnnrrrrklnksrLQSVIVSRYSTA  234
            YHWNRNDDG  + TD+F LHNQ+WG+  RRRKLNK+ L SVI  R  TA
Sbjct  427  YHWNRNDDGNNITTDSFTLHNQYWGSGLRRRKLNKNHLNSVISERPFTA  475



>ref|XP_006389431.1| hypothetical protein POPTR_0025s00640g [Populus trichocarpa]
 gb|ERP48345.1| hypothetical protein POPTR_0025s00640g [Populus trichocarpa]
Length=484

 Score =   380 bits (977),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTP+ ASKS++ LWYAIRRASAHIIVLS+YSPFVKYTPQW+WL+EEL RVDREKTPWL
Sbjct  257  RYPTPHLASKSSSPLWYAIRRASAHIIVLSSYSPFVKYTPQWEWLQEELERVDREKTPWL  316

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHFMEGESMR V+EEWFV YKVDV+FAGHVHAYERSYRISNIHYNVS
Sbjct  317  IVLMHVPIYNSNEAHFMEGESMRAVFEEWFVHYKVDVIFAGHVHAYERSYRISNIHYNVS  376

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
             G  YP  D+SAPVYITVGDGGNQEGLA RFRDPQP+YSAFREASYGHSTLEIKNRTHA 
Sbjct  377  GGDCYPAADESAPVYITVGDGGNQEGLAERFRDPQPDYSAFREASYGHSTLEIKNRTHAL  436

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK+V TDAFVLHNQ+WG
Sbjct  437  YHWNRNDDGKKVPTDAFVLHNQYWG  461



>ref|XP_010050094.1| PREDICTED: bifunctional purple acid phosphatase 26 [Eucalyptus 
grandis]
 gb|KCW82984.1| hypothetical protein EUGRSUZ_C04373 [Eucalyptus grandis]
Length=485

 Score =   380 bits (976),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  923  FRYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPW  744
            +RY TPY ASKST+ LWYA+RRASAHIIVLS+YSPFVKYTPQW WLREEL RVDREKTPW
Sbjct  256  YRYATPYLASKSTSPLWYAVRRASAHIIVLSSYSPFVKYTPQWMWLREELKRVDREKTPW  315

Query  743  LIVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNV  564
            LIVLMHVPIYNSN AHFMEGESMR+V+E WFV+ KVDV+FAGHVHAYERSYRISNIHYNV
Sbjct  316  LIVLMHVPIYNSNDAHFMEGESMRSVFERWFVRNKVDVIFAGHVHAYERSYRISNIHYNV  375

Query  563  SSGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHA  384
            S+G  YP+PD+SAPVYITVGDGGNQEGLAGRFRDPQP+YSAFREASYGHSTLEIKNRTHA
Sbjct  376  STGDRYPIPDESAPVYITVGDGGNQEGLAGRFRDPQPDYSAFREASYGHSTLEIKNRTHA  435

Query  383  FYHWNRNDDGKRVATDAFVLHNQFWG  306
             YHWNRNDDG++VATD+FVL NQ+W 
Sbjct  436  LYHWNRNDDGRKVATDSFVLQNQYWA  461



>ref|XP_007013582.1| Purple acid phosphatase 26 isoform 1 [Theobroma cacao]
 gb|EOY31201.1| Purple acid phosphatase 26 isoform 1 [Theobroma cacao]
Length=477

 Score =   380 bits (975),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 178/204 (87%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTPY A KS++ +WYAIRRASAHI+VLS+YSPFVKYTPQW WL +EL RVDREKTPWL
Sbjct  250  RYPTPYLACKSSSPMWYAIRRASAHIVVLSSYSPFVKYTPQWVWLSKELKRVDREKTPWL  309

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHFMEGESMR V+EEWF+ +KVDVVFAGHVHAYERSYRISNI YNVS
Sbjct  310  IVLMHVPIYNSNEAHFMEGESMRAVFEEWFIHHKVDVVFAGHVHAYERSYRISNIRYNVS  369

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEI+NRTHAF
Sbjct  370  SGERFPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIRNRTHAF  429

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGK+VATD+FVLHNQ+W
Sbjct  430  YHWNRNDDGKKVATDSFVLHNQYW  453



>ref|XP_008242837.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X1 
[Prunus mume]
 ref|XP_008242838.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X1 
[Prunus mume]
 ref|XP_008242839.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X1 
[Prunus mume]
Length=483

 Score =   380 bits (975),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS+N LWYAIRRASAHIIVLS+YSPFVKYTPQW+WL EEL RVDREKTPWL
Sbjct  256  RYATPYLASKSSNPLWYAIRRASAHIIVLSSYSPFVKYTPQWRWLEEELKRVDREKTPWL  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AH+MEGESMR V+E WFV YKVDV+FAGHVHAYERSYRISNIHYN++
Sbjct  316  IVLMHVPIYNSNDAHYMEGESMRVVFESWFVHYKVDVIFAGHVHAYERSYRISNIHYNIT  375

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG   P+PD SAPVYITVGDGGNQEGLAGRFRDPQP+YSAFREA+YGHSTLEI NRTHA 
Sbjct  376  SGDQNPIPDNSAPVYITVGDGGNQEGLAGRFRDPQPDYSAFREAAYGHSTLEIINRTHAL  435

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK++ATDAFVLHNQ+WG
Sbjct  436  YHWNRNDDGKKIATDAFVLHNQYWG  460



>ref|XP_007013583.1| Purple acid phosphatase 26 isoform 2 [Theobroma cacao]
 gb|EOY31202.1| Purple acid phosphatase 26 isoform 2 [Theobroma cacao]
Length=483

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 178/204 (87%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTPY A KS++ +WYAIRRASAHI+VLS+YSPFVKYTPQW WL +EL RVDREKTPWL
Sbjct  256  RYPTPYLACKSSSPMWYAIRRASAHIVVLSSYSPFVKYTPQWVWLSKELKRVDREKTPWL  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHFMEGESMR V+EEWF+ +KVDVVFAGHVHAYERSYRISNI YNVS
Sbjct  316  IVLMHVPIYNSNEAHFMEGESMRAVFEEWFIHHKVDVVFAGHVHAYERSYRISNIRYNVS  375

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEI+NRTHAF
Sbjct  376  SGERFPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIRNRTHAF  435

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGK+VATD+FVLHNQ+W
Sbjct  436  YHWNRNDDGKKVATDSFVLHNQYW  459



>ref|XP_007202018.1| hypothetical protein PRUPE_ppa004955mg [Prunus persica]
 gb|EMJ03217.1| hypothetical protein PRUPE_ppa004955mg [Prunus persica]
Length=483

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS+N LWYAIRRASAHIIVLS+YSPFVKYTPQW+WL EEL RVDREKTPWL
Sbjct  256  RYATPYLASKSSNPLWYAIRRASAHIIVLSSYSPFVKYTPQWRWLEEELKRVDREKTPWL  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AH+MEGESMR V+E WFV YKVDV+FAGHVHAYERSYRISNIHYN++
Sbjct  316  IVLMHVPIYNSNDAHYMEGESMRVVFESWFVHYKVDVIFAGHVHAYERSYRISNIHYNIT  375

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG   P+PDKSAPVYITVGDGGNQEGLAGRF DPQP+YSAFREA+YGHSTLEI NRTHA 
Sbjct  376  SGDQNPIPDKSAPVYITVGDGGNQEGLAGRFTDPQPDYSAFREAAYGHSTLEIINRTHAL  435

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK++ATDAFVLHNQ+WG
Sbjct  436  YHWNRNDDGKKIATDAFVLHNQYWG  460



>ref|XP_007013584.1| Purple acid phosphatase 26 isoform 3 [Theobroma cacao]
 gb|EOY31203.1| Purple acid phosphatase 26 isoform 3 [Theobroma cacao]
Length=489

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 178/204 (87%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTPY A KS++ +WYAIRRASAHI+VLS+YSPFVKYTPQW WL +EL RVDREKTPWL
Sbjct  256  RYPTPYLACKSSSPMWYAIRRASAHIVVLSSYSPFVKYTPQWVWLSKELKRVDREKTPWL  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHFMEGESMR V+EEWF+ +KVDVVFAGHVHAYERSYRISNI YNVS
Sbjct  316  IVLMHVPIYNSNEAHFMEGESMRAVFEEWFIHHKVDVVFAGHVHAYERSYRISNIRYNVS  375

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEI+NRTHAF
Sbjct  376  SGERFPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIRNRTHAF  435

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGK+VATD+FVLHNQ+W
Sbjct  436  YHWNRNDDGKKVATDSFVLHNQYW  459



>ref|XP_010687874.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Beta 
vulgaris subsp. vulgaris]
Length=478

 Score =   379 bits (973),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY AS+S++ LWYAIRRASAHIIVLS+YSPFVKYTPQWKWL EEL +VDREKTPWL
Sbjct  256  RYATPYAASQSSSSLWYAIRRASAHIIVLSSYSPFVKYTPQWKWLSEELKKVDREKTPWL  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHFMEGESMR+V+EEWFV YKVDV+FAGHVHAYERSYRISNI YNVS
Sbjct  316  IVLMHVPIYNSNEAHFMEGESMRSVFEEWFVNYKVDVIFAGHVHAYERSYRISNIRYNVS  375

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDK+APVYITVGDGGNQEGLAGRFRDPQPEYSAFRE+SYGHSTLEIKNRTHAF
Sbjct  376  SGERYPVPDKAAPVYITVGDGGNQEGLAGRFRDPQPEYSAFRESSYGHSTLEIKNRTHAF  435

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK+V TD+ VL NQ+W 
Sbjct  436  YHWNRNDDGKKVPTDSMVLLNQYWA  460



>ref|XP_006381099.1| hypothetical protein POPTR_0006s06250g [Populus trichocarpa]
 gb|ERP58896.1| hypothetical protein POPTR_0006s06250g [Populus trichocarpa]
Length=483

 Score =   379 bits (972),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTP+ ASKS++  WYAIRRASAHIIVLS+YS FVKYTPQW+WLREEL RVDREKTPWL
Sbjct  256  RYPTPHLASKSSSPFWYAIRRASAHIIVLSSYSSFVKYTPQWEWLREELKRVDREKTPWL  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH+PIYNSN AHFMEGESMR V+E+WFV+YKVDVVFAGHVHAYERSYR+SNIHYNVS
Sbjct  316  IVLMHIPIYNSNEAHFMEGESMRAVFEKWFVRYKVDVVFAGHVHAYERSYRVSNIHYNVS  375

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +P  D+SAPVYITVGDGGNQEGLAGRFRDPQP+YSAFREASYGHSTLEIKNRTHA 
Sbjct  376  SGDRFPAADESAPVYITVGDGGNQEGLAGRFRDPQPDYSAFREASYGHSTLEIKNRTHAI  435

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK+V TDAFVLHNQ+WG
Sbjct  436  YHWNRNDDGKKVPTDAFVLHNQYWG  460



>ref|XP_008242841.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X2 
[Prunus mume]
Length=459

 Score =   377 bits (968),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS+N LWYAIRRASAHIIVLS+YSPFVKYTPQW+WL EEL RVDREKTPWL
Sbjct  256  RYATPYLASKSSNPLWYAIRRASAHIIVLSSYSPFVKYTPQWRWLEEELKRVDREKTPWL  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AH+MEGESMR V+E WFV YKVDV+FAGHVHAYERSYRISNIHYN++
Sbjct  316  IVLMHVPIYNSNDAHYMEGESMRVVFESWFVHYKVDVIFAGHVHAYERSYRISNIHYNIT  375

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG   P+PD SAPVYITVGDGGNQEGLAGRFRDPQP+YSAFREA+YGHSTLEI NRTHA 
Sbjct  376  SGDQNPIPDNSAPVYITVGDGGNQEGLAGRFRDPQPDYSAFREAAYGHSTLEIINRTHAL  435

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGK++ATDAFVLHNQ+W
Sbjct  436  YHWNRNDDGKKIATDAFVLHNQYW  459



>ref|XP_007202017.1| hypothetical protein PRUPE_ppa004955mg [Prunus persica]
 gb|EMJ03216.1| hypothetical protein PRUPE_ppa004955mg [Prunus persica]
Length=416

 Score =   375 bits (964),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS+N LWYAIRRASAHIIVLS+YSPFVKYTPQW+WL EEL RVDREKTPWL
Sbjct  213  RYATPYLASKSSNPLWYAIRRASAHIIVLSSYSPFVKYTPQWRWLEEELKRVDREKTPWL  272

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AH+MEGESMR V+E WFV YKVDV+FAGHVHAYERSYRISNIHYN++
Sbjct  273  IVLMHVPIYNSNDAHYMEGESMRVVFESWFVHYKVDVIFAGHVHAYERSYRISNIHYNIT  332

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG   P+PDKSAPVYITVGDGGNQEGLAGRF DPQP+YSAFREA+YGHSTLEI NRTHA 
Sbjct  333  SGDQNPIPDKSAPVYITVGDGGNQEGLAGRFTDPQPDYSAFREAAYGHSTLEIINRTHAL  392

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGK++ATDAFVLHNQ+W
Sbjct  393  YHWNRNDDGKKIATDAFVLHNQYW  416



>ref|XP_010241604.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X2 
[Nelumbo nucifera]
Length=455

 Score =   377 bits (967),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKST+ LWYAIRRASAHIIVLS+YSPFVKYTPQW WLREEL RVDREKTPWL
Sbjct  252  RYATPYMASKSTDPLWYAIRRASAHIIVLSSYSPFVKYTPQWHWLREELKRVDREKTPWL  311

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IV+MHVPIYNSN AHFMEGESMR V+E+WF+ YKVD++FAGHVHAYERSYRISNIHYNVS
Sbjct  312  IVVMHVPIYNSNEAHFMEGESMRPVFEKWFIHYKVDLIFAGHVHAYERSYRISNIHYNVS  371

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YP+PDKSAPVYITVGDGGNQEGLAGRFRDPQP+YSAFREASYGHSTLEI NRTHAF
Sbjct  372  SGDRYPIPDKSAPVYITVGDGGNQEGLAGRFRDPQPDYSAFREASYGHSTLEIMNRTHAF  431

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGK+VATD+ + +NQ+W
Sbjct  432  YHWNRNDDGKKVATDSVIFNNQYW  455



>ref|XP_010241603.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X1 
[Nelumbo nucifera]
Length=478

 Score =   377 bits (968),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKST+ LWYAIRRASAHIIVLS+YSPFVKYTPQW WLREEL RVDREKTPWL
Sbjct  252  RYATPYMASKSTDPLWYAIRRASAHIIVLSSYSPFVKYTPQWHWLREELKRVDREKTPWL  311

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IV+MHVPIYNSN AHFMEGESMR V+E+WF+ YKVD++FAGHVHAYERSYRISNIHYNVS
Sbjct  312  IVVMHVPIYNSNEAHFMEGESMRPVFEKWFIHYKVDLIFAGHVHAYERSYRISNIHYNVS  371

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YP+PDKSAPVYITVGDGGNQEGLAGRFRDPQP+YSAFREASYGHSTLEI NRTHAF
Sbjct  372  SGDRYPIPDKSAPVYITVGDGGNQEGLAGRFRDPQPDYSAFREASYGHSTLEIMNRTHAF  431

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK+VATD+ + +NQ+W 
Sbjct  432  YHWNRNDDGKKVATDSVIFNNQYWA  456



>ref|XP_011017866.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X2 [Populus euphratica]
Length=434

 Score =   375 bits (964),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 189/205 (92%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTP+ ASKS++  WYAIRRASAHIIVLS+YSPFVKYTPQW+WL+EEL RVDRE TPWL
Sbjct  207  RYPTPHLASKSSSPFWYAIRRASAHIIVLSSYSPFVKYTPQWEWLKEELERVDREMTPWL  266

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHFMEGESMR V+EEWFV YKVDV+FAGHVHAYERSYRISNIHYNVS
Sbjct  267  IVLMHVPIYNSNEAHFMEGESMRAVFEEWFVHYKVDVIFAGHVHAYERSYRISNIHYNVS  326

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
             G  YP  D+SAPVYITVGDGGNQEGLA RFRDPQP+YSAFREASYGHSTLEIKNRTHA 
Sbjct  327  GGACYPAADESAPVYITVGDGGNQEGLAERFRDPQPDYSAFREASYGHSTLEIKNRTHAL  386

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK+V TDAFVLHN++WG
Sbjct  387  YHWNRNDDGKKVPTDAFVLHNRYWG  411



>ref|NP_198334.1| purple acid phosphatase 26 [Arabidopsis thaliana]
 sp|Q949Y3.1|PPA26_ARATH RecName: Full=Bifunctional purple acid phosphatase 26; Includes: 
RecName: Full=Acid phosphatase; Includes: RecName: Full=Peroxidase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK92747.1| putative acid phosphatase [Arabidopsis thaliana]
 gb|AAM14354.1| putative acid phosphatase [Arabidopsis thaliana]
 gb|AED93912.1| purple acid phosphatase 26 [Arabidopsis thaliana]
Length=475

 Score =   377 bits (967),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS++ LWYA+RRASAHIIVLS+YSPFVKYTPQW WL EELTRVDREKTPWL
Sbjct  248  RYTTPYLASKSSSPLWYAVRRASAHIIVLSSYSPFVKYTPQWHWLSEELTRVDREKTPWL  307

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHFMEGESMR  +EEWFV++KVDV+FAGHVHAYERSYRISN+ YNVS
Sbjct  308  IVLMHVPIYNSNEAHFMEGESMRAAFEEWFVQHKVDVIFAGHVHAYERSYRISNVRYNVS  367

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDKSAPVYITVGDGGNQEGLAGRF +PQP+YSAFREASYGHSTL+IKNRTHA 
Sbjct  368  SGDRYPVPDKSAPVYITVGDGGNQEGLAGRFTEPQPDYSAFREASYGHSTLDIKNRTHAI  427

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK+VATD FVLHNQ+WG
Sbjct  428  YHWNRNDDGKKVATDEFVLHNQYWG  452



>ref|XP_002870408.1| ATPAP26/PAP26 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46667.1| ATPAP26/PAP26 [Arabidopsis lyrata subsp. lyrata]
Length=475

 Score =   377 bits (967),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS++ LWYA+RRASAHIIVLS+YSPFVKYTPQW WL EEL RVDREKTPWL
Sbjct  247  RYTTPYLASKSSSPLWYAVRRASAHIIVLSSYSPFVKYTPQWHWLSEELKRVDREKTPWL  306

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHFMEGESMR V+EEWFV++KVDV+FAGHVHAYERSYRISN+ YNVS
Sbjct  307  IVLMHVPIYNSNEAHFMEGESMRAVFEEWFVEHKVDVIFAGHVHAYERSYRISNVRYNVS  366

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPDKSAPVYITVGDGGNQEGLAGRFR+PQP+YSAFREASYGHSTL+IKNRTHA 
Sbjct  367  SGDRFPVPDKSAPVYITVGDGGNQEGLAGRFREPQPDYSAFREASYGHSTLDIKNRTHAI  426

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK+VATD FVLHNQ+WG
Sbjct  427  YHWNRNDDGKKVATDEFVLHNQYWG  451



>ref|XP_010435389.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X1 
[Camelina sativa]
Length=475

 Score =   377 bits (967),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 186/225 (83%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS+N LWYA+RRASAHIIVLS+YSPFVKYTPQW WL EEL RVDREKTPWL
Sbjct  248  RYTTPYLASKSSNPLWYAVRRASAHIIVLSSYSPFVKYTPQWHWLSEELKRVDREKTPWL  307

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYN+N AHFMEGESMR  +E+WFV++KVDV+FAGHVHAYERSYRISN+ YNVS
Sbjct  308  IVLMHVPIYNTNEAHFMEGESMRAAFEKWFVEHKVDVIFAGHVHAYERSYRISNVRYNVS  367

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPDKSAPVYITVGDGGNQEGLA RFR+PQP+YSAFREASYGHSTLEIKNRTHA 
Sbjct  368  SGDRFPVPDKSAPVYITVGDGGNQEGLAARFREPQPDYSAFREASYGHSTLEIKNRTHAI  427

Query  380  YHWNRNDDGKRVATDAFVLHNQFWGnnrrrrklnksrLQSVIVSR  246
            YHWNRNDDGK+VATD FVLHNQ+WGNN RRRKL K  ++SV+  R
Sbjct  428  YHWNRNDDGKKVATDEFVLHNQYWGNNIRRRKLKKHYIKSVVADR  472



>gb|KJB64666.1| hypothetical protein B456_010G060100 [Gossypium raimondii]
Length=477

 Score =   376 bits (965),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTP+ + KS++ +WYAIRRASAHIIVLS+YSPFVKYTPQ++WL EEL +VDREKTPWL
Sbjct  250  RYPTPHLSCKSSSPMWYAIRRASAHIIVLSSYSPFVKYTPQYEWLSEELKKVDREKTPWL  309

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH+PIYNSN AHFMEGESMR V+EEWFV +KVDV+FAGHVHAYERSYRISNI YNVS
Sbjct  310  IVLMHMPIYNSNEAHFMEGESMRAVFEEWFVHHKVDVIFAGHVHAYERSYRISNIRYNVS  369

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDKSAPVYITVGDGGNQEGLAGRF DPQPEYSAFREASYGHSTLEI+NRTHAF
Sbjct  370  SGERYPVPDKSAPVYITVGDGGNQEGLAGRFLDPQPEYSAFREASYGHSTLEIQNRTHAF  429

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGKRVATD+FVLHNQ+W
Sbjct  430  YHWNRNDDGKRVATDSFVLHNQYW  453



>ref|XP_012081169.1| PREDICTED: bifunctional purple acid phosphatase 26 [Jatropha 
curcas]
 ref|XP_012081170.1| PREDICTED: bifunctional purple acid phosphatase 26 [Jatropha 
curcas]
 ref|XP_012081171.1| PREDICTED: bifunctional purple acid phosphatase 26 [Jatropha 
curcas]
 gb|KDP30232.1| hypothetical protein JCGZ_17014 [Jatropha curcas]
Length=478

 Score =   376 bits (965),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTPY ASKS++ LWYAIRRASAHIIVLS+YSPFVKYTPQW WL+ EL  V+REKTPWL
Sbjct  250  RYPTPYLASKSSSPLWYAIRRASAHIIVLSSYSPFVKYTPQWLWLKGELKNVNREKTPWL  309

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVP+YNSN AHFMEGESMR V+E+WF++YKVD++FAGHVHAYERSYRISNIHYN+S
Sbjct  310  IVLMHVPLYNSNEAHFMEGESMRVVFEKWFIRYKVDIIFAGHVHAYERSYRISNIHYNIS  369

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YP+PDKSAPVYITVGDGGNQEGLAG+FRDPQP+YSAFREASYGHSTLEI NRTHA 
Sbjct  370  SGDRYPIPDKSAPVYITVGDGGNQEGLAGKFRDPQPDYSAFREASYGHSTLEIMNRTHAI  429

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGK+V TDAFVLHNQ+W
Sbjct  430  YHWNRNDDGKKVPTDAFVLHNQYW  453



>gb|KJB64663.1| hypothetical protein B456_010G060100 [Gossypium raimondii]
 gb|KJB64664.1| hypothetical protein B456_010G060100 [Gossypium raimondii]
 gb|KJB64667.1| hypothetical protein B456_010G060100 [Gossypium raimondii]
 gb|KJB64670.1| hypothetical protein B456_010G060100 [Gossypium raimondii]
 gb|KJB64671.1| hypothetical protein B456_010G060100 [Gossypium raimondii]
Length=477

 Score =   376 bits (965),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTP+ + KS++ +WYAIRRASAHIIVLS+YSPFVKYTPQ++WL EEL +VDREKTPWL
Sbjct  250  RYPTPHLSCKSSSPMWYAIRRASAHIIVLSSYSPFVKYTPQYEWLSEELKKVDREKTPWL  309

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH+PIYNSN AHFMEGESMR V+EEWFV +KVDV+FAGHVHAYERSYRISNI YNVS
Sbjct  310  IVLMHMPIYNSNEAHFMEGESMRAVFEEWFVHHKVDVIFAGHVHAYERSYRISNIRYNVS  369

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDKSAPVYITVGDGGNQEGLAGRF DPQPEYSAFREASYGHSTLEI+NRTHAF
Sbjct  370  SGERYPVPDKSAPVYITVGDGGNQEGLAGRFLDPQPEYSAFREASYGHSTLEIQNRTHAF  429

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGKRVATD+FVLHNQ+W
Sbjct  430  YHWNRNDDGKRVATDSFVLHNQYW  453



>gb|KJB64662.1| hypothetical protein B456_010G060100 [Gossypium raimondii]
 gb|KJB64665.1| hypothetical protein B456_010G060100 [Gossypium raimondii]
 gb|KJB64669.1| hypothetical protein B456_010G060100 [Gossypium raimondii]
Length=453

 Score =   375 bits (963),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTP+ + KS++ +WYAIRRASAHIIVLS+YSPFVKYTPQ++WL EEL +VDREKTPWL
Sbjct  250  RYPTPHLSCKSSSPMWYAIRRASAHIIVLSSYSPFVKYTPQYEWLSEELKKVDREKTPWL  309

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH+PIYNSN AHFMEGESMR V+EEWFV +KVDV+FAGHVHAYERSYRISNI YNVS
Sbjct  310  IVLMHMPIYNSNEAHFMEGESMRAVFEEWFVHHKVDVIFAGHVHAYERSYRISNIRYNVS  369

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDKSAPVYITVGDGGNQEGLAGRF DPQPEYSAFREASYGHSTLEI+NRTHAF
Sbjct  370  SGERYPVPDKSAPVYITVGDGGNQEGLAGRFLDPQPEYSAFREASYGHSTLEIQNRTHAF  429

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGKRVATD+FVLHNQ+W
Sbjct  430  YHWNRNDDGKRVATDSFVLHNQYW  453



>ref|XP_011017864.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X1 [Populus euphratica]
 ref|XP_011017865.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X1 [Populus euphratica]
Length=484

 Score =   375 bits (964),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 189/205 (92%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTP+ ASKS++  WYAIRRASAHIIVLS+YSPFVKYTPQW+WL+EEL RVDRE TPWL
Sbjct  257  RYPTPHLASKSSSPFWYAIRRASAHIIVLSSYSPFVKYTPQWEWLKEELERVDREMTPWL  316

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHFMEGESMR V+EEWFV YKVDV+FAGHVHAYERSYRISNIHYNVS
Sbjct  317  IVLMHVPIYNSNEAHFMEGESMRAVFEEWFVHYKVDVIFAGHVHAYERSYRISNIHYNVS  376

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
             G  YP  D+SAPVYITVGDGGNQEGLA RFRDPQP+YSAFREASYGHSTLEIKNRTHA 
Sbjct  377  GGACYPAADESAPVYITVGDGGNQEGLAERFRDPQPDYSAFREASYGHSTLEIKNRTHAL  436

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK+V TDAFVLHN++WG
Sbjct  437  YHWNRNDDGKKVPTDAFVLHNRYWG  461



>ref|XP_010440687.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X1 [Camelina sativa]
 ref|XP_010440688.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X1 [Camelina sativa]
Length=475

 Score =   375 bits (962),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 185/225 (82%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS+N LWYA+RRASAHIIVLS+YSPFVKYTPQW WL EEL RVDREKTPWL
Sbjct  248  RYTTPYLASKSSNPLWYAVRRASAHIIVLSSYSPFVKYTPQWHWLSEELKRVDREKTPWL  307

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYN+N AHFMEGESMR  +E+WFV++KVDV+FAGHVHAYERSYRISN+ YNVS
Sbjct  308  IVLMHVPIYNTNEAHFMEGESMRAAFEKWFVEHKVDVIFAGHVHAYERSYRISNVRYNVS  367

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPDKSAPVYITVGDGGNQEGLA  FR+PQP+YSAFREASYGHSTLEIKNRTHA 
Sbjct  368  SGDRFPVPDKSAPVYITVGDGGNQEGLAASFREPQPDYSAFREASYGHSTLEIKNRTHAI  427

Query  380  YHWNRNDDGKRVATDAFVLHNQFWGnnrrrrklnksrLQSVIVSR  246
            YHWNRNDDGK+VATD FVLHNQ+WGNN RRRKL K  ++SV+ +R
Sbjct  428  YHWNRNDDGKKVATDEFVLHNQYWGNNIRRRKLKKHYIKSVVANR  472



>ref|XP_003609435.1| Purple acid phosphatase-like protein [Medicago truncatula]
 gb|AES91632.1| iron(III)-zinc(II) purple acid phosphatase, putative [Medicago 
truncatula]
Length=475

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 175/205 (85%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKST+ LWYAIRRASAHIIVLS+YSP+VKYTPQ+KWL +EL RVDREKTPWL
Sbjct  249  RYTTPYLASKSTSPLWYAIRRASAHIIVLSSYSPYVKYTPQYKWLSDELLRVDREKTPWL  308

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVP+YNSN AHFMEGESMR VYE WF+KYKVDV+FAGHVHAYERSYR SN+ YN++
Sbjct  309  IVLMHVPLYNSNEAHFMEGESMRVVYESWFIKYKVDVIFAGHVHAYERSYRFSNVDYNIT  368

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G  YPV DKSAPVYITVGDGGNQEGLA RFRDPQPEYSAFREASYGHSTLEIKNRTHA 
Sbjct  369  TGNRYPVADKSAPVYITVGDGGNQEGLASRFRDPQPEYSAFREASYGHSTLEIKNRTHAV  428

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK+VATD+FVLHNQ+WG
Sbjct  429  YHWNRNDDGKKVATDSFVLHNQYWG  453



>gb|AFK47719.1| unknown [Medicago truncatula]
Length=475

 Score =   374 bits (960),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 175/205 (85%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKST+ LWYAIRRASAHIIVLS+YSP+VKYTPQ+KWL +EL RVDREKTPWL
Sbjct  249  RYTTPYLASKSTSPLWYAIRRASAHIIVLSSYSPYVKYTPQYKWLSDELPRVDREKTPWL  308

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVP+YNSN AHFMEGESMR VYE WF+KYKVDV+FAGHVHAYERSYR SN+ YN++
Sbjct  309  IVLMHVPLYNSNEAHFMEGESMRVVYESWFIKYKVDVIFAGHVHAYERSYRFSNVDYNIT  368

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G  YPV DKSAPVYITVGDGGNQEGLA RFRDPQPEYSAFREASYGHSTLEIKNRTHA 
Sbjct  369  TGNRYPVADKSAPVYITVGDGGNQEGLASRFRDPQPEYSAFREASYGHSTLEIKNRTHAV  428

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK+VATD+FVLHNQ+WG
Sbjct  429  YHWNRNDDGKKVATDSFVLHNQYWG  453



>ref|XP_010450337.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X1 [Camelina sativa]
 ref|XP_010450338.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X1 [Camelina sativa]
Length=475

 Score =   373 bits (958),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS+N LWYA+RRASAHIIVLS+YSPFVKYTPQW WL EEL RVDREKTPWL
Sbjct  248  RYTTPYLASKSSNPLWYAVRRASAHIIVLSSYSPFVKYTPQWHWLSEELKRVDREKTPWL  307

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVP+YN+N AH+MEGESMR  +E+WFV++KVDV+FAGHVHAYERSYRISN+ YNVS
Sbjct  308  IVLMHVPLYNTNEAHYMEGESMRAAFEKWFVEHKVDVIFAGHVHAYERSYRISNVRYNVS  367

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPDKSAPVYITVGDGGNQEGLA RFR+PQP+YSAFREASYGHSTLEIKNRTHA 
Sbjct  368  SGDRFPVPDKSAPVYITVGDGGNQEGLAARFREPQPDYSAFREASYGHSTLEIKNRTHAI  427

Query  380  YHWNRNDDGKRVATDAFVLHNQFWGnnrrrrklnksrLQSVIVSR  246
            YHWNRNDDGK+VATD FVLHNQ+WGNN RRRKL K  ++S++  R
Sbjct  428  YHWNRNDDGKKVATDEFVLHNQYWGNNIRRRKLKKHYIKSIVADR  472



>ref|XP_011020214.1| PREDICTED: bifunctional purple acid phosphatase 26 [Populus euphratica]
 ref|XP_011020215.1| PREDICTED: bifunctional purple acid phosphatase 26 [Populus euphratica]
Length=483

 Score =   373 bits (958),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 175/205 (85%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTP+ ASKS++  WYAIRRASAHIIVLS+YS FVKYTPQW+WLREEL RVDREKTPWL
Sbjct  256  RYPTPHLASKSSSPFWYAIRRASAHIIVLSSYSSFVKYTPQWEWLREELKRVDREKTPWL  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH+PIYNSN AHFMEGESMR V+E+WFV+YKVDVVFAGHVHAYERSYR+SN  YNVS
Sbjct  316  IVLMHIPIYNSNEAHFMEGESMRAVFEKWFVRYKVDVVFAGHVHAYERSYRVSNTRYNVS  375

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +P  D+SAPVYITVGDGGNQEGLAGRFRDPQP+YSAFREASYGHSTLEIKNRTHA 
Sbjct  376  SGDRFPAADESAPVYITVGDGGNQEGLAGRFRDPQPDYSAFREASYGHSTLEIKNRTHAI  435

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK+V TDAFVLHNQ+WG
Sbjct  436  YHWNRNDDGKKVPTDAFVLHNQYWG  460



>gb|AGL44396.1| calcineurin-like phosphoesterase [Manihot esculenta]
Length=469

 Score =   372 bits (956),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 172/205 (84%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R+PTP+ AS+STN LWYA+RRASAHIIVLS+YS + KYTPQW+WLREELTRVDR+KTPWL
Sbjct  248  RFPTPHTASRSTNPLWYAVRRASAHIIVLSSYSSYAKYTPQWRWLREELTRVDRDKTPWL  307

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH PIYNSN+AH+MEGESMRTV+E WFV++KVD++FAGHVHAYERSYRISNI+YNVS
Sbjct  308  IVLMHAPIYNSNLAHYMEGESMRTVFESWFVRFKVDLIFAGHVHAYERSYRISNIYYNVS  367

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDKSAPVYITVGDGGNQEGLAGRF DPQPEYSAFREASYGHSTLEIKNRTHAF
Sbjct  368  SGDQYPVPDKSAPVYITVGDGGNQEGLAGRFWDPQPEYSAFREASYGHSTLEIKNRTHAF  427

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK V TD+ + +NQ+WG
Sbjct  428  YHWNRNDDGKNVPTDSVIFNNQYWG  452



>ref|XP_010435390.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X2 
[Camelina sativa]
Length=451

 Score =   372 bits (954),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS+N LWYA+RRASAHIIVLS+YSPFVKYTPQW WL EEL RVDREKTPWL
Sbjct  248  RYTTPYLASKSSNPLWYAVRRASAHIIVLSSYSPFVKYTPQWHWLSEELKRVDREKTPWL  307

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYN+N AHFMEGESMR  +E+WFV++KVDV+FAGHVHAYERSYRISN+ YNVS
Sbjct  308  IVLMHVPIYNTNEAHFMEGESMRAAFEKWFVEHKVDVIFAGHVHAYERSYRISNVRYNVS  367

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPDKSAPVYITVGDGGNQEGLA RFR+PQP+YSAFREASYGHSTLEIKNRTHA 
Sbjct  368  SGDRFPVPDKSAPVYITVGDGGNQEGLAARFREPQPDYSAFREASYGHSTLEIKNRTHAI  427

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGK+VATD FVLHNQ+W
Sbjct  428  YHWNRNDDGKKVATDEFVLHNQYW  451



>gb|AAW29950.1| putative purple acid phosphatase [Arabidopsis thaliana]
Length=475

 Score =   372 bits (956),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 189/205 (92%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS++ LWYA+RRASAHIIVLS+YSPFVKYTPQW WL EELTRVD EKTPWL
Sbjct  248  RYTTPYLASKSSSPLWYAVRRASAHIIVLSSYSPFVKYTPQWHWLSEELTRVDGEKTPWL  307

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHFMEGESMR  +EEWFV++KVDV+FAGHVHAYERSYRISN+ YNVS
Sbjct  308  IVLMHVPIYNSNEAHFMEGESMRAAFEEWFVQHKVDVIFAGHVHAYERSYRISNVRYNVS  367

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDKSAPVYITVGDGGNQEGLAGRF +PQP+YSAFREASYGHSTL IKNRTHA 
Sbjct  368  SGDRYPVPDKSAPVYITVGDGGNQEGLAGRFTEPQPDYSAFREASYGHSTLGIKNRTHAI  427

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK+VATD FVLHNQ+WG
Sbjct  428  YHWNRNDDGKKVATDEFVLHNQYWG  452



>gb|EYU40133.1| hypothetical protein MIMGU_mgv1a005618mg [Erythranthe guttata]
Length=477

 Score =   372 bits (954),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 173/205 (84%), Positives = 189/205 (92%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTPY AS+S++ LWYA+RRASAHIIVLS+YSPFVKYTPQW+WL++EL RVDREKTPWL
Sbjct  247  RYPTPYLASESSSPLWYAVRRASAHIIVLSSYSPFVKYTPQWEWLQQELKRVDREKTPWL  306

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P+YNSN AHFMEGESMR V+E WF  YKVDVVFAGHVHAYERSYRISN  YNVS
Sbjct  307  IVLVHSPLYNSNDAHFMEGESMRVVFESWFCNYKVDVVFAGHVHAYERSYRISNTRYNVS  366

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG AYPVPDKSAPVYIT+GDGGNQEGLA RFRDPQP+YSAFREASYGH+TL+IKNRTHAF
Sbjct  367  SGPAYPVPDKSAPVYITIGDGGNQEGLALRFRDPQPDYSAFREASYGHATLDIKNRTHAF  426

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGKR  TD FVLHNQ+WG
Sbjct  427  YHWNRNDDGKRTPTDEFVLHNQYWG  451



>gb|KHG11290.1| Bifunctional purple acid phosphatase 26 -like protein [Gossypium 
arboreum]
Length=477

 Score =   372 bits (954),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R+PTP+ + KS++ +WYAIRRASAHIIVLS+YSPFVKYTPQ++WL EEL +VDREKTPWL
Sbjct  250  RHPTPHLSCKSSSPMWYAIRRASAHIIVLSSYSPFVKYTPQYEWLSEELKKVDREKTPWL  309

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH+PIYNSN AHFMEGESMR V+EEWFV ++VDV+FAGHVHAYERSYRISNI YNVS
Sbjct  310  IVLMHMPIYNSNEAHFMEGESMRAVFEEWFVHHRVDVIFAGHVHAYERSYRISNIRYNVS  369

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDKSAPVYITVGDGGNQEGLAGRF DPQPEYSAFREASYGHSTLEI+NRTHAF
Sbjct  370  SGERYPVPDKSAPVYITVGDGGNQEGLAGRFLDPQPEYSAFREASYGHSTLEIQNRTHAF  429

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGK+VATD+FVLHNQ+W
Sbjct  430  YHWNRNDDGKKVATDSFVLHNQYW  453



>gb|KJB64668.1| hypothetical protein B456_010G060100 [Gossypium raimondii]
Length=484

 Score =   372 bits (954),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTP+ + KS++ +WYAIRRASAHIIVLS+YSPFVKYTPQ++WL EEL +VDREKTPWL
Sbjct  250  RYPTPHLSCKSSSPMWYAIRRASAHIIVLSSYSPFVKYTPQYEWLSEELKKVDREKTPWL  309

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH+PIYNSN AHFMEGESMR V+EEWFV +KVDV+FAGHVHAYERSYRISNI YNVS
Sbjct  310  IVLMHMPIYNSNEAHFMEGESMRAVFEEWFVHHKVDVIFAGHVHAYERSYRISNIRYNVS  369

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDKSAPVYITVGDGGNQEGLAGRF DPQPEYSAFREASYGHSTLEI+NRTHAF
Sbjct  370  SGERYPVPDKSAPVYITVGDGGNQEGLAGRFLDPQPEYSAFREASYGHSTLEIQNRTHAF  429

Query  380  YHWNRNDDGKRVATDAFVLHNQF  312
            YHWNRNDDGKRVATD+FVLHNQ 
Sbjct  430  YHWNRNDDGKRVATDSFVLHNQI  452



>ref|XP_008362885.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X1 [Malus domestica]
Length=486

 Score =   371 bits (953),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 173/205 (84%), Positives = 185/205 (90%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY AS S+N LWYAIRRASAHIIVLS+YSPFVKYTPQW WL  EL RVDR+KTPWL
Sbjct  258  RYATPYLASSSSNPLWYAIRRASAHIIVLSSYSPFVKYTPQWMWLAAELQRVDRKKTPWL  317

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVP+YNSN AH+MEGESMR V+E WFV+YKVDVVFAGHVHAYERSYR SNI YNV+
Sbjct  318  IVLMHVPMYNSNEAHYMEGESMRAVFESWFVQYKVDVVFAGHVHAYERSYRFSNIQYNVT  377

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDKSAPVYITVGDGGNQEGLAG FRDPQP+YSAFREASYGHSTLE+ NRTHA 
Sbjct  378  SGYQYPVPDKSAPVYITVGDGGNQEGLAGPFRDPQPDYSAFREASYGHSTLELINRTHAL  437

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK+ A DAFVLHNQ+WG
Sbjct  438  YHWNRNDDGKKTAMDAFVLHNQYWG  462



>ref|XP_010250242.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Nelumbo 
nucifera]
Length=531

 Score =   372 bits (956),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  923  FRYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPW  744
            +RY TPY AS S++ LWYAIRRASAHIIVL +YSPFVKYTPQW WLR+EL RVDREKTPW
Sbjct  303  YRYTTPYMASGSSSPLWYAIRRASAHIIVLCSYSPFVKYTPQWHWLRDELKRVDREKTPW  362

Query  743  LIVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNV  564
            LIVLMH PIYNSNVAHFMEGESMR+V+E WFV YKVD++FAGHVHAYERSYRISNI+YNV
Sbjct  363  LIVLMHTPIYNSNVAHFMEGESMRSVFESWFVDYKVDIIFAGHVHAYERSYRISNINYNV  422

Query  563  SSGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHA  384
            SSG  YP+PDKSAPVYITVGDGGNQEGLAGRFRDPQP+YSA+RE+SYGHSTLEIKNRTHA
Sbjct  423  SSGDRYPIPDKSAPVYITVGDGGNQEGLAGRFRDPQPDYSAYRESSYGHSTLEIKNRTHA  482

Query  383  FYHWNRNDDGKRVATDAFVLHNQFWG  306
            FYHWNRN+DG +V +D+ VLHNQ+W 
Sbjct  483  FYHWNRNEDGIKVTSDSVVLHNQYWA  508



>gb|KJB83219.1| hypothetical protein B456_013G236000 [Gossypium raimondii]
 gb|KJB83220.1| hypothetical protein B456_013G236000 [Gossypium raimondii]
Length=475

 Score =   370 bits (951),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTPY ASKS++ +WYAIRRASAHIIVLS+YSPFVKYTPQWKWL EEL RVDR+KTPWL
Sbjct  250  RYPTPYLASKSSSPMWYAIRRASAHIIVLSSYSPFVKYTPQWKWLEEELNRVDRKKTPWL  309

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+HVPIYNSN AHFMEGESMR V+EEWF+ +KVDV+FAGHVHAYERSYRISNI YNVS
Sbjct  310  IVLVHVPIYNSNEAHFMEGESMRAVFEEWFIHHKVDVIFAGHVHAYERSYRISNIRYNVS  369

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPD+SAPVYITVGDGGNQEGLAG+FRDPQP+YSAFREASYGHSTLEI NRTHA 
Sbjct  370  SGERFPVPDESAPVYITVGDGGNQEGLAGKFRDPQPDYSAFREASYGHSTLEIMNRTHAV  429

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGK+VA D+FVL+NQ+W
Sbjct  430  YHWNRNDDGKKVAIDSFVLNNQYW  453



>ref|XP_010440689.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X2 [Camelina sativa]
Length=451

 Score =   369 bits (948),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS+N LWYA+RRASAHIIVLS+YSPFVKYTPQW WL EEL RVDREKTPWL
Sbjct  248  RYTTPYLASKSSNPLWYAVRRASAHIIVLSSYSPFVKYTPQWHWLSEELKRVDREKTPWL  307

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYN+N AHFMEGESMR  +E+WFV++KVDV+FAGHVHAYERSYRISN+ YNVS
Sbjct  308  IVLMHVPIYNTNEAHFMEGESMRAAFEKWFVEHKVDVIFAGHVHAYERSYRISNVRYNVS  367

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPDKSAPVYITVGDGGNQEGLA  FR+PQP+YSAFREASYGHSTLEIKNRTHA 
Sbjct  368  SGDRFPVPDKSAPVYITVGDGGNQEGLAASFREPQPDYSAFREASYGHSTLEIKNRTHAI  427

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGK+VATD FVLHNQ+W
Sbjct  428  YHWNRNDDGKKVATDEFVLHNQYW  451



>ref|XP_010450339.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X2 [Camelina sativa]
Length=451

 Score =   369 bits (947),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS+N LWYA+RRASAHIIVLS+YSPFVKYTPQW WL EEL RVDREKTPWL
Sbjct  248  RYTTPYLASKSSNPLWYAVRRASAHIIVLSSYSPFVKYTPQWHWLSEELKRVDREKTPWL  307

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVP+YN+N AH+MEGESMR  +E+WFV++KVDV+FAGHVHAYERSYRISN+ YNVS
Sbjct  308  IVLMHVPLYNTNEAHYMEGESMRAAFEKWFVEHKVDVIFAGHVHAYERSYRISNVRYNVS  367

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPDKSAPVYITVGDGGNQEGLA RFR+PQP+YSAFREASYGHSTLEIKNRTHA 
Sbjct  368  SGDRFPVPDKSAPVYITVGDGGNQEGLAARFREPQPDYSAFREASYGHSTLEIKNRTHAI  427

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGK+VATD FVLHNQ+W
Sbjct  428  YHWNRNDDGKKVATDEFVLHNQYW  451



>ref|XP_006283714.1| hypothetical protein CARUB_v10004784mg [Capsella rubella]
 gb|EOA16612.1| hypothetical protein CARUB_v10004784mg [Capsella rubella]
Length=453

 Score =   369 bits (947),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY AS+STN LWYA+RRASAHIIVLS+YSPFVKYTPQW WL EEL RVDREKTPWL
Sbjct  250  RYTTPYLASRSTNPLWYAVRRASAHIIVLSSYSPFVKYTPQWHWLSEELKRVDREKTPWL  309

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYN+N AHFMEGESMR  +E+WFV+YKVDV+FAGHVHAYERSYRISN+ YNVS
Sbjct  310  IVLMHVPIYNTNEAHFMEGESMRAAFEKWFVEYKVDVIFAGHVHAYERSYRISNVRYNVS  369

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG   PVPDKSAPVYITVGDGGNQEGLA  FR+PQP+YSAFREASYGHSTL+IKNRTHA 
Sbjct  370  SGDCNPVPDKSAPVYITVGDGGNQEGLAAMFREPQPDYSAFREASYGHSTLDIKNRTHAI  429

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGK+VATD FVLHNQ+W
Sbjct  430  YHWNRNDDGKKVATDEFVLHNQYW  453



>gb|AET86956.1| PAP26 [Gossypium hirsutum]
Length=476

 Score =   370 bits (949),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTPY ASKS++ +WYAIRRASAHII+LS+YSPFVKYTPQWKWL EEL RVDR+KTPWL
Sbjct  250  RYPTPYLASKSSSPMWYAIRRASAHIIMLSSYSPFVKYTPQWKWLEEELNRVDRKKTPWL  309

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+HVPIYNSN AHFMEGESMR V+EEWF+ +KVDV+FAGHVHAYERSYRISNI YNVS
Sbjct  310  IVLVHVPIYNSNEAHFMEGESMRAVFEEWFIHHKVDVIFAGHVHAYERSYRISNIRYNVS  369

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPD+SAPVYITVGDGGNQEGLAG+FRDPQP+YSAFREASYGHSTLEI NRTHA 
Sbjct  370  SGERFPVPDESAPVYITVGDGGNQEGLAGKFRDPQPDYSAFREASYGHSTLEIMNRTHAV  429

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGK+VA D+FVL+NQ+W
Sbjct  430  YHWNRNDDGKKVAIDSFVLNNQYW  453



>ref|XP_010648745.1| PREDICTED: bifunctional purple acid phosphatase 26 [Vitis vinifera]
 ref|XP_010648746.1| PREDICTED: bifunctional purple acid phosphatase 26 [Vitis vinifera]
 emb|CBI21132.3| unnamed protein product [Vitis vinifera]
Length=484

 Score =   369 bits (948),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 170/205 (83%), Positives = 189/205 (92%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY AS+S+N LWYA+RRASAHIIVLS+YSPFVKYTPQWKWLREEL RVDREKTPWL
Sbjct  256  RYATPYMASQSSNPLWYAVRRASAHIIVLSSYSPFVKYTPQWKWLREELKRVDREKTPWL  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+Y+SNVAH+MEGESMR V+E WFV  KVD++FAGHVHAYERSYRISNIHYN++
Sbjct  316  IVLMHAPMYSSNVAHYMEGESMRAVFESWFVHAKVDLIFAGHVHAYERSYRISNIHYNIT  375

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G  YP+PDKSAPVYITVGDGGNQEGLAGRF DPQPEYS+FREASYGHSTLEIKNRTHAF
Sbjct  376  NGDRYPIPDKSAPVYITVGDGGNQEGLAGRFVDPQPEYSSFREASYGHSTLEIKNRTHAF  435

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK+V TD+ V +NQ+W 
Sbjct  436  YHWNRNDDGKKVPTDSVVFYNQYWA  460



>gb|AGV54598.1| acid phosphatase [Phaseolus vulgaris]
Length=479

 Score =   369 bits (947),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  923  FRYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPW  744
            +RY TPY AS S+N LWYA+RRASAHIIVLS+YSPFVKYTPQ+ WL+EEL RVDREKTPW
Sbjct  252  YRYTTPYLASNSSNPLWYAVRRASAHIIVLSSYSPFVKYTPQYMWLQEELKRVDREKTPW  311

Query  743  LIVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNV  564
            LIVLMHVP+YNSN AH+MEGESMR+V+E WF+KYKVDV+FAGHVHAYERSYR SNI YN+
Sbjct  312  LIVLMHVPLYNSNGAHYMEGESMRSVFESWFIKYKVDVIFAGHVHAYERSYRFSNIDYNI  371

Query  563  SSGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHA  384
            ++G  YP+PDKSAPVYITVGDGGNQEGLA +F DPQPEYSAFREASYGHSTLEIKNRTHA
Sbjct  372  TNGNRYPLPDKSAPVYITVGDGGNQEGLASKFLDPQPEYSAFREASYGHSTLEIKNRTHA  431

Query  383  FYHWNRNDDGKRVATDAFVLHNQFWG  306
             YHWNRNDDGK+V TD+FVLHNQ+WG
Sbjct  432  IYHWNRNDDGKKVPTDSFVLHNQYWG  457



>gb|KCW79137.1| hypothetical protein EUGRSUZ_C00583 [Eucalyptus grandis]
Length=407

 Score =   366 bits (940),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTPY ASKST+ LWYAIRRASAHIIVLS+YS FVKYT QW WLREE  RVDR+KTPWL
Sbjct  190  RYPTPYLASKSTSPLWYAIRRASAHIIVLSSYSSFVKYTLQWMWLREEFKRVDRKKTPWL  249

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVP Y+SN  HFMEGESMR V+E+WFV+ +VD+VFAGHVHAYERSYRISNI YNVS
Sbjct  250  IVLMHVPFYDSNDVHFMEGESMRAVFEKWFVRNRVDIVFAGHVHAYERSYRISNIQYNVS  309

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG   PVPD+SAP+YITVGDGGNQEGLAGRFRDPQP+YSAFREASYGHSTLEIKNRTHAF
Sbjct  310  SGDRNPVPDRSAPLYITVGDGGNQEGLAGRFRDPQPDYSAFREASYGHSTLEIKNRTHAF  369

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGK+V TD+F+LHNQ+W
Sbjct  370  YHWNRNDDGKKVETDSFILHNQYW  393



>emb|CAN71549.1| hypothetical protein VITISV_030234 [Vitis vinifera]
Length=465

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/205 (84%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -2

Query  923  FRYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPW  744
            +R+PTPY ASKS++ LWYAIRRASAHIIVLS+YSPFV YTPQW WL EE  RV+REKTPW
Sbjct  252  YRFPTPYAASKSSSPLWYAIRRASAHIIVLSSYSPFVTYTPQWLWLAEEFKRVNREKTPW  311

Query  743  LIVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNV  564
            LIVLMHVPIYNSN AHFMEGESMR  +E WF+  KVD+VFAGHVHAYERSYRISNIHY+V
Sbjct  312  LIVLMHVPIYNSNEAHFMEGESMRAAFESWFILNKVDIVFAGHVHAYERSYRISNIHYSV  371

Query  563  SSGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHA  384
            SSG  YPVPD+SAPVYITVGDGGNQEGLAGRFRDPQP+YSAFREASYGHSTLEIKNRTHA
Sbjct  372  SSGDPYPVPDESAPVYITVGDGGNQEGLAGRFRDPQPDYSAFREASYGHSTLEIKNRTHA  431

Query  383  FYHWNRNDDGKRVATDAFVLHNQFW  309
            FY WNRN DGK+V+TD+FVLHNQ+W
Sbjct  432  FYRWNRNSDGKQVSTDSFVLHNQYW  456



>ref|XP_002264680.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Vitis 
vinifera]
 ref|XP_010656512.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Vitis 
vinifera]
Length=487

 Score =   369 bits (947),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = -2

Query  923  FRYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPW  744
            +R+PTPY ASKS++ LWYAIRRASAHIIVLS+YSPFV YTPQW WL EE  RV+REKTPW
Sbjct  259  YRFPTPYAASKSSSPLWYAIRRASAHIIVLSSYSPFVTYTPQWLWLAEEFKRVNREKTPW  318

Query  743  LIVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNV  564
            LIVLMHVPIYNSN AHFMEGESMR  +E WF+  KVD+VFAGHVHAYERSYRISNIHY+V
Sbjct  319  LIVLMHVPIYNSNEAHFMEGESMRAAFESWFILNKVDIVFAGHVHAYERSYRISNIHYSV  378

Query  563  SSGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHA  384
            SSG  YPVPD+SAPVYITVGDGGNQEGLAGRFRDPQP+YSAFREASYGHSTLEIKNRTHA
Sbjct  379  SSGDPYPVPDESAPVYITVGDGGNQEGLAGRFRDPQPDYSAFREASYGHSTLEIKNRTHA  438

Query  383  FYHWNRNDDGKRVATDAFVLHNQFWG  306
            FY WNRN DGK+V+TD+FVLHNQ+W 
Sbjct  439  FYRWNRNSDGKQVSTDSFVLHNQYWA  464



>ref|XP_007155068.1| hypothetical protein PHAVU_003G170500g [Phaseolus vulgaris]
 gb|ESW27062.1| hypothetical protein PHAVU_003G170500g [Phaseolus vulgaris]
Length=480

 Score =   369 bits (946),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  923  FRYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPW  744
            +RY TPY AS S+N LWYA+RRASAHIIVLS+YSPFVKYTPQ+ WL+EEL RVDREKTPW
Sbjct  253  YRYTTPYLASNSSNPLWYAVRRASAHIIVLSSYSPFVKYTPQYMWLQEELKRVDREKTPW  312

Query  743  LIVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNV  564
            LIVLMHVP+YNSN AH+MEGESMR+V+E WF+KYKVDV+FAGHVHAYERSYR SNI YN+
Sbjct  313  LIVLMHVPLYNSNGAHYMEGESMRSVFESWFIKYKVDVIFAGHVHAYERSYRFSNIDYNI  372

Query  563  SSGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHA  384
            ++G  YP+PDKSAPVYITVGDGGNQEGLA +F DPQPEYSAFREASYGHSTLEIKNRTHA
Sbjct  373  TNGNRYPLPDKSAPVYITVGDGGNQEGLASKFLDPQPEYSAFREASYGHSTLEIKNRTHA  432

Query  383  FYHWNRNDDGKRVATDAFVLHNQFWG  306
             YHWNRNDDGK+V TD+FVLHNQ+WG
Sbjct  433  IYHWNRNDDGKKVPTDSFVLHNQYWG  458



>emb|CBI25544.3| unnamed protein product [Vitis vinifera]
Length=462

 Score =   368 bits (945),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = -2

Query  923  FRYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPW  744
            +R+PTPY ASKS++ LWYAIRRASAHIIVLS+YSPFV YTPQW WL EE  RV+REKTPW
Sbjct  234  YRFPTPYAASKSSSPLWYAIRRASAHIIVLSSYSPFVTYTPQWLWLAEEFKRVNREKTPW  293

Query  743  LIVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNV  564
            LIVLMHVPIYNSN AHFMEGESMR  +E WF+  KVD+VFAGHVHAYERSYRISNIHY+V
Sbjct  294  LIVLMHVPIYNSNEAHFMEGESMRAAFESWFILNKVDIVFAGHVHAYERSYRISNIHYSV  353

Query  563  SSGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHA  384
            SSG  YPVPD+SAPVYITVGDGGNQEGLAGRFRDPQP+YSAFREASYGHSTLEIKNRTHA
Sbjct  354  SSGDPYPVPDESAPVYITVGDGGNQEGLAGRFRDPQPDYSAFREASYGHSTLEIKNRTHA  413

Query  383  FYHWNRNDDGKRVATDAFVLHNQFWG  306
            FY WNRN DGK+V+TD+FVLHNQ+W 
Sbjct  414  FYRWNRNSDGKQVSTDSFVLHNQYWA  439



>ref|XP_008362886.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X2 [Malus domestica]
Length=461

 Score =   368 bits (944),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY AS S+N LWYAIRRASAHIIVLS+YSPFVKYTPQW WL  EL RVDR+KTPWL
Sbjct  258  RYATPYLASSSSNPLWYAIRRASAHIIVLSSYSPFVKYTPQWMWLAAELQRVDRKKTPWL  317

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVP+YNSN AH+MEGESMR V+E WFV+YKVDVVFAGHVHAYERSYR SNI YNV+
Sbjct  318  IVLMHVPMYNSNEAHYMEGESMRAVFESWFVQYKVDVVFAGHVHAYERSYRFSNIQYNVT  377

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDKSAPVYITVGDGGNQEGLAG FRDPQP+YSAFREASYGHSTLE+ NRTHA 
Sbjct  378  SGYQYPVPDKSAPVYITVGDGGNQEGLAGPFRDPQPDYSAFREASYGHSTLELINRTHAL  437

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGK+ A DAFVLHNQ+W
Sbjct  438  YHWNRNDDGKKTAMDAFVLHNQYW  461



>ref|XP_002530765.1| Iron(III)-zinc(II) purple acid phosphatase precursor, putative 
[Ricinus communis]
 gb|EEF31625.1| Iron(III)-zinc(II) purple acid phosphatase precursor, putative 
[Ricinus communis]
Length=488

 Score =   367 bits (943),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 169/205 (82%), Positives = 189/205 (92%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTP+ ASKS++ LWYAIR ASAHIIVLS+YSPFVKYTPQW+WL +EL  V+RE+TPWL
Sbjct  254  RYPTPHLASKSSSPLWYAIRCASAHIIVLSSYSPFVKYTPQWEWLHQELKNVNREQTPWL  313

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVP+YNSN AHFMEGESMR V+E+WF++YKVD++FAGHVHAYERSYRISNI YNVS
Sbjct  314  IVLMHVPLYNSNEAHFMEGESMRAVFEKWFIRYKVDIIFAGHVHAYERSYRISNIQYNVS  373

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YP+ DKSAPVYITVGDGGNQEGLA RFRDPQP+YSAFREAS+GHSTLEIKNRTHAF
Sbjct  374  SGERYPIADKSAPVYITVGDGGNQEGLAARFRDPQPDYSAFREASFGHSTLEIKNRTHAF  433

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            Y WNRNDDG +VATDAFVLHNQ+W 
Sbjct  434  YQWNRNDDGNKVATDAFVLHNQYWA  458



>ref|XP_007155069.1| hypothetical protein PHAVU_003G170500g [Phaseolus vulgaris]
 dbj|BAD05166.1| acid phosphatase [Phaseolus vulgaris]
 dbj|BAD05167.1| acid phosphatase [Phaseolus vulgaris]
 gb|ESW27063.1| hypothetical protein PHAVU_003G170500g [Phaseolus vulgaris]
Length=457

 Score =   366 bits (939),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 169/205 (82%), Positives = 189/205 (92%), Gaps = 0/205 (0%)
 Frame = -2

Query  923  FRYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPW  744
            +RY TPY AS S+N LWYA+RRASAHIIVLS+YSPFVKYTPQ+ WL+EEL RVDREKTPW
Sbjct  253  YRYTTPYLASNSSNPLWYAVRRASAHIIVLSSYSPFVKYTPQYMWLQEELKRVDREKTPW  312

Query  743  LIVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNV  564
            LIVLMHVP+YNSN AH+MEGESMR+V+E WF+KYKVDV+FAGHVHAYERSYR SNI YN+
Sbjct  313  LIVLMHVPLYNSNGAHYMEGESMRSVFESWFIKYKVDVIFAGHVHAYERSYRFSNIDYNI  372

Query  563  SSGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHA  384
            ++G  YP+PDKSAPVYITVGDGGNQEGLA +F DPQPEYSAFREASYGHSTLEIKNRTHA
Sbjct  373  TNGNRYPLPDKSAPVYITVGDGGNQEGLASKFLDPQPEYSAFREASYGHSTLEIKNRTHA  432

Query  383  FYHWNRNDDGKRVATDAFVLHNQFW  309
             YHWNRNDDGK+V TD+FVLHNQ+W
Sbjct  433  IYHWNRNDDGKKVPTDSFVLHNQYW  457



>ref|XP_008336971.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Malus 
domestica]
Length=485

 Score =   367 bits (941),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TP+ AS S+N LWYAIRRASAHIIVLS+YSPFVKYTPQW WL EEL RVDREKTPWL
Sbjct  258  RYATPHLASNSSNPLWYAIRRASAHIIVLSSYSPFVKYTPQWSWLAEELKRVDREKTPWL  317

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVP+YNSN  H+MEGESMR V+E WFV+YKVDVVFAGHVHAYERSYRISNI YNV+
Sbjct  318  IVLMHVPLYNSNDVHYMEGESMRAVFERWFVQYKVDVVFAGHVHAYERSYRISNIRYNVT  377

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YP+PDKSAPVYITVGDGGNQEGLAGRFR+PQP+YSAFREASYGHSTLE+ NRTHA 
Sbjct  378  SGYQYPIPDKSAPVYITVGDGGNQEGLAGRFRNPQPDYSAFREASYGHSTLELINRTHAL  437

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGK+ A DAF+L NQ+W
Sbjct  438  YHWNRNDDGKKTAMDAFILDNQYW  461



>ref|XP_002515485.1| Iron(III)-zinc(II) purple acid phosphatase precursor, putative 
[Ricinus communis]
 gb|EEF46934.1| Iron(III)-zinc(II) purple acid phosphatase precursor, putative 
[Ricinus communis]
Length=469

 Score =   366 bits (939),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/205 (82%), Positives = 185/205 (90%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS+N LWYAIRRAS HIIVLS+YSP+VKYTPQW+WLREE  RVDREKTPWL
Sbjct  248  RYATPYNASKSSNPLWYAIRRASTHIIVLSSYSPYVKYTPQWRWLREEFKRVDREKTPWL  307

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN  H+MEGESMR V+E WFV +KVD +FAGHVHAYERSYRISNIHYNV+
Sbjct  308  IVLMHVPIYNSNFGHYMEGESMRAVFESWFVHFKVDFIFAGHVHAYERSYRISNIHYNVT  367

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDKSAPVYITVGDGGNQEGLAGRF DPQP+YSAFREASYGHSTLEI+NRTHA 
Sbjct  368  SGDRYPVPDKSAPVYITVGDGGNQEGLAGRFWDPQPDYSAFREASYGHSTLEIRNRTHAI  427

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDG++V TD+ + HNQ+W 
Sbjct  428  YHWNRNDDGRKVPTDSVIFHNQYWA  452



>emb|CDY12397.1| BnaC08g08080D [Brassica napus]
Length=475

 Score =   366 bits (939),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 200/223 (90%), Gaps = 0/223 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS+N LWY++RRASAHIIVLS+YSPFVKYTPQW+WL EE  RVDREKTPWL
Sbjct  248  RYTTPYLASKSSNPLWYSVRRASAHIIVLSSYSPFVKYTPQWRWLDEEFKRVDREKTPWL  307

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH PIYNSN AHF EGESMR  +EEWFV+Y+VDVVFAGHVHAYERSYR+SN+ YNVS
Sbjct  308  IVLMHSPIYNSNEAHFKEGESMRAAFEEWFVEYRVDVVFAGHVHAYERSYRVSNVRYNVS  367

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPD SAPVYITVGDGGNQEGLAGRF +PQP+YSAFREASYGHSTL+IKNRTHA 
Sbjct  368  SGDRFPVPDTSAPVYITVGDGGNQEGLAGRFMEPQPDYSAFREASYGHSTLDIKNRTHAI  427

Query  380  YHWNRNDDGKRVATDAFVLHNQFWGnnrrrrklnksrLQSVIV  252
            YHWNRNDDGK+VATD FVL+NQ+WG N RRRKL K  ++SV+V
Sbjct  428  YHWNRNDDGKKVATDEFVLYNQYWGKNIRRRKLKKHYIKSVVV  470



>ref|XP_010047261.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Eucalyptus 
grandis]
 ref|XP_010047262.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Eucalyptus 
grandis]
 ref|XP_010047263.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Eucalyptus 
grandis]
 ref|XP_010047264.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Eucalyptus 
grandis]
 ref|XP_010047265.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Eucalyptus 
grandis]
 gb|KCW79136.1| hypothetical protein EUGRSUZ_C00583 [Eucalyptus grandis]
Length=466

 Score =   365 bits (938),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTPY ASKST+ LWYAIRRASAHIIVLS+YS FVKYT QW WLREE  RVDR+KTPWL
Sbjct  249  RYPTPYLASKSTSPLWYAIRRASAHIIVLSSYSSFVKYTLQWMWLREEFKRVDRKKTPWL  308

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVP Y+SN  HFMEGESMR V+E+WFV+ +VD+VFAGHVHAYERSYRISNI YNVS
Sbjct  309  IVLMHVPFYDSNDVHFMEGESMRAVFEKWFVRNRVDIVFAGHVHAYERSYRISNIQYNVS  368

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG   PVPD+SAP+YITVGDGGNQEGLAGRFRDPQP+YSAFREASYGHSTLEIKNRTHAF
Sbjct  369  SGDRNPVPDRSAPLYITVGDGGNQEGLAGRFRDPQPDYSAFREASYGHSTLEIKNRTHAF  428

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGK+V TD+F+LHNQ+W
Sbjct  429  YHWNRNDDGKKVETDSFILHNQYW  452



>ref|XP_009358556.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Pyrus 
x bretschneideri]
Length=485

 Score =   366 bits (939),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TP+ AS S+N LWYAIRRAS HIIVLS+YSPFVKYTPQW+WL EEL RVDREKTPWL
Sbjct  258  RYATPHLASNSSNPLWYAIRRASTHIIVLSSYSPFVKYTPQWRWLAEELKRVDREKTPWL  317

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVP+YNSN  H+MEGESMR V+E WF++YKVDVVFAGHVHAYERSYRISNI YNV+
Sbjct  318  IVLMHVPLYNSNDVHYMEGESMRAVFERWFIQYKVDVVFAGHVHAYERSYRISNIRYNVT  377

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YP+PDKSAPVYITVGDGGNQEGLAGRFR+PQP+YSAFREASYGHSTLE+ NRTHA 
Sbjct  378  SGYQYPIPDKSAPVYITVGDGGNQEGLAGRFRNPQPDYSAFREASYGHSTLELINRTHAL  437

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGK+ A DAFVL NQ+W
Sbjct  438  YHWNRNDDGKKTAMDAFVLDNQYW  461



>ref|XP_009363959.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X1 [Pyrus x bretschneideri]
Length=463

 Score =   365 bits (936),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY AS S+N LWYAIRRASAHIIVLS+YSPFVKYTPQ+ WL EEL +VDREKTPWL
Sbjct  258  RYATPYLASNSSNPLWYAIRRASAHIIVLSSYSPFVKYTPQYMWLAEELEKVDREKTPWL  317

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH+P+YNSN AHFMEGESMR V+E WFV+YKVDVVFAGHVHAYERSYRISNI YNV+
Sbjct  318  IVLMHIPMYNSNDAHFMEGESMRAVFESWFVQYKVDVVFAGHVHAYERSYRISNIQYNVT  377

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SGI YP+PDKSAPVY+ VGDGGN EGLA R+RDPQP+YSAFREASYGHSTLE+ NRTHA 
Sbjct  378  SGICYPIPDKSAPVYVNVGDGGNNEGLAARYRDPQPDYSAFREASYGHSTLELINRTHAL  437

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRND+GK+ A DAFV HNQ+W
Sbjct  438  YHWNRNDEGKKTAADAFVFHNQYW  461



>ref|XP_004508439.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X1 [Cicer arietinum]
 ref|XP_004508440.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X2 [Cicer arietinum]
Length=476

 Score =   364 bits (935),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 169/205 (82%), Positives = 187/205 (91%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS++ LWYA RRASAHIIVLS+YSPFVKYTPQW+WLREEL  VDREKTPWL
Sbjct  250  RYSTPYLASKSSSPLWYAFRRASAHIIVLSSYSPFVKYTPQWQWLREELKNVDREKTPWL  309

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVP+YNSN AH+MEGESMR V+E WF++YKVD++FAGHVHAYERSYR SN+ YN++
Sbjct  310  IVLMHVPLYNSNDAHYMEGESMRVVFESWFIEYKVDMIFAGHVHAYERSYRFSNVDYNIT  369

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPV DKSAPVYITVGDGGNQEGLA RF DPQPEYSAFREASYGHSTLEIKNRTHA 
Sbjct  370  SGNRYPVADKSAPVYITVGDGGNQEGLASRFMDPQPEYSAFREASYGHSTLEIKNRTHAI  429

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK+V TD+FVL+NQ+WG
Sbjct  430  YHWNRNDDGKKVPTDSFVLYNQYWG  454



>ref|XP_009108064.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X2 
[Brassica rapa]
Length=480

 Score =   365 bits (936),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 199/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS+N LWYA+RRASAHIIVLS+YSPFVKYTPQW+WL  E  RVDREKTPWL
Sbjct  253  RYTTPYLASKSSNPLWYAVRRASAHIIVLSSYSPFVKYTPQWRWLDAEFKRVDREKTPWL  312

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH PIYNSN AHF EGESMR  +EEWFV+Y+VDVVFAGHVHAYERSYR+SN+ YNVS
Sbjct  313  IVLMHSPIYNSNEAHFKEGESMRAAFEEWFVEYRVDVVFAGHVHAYERSYRVSNVRYNVS  372

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPD SAPVYITVGDGGNQEGLAGRF +PQP+YSAFREASYGHSTL+IKNRTHA 
Sbjct  373  SGDRFPVPDTSAPVYITVGDGGNQEGLAGRFMEPQPDYSAFREASYGHSTLDIKNRTHAV  432

Query  380  YHWNRNDDGKRVATDAFVLHNQFWGnnrrrrklnksrLQSVIV  252
            YHWNRNDDGK+VATD FVL+NQ+WG N RRRKL K  ++SV+V
Sbjct  433  YHWNRNDDGKKVATDEFVLYNQYWGKNIRRRKLKKHYIKSVVV  475



>emb|CDY47560.1| BnaA08g07270D [Brassica napus]
Length=480

 Score =   364 bits (935),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 199/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS+N LWYA+RRASAHIIVLS+YSPFVKYTPQW+WL  E  RVDREKTPWL
Sbjct  253  RYTTPYLASKSSNPLWYAVRRASAHIIVLSSYSPFVKYTPQWRWLDAEFKRVDREKTPWL  312

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH PIYNSN AHF EGESMR  +EEWFV+Y+VDVVFAGHVHAYERSYR+SN+ YNVS
Sbjct  313  IVLMHSPIYNSNEAHFKEGESMRAAFEEWFVEYRVDVVFAGHVHAYERSYRVSNVRYNVS  372

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPD SAPVYITVGDGGNQEGLAGRF +PQP+YSAFREASYGHSTL+IKNRTHA 
Sbjct  373  SGDRFPVPDTSAPVYITVGDGGNQEGLAGRFMEPQPDYSAFREASYGHSTLDIKNRTHAV  432

Query  380  YHWNRNDDGKRVATDAFVLHNQFWGnnrrrrklnksrLQSVIV  252
            YHWNRNDDGK+VATD FVL+NQ+WG N RRRKL K  ++SV+V
Sbjct  433  YHWNRNDDGKKVATDEFVLYNQYWGKNIRRRKLKKHYIKSVVV  475



>ref|XP_011078422.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X1 
[Sesamum indicum]
 ref|XP_011078423.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X1 
[Sesamum indicum]
Length=480

 Score =   363 bits (933),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 172/205 (84%), Positives = 186/205 (91%), Gaps = 4/205 (2%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTPY ASKS++ LWYA+RRASAHIIVLS+YSPFVKYTPQW+WL EEL RVDREKTPWL
Sbjct  247  RYPTPYPASKSSSPLWYAVRRASAHIIVLSSYSPFVKYTPQWRWLEEELKRVDREKTPWL  306

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH PIYNSN AHFMEGESMR V+E WF +YKVDV+FAGHVHAYERSYRISNI  + S
Sbjct  307  IVLMHAPIYNSNNAHFMEGESMRVVFESWFCQYKVDVIFAGHVHAYERSYRISNIRPDSS  366

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +    PVPDKSAPVYITVGDGGNQEGLA RFRDPQP+YSAFREASYGHSTLEIKNRTHA 
Sbjct  367  N----PVPDKSAPVYITVGDGGNQEGLANRFRDPQPDYSAFREASYGHSTLEIKNRTHAI  422

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRND+GKRV TD+FVLHNQ+WG
Sbjct  423  YHWNRNDEGKRVPTDSFVLHNQYWG  447



>ref|XP_004508441.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X3 [Cicer arietinum]
Length=466

 Score =   363 bits (931),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS++ LWYA RRASAHIIVLS+YSPFVKYTPQW+WLREEL  VDREKTPWL
Sbjct  250  RYSTPYLASKSSSPLWYAFRRASAHIIVLSSYSPFVKYTPQWQWLREELKNVDREKTPWL  309

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVP+YNSN AH+MEGESMR V+E WF++YKVD++FAGHVHAYERSYR SN+ YN++
Sbjct  310  IVLMHVPLYNSNDAHYMEGESMRVVFESWFIEYKVDMIFAGHVHAYERSYRFSNVDYNIT  369

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPV DKSAPVYITVGDGGNQEGLA RF DPQPEYSAFREASYGHSTLEIKNRTHA 
Sbjct  370  SGNRYPVADKSAPVYITVGDGGNQEGLASRFMDPQPEYSAFREASYGHSTLEIKNRTHAI  429

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGK+V TD+FVL+NQ+W
Sbjct  430  YHWNRNDDGKKVPTDSFVLYNQYW  453



>ref|XP_009108063.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X1 
[Brassica rapa]
Length=518

 Score =   364 bits (935),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 199/223 (89%), Gaps = 0/223 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS+N LWYA+RRASAHIIVLS+YSPFVKYTPQW+WL  E  RVDREKTPWL
Sbjct  291  RYTTPYLASKSSNPLWYAVRRASAHIIVLSSYSPFVKYTPQWRWLDAEFKRVDREKTPWL  350

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH PIYNSN AHF EGESMR  +EEWFV+Y+VDVVFAGHVHAYERSYR+SN+ YNVS
Sbjct  351  IVLMHSPIYNSNEAHFKEGESMRAAFEEWFVEYRVDVVFAGHVHAYERSYRVSNVRYNVS  410

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPD SAPVYITVGDGGNQEGLAGRF +PQP+YSAFREASYGHSTL+IKNRTHA 
Sbjct  411  SGDRFPVPDTSAPVYITVGDGGNQEGLAGRFMEPQPDYSAFREASYGHSTLDIKNRTHAV  470

Query  380  YHWNRNDDGKRVATDAFVLHNQFWGnnrrrrklnksrLQSVIV  252
            YHWNRNDDGK+VATD FVL+NQ+WG N RRRKL K  ++SV+V
Sbjct  471  YHWNRNDDGKKVATDEFVLYNQYWGKNIRRRKLKKHYIKSVVV  513



>gb|EYU34962.1| hypothetical protein MIMGU_mgv1a005843mg [Erythranthe guttata]
Length=468

 Score =   362 bits (929),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 168/205 (82%), Positives = 186/205 (91%), Gaps = 3/205 (1%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTPY AS+S++ LWYA+RRASAHIIVLS+YSPFVKYTPQWKWLR+EL +VDR+KTPWL
Sbjct  247  RYPTPYPASESSSPLWYAVRRASAHIIVLSSYSPFVKYTPQWKWLRQELKKVDRQKTPWL  306

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH PIYNSN AHF EGESMR VYE WF +YKVDV+FAGHVHAYERSYRIS++  N  
Sbjct  307  IVLMHAPIYNSNEAHFFEGESMRVVYESWFCQYKVDVIFAGHVHAYERSYRISSLRQN--  364

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
             G +YPVPDKSAPVYITVGDGGNQEGLA +FRDPQP+YSAFREASYGHSTLE+KN+THA 
Sbjct  365  -GSSYPVPDKSAPVYITVGDGGNQEGLAKKFRDPQPDYSAFREASYGHSTLEVKNKTHAI  423

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGKRV TD FVLHNQ+WG
Sbjct  424  YHWNRNDDGKRVQTDTFVLHNQYWG  448



>gb|AFY06665.1| purple acid phosphatase [Citrus trifoliata]
Length=476

 Score =   362 bits (929),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R  TPY A+KSTN LWYAIRRASAHIIVLS+YSP+VKYTPQW WLREEL +VDREKTPWL
Sbjct  255  RIATPYTAAKSTNPLWYAIRRASAHIIVLSSYSPYVKYTPQWWWLREELKKVDREKTPWL  314

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVP+Y+SNV H+MEGESMR V+E WFV  +VD +FAGHVHAYERSYRISNIHYNV+
Sbjct  315  IVLMHVPLYSSNVVHYMEGESMRAVFESWFVHSRVDFIFAGHVHAYERSYRISNIHYNVT  374

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDKSAPVY+TVGDGGNQEGLAGRF DPQP YSAFREASYGHSTLEIKNRTHAF
Sbjct  375  SGDRYPVPDKSAPVYLTVGDGGNQEGLAGRFLDPQPNYSAFREASYGHSTLEIKNRTHAF  434

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDG +V TD+ V HNQ+W
Sbjct  435  YHWNRNDDGNKVTTDSVVFHNQYW  458



>ref|XP_008373401.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Malus 
domestica]
Length=463

 Score =   361 bits (926),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY AS S+N LWYAIRRASAHIIVLS+YSPFVKYTPQ+ WL EEL +VDREKTPWL
Sbjct  258  RYATPYLASNSSNPLWYAIRRASAHIIVLSSYSPFVKYTPQYLWLAEELKKVDREKTPWL  317

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH+P+YNSN AHF EGESMR V+E WFV+YKVDVVFAGHVHAYERSYRISNI YN++
Sbjct  318  IVLMHIPMYNSNDAHFKEGESMRAVFESWFVQYKVDVVFAGHVHAYERSYRISNIQYNIT  377

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SGI YP+PDKSAPVY+ VGDGGN EGLA R+RDPQP+YSAFREASYGHSTLE+ NRTHA 
Sbjct  378  SGIWYPIPDKSAPVYVNVGDGGNNEGLAARYRDPQPDYSAFREASYGHSTLELMNRTHAL  437

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRND+GK+ A DAFVLHNQ+W
Sbjct  438  YHWNRNDEGKKTAADAFVLHNQYW  461



>ref|XP_011078424.1| PREDICTED: bifunctional purple acid phosphatase 26 isoform X2 
[Sesamum indicum]
Length=446

 Score =   360 bits (924),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 185/204 (91%), Gaps = 4/204 (2%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTPY ASKS++ LWYA+RRASAHIIVLS+YSPFVKYTPQW+WL EEL RVDREKTPWL
Sbjct  247  RYPTPYPASKSSSPLWYAVRRASAHIIVLSSYSPFVKYTPQWRWLEEELKRVDREKTPWL  306

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH PIYNSN AHFMEGESMR V+E WF +YKVDV+FAGHVHAYERSYRISNI  + S
Sbjct  307  IVLMHAPIYNSNNAHFMEGESMRVVFESWFCQYKVDVIFAGHVHAYERSYRISNIRPDSS  366

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +    PVPDKSAPVYITVGDGGNQEGLA RFRDPQP+YSAFREASYGHSTLEIKNRTHA 
Sbjct  367  N----PVPDKSAPVYITVGDGGNQEGLANRFRDPQPDYSAFREASYGHSTLEIKNRTHAI  422

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRND+GKRV TD+FVLHNQ+W
Sbjct  423  YHWNRNDEGKRVPTDSFVLHNQYW  446



>ref|XP_006371754.1| hypothetical protein POPTR_0018s01990g [Populus trichocarpa]
 gb|ERP49551.1| hypothetical protein POPTR_0018s01990g [Populus trichocarpa]
Length=460

 Score =   360 bits (925),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R+ TP+ ASKSTN LWYAIRRASAHIIVLS+YSPFVKYTPQW WLREEL RV+REKTPWL
Sbjct  257  RFATPHTASKSTNPLWYAIRRASAHIIVLSSYSPFVKYTPQWMWLREELKRVNREKTPWL  316

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IV+MHVPIYNSN AH+MEGESMR V+E WFV+ KVD +FAGHVHAYERSYRISNIHYNV+
Sbjct  317  IVVMHVPIYNSNAAHYMEGESMRAVFESWFVRSKVDFIFAGHVHAYERSYRISNIHYNVT  376

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G  YPVPDKSAPVY+TVGDGGNQEGL GRF DPQP+YSAFREASYGHSTLEI+NRTHAF
Sbjct  377  TGDRYPVPDKSAPVYLTVGDGGNQEGLVGRFVDPQPDYSAFREASYGHSTLEIRNRTHAF  436

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y WNRNDDGK   TD+ + HNQ+W
Sbjct  437  YQWNRNDDGKPETTDSVIFHNQYW  460



>ref|XP_002324876.1| hypothetical protein POPTR_0018s01990g [Populus trichocarpa]
 ref|XP_006371755.1| hypothetical protein POPTR_0018s01990g [Populus trichocarpa]
 gb|EEF03441.1| hypothetical protein POPTR_0018s01990g [Populus trichocarpa]
 gb|ERP49552.1| hypothetical protein POPTR_0018s01990g [Populus trichocarpa]
Length=478

 Score =   361 bits (926),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R+ TP+ ASKSTN LWYAIRRASAHIIVLS+YSPFVKYTPQW WLREEL RV+REKTPWL
Sbjct  257  RFATPHTASKSTNPLWYAIRRASAHIIVLSSYSPFVKYTPQWMWLREELKRVNREKTPWL  316

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IV+MHVPIYNSN AH+MEGESMR V+E WFV+ KVD +FAGHVHAYERSYRISNIHYNV+
Sbjct  317  IVVMHVPIYNSNAAHYMEGESMRAVFESWFVRSKVDFIFAGHVHAYERSYRISNIHYNVT  376

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G  YPVPDKSAPVY+TVGDGGNQEGL GRF DPQP+YSAFREASYGHSTLEI+NRTHAF
Sbjct  377  TGDRYPVPDKSAPVYLTVGDGGNQEGLVGRFVDPQPDYSAFREASYGHSTLEIRNRTHAF  436

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            Y WNRNDDGK   TD+ + HNQ+W 
Sbjct  437  YQWNRNDDGKPETTDSVIFHNQYWA  461



>ref|XP_006483400.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X1 [Citrus sinensis]
Length=479

 Score =   360 bits (925),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R  TPY ASKSTN LWYAIRRASAHIIVLS+YSP+VKYTPQW WLREEL +VDREKTPWL
Sbjct  255  RIATPYTASKSTNPLWYAIRRASAHIIVLSSYSPYVKYTPQWWWLREELKKVDREKTPWL  314

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVP+Y+SNV H+MEGESMR V+E WFV  +VD +FAGHVHAYERSYRISNIHYN +
Sbjct  315  IVLMHVPLYSSNVVHYMEGESMRAVFESWFVHSRVDFIFAGHVHAYERSYRISNIHYNFT  374

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDKSAPVY+TVGDGGNQEGLAGRF DPQP YSAFREASYGHSTLEIKNRTHAF
Sbjct  375  SGDRYPVPDKSAPVYLTVGDGGNQEGLAGRFLDPQPNYSAFREASYGHSTLEIKNRTHAF  434

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDG +V TD+ V HNQ+W
Sbjct  435  YHWNRNDDGNKVTTDSVVFHNQYW  458



>ref|XP_006450380.1| hypothetical protein CICLE_v10008150mg [Citrus clementina]
 gb|ESR63620.1| hypothetical protein CICLE_v10008150mg [Citrus clementina]
 gb|KDO61796.1| hypothetical protein CISIN_1g011680mg [Citrus sinensis]
Length=479

 Score =   360 bits (925),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R  TPY ASKSTN LWYAIRRASAHIIVLS+YSP+VKYTPQW WLREEL +VDREKTPWL
Sbjct  255  RIATPYTASKSTNPLWYAIRRASAHIIVLSSYSPYVKYTPQWWWLREELKKVDREKTPWL  314

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVP+Y+SNV H+MEGESMR V+E WFV  +VD +FAGHVHAYERSYRISNIHYN +
Sbjct  315  IVLMHVPLYSSNVVHYMEGESMRAVFESWFVHSRVDFIFAGHVHAYERSYRISNIHYNFT  374

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDKSAPVY+TVGDGGNQEGLAGRF DPQP YSAFREASYGHSTLEIKNRTHAF
Sbjct  375  SGDRYPVPDKSAPVYLTVGDGGNQEGLAGRFLDPQPNYSAFREASYGHSTLEIKNRTHAF  434

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDG +V TD+ V HNQ+W
Sbjct  435  YHWNRNDDGNKVTTDSVVFHNQYW  458



>emb|CAD30328.1| acid phosphatase [Lupinus luteus]
Length=477

 Score =   360 bits (923),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 187/205 (91%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY AS+S++ LWYAIRRASAHIIVLS+YSPFVKYTPQ+ WL+EELTRVDREKTPWL
Sbjct  250  RYTTPYLASQSSSPLWYAIRRASAHIIVLSSYSPFVKYTPQYTWLKEELTRVDREKTPWL  309

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVP+YNSN AH+MEGESMR+V+E WF+ Y+VDV+FAGHVHAYERSYR SN  YN++
Sbjct  310  IVLMHVPLYNSNEAHYMEGESMRSVFESWFIHYEVDVIFAGHVHAYERSYRFSNTDYNIT  369

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +P+ DKSAPVYITVGDGGNQEGLA RF DPQPEYSAFREASYGHSTLEIKNRTHA 
Sbjct  370  SGHRFPIADKSAPVYITVGDGGNQEGLASRFTDPQPEYSAFREASYGHSTLEIKNRTHAI  429

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK+V  D+F+L+NQ+WG
Sbjct  430  YHWNRNDDGKKVPIDSFILYNQYWG  454



>ref|NP_001236677.1| purple acid phosphatase-like protein [Glycine max]
 gb|AAN85416.1| purple acid phosphatase-like protein [Glycine max]
 gb|AAN85417.1| purple acid phosphatase-like protein [Glycine max]
 gb|AAN85418.1| purple acid phosphatase-like protein [Glycine max]
 gb|AAN85419.1| purple acid phosphatase-like protein [Glycine max]
 gb|AAN85420.1| purple acid phosphatase-like protein [Glycine max]
 gb|ADM32497.1| phytase [Glycine max]
 gb|KHN15041.1| Bifunctional purple acid phosphatase 26 [Glycine soja]
Length=512

 Score =   361 bits (926),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  923  FRYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPW  744
            +RY TPY AS S++ LWYA+RRASAHIIVLS+YSPFVKYTPQ+ WL+EEL RV+REKTPW
Sbjct  285  YRYTTPYLASNSSSPLWYAVRRASAHIIVLSSYSPFVKYTPQYMWLKEELKRVEREKTPW  344

Query  743  LIVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNV  564
            LIVLMHVP+YNSN AH+MEGESMR+V+E WF++YKVDV+FAGHVHAYERSYR SN+ YN+
Sbjct  345  LIVLMHVPLYNSNGAHYMEGESMRSVFESWFIEYKVDVIFAGHVHAYERSYRYSNVDYNI  404

Query  563  SSGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHA  384
            + G  YP+P+KSAPVYITVGDGGNQEGLA RF DPQPEYSAFREASYGHSTLEIKNRTHA
Sbjct  405  TGGNRYPLPNKSAPVYITVGDGGNQEGLASRFLDPQPEYSAFREASYGHSTLEIKNRTHA  464

Query  383  FYHWNRNDDGKRVATDAFVLHNQFWG  306
             YHWNRNDDGK+V TD+FVLHNQ+WG
Sbjct  465  IYHWNRNDDGKKVPTDSFVLHNQYWG  490



>ref|XP_011036592.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Populus 
euphratica]
 ref|XP_011036593.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Populus 
euphratica]
Length=478

 Score =   360 bits (923),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R+ TP+ ASKSTN LWYAIRRASAHIIVLS+YSPFVKYTPQW WLREEL RV+REKTPWL
Sbjct  257  RFATPHTASKSTNPLWYAIRRASAHIIVLSSYSPFVKYTPQWMWLREELKRVNREKTPWL  316

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IV+MHVPIYNSN AH+MEGESMR V+E WFV+ KVD +FAGHVHAYERSYRISNIHYN++
Sbjct  317  IVVMHVPIYNSNAAHYMEGESMRAVFESWFVRSKVDFIFAGHVHAYERSYRISNIHYNMT  376

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G  YPVPDKSAPVY+TVGDGGNQEGL GRF DPQP+YSAFREASYGHSTLEI+NRTHAF
Sbjct  377  TGDRYPVPDKSAPVYLTVGDGGNQEGLVGRFFDPQPDYSAFREASYGHSTLEIRNRTHAF  436

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            Y WNRNDDGK   TD+ + HNQ+W 
Sbjct  437  YQWNRNDDGKPETTDSVIFHNQYWA  461



>gb|AGL44397.1| calcineurin-like phosphoesterase [Manihot esculenta]
Length=477

 Score =   358 bits (918),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 170/205 (83%), Positives = 188/205 (92%), Gaps = 2/205 (1%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTP+ ASKS++ LWYAIRRASAHIIVLS+YSPFVKYTPQ+ WL  EL +V+RE+TPWL
Sbjct  252  RYPTPHSASKSSSPLWYAIRRASAHIIVLSSYSPFVKYTPQYIWLYNELEKVNREETPWL  311

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHF EGESMR+V+EEWFV+YKVD++FAGHVHAYERSYRISNIHYNVS
Sbjct  312  IVLMHVPIYNSNEAHFKEGESMRSVFEEWFVRYKVDIIFAGHVHAYERSYRISNIHYNVS  371

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G  YPV DK APVYITVGDGGNQEGLA   +DPQP+YSAFREASYGHSTLEIKNRTHAF
Sbjct  372  TGNCYPVADKFAPVYITVGDGGNQEGLAA--KDPQPDYSAFREASYGHSTLEIKNRTHAF  429

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            Y WNRNDDGK+VATDAFVLHNQ+W 
Sbjct  430  YQWNRNDDGKQVATDAFVLHNQYWA  454



>dbj|BAJ92186.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=477

 Score =   355 bits (912),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS++ +WYA+RRASAHIIVLS+YSPFVKYTPQW WLR EL RVDREKTPWL
Sbjct  248  RYSTPYLASKSSSPMWYAVRRASAHIIVLSSYSPFVKYTPQWMWLRGELKRVDREKTPWL  307

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNSN AH+MEGESMR  +E+WFVKYKVD+VFAGHVHAYERSYRISN++YN++
Sbjct  308  IVLMHSPMYNSNDAHYMEGESMRAAFEQWFVKYKVDLVFAGHVHAYERSYRISNVNYNIT  367

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDKSAPVYITVGDGGNQEGLA RF DPQP+YSAFREASYGHSTL++ NRTHA 
Sbjct  368  SGNRYPVPDKSAPVYITVGDGGNQEGLASRFNDPQPDYSAFREASYGHSTLQLMNRTHAV  427

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            Y WNRNDDGK V TD  V HNQ+W 
Sbjct  428  YQWNRNDDGKHVPTDNVVFHNQYWA  452



>ref|XP_008443931.1| PREDICTED: bifunctional purple acid phosphatase 26 [Cucumis melo]
Length=481

 Score =   354 bits (908),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 171/205 (83%), Positives = 184/205 (90%), Gaps = 1/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS++ LWYAIRRASAHIIVLS YSPFVKYTPQW W+ EE  RVDREKTPWL
Sbjct  256  RYLTPYLASKSSSPLWYAIRRASAHIIVLSAYSPFVKYTPQWHWIHEEFERVDREKTPWL  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHF EG+SMR+V+E  FVKY+VDVVFAGHVHAYERSYRIS++H NV 
Sbjct  316  IVLMHVPIYNSNEAHFEEGDSMRSVFESLFVKYRVDVVFAGHVHAYERSYRISSVHNNV-  374

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  + VPDKSAPVYITVGDGGNQEGLAGRF+DPQPEYSAFRE SYGHSTLEIKNRTHA 
Sbjct  375  SGDHHIVPDKSAPVYITVGDGGNQEGLAGRFKDPQPEYSAFREPSYGHSTLEIKNRTHAL  434

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK+VATDAFVL NQ+W 
Sbjct  435  YHWNRNDDGKKVATDAFVLRNQYWA  459



>ref|XP_011655340.1| PREDICTED: bifunctional purple acid phosphatase 26 [Cucumis sativus]
 gb|KGN65112.1| hypothetical protein Csa_1G225410 [Cucumis sativus]
Length=481

 Score =   353 bits (906),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 171/205 (83%), Positives = 184/205 (90%), Gaps = 1/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS++ LWYAIRRASAHIIVLS YSPFVKYTPQW W+ EE  RVDREKTPWL
Sbjct  256  RYLTPYLASKSSSPLWYAIRRASAHIIVLSAYSPFVKYTPQWHWIHEEFERVDREKTPWL  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHF EG+SMR+V+E  FVKY+VDVVFAGHVHAYERSYRIS++H NVS
Sbjct  316  IVLMHVPIYNSNEAHFEEGDSMRSVFESLFVKYRVDVVFAGHVHAYERSYRISSVHNNVS  375

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +   + VPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFRE SYGHSTLEIKNRTHA 
Sbjct  376  AD-HHIVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREPSYGHSTLEIKNRTHAL  434

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK+VATDAFVL NQ+W 
Sbjct  435  YHWNRNDDGKKVATDAFVLRNQYWA  459



>gb|ACR23330.1| mitochondrial acid phosphatase [Triticum aestivum]
Length=477

 Score =   351 bits (901),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS++ +WYA+RRASAHIIVLS+YSPFVKYTPQW WL+ EL RVDREKTPWL
Sbjct  248  RYSTPYLASKSSSPMWYAVRRASAHIIVLSSYSPFVKYTPQWMWLKGELKRVDREKTPWL  307

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNSN AH+MEGESMR  +E+WFVKYKVD+VFAGHVHAYERSYRISNI+YNV+
Sbjct  308  IVLMHAPMYNSNNAHYMEGESMRAAFEKWFVKYKVDLVFAGHVHAYERSYRISNINYNVT  367

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDKSAPVYITVGDGGNQEGLA RF DPQP+YSAFREAS+GHSTL++ NRTHA 
Sbjct  368  SGNRYPVPDKSAPVYITVGDGGNQEGLAWRFNDPQPDYSAFREASFGHSTLQLVNRTHAV  427

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            Y WNRNDDGK V TD  V HNQ+W 
Sbjct  428  YQWNRNDDGKHVPTDNVVFHNQYWA  452



>gb|AET22430.1| acid phosphatase [Citrus maxima]
Length=206

 Score =   341 bits (874),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTP+ ASKS++ LWYAIRRASAHIIVLS+YSPFVKYTPQW+WLREEL +VDREKTPWL
Sbjct  23   RYPTPHLASKSSSPLWYAIRRASAHIIVLSSYSPFVKYTPQWEWLREELKKVDREKTPWL  82

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHFMEGESMR  +E WFV+YKVDVVFAGHVHAYERSYRISN+HYN+S
Sbjct  83   IVLMHVPIYNSNEAHFMEGESMRAAFESWFVRYKVDVVFAGHVHAYERSYRISNLHYNIS  142

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPDKSAPVYITVGDGGNQEGLAG+FR PQP+YSAFREASYGHSTLEIKNRTHA 
Sbjct  143  SGDCFPVPDKSAPVYITVGDGGNQEGLAGKFRYPQPDYSAFREASYGHSTLEIKNRTHAI  202

Query  380  YHWN  369
            YHWN
Sbjct  203  YHWN  206



>ref|XP_003563304.2| PREDICTED: phosphoenolpyruvate phosphatase [Brachypodium distachyon]
Length=563

 Score =   352 bits (904),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY AS S++Q+WYA+RRASAHIIVLS+YSPFVKYTPQW WLR E  RVDREKTPWL
Sbjct  334  RYKTPYLASNSSSQMWYAVRRASAHIIVLSSYSPFVKYTPQWMWLRSEFKRVDREKTPWL  393

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNSN AH+MEGESMR  +E+WFVKYKVD+VFAGHVHAYERSYRISN++YN++
Sbjct  394  IVLMHAPMYNSNNAHYMEGESMRAAFEKWFVKYKVDLVFAGHVHAYERSYRISNVNYNIT  453

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDKSAPVYITVGDGGNQEGLA RF DPQP+YSAFREASYGHS L++KNRTHA 
Sbjct  454  SGSRYPVPDKSAPVYITVGDGGNQEGLASRFNDPQPDYSAFREASYGHSILQLKNRTHAV  513

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            Y W+RNDDGK V  D  V HNQ+W 
Sbjct  514  YQWHRNDDGKHVPADNVVFHNQYWA  538



>ref|XP_007011812.1| Purple acid phosphatase 26 isoform 2, partial [Theobroma cacao]
 ref|XP_007011813.1| Purple acid phosphatase 26 isoform 2, partial [Theobroma cacao]
 gb|EOY29431.1| Purple acid phosphatase 26 isoform 2, partial [Theobroma cacao]
 gb|EOY29432.1| Purple acid phosphatase 26 isoform 2, partial [Theobroma cacao]
Length=468

 Score =   349 bits (896),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY AS+S N LWYAIRRASAHIIVLS+YSP VKYTPQW+WLR+EL RVDR+KTPWL
Sbjct  257  RYSTPYLASRSNNPLWYAIRRASAHIIVLSSYSPHVKYTPQWQWLRDELKRVDRKKTPWL  316

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            I++MHVPIYNSN AHFMEGES+R V+E WFV+Y+VD +FAGHVHAYERSYRISNI YNVS
Sbjct  317  IIVMHVPIYNSNQAHFMEGESIRVVFERWFVRYRVDFIFAGHVHAYERSYRISNIRYNVS  376

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPD+SAPVY+TVGDGGNQEGLAGRF DPQPEYSAFREASYGHSTLEIKNRTH+F
Sbjct  377  SGDRYPVPDRSAPVYVTVGDGGNQEGLAGRFWDPQPEYSAFREASYGHSTLEIKNRTHSF  436

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
             HW+RNDDG++V  D+ V  N+ W 
Sbjct  437  LHWHRNDDGQKVPADSVVFLNRHWA  461



>ref|XP_006593472.1| PREDICTED: uncharacterized protein LOC100818438 isoform X1 [Glycine 
max]
Length=475

 Score =   349 bits (895),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -2

Query  923  FRYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPW  744
            +RY TPY ASKST+ LWYA+RRASAHIIVLS+YSPFVKYTPQ+ WL+EEL RVDR+KTPW
Sbjct  253  YRYTTPYSASKSTSPLWYAVRRASAHIIVLSSYSPFVKYTPQYIWLKEELARVDRKKTPW  312

Query  743  LIVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNV  564
            LIVL+H P+Y+SNVAH+MEGE+MR+V+E WFV+YKVDV+FAGHVHAYERSYR SNI YN+
Sbjct  313  LIVLVHKPLYSSNVAHYMEGEAMRSVFETWFVQYKVDVIFAGHVHAYERSYRYSNIDYNI  372

Query  563  SSGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHA  384
            + G  YP+PDKSAP+YIT+GDGGN EGLA  + DPQPEYSAFREASYGH+TLEIKNRTHA
Sbjct  373  TGGRRYPIPDKSAPIYITIGDGGNLEGLASSYLDPQPEYSAFREASYGHATLEIKNRTHA  432

Query  383  FYHWNRNDDGKRVATDAFVLHNQFWG  306
             YHW RNDDGK+V  D+ VLHNQ+WG
Sbjct  433  IYHWYRNDDGKKVPADSLVLHNQYWG  458



>ref|XP_007011811.1| Purple acid phosphatase 26 isoform 1 [Theobroma cacao]
 gb|EOY29430.1| Purple acid phosphatase 26 isoform 1 [Theobroma cacao]
Length=482

 Score =   349 bits (895),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY AS+S N LWYAIRRASAHIIVLS+YSP VKYTPQW+WLR+EL RVDR+KTPWL
Sbjct  257  RYSTPYLASRSNNPLWYAIRRASAHIIVLSSYSPHVKYTPQWQWLRDELKRVDRKKTPWL  316

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            I++MHVPIYNSN AHFMEGES+R V+E WFV+Y+VD +FAGHVHAYERSYRISNI YNVS
Sbjct  317  IIVMHVPIYNSNQAHFMEGESIRVVFERWFVRYRVDFIFAGHVHAYERSYRISNIRYNVS  376

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPD+SAPVY+TVGDGGNQEGLAGRF DPQPEYSAFREASYGHSTLEIKNRTH+F
Sbjct  377  SGDRYPVPDRSAPVYVTVGDGGNQEGLAGRFWDPQPEYSAFREASYGHSTLEIKNRTHSF  436

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
             HW+RNDDG++V  D+ V  N+ W 
Sbjct  437  LHWHRNDDGQKVPADSVVFLNRHWA  461



>gb|KHN47108.1| Bifunctional purple acid phosphatase 26 [Glycine soja]
Length=472

 Score =   348 bits (894),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -2

Query  923  FRYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPW  744
            +RY TPY ASKST+ LWYA+RRASAHIIVLS+YSPFVKYTPQ+ WL+EEL RVDR+KTPW
Sbjct  250  YRYTTPYSASKSTSPLWYAVRRASAHIIVLSSYSPFVKYTPQYIWLKEELARVDRKKTPW  309

Query  743  LIVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNV  564
            LIVL+H P+Y+SNVAH+MEGE+MR+V+E WFV+YKVDV+FAGHVHAYERSYR SNI YN+
Sbjct  310  LIVLVHKPLYSSNVAHYMEGEAMRSVFETWFVQYKVDVIFAGHVHAYERSYRYSNIDYNI  369

Query  563  SSGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHA  384
            + G  YP+PDKSAP+YIT+GDGGN EGLA  + DPQPEYSAFREASYGH+TLEIKNRTHA
Sbjct  370  TGGRRYPIPDKSAPIYITIGDGGNLEGLASSYLDPQPEYSAFREASYGHATLEIKNRTHA  429

Query  383  FYHWNRNDDGKRVATDAFVLHNQFWG  306
             YHW RNDDGK+V  D+ VLHNQ+WG
Sbjct  430  IYHWYRNDDGKKVPADSLVLHNQYWG  455



>gb|KDO73457.1| hypothetical protein CISIN_1g011679mg [Citrus sinensis]
Length=466

 Score =   348 bits (892),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 181/205 (88%), Gaps = 13/205 (6%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTP+ ASKS++ LWYAIRRASAHIIVLS+YSPFVKYTPQW+WLREEL +VDREKTPWL
Sbjct  253  RYPTPHLASKSSSPLWYAIRRASAHIIVLSSYSPFVKYTPQWEWLREELKKVDREKTPWL  312

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHFMEGESMR  +E WFV+YKVD             YRISN+HYN+S
Sbjct  313  IVLMHVPIYNSNEAHFMEGESMRAAFESWFVRYKVD-------------YRISNLHYNIS  359

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPDKSAPVYITVGDGGNQEGLAG+FR PQP+YSAFREASYGHSTLEIKNRTHAF
Sbjct  360  SGDCFPVPDKSAPVYITVGDGGNQEGLAGKFRYPQPDYSAFREASYGHSTLEIKNRTHAF  419

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK+VATD+F+LHNQ+W 
Sbjct  420  YHWNRNDDGKKVATDSFILHNQYWA  444



>gb|AET22413.1| acid phosphatase [Citrus sinensis]
Length=205

 Score =   338 bits (867),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTP+ ASKS++ LWYAIRRASAHIIVLS+YSPFVKYTPQW+WLREEL +VDREKTPWL
Sbjct  23   RYPTPHLASKSSSPLWYAIRRASAHIIVLSSYSPFVKYTPQWEWLREELKKVDREKTPWL  82

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVPIYNSN AHFMEGESMR  +E WFV+YKVDVVFAGHVHAYERSYRISN+HYN+S
Sbjct  83   IVLMHVPIYNSNEAHFMEGESMRAAFESWFVRYKVDVVFAGHVHAYERSYRISNLHYNIS  142

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPDKSAPVYITVGDGGNQEGLAG+FR PQP+YSAFREASYGHSTLEIKNRTHA 
Sbjct  143  SGDCFPVPDKSAPVYITVGDGGNQEGLAGKFRYPQPDYSAFREASYGHSTLEIKNRTHAI  202

Query  380  YHW  372
            YHW
Sbjct  203  YHW  205



>ref|XP_011626417.1| PREDICTED: bifunctional purple acid phosphatase 26 [Amborella 
trichopoda]
 ref|XP_011626418.1| PREDICTED: bifunctional purple acid phosphatase 26 [Amborella 
trichopoda]
Length=484

 Score =   348 bits (892),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 186/205 (91%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY AS+S++ LWYAIRRASAHIIVLS+YSPFVKYTPQW WLR EL RVDREKTPWL
Sbjct  254  RYATPYMASESSSPLWYAIRRASAHIIVLSSYSPFVKYTPQWLWLRSELHRVDREKTPWL  313

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVP+YNSN AH+MEGESMR V+E+WF+KYK D+VFAGHVHAYERS+R+SNI YN++
Sbjct  314  IVLMHVPMYNSNGAHYMEGESMRAVFEKWFIKYKADLVFAGHVHAYERSHRVSNIRYNIT  373

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G  +P+ D+SAP+YITVGDGGNQEGLA +F  PQP+YSAFREASYGHSTLEIKN+THAF
Sbjct  374  NGERFPMRDESAPIYITVGDGGNQEGLASKFSYPQPDYSAFREASYGHSTLEIKNQTHAF  433

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK+V TD+ +L NQ+WG
Sbjct  434  YHWNRNDDGKKVLTDSVILFNQYWG  458



>ref|XP_008795838.1| PREDICTED: phosphoenolpyruvate phosphatase [Phoenix dactylifera]
Length=475

 Score =   347 bits (890),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS++ LWYA+RRASAHIIVLS+YS FVKYTPQW WL EE+ RVDREKTPWL
Sbjct  249  RYATPYVASKSSSPLWYAVRRASAHIIVLSSYSSFVKYTPQWFWLLEEVKRVDREKTPWL  308

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNSN AH+MEGESMR V+E WFV+YKVD+VF+GHVHAYERSYRISNI+YN++
Sbjct  309  IVLMHAPLYNSNEAHYMEGESMRAVFESWFVRYKVDLVFSGHVHAYERSYRISNINYNIT  368

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +P+PDKSAPVYITVGDGGNQEGLA RF DPQP+YSAFREASYGHSTLE+KNRTHA 
Sbjct  369  SGSRHPMPDKSAPVYITVGDGGNQEGLAVRFSDPQPDYSAFREASYGHSTLELKNRTHAL  428

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            Y WNRNDDGK V TD  V HNQ+W 
Sbjct  429  YRWNRNDDGKPVHTDHVVFHNQYWA  453



>gb|ERN14342.1| hypothetical protein AMTR_s00033p00208170 [Amborella trichopoda]
Length=509

 Score =   348 bits (893),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 186/205 (91%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY AS+S++ LWYAIRRASAHIIVLS+YSPFVKYTPQW WLR EL RVDREKTPWL
Sbjct  279  RYATPYMASESSSPLWYAIRRASAHIIVLSSYSPFVKYTPQWLWLRSELHRVDREKTPWL  338

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVP+YNSN AH+MEGESMR V+E+WF+KYK D+VFAGHVHAYERS+R+SNI YN++
Sbjct  339  IVLMHVPMYNSNGAHYMEGESMRAVFEKWFIKYKADLVFAGHVHAYERSHRVSNIRYNIT  398

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G  +P+ D+SAP+YITVGDGGNQEGLA +F  PQP+YSAFREASYGHSTLEIKN+THAF
Sbjct  399  NGERFPMRDESAPIYITVGDGGNQEGLASKFSYPQPDYSAFREASYGHSTLEIKNQTHAF  458

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK+V TD+ +L NQ+WG
Sbjct  459  YHWNRNDDGKKVLTDSVILFNQYWG  483



>ref|NP_001239650.1| uncharacterized protein LOC100818438 precursor [Glycine max]
 gb|ADM32498.1| phytase [Glycine max]
Length=457

 Score =   346 bits (888),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = -2

Query  923  FRYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPW  744
            +RY TPY ASKST+ LWYA+RRASAHIIVLS+YSPFVKYTPQ+ WL+EEL RVDR+KTPW
Sbjct  253  YRYTTPYSASKSTSPLWYAVRRASAHIIVLSSYSPFVKYTPQYIWLKEELARVDRKKTPW  312

Query  743  LIVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNV  564
            LIVL+H P+Y+SNVAH+MEGE+MR+V+E WFV+YKVDV+FAGHVHAYERSYR SNI YN+
Sbjct  313  LIVLVHKPLYSSNVAHYMEGEAMRSVFETWFVQYKVDVIFAGHVHAYERSYRYSNIDYNI  372

Query  563  SSGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHA  384
            + G  YP+PDKSAP+YIT+GDGGN EGLA  + DPQPEYSAFREASYGH+TLEIKNRTHA
Sbjct  373  TGGRRYPIPDKSAPIYITIGDGGNLEGLASSYLDPQPEYSAFREASYGHATLEIKNRTHA  432

Query  383  FYHWNRNDDGKRVATDAFVLHNQFW  309
             YHW RNDDGK+V  D+ VLHNQ+W
Sbjct  433  IYHWYRNDDGKKVPADSLVLHNQYW  457



>ref|XP_009392136.1| PREDICTED: phosphoenolpyruvate phosphatase-like [Musa acuminata 
subsp. malaccensis]
Length=468

 Score =   346 bits (888),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/205 (79%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY +SKS++ LWYA+RRASAHIIVLS+YSPFVKYTPQW WLREEL RV+REKTPWL
Sbjct  248  RYVTPYVSSKSSSPLWYAVRRASAHIIVLSSYSPFVKYTPQWFWLREELKRVNREKTPWL  307

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVP+YNSN AH+MEGE+MR V+E WFV YKVD+VFAGHVHAYERSYR+SN++YN++
Sbjct  308  IVLMHVPLYNSNEAHYMEGEAMRDVFESWFVHYKVDIVFAGHVHAYERSYRVSNMNYNIT  367

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPDKSAPVYI VGDGGNQEGLA RF D QP+YSAFREASYGHSTLE+KNRTHAF
Sbjct  368  SGSRHPVPDKSAPVYIIVGDGGNQEGLAVRFSDLQPDYSAFREASYGHSTLELKNRTHAF  427

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRN+DGK V TD  V  NQ+W 
Sbjct  428  YHWNRNNDGKHVLTDHIVFRNQYWA  452



>ref|XP_010696563.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010696569.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010696573.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010696577.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Beta 
vulgaris subsp. vulgaris]
Length=469

 Score =   346 bits (887),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTP+ ASKS++ LWY++RRASAHIIVLS+YSPFV+ TPQW WLREEL RVDREKTPWL
Sbjct  255  RYPTPHVASKSSSPLWYSVRRASAHIIVLSSYSPFVRSTPQWMWLREELHRVDREKTPWL  314

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            I+LMH PIY+SNV H+MEGESMR+V+E WFV+Y+VD+VFAGHVHAYERSYRISNIHYNV+
Sbjct  315  IILMHAPIYSSNVIHYMEGESMRSVFESWFVRYRVDLVFAGHVHAYERSYRISNIHYNVT  374

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
             G  YPVPDK+APVYITVGDGGN+EGLA +F DPQP+YSAFREASYGHSTLEI NRTHA 
Sbjct  375  YGDRYPVPDKAAPVYITVGDGGNREGLAAKFWDPQPDYSAFREASYGHSTLEIWNRTHAI  434

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            Y WNRNDDGK + TD  V HNQ+W 
Sbjct  435  YRWNRNDDGKSMPTDDVVFHNQYWA  459



>sp|Q93WP4.1|PEPP_ALLCE RecName: Full=Phosphoenolpyruvate phosphatase; Short=PEP phosphatase; 
Flags: Precursor [Allium cepa]
 dbj|BAB60719.1| PEP phosphatase [Allium cepa]
Length=481

 Score =   346 bits (888),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTP+ AS S++ LWY+IRRASAHIIVLS+YSPFVKYTPQW WL EELTRVDREKTPWL
Sbjct  253  RYPTPHLASASSSPLWYSIRRASAHIIVLSSYSPFVKYTPQWLWLSEELTRVDREKTPWL  312

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNSN AH+MEGESMR  +E WFV+YKVD+VFAGHVHAYERSYRISNI YN++
Sbjct  313  IVLMHAPLYNSNEAHYMEGESMRVAFESWFVQYKVDLVFAGHVHAYERSYRISNIVYNIT  372

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YP+PDKSAPVYITVGDGGNQEGLA RF + QP+YSAFRE+SYGHSTLE++NRTHAF
Sbjct  373  SGNRYPIPDKSAPVYITVGDGGNQEGLAERFSESQPDYSAFRESSYGHSTLELRNRTHAF  432

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            Y WNRNDDGK +  D  +  NQ+W 
Sbjct  433  YQWNRNDDGKHIPVDRIIFRNQYWA  457



>ref|XP_004965755.1| PREDICTED: phosphoenolpyruvate phosphatase-like [Setaria italica]
Length=476

 Score =   345 bits (886),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS++ +WYA+RRASAHIIVLS+YSPFVKYTPQW WL+ EL RVDREKTPWL
Sbjct  247  RYMTPYLASKSSSPMWYAVRRASAHIIVLSSYSPFVKYTPQWWWLKNELKRVDREKTPWL  306

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNSN AH+MEGESMR  +E+WFVKYKVD+VFAGHVHAYERSYRISN++YN++
Sbjct  307  IVLMHSPMYNSNEAHYMEGESMRAAFEKWFVKYKVDLVFAGHVHAYERSYRISNVNYNIT  366

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVP+KSAPVYITVGDGGNQEGLA RF DPQP+YSAFREASYGHS L++KNRTHA 
Sbjct  367  SGNRYPVPNKSAPVYITVGDGGNQEGLASRFLDPQPDYSAFREASYGHSILQLKNRTHAV  426

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y WNRNDDG  V  D  V HNQ+W
Sbjct  427  YCWNRNDDGNHVPADTVVFHNQYW  450



>gb|EEC81063.1| hypothetical protein OsI_23873 [Oryza sativa Indica Group]
Length=476

 Score =   345 bits (885),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R  TPY ASKS++ +WYA+RRASAHIIVLS+YSPFVKYTPQW WL+ EL  VDREKTPWL
Sbjct  247  RCHTPYLASKSSSPMWYAVRRASAHIIVLSSYSPFVKYTPQWTWLKYELKHVDREKTPWL  306

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNSN AH+MEGESMR  +E+WFVKYKVD+VFAGHVHAYERSYRISNI+YN++
Sbjct  307  IVLMHSPMYNSNEAHYMEGESMRAAFEKWFVKYKVDLVFAGHVHAYERSYRISNINYNIT  366

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDKSAPVYITVGDGGNQEGLA RF DPQP+YSAFREASYGHS L++KNRTHA 
Sbjct  367  SGNRYPVPDKSAPVYITVGDGGNQEGLASRFSDPQPDYSAFREASYGHSILQLKNRTHAI  426

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            Y WNRNDDGK V  D  V HNQ+W 
Sbjct  427  YQWNRNDDGKHVPADNVVFHNQYWA  451



>ref|NP_001058182.1| Os06g0643900 [Oryza sativa Japonica Group]
 gb|AAM00197.1|AF356352_1 acid phosphatase [Oryza sativa]
 dbj|BAD37373.1| acid phosphatase [Oryza sativa Japonica Group]
 dbj|BAD37429.1| acid phosphatase [Oryza sativa Japonica Group]
 dbj|BAF20096.1| Os06g0643900 [Oryza sativa Japonica Group]
 gb|EAZ37798.1| hypothetical protein OsJ_22134 [Oryza sativa Japonica Group]
Length=476

 Score =   345 bits (885),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R  TPY ASKS++ +WYA+RRASAHIIVLS+YSPFVKYTPQW WL+ EL  VDREKTPWL
Sbjct  247  RCHTPYLASKSSSPMWYAVRRASAHIIVLSSYSPFVKYTPQWTWLKYELKHVDREKTPWL  306

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNSN AH+MEGESMR  +E+WFVKYKVD+VFAGHVHAYERSYRISNI+YN++
Sbjct  307  IVLMHSPMYNSNEAHYMEGESMRAAFEKWFVKYKVDLVFAGHVHAYERSYRISNINYNIT  366

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDKSAPVYITVGDGGNQEGLA RF DPQP+YSAFREASYGHS L++KNRTHA 
Sbjct  367  SGNRYPVPDKSAPVYITVGDGGNQEGLASRFSDPQPDYSAFREASYGHSILQLKNRTHAI  426

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            Y WNRNDDGK V  D  V HNQ+W 
Sbjct  427  YQWNRNDDGKHVPADNVVFHNQYWA  451



>ref|XP_009418189.1| PREDICTED: phosphoenolpyruvate phosphatase-like [Musa acuminata 
subsp. malaccensis]
Length=484

 Score =   345 bits (884),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R+ TPY AS+S++ LWYA+RRASAHIIVLS+YSPFVKYTPQW WLR EL +V+REKTPWL
Sbjct  248  RFATPYVASQSSSPLWYAVRRASAHIIVLSSYSPFVKYTPQWFWLRGELKQVNREKTPWL  307

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMHVP+YNSN AH+MEGE+MR V+E WFV YKVD+VFAGHVHAYERSYR+SNI+YN++
Sbjct  308  IVLMHVPMYNSNEAHYMEGEAMRAVFESWFVHYKVDIVFAGHVHAYERSYRVSNINYNIT  367

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDKSAPVYITVGDGGNQEGLA RF   QP+YSA+REASYGHSTLE+KNRTHA 
Sbjct  368  SGNRYPVPDKSAPVYITVGDGGNQEGLAERFSKLQPDYSAYREASYGHSTLELKNRTHAL  427

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDGK V TD  + HNQ+W 
Sbjct  428  YHWNRNDDGKHVPTDHIIFHNQYWA  452



>gb|AGT16393.1| purple acid phosphatase precursor [Saccharum hybrid cultivar 
R570]
Length=425

 Score =   343 bits (879),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS++ +WYA+RRASAHIIVLS+YSPFVKYTPQW WL+ E  RVDREKTPWL
Sbjct  196  RYMTPYLASKSSSPMWYAVRRASAHIIVLSSYSPFVKYTPQWLWLKHEFKRVDREKTPWL  255

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNSN AH+MEGESMR  +E+WFVKYKVD+VFAGHVHAYERSYRISN++YN++
Sbjct  256  IVLMHSPMYNSNEAHYMEGESMRAAFEKWFVKYKVDLVFAGHVHAYERSYRISNVNYNIT  315

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVP+KSAPVYITVGDGGNQEGLA RF DPQP+YSAFREASYGHS L++KNRTHA 
Sbjct  316  SGNRYPVPNKSAPVYITVGDGGNQEGLASRFYDPQPDYSAFREASYGHSILQLKNRTHAV  375

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y WNRNDDG  V  D  + HNQ+W
Sbjct  376  YQWNRNDDGNPVPADTVMFHNQYW  399



>ref|XP_006656291.1| PREDICTED: phosphoenolpyruvate phosphatase-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006656292.1| PREDICTED: phosphoenolpyruvate phosphatase-like isoform X2 [Oryza 
brachyantha]
Length=477

 Score =   344 bits (883),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS++ +WYA+RRASAHIIVLS+YSPFVKYTPQW WL+ EL  VDREKTPWL
Sbjct  248  RYQTPYLASKSSSPMWYAVRRASAHIIVLSSYSPFVKYTPQWTWLKNELKHVDREKTPWL  307

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNSN AH+MEGES+R  +E+WFVKYKVD+VFAGHVHAYERSYRISNI+YN++
Sbjct  308  IVLMHAPMYNSNEAHYMEGESIRAAFEKWFVKYKVDLVFAGHVHAYERSYRISNINYNIT  367

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YP+ DKSAPVYITVGDGGNQEGLA RF DPQP+YSAFREASYGHS L++KNRTHA 
Sbjct  368  SGNRYPMADKSAPVYITVGDGGNQEGLASRFSDPQPDYSAFREASYGHSILQLKNRTHAI  427

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            Y WNRNDDGK V  D  V HNQ+W 
Sbjct  428  YQWNRNDDGKNVPADNVVFHNQYWA  452



>ref|NP_001147979.1| purple acid phosphatase precursor [Zea mays]
 gb|ACG29312.1| purple acid phosphatase precursor [Zea mays]
Length=476

 Score =   343 bits (880),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS++ +WYA+RRASAHIIVLS+YSPFVKYTPQW WL+ E  RVDREKTPWL
Sbjct  247  RYMTPYLASKSSSPMWYAVRRASAHIIVLSSYSPFVKYTPQWLWLKNEFKRVDREKTPWL  306

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNSN AH+MEGESMR  +E+WFVKYKVD+VFAGHVHAYERSYRISN++YN++
Sbjct  307  IVLMHSPMYNSNEAHYMEGESMRAAFEKWFVKYKVDLVFAGHVHAYERSYRISNVNYNIT  366

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDKSAPVYITVGDGGNQEGLA RF +PQP+YSAFREASYGHS L++KNRTHA 
Sbjct  367  SGNRYPVPDKSAPVYITVGDGGNQEGLASRFYNPQPDYSAFREASYGHSVLQLKNRTHAI  426

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y WNRNDDG  V  D  + HNQ+W
Sbjct  427  YQWNRNDDGNPVPADTVMFHNQYW  450



>gb|ACF84615.1| unknown [Zea mays]
 gb|AFW87298.1| hypothetical protein ZEAMMB73_796282 [Zea mays]
Length=476

 Score =   343 bits (880),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS++ +WYA+RRASAHIIVLS+YSPFVKYTPQW WL+ E  RVDREKTPWL
Sbjct  247  RYMTPYLASKSSSPMWYAVRRASAHIIVLSSYSPFVKYTPQWLWLKNEFKRVDREKTPWL  306

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNSN AH+MEGESMR  +E+WFVKYKVD+VFAGHVHAYERSYRISN++YN++
Sbjct  307  IVLMHSPMYNSNEAHYMEGESMRAAFEKWFVKYKVDLVFAGHVHAYERSYRISNVNYNIT  366

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDKSAPVYITVGDGGNQEGLA RF +PQP+YSAFREASYGHS L++KNRTHA 
Sbjct  367  SGNRYPVPDKSAPVYITVGDGGNQEGLASRFYNPQPDYSAFREASYGHSVLQLKNRTHAI  426

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y WNRNDDG  V  D  + HNQ+W
Sbjct  427  YQWNRNDDGNPVPADTVMFHNQYW  450



>ref|XP_010913337.1| PREDICTED: phosphoenolpyruvate phosphatase isoform X2 [Elaeis 
guineensis]
Length=487

 Score =   343 bits (880),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 178/205 (87%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS++ LWYA+RRAS HIIVLS+YSPFVKY PQW WL EEL RVDREKTPWL
Sbjct  261  RYATPYVASKSSSPLWYAVRRASVHIIVLSSYSPFVKYAPQWFWLLEELKRVDREKTPWL  320

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNSN AH+MEGESMR  +E  FV YKVD+VF+GHVHAYERSYRISNI+YN++
Sbjct  321  IVLMHTPLYNSNEAHYMEGESMRAAFESLFVHYKVDIVFSGHVHAYERSYRISNINYNIT  380

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YP+PDKSAPVYITVGDGGNQEGLA RF +PQP+YSAFREASYGHSTLE+KNRTHA 
Sbjct  381  SGSRYPMPDKSAPVYITVGDGGNQEGLAVRFSEPQPDYSAFREASYGHSTLELKNRTHAL  440

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            Y WNRNDDGK V TD  V HNQ+W 
Sbjct  441  YRWNRNDDGKPVPTDHVVFHNQYWA  465



>gb|KJB65855.1| hypothetical protein B456_010G116200 [Gossypium raimondii]
Length=404

 Score =   340 bits (873),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R+ TP+ AS+S N LWYAIRR SAHIIVLS+YSP VKYTPQW WLR+EL RVDR+KTPWL
Sbjct  179  RFSTPHLASRSNNPLWYAIRRVSAHIIVLSSYSPHVKYTPQWLWLRDELKRVDRKKTPWL  238

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            I+LMHVPIYNSN AHFMEGESMR V+E WFV+++VD +FAGHVHAYERSYRISNI YNVS
Sbjct  239  IILMHVPIYNSNQAHFMEGESMRAVFERWFVRHRVDFIFAGHVHAYERSYRISNIRYNVS  298

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVP+KSAPVY+TVGDGGNQEGLAGRF+DPQPEYSAFREASYGHSTLE+KNRTHAF
Sbjct  299  SGYRYPVPNKSAPVYVTVGDGGNQEGLAGRFQDPQPEYSAFREASYGHSTLELKNRTHAF  358

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
             +W+RN+DG++V  D+ +  N+ W 
Sbjct  359  LNWHRNEDGQKVHADSVIFLNRHWA  383



>gb|AGT15919.1| purple acid phosphatase precursor [Saccharum hybrid cultivar 
R570]
Length=476

 Score =   343 bits (879),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS++ +WYA+RRASAHIIVLS+YSPFVKYTPQW WL+ E  RVDREKTPWL
Sbjct  247  RYMTPYLASKSSSPMWYAVRRASAHIIVLSSYSPFVKYTPQWLWLKHEFKRVDREKTPWL  306

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNSN AH+MEGESMR  +E+WFVKYKVD+VFAGHVHAYERSYRISN++YN++
Sbjct  307  IVLMHSPMYNSNEAHYMEGESMRAAFEKWFVKYKVDLVFAGHVHAYERSYRISNVNYNIT  366

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVP+KSAPVYITVGDGGNQEGLA RF DPQP+YSAFREASYGHS L++KNRTHA 
Sbjct  367  SGNRYPVPNKSAPVYITVGDGGNQEGLASRFYDPQPDYSAFREASYGHSILQLKNRTHAV  426

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y WNRNDDG  V  D  + HNQ+W
Sbjct  427  YQWNRNDDGNPVPADTVMFHNQYW  450



>ref|XP_010913336.1| PREDICTED: phosphoenolpyruvate phosphatase isoform X1 [Elaeis 
guineensis]
Length=491

 Score =   343 bits (879),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 178/205 (87%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS++ LWYA+RRAS HIIVLS+YSPFVKY PQW WL EEL RVDREKTPWL
Sbjct  265  RYATPYVASKSSSPLWYAVRRASVHIIVLSSYSPFVKYAPQWFWLLEELKRVDREKTPWL  324

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNSN AH+MEGESMR  +E  FV YKVD+VF+GHVHAYERSYRISNI+YN++
Sbjct  325  IVLMHTPLYNSNEAHYMEGESMRAAFESLFVHYKVDIVFSGHVHAYERSYRISNINYNIT  384

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YP+PDKSAPVYITVGDGGNQEGLA RF +PQP+YSAFREASYGHSTLE+KNRTHA 
Sbjct  385  SGSRYPMPDKSAPVYITVGDGGNQEGLAVRFSEPQPDYSAFREASYGHSTLELKNRTHAL  444

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            Y WNRNDDGK V TD  V HNQ+W 
Sbjct  445  YRWNRNDDGKPVPTDHVVFHNQYWA  469



>dbj|BAB88215.1| putative secretory acid phosphatase precursor [Oryza sativa Japonica 
Group]
Length=476

 Score =   342 bits (877),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 178/205 (87%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R  TPY ASKS++ +WYA+RRASAHIIVLS+YSPFVKYTPQW WL+ EL  VDREKTPWL
Sbjct  247  RCHTPYLASKSSSPMWYAVRRASAHIIVLSSYSPFVKYTPQWTWLKYELKHVDREKTPWL  306

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNSN AH+MEGESMR  +E+WFVKYKVD+VFAGHVHAYERSYRISNI+YN++
Sbjct  307  IVLMHSPMYNSNEAHYMEGESMRAAFEKWFVKYKVDLVFAGHVHAYERSYRISNINYNIT  366

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDKSAPVYITVGDGGNQEG A RF DPQP+YSAFREASYGHS L++KNRTHA 
Sbjct  367  SGNRYPVPDKSAPVYITVGDGGNQEGPASRFSDPQPDYSAFREASYGHSILQLKNRTHAI  426

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            Y WNRNDDGK V  D  V HNQ+W 
Sbjct  427  YQWNRNDDGKHVPADNVVFHNQYWA  451



>gb|AGT16225.1| purple acid phosphatase precursor [Saccharum hybrid cultivar 
R570]
Length=476

 Score =   342 bits (877),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS++ +WYA+RRASAHIIVLS+YSPFVKYTPQW WL+ E  RVDREKTPWL
Sbjct  247  RYMTPYLASKSSSPMWYAVRRASAHIIVLSSYSPFVKYTPQWLWLKHEFKRVDREKTPWL  306

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNSN AH+MEGESMR  +E+WFV+YKVD+VFAGHVHAYERSYRISN++YN++
Sbjct  307  IVLMHSPMYNSNEAHYMEGESMRAAFEKWFVEYKVDLVFAGHVHAYERSYRISNVNYNIT  366

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVP+KSAPVYITVGDGGNQEGLA RF DPQP+YSAFREASYGHS L++KNRTHA 
Sbjct  367  SGNRYPVPNKSAPVYITVGDGGNQEGLASRFYDPQPDYSAFREASYGHSILQLKNRTHAV  426

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y WNRNDDG  V  D  V HNQ+W
Sbjct  427  YQWNRNDDGNPVPADTVVFHNQYW  450



>gb|KJB65854.1| hypothetical protein B456_010G116200 [Gossypium raimondii]
 gb|KJB65856.1| hypothetical protein B456_010G116200 [Gossypium raimondii]
Length=479

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R+ TP+ AS+S N LWYAIRR SAHIIVLS+YSP VKYTPQW WLR+EL RVDR+KTPWL
Sbjct  254  RFSTPHLASRSNNPLWYAIRRVSAHIIVLSSYSPHVKYTPQWLWLRDELKRVDRKKTPWL  313

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            I+LMHVPIYNSN AHFMEGESMR V+E WFV+++VD +FAGHVHAYERSYRISNI YNVS
Sbjct  314  IILMHVPIYNSNQAHFMEGESMRAVFERWFVRHRVDFIFAGHVHAYERSYRISNIRYNVS  373

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVP+KSAPVY+TVGDGGNQEGLAGRF+DPQPEYSAFREASYGHSTLE+KNRTHAF
Sbjct  374  SGYRYPVPNKSAPVYVTVGDGGNQEGLAGRFQDPQPEYSAFREASYGHSTLELKNRTHAF  433

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
             +W+RN+DG++V  D+ +  N+ W 
Sbjct  434  LNWHRNEDGQKVHADSVIFLNRHWA  458



>gb|AGT17175.1| acid phosphatase precursor [Saccharum hybrid cultivar R570]
Length=476

 Score =   340 bits (873),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS++ +WYA+RRASAHIIVLS+YSPFVKYTPQW WL+ E  RVDREKTPWL
Sbjct  247  RYMTPYLASKSSSPMWYAVRRASAHIIVLSSYSPFVKYTPQWLWLKHEFKRVDREKTPWL  306

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNSN AH+MEGESMR  +E+WFVKYKVD+VFAGHVHAYERSYRISN++YN++
Sbjct  307  IVLMHSPMYNSNEAHYMEGESMRAAFEKWFVKYKVDLVFAGHVHAYERSYRISNVNYNIT  366

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVP+KSAPVYI VGDGGNQEGLA RF DPQP+YSAFREASYGHS L++KNRTHA 
Sbjct  367  SGNRYPVPNKSAPVYIIVGDGGNQEGLASRFYDPQPDYSAFREASYGHSILQLKNRTHAV  426

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y WNRNDDG  V  D  + HNQ+W
Sbjct  427  YQWNRNDDGNPVPADTVMFHNQYW  450



>gb|KHG06954.1| Bifunctional purple acid phosphatase 26 -like protein [Gossypium 
arboreum]
Length=479

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R+ TP+ AS+S N LWYAIRRASAHIIVLS+YSP VKYTPQW WLR+EL RVDR+KTPWL
Sbjct  254  RFSTPHLASRSKNPLWYAIRRASAHIIVLSSYSPHVKYTPQWLWLRDELKRVDRKKTPWL  313

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            I++MHVPIYNSN AHFMEGESMR V+E WFV+++VD +FAGHVHAYERSYRISNI YNVS
Sbjct  314  IIIMHVPIYNSNQAHFMEGESMRAVFERWFVRHRVDFIFAGHVHAYERSYRISNIRYNVS  373

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVP+KSAPVY+TVGD GNQEGLAGRFRDPQPEYSAFREASYGHSTLE+KNRTHAF
Sbjct  374  SGYRYPVPNKSAPVYVTVGDAGNQEGLAGRFRDPQPEYSAFREASYGHSTLELKNRTHAF  433

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
             +W+RN+DG++V  D+ +  N+ W 
Sbjct  434  LNWHRNEDGQKVHADSVIFLNRRWA  458



>gb|EPS64420.1| hypothetical protein M569_10360, partial [Genlisea aurea]
Length=480

 Score =   340 bits (872),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 185/204 (91%), Gaps = 3/204 (1%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTPY AS S++ LWY++RRASAHIIVLS+YSPFVKYTPQW+WLR+EL  V+RE+TPWL
Sbjct  253  RYPTPYPASSSSSPLWYSVRRASAHIIVLSSYSPFVKYTPQWRWLRQELLNVNREETPWL  312

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNSN AH++EGESMR V+E WF  YKVDVVFAGHVHAYERSYRIS++    S
Sbjct  313  IVLMHSPFYNSNDAHYLEGESMRFVFESWFCHYKVDVVFAGHVHAYERSYRISHLR---S  369

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            S  ++PVPDKSAPVYITVGDGGNQEGLA +FRDPQP+YSAFRE+SYGHSTLEI+NRTHAF
Sbjct  370  SDSSHPVPDKSAPVYITVGDGGNQEGLADKFRDPQPDYSAFRESSYGHSTLEIENRTHAF  429

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRN++GKRVATD+FVLHNQ+W
Sbjct  430  YHWNRNEEGKRVATDSFVLHNQYW  453



>ref|XP_009363960.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X2 [Pyrus x bretschneideri]
Length=478

 Score =   340 bits (872),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 173/205 (84%), Gaps = 8/205 (4%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY AS S+N LWYAIRRASAHIIVLS+YSPFVKYTPQW WL  EL RV        
Sbjct  258  RYATPYLASGSSNPLWYAIRRASAHIIVLSSYSPFVKYTPQWTWLEAELKRV--------  309

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            +   H+P+YNSN AH+MEGESMR V+E WFV+YKVDVVFAGHVHAYERSYR SNI YNV+
Sbjct  310  LACFHLPLYNSNEAHYMEGESMRAVFESWFVQYKVDVVFAGHVHAYERSYRFSNIQYNVT  369

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVPDKSAPVYITVGDGGNQEGLAGRFRDPQP YSAFREASYGHSTLE+ NRTHA 
Sbjct  370  SGYQYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPNYSAFREASYGHSTLELINRTHAL  429

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            YHWNRNDDG + A DAFVLHNQ+WG
Sbjct  430  YHWNRNDDGNKTAVDAFVLHNQYWG  454



>gb|EMS63219.1| Bifunctional purple acid phosphatase 26 [Triticum urartu]
Length=469

 Score =   337 bits (865),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 166/235 (71%), Positives = 182/235 (77%), Gaps = 30/235 (13%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFV------------------------  813
            RY TPY ASKS++ +WYA+RRASAHIIVLS+YSPFV                        
Sbjct  210  RYSTPYLASKSSSPMWYAVRRASAHIIVLSSYSPFVSDKERGCDVGSSDWDFQVLGLCPK  269

Query  812  ------KYTPQWKWLREELTRVDREKTPWLIVLMHVPIYNSNVAHFMEGESMRTVYEEWF  651
                  KYTPQW WL+ EL RVDREKTPWLIVLMH P+YNSN AHFMEGESMR  +E+WF
Sbjct  270  HGSSRVKYTPQWMWLKGELKRVDREKTPWLIVLMHAPMYNSNDAHFMEGESMRAAFEKWF  329

Query  650  VKYKVDVVFAGHVHAYERSYRISNIHYNVSSGIAYPVPDKSAPVYITVGDGGNQEGLAGR  471
            VKYKVD+VFAGHVHAYERSYRISNI+YNV+SG  YPVPDKSAPVYITVGDGGNQEGLA R
Sbjct  330  VKYKVDLVFAGHVHAYERSYRISNINYNVTSGNRYPVPDKSAPVYITVGDGGNQEGLAWR  389

Query  470  FRDPQPEYSAFREASYGHSTLEIKNRTHAFYHWNRNDDGKRVATDAFVLHNQFWG  306
            F DPQP+YSAFREASYGHSTL++ NRTHA Y WNRNDDGK V TD  V HNQ+W 
Sbjct  390  FSDPQPDYSAFREASYGHSTLQLINRTHAVYQWNRNDDGKHVPTDNVVFHNQYWA  444



>gb|KJB83221.1| hypothetical protein B456_013G236000 [Gossypium raimondii]
Length=462

 Score =   336 bits (862),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 178/204 (87%), Gaps = 13/204 (6%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTPY ASKS++ +WYAIRRASAHIIVLS+YSPFVKYTPQWKWL EEL RVDR+KTPWL
Sbjct  250  RYPTPYLASKSSSPMWYAIRRASAHIIVLSSYSPFVKYTPQWKWLEEELNRVDRKKTPWL  309

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+HVPIYNSN AHFMEGESMR V+EEWF+ +KVD             YRISNI YNVS
Sbjct  310  IVLVHVPIYNSNEAHFMEGESMRAVFEEWFIHHKVD-------------YRISNIRYNVS  356

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  +PVPD+SAPVYITVGDGGNQEGLAG+FRDPQP+YSAFREASYGHSTLEI NRTHA 
Sbjct  357  SGERFPVPDESAPVYITVGDGGNQEGLAGKFRDPQPDYSAFREASYGHSTLEIMNRTHAV  416

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGK+VA D+FVL+NQ+W
Sbjct  417  YHWNRNDDGKKVAIDSFVLNNQYW  440



>gb|AGT17000.1| acid phosphatase precursor [Saccharum hybrid cultivar R570]
Length=476

 Score =   335 bits (858),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY ASKS++ +WYA++RASAHIIVLS+YSPFVKYTPQW WL+ E  RVDREKTPWL
Sbjct  247  RYMTPYLASKSSSPMWYAVKRASAHIIVLSSYSPFVKYTPQWLWLKHEFKRVDREKTPWL  306

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNSN AH+MEGESMR  +E+ FVKYKVD+VFAGHVHAYE SYRISN++YN++
Sbjct  307  IVLMHSPMYNSNEAHYMEGESMRAAFEKLFVKYKVDLVFAGHVHAYEGSYRISNVNYNIT  366

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YPVP+KSAPVYITVGDGGNQEGLA RF DPQP+YSAFREASYGHS L++KNRTHA 
Sbjct  367  SGNRYPVPNKSAPVYITVGDGGNQEGLASRFYDPQPDYSAFREASYGHSILQLKNRTHAV  426

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y WNRNDDG  V  D  + HNQ+W
Sbjct  427  YQWNRNDDGNPVPADTVMFHNQYW  450



>ref|XP_002530767.1| Purple acid phosphatase precursor, putative [Ricinus communis]
 gb|EEF31627.1| Purple acid phosphatase precursor, putative [Ricinus communis]
Length=463

 Score =   329 bits (844),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 180/206 (87%), Gaps = 0/206 (0%)
 Frame = -2

Query  923  FRYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPW  744
            +RYPTPY AS S++ LWYAIRRASAHIIVL++YSPFV+YTPQW WL++EL  V+RE+TPW
Sbjct  225  YRYPTPYMASNSSSPLWYAIRRASAHIIVLNSYSPFVRYTPQWLWLQQELKHVNREETPW  284

Query  743  LIVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNV  564
            LIV+ HVP+YNSN AH+MEGESMR  +EEWF++YKVDV+F+GHVHAYERSYR SN+  +V
Sbjct  285  LIVVTHVPLYNSNEAHYMEGESMRAAFEEWFIEYKVDVIFSGHVHAYERSYRFSNVRSSV  344

Query  563  SSGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHA  384
            SS   YPV ++SAP+YITVGDGGNQEG+A  F DPQP++SAFREASYGHSTLEI N+THA
Sbjct  345  SSPNCYPVANESAPMYITVGDGGNQEGIAANFTDPQPDHSAFREASYGHSTLEIMNKTHA  404

Query  383  FYHWNRNDDGKRVATDAFVLHNQFWG  306
            FY+W+RNDDGK+V  D  VLHNQ+W 
Sbjct  405  FYYWHRNDDGKKVVADKLVLHNQYWA  430



>gb|ABK24726.1| unknown [Picea sitchensis]
Length=517

 Score =   324 bits (831),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PY AS ST+ LWY+I+RASAHIIVLS+YSP+ KYTPQW WLR EL  VDREKTPWL
Sbjct  285  RYQVPYTASGSTSPLWYSIKRASAHIIVLSSYSPYAKYTPQWVWLRSELQHVDREKTPWL  344

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNSN  H+MEGESMRTV+E WF+KYKVD++FAGHVHAYERSYRISN+ YN++
Sbjct  345  IVLMHAPLYNSNSFHYMEGESMRTVFELWFIKYKVDIIFAGHVHAYERSYRISNVKYNIT  404

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G   P  D+SAPVYITVGDGGN EGLAG F++PQP YSAFREASYGH+ LEIKN +HA+
Sbjct  405  NGACKPEQDESAPVYITVGDGGNLEGLAGIFKEPQPAYSAFREASYGHAMLEIKNSSHAY  464

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y+WNRN+DG  VA+D+  L+NQ+W
Sbjct  465  YYWNRNEDGVSVASDSLWLYNQYW  488



>gb|EMT07067.1| Bifunctional purple acid phosphatase 26 [Aegilops tauschii]
Length=525

 Score =   319 bits (817),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 174/223 (78%), Gaps = 19/223 (9%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVK-------------------YTPQ  798
            RY TPY ASKS++ +WYA+RRASAHIIVLS+YSPFV                    +   
Sbjct  248  RYSTPYLASKSSSPMWYAVRRASAHIIVLSSYSPFVSDKERGCDVGSTIGISKRLAFVQS  307

Query  797  WKWLREELTRVDREKTPWLIVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAG  618
                  EL RVDREKTPWLIVLMH P+YNSN AH+MEGESMR  +E+WFVKYKVD+VFAG
Sbjct  308  MGQAGGELKRVDREKTPWLIVLMHAPMYNSNDAHYMEGESMRAAFEKWFVKYKVDLVFAG  367

Query  617  HVHAYERSYRISNIHYNVSSGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAF  438
            HVHAYERSYRISNI+YNV+SG  YPVPDKSAPVYITVGDGGNQEGLA RF DPQP+YSAF
Sbjct  368  HVHAYERSYRISNINYNVTSGNRYPVPDKSAPVYITVGDGGNQEGLAWRFSDPQPDYSAF  427

Query  437  REASYGHSTLEIKNRTHAFYHWNRNDDGKRVATDAFVLHNQFW  309
            REASYGHSTL++ NRTHA Y WNRNDDGK V TD  V HNQ+W
Sbjct  428  REASYGHSTLQLVNRTHAVYQWNRNDDGKHVPTDNVVFHNQYW  470



>ref|XP_010687873.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Beta 
vulgaris subsp. vulgaris]
Length=462

 Score =   314 bits (804),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTPYKAS ST+ LWYA+RR  AHIIVLS+YS FVKYT Q+ WL +EL +VDR+KTPWL
Sbjct  257  RYPTPYKASGSTDALWYAVRRGPAHIIVLSSYSGFVKYTAQYHWLEDELKKVDRKKTPWL  316

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH+P+YN+N AH+MEGESMR+V+E+WF+  KVD VFAGHVHAYERS+R+SN+ YN+S
Sbjct  317  IVLMHMPLYNTNSAHYMEGESMRSVFEQWFIDSKVDAVFAGHVHAYERSHRVSNVKYNIS  376

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G   P+ D++AP Y+T+GDGGN EG+AG +  PQP YSAFREAS+GH+ L+IKN+THA+
Sbjct  377  NGACNPILDEAAPFYVTIGDGGNAEGIAGEYIVPQPHYSAFREASFGHAILDIKNKTHAY  436

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y+W+RN DG +V  D FVLHNQ+W
Sbjct  437  YYWHRNHDGNKVTADTFVLHNQYW  460



>ref|XP_007155070.1| hypothetical protein PHAVU_003G170600g [Phaseolus vulgaris]
 gb|ESW27064.1| hypothetical protein PHAVU_003G170600g [Phaseolus vulgaris]
Length=441

 Score =   313 bits (802),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 170/195 (87%), Gaps = 0/195 (0%)
 Frame = -2

Query  893  KSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWLIVLMHVPIY  714
            K ++ LWYA+RRASAHIIVLS+YS FV+Y+PQ+ WL+EEL RVDREKTPWL V++H P+Y
Sbjct  247  KYSSPLWYAVRRASAHIIVLSSYSAFVRYSPQYIWLKEELARVDREKTPWLFVIVHKPLY  306

Query  713  NSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVSSGIAYPVPD  534
            +SNVAH+MEGE+MR+V+E WFV+YKVD VFAGHVHAYERSYR SNI YN++ G  YPVPD
Sbjct  307  SSNVAHYMEGEAMRSVFESWFVQYKVDAVFAGHVHAYERSYRYSNIDYNITGGRRYPVPD  366

Query  533  KSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAFYHWNRNDDG  354
             SAP+Y+T+GDGGN EGLA  + DPQPEYSAFREASYGH+TLEIKNRTHA Y+W RNDDG
Sbjct  367  TSAPIYVTIGDGGNLEGLASSYLDPQPEYSAFREASYGHATLEIKNRTHAVYNWYRNDDG  426

Query  353  KRVATDAFVLHNQFW  309
            KRV  D+ VL NQ+W
Sbjct  427  KRVPADSLVLLNQYW  441



>ref|XP_008361111.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Malus 
domestica]
Length=485

 Score =   308 bits (790),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 163/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TP+ AS S+N LWYAIR ASAHIIVLS+YSPF  YT Q   L  E  RV  E   W 
Sbjct  258  RYATPHLASNSSNPLWYAIRXASAHIIVLSSYSPFGNYTXQXXXLXXEXXRVXXEXXXWX  317

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
             V     +Y  +  H+MEGESMR V+E WFV+YKVDVVFAGHVHAYERSYRISNI YNV+
Sbjct  318  XVXXXXXLYXXBXVHYMEGESMRAVFERWFVQYKVDVVFAGHVHAYERSYRISNIRYNVT  377

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG  YP+PDKSAPVYITVGDGGNQEGLAGRFR+PQP+YSAFREASYGHSTLE+ NRTHA 
Sbjct  378  SGYQYPIPDKSAPVYITVGDGGNQEGLAGRFRNPQPDYSAFREASYGHSTLELINRTHAL  437

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            YHWNRNDDGK+ A DAF+L NQ+W
Sbjct  438  YHWNRNDDGKKTAMDAFILDNQYW  461



>gb|KEH16424.1| purple acid phosphatase superfamily protein [Medicago truncatula]
Length=471

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPYKAS+ST+  WY+I+RASAHIIVL++YS + KYTPQ+ WL EEL RV+R+KTPWL
Sbjct  256  RYQTPYKASQSTSPFWYSIKRASAHIIVLASYSAYGKYTPQYAWLEEELPRVNRKKTPWL  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNSN  H+MEGE+MR ++E WFVKYKVDVVFAGHVHAYERS R+SNI YN+ 
Sbjct  316  IVLMHSPWYNSNSYHYMEGETMRVMFESWFVKYKVDVVFAGHVHAYERSERVSNIAYNIV  375

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +GI  PV D SAPVYI +GDGGN EGLA ++  PQPEYSAFREAS+GH+  +IKNRTHA+
Sbjct  376  NGICAPVKDLSAPVYINIGDGGNIEGLATKYTQPQPEYSAFREASFGHAIFDIKNRTHAY  435

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  V +D+    N+FW
Sbjct  436  YSWHRNQDGDAVKSDSLWFFNRFW  459



>ref|XP_004970155.1| PREDICTED: purple acid phosphatase 2-like [Setaria italica]
Length=475

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTPYKAS ST   WY+I+RASA+IIVL++YS + KYTPQ+KWL  E  +V+R +TPWL
Sbjct  261  RYPTPYKASGSTAPYWYSIKRASAYIIVLASYSSYGKYTPQYKWLEAEFPKVNRSETPWL  320

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGESMR +YE WFVKYKVD+VFAGHVHAYER++R+SN+ YNV 
Sbjct  321  IVLMHAPWYNSYNYHYMEGESMRVMYEPWFVKYKVDLVFAGHVHAYERTHRVSNVAYNVV  380

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  PVPD+SAPVYIT+GDGGNQEGLA    +PQP YSAFREAS+GH+ L+IKNRTHA+
Sbjct  381  NGLCTPVPDQSAPVYITIGDGGNQEGLATNMSEPQPRYSAFREASFGHAILDIKNRTHAY  440

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  VA DA    N++W
Sbjct  441  YTWHRNQDGSAVAADAMWFTNRYW  464



>ref|XP_003564342.1| PREDICTED: purple acid phosphatase 2 [Brachypodium distachyon]
 ref|XP_010232421.1| PREDICTED: purple acid phosphatase 2 [Brachypodium distachyon]
Length=468

 Score =   296 bits (759),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTPYKAS ST   WY+I+RASA++IVL++YS + KYTPQ+KWL  E  +V+R +TPWL
Sbjct  254  RYPTPYKASGSTAPYWYSIKRASAYVIVLASYSAYGKYTPQYKWLEAEFPKVNRSETPWL  313

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGESMR +YE WFVKYKVDVVFAGHVHAYER++RISN+ YN+ 
Sbjct  314  IVLMHAPWYNSYNYHYMEGESMRVMYEPWFVKYKVDVVFAGHVHAYERTHRISNVAYNII  373

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+PD+SAPVYIT+GDGGNQEGLA    +PQP YSAFREAS+GH+ L+IKNRTHA+
Sbjct  374  NGLCSPIPDQSAPVYITIGDGGNQEGLATNMSEPQPRYSAFREASFGHAILDIKNRTHAY  433

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  VA D+    N++W
Sbjct  434  YAWHRNQDGSAVAADSLWFTNRYW  457



>ref|NP_001141970.1| hypothetical protein precursor [Zea mays]
 gb|ACF78809.1| unknown [Zea mays]
 gb|ACF87398.1| unknown [Zea mays]
 tpg|DAA57387.1| TPA: hypothetical protein ZEAMMB73_877733 [Zea mays]
Length=475

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTPYKAS ST   WY+I+RASA+IIVL++YS + KYTPQ+KWL  E  +V+R +TPWL
Sbjct  261  RYPTPYKASGSTAPYWYSIKRASAYIIVLASYSAYGKYTPQYKWLEAEFPKVNRSETPWL  320

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            +VLMH P YNS   H+MEGE+MR +YE WFVKYKVDVVFAGHVHAYER++RISN+ YNV 
Sbjct  321  VVLMHAPWYNSYNYHYMEGETMRVMYEPWFVKYKVDVVFAGHVHAYERTHRISNVAYNVV  380

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+PD+SAPVYIT+GDGGNQEGLA     PQP YSAFREAS+GH+ L+IKNRTHA+
Sbjct  381  NGLCTPIPDQSAPVYITIGDGGNQEGLATNMSQPQPSYSAFREASFGHAILDIKNRTHAY  440

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  VA D+    N++W
Sbjct  441  YTWHRNQDGSAVAADSMWFTNRYW  464



>ref|XP_010061256.1| PREDICTED: purple acid phosphatase-like isoform X2 [Eucalyptus 
grandis]
Length=417

 Score =   293 bits (750),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R+  PYKAS ST+  WY+I+RASAH+IV+++YS F KYTPQ+KWL+ EL RV+R +TPWL
Sbjct  197  RFHVPYKASDSTSPFWYSIKRASAHVIVMASYSAFGKYTPQYKWLKNELARVNRTETPWL  256

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IV MH P+YNS VAH+MEGE+MR +YE WFV+YKVDVVFAGHVHAYERS RISN+ YN+ 
Sbjct  257  IVFMHCPLYNSYVAHYMEGETMRVMYEPWFVEYKVDVVFAGHVHAYERSERISNVAYNIV  316

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D SAPVYIT+GDGGN EGLA +  +PQP YSAFREAS+GH  L+IKNRTHA+
Sbjct  317  NGLCTPIRDPSAPVYITIGDGGNLEGLATQMTEPQPHYSAFREASFGHGILDIKNRTHAY  376

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + W+RN+DG  V  D+  L+N++W
Sbjct  377  FGWHRNEDGYAVEADSVWLYNRYW  400



>dbj|BAJ85173.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91499.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89313.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=466

 Score =   294 bits (752),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPYKAS ST   WY+I+RASA+IIVL++YS + KYTPQ+KWL  E  +V+R +TPWL
Sbjct  253  RYHTPYKASGSTAPYWYSIKRASAYIIVLASYSAYGKYTPQYKWLESEFPKVNRSETPWL  312

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGESMR +YE WFVKYKVD+VFAGHVHAYER++RISN+ YN+ 
Sbjct  313  IVLMHAPWYNSYNYHYMEGESMRVMYEPWFVKYKVDLVFAGHVHAYERTHRISNVAYNII  372

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+PD+SAPVYIT+GDGGNQEGLA    +PQP YSAFREAS+GH+ L+IKNRTHA+
Sbjct  373  NGLCSPIPDQSAPVYITIGDGGNQEGLATNMSEPQPSYSAFREASFGHAILDIKNRTHAY  432

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  VA DA    N++W
Sbjct  433  YAWHRNQDGAAVAADALWFTNRYW  456



>ref|XP_010531065.1| PREDICTED: purple acid phosphatase 25 [Tarenaya hassleriana]
Length=464

 Score =   293 bits (749),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PYK+SKST+ LWY+I+RASAHIIVLS+YS + KYTPQ+ WL +EL +V+R++TPWL
Sbjct  248  RYHVPYKSSKSTSPLWYSIKRASAHIIVLSSYSAYGKYTPQYTWLEQELKKVNRKETPWL  307

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P YNSN  HFMEGE+MR ++E W V+ KVD+VF+GHVHAYERS R+SNI YN++
Sbjct  308  IVLVHSPWYNSNNYHFMEGETMRVMFESWLVENKVDIVFSGHVHAYERSERVSNIQYNIT  367

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
             G++YPV DKSAPVYIT+GDGGN EG+A  F  PQP YSAFREAS+GH+ LEIKNRTHA 
Sbjct  368  DGLSYPVKDKSAPVYITIGDGGNIEGIADCFTQPQPSYSAFREASFGHALLEIKNRTHAL  427

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN D + VA D+  LHN+++
Sbjct  428  YTWHRNQDSEPVAADSLWLHNRYF  451



>ref|XP_002972138.1| hypothetical protein SELMODRAFT_96478 [Selaginella moellendorffii]
 gb|EFJ27055.1| hypothetical protein SELMODRAFT_96478 [Selaginella moellendorffii]
Length=475

 Score =   293 bits (750),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TP+++SKST+QLWY+I RASAHIIVLS+YS + KYTPQW WL+ +L  ++R+KTPW+
Sbjct  270  RYQTPHRSSKSTSQLWYSINRASAHIIVLSSYSAYGKYTPQWAWLQNDLQNINRKKTPWV  329

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNSN  H+MEGE+MR  +E WFV+Y+VD+VFAGHVHAYERS+R+SNI YNV 
Sbjct  330  IVLMHSPWYNSNTHHYMEGETMRVQFEAWFVQYRVDIVFAGHVHAYERSHRVSNIEYNVV  389

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G   P  ++SAPVYITVGDGGN EGLAG F  PQP YSA+REAS+GH+ LEIKNRTHAF
Sbjct  390  NGQCSPSRNESAPVYITVGDGGNIEGLAGNFTQPQPNYSAYREASFGHAMLEIKNRTHAF  449

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y+W+RN DG+ V +D+  L N+++
Sbjct  450  YYWHRNQDGEAVRSDSTWLTNRYF  473



>ref|XP_010061253.1| PREDICTED: purple acid phosphatase-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010061254.1| PREDICTED: purple acid phosphatase-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW68181.1| hypothetical protein EUGRSUZ_F01849 [Eucalyptus grandis]
Length=476

 Score =   293 bits (749),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R+  PYKAS ST+  WY+I+RASAH+IV+++YS F KYTPQ+KWL+ EL RV+R +TPWL
Sbjct  256  RFHVPYKASDSTSPFWYSIKRASAHVIVMASYSAFGKYTPQYKWLKNELARVNRTETPWL  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IV MH P+YNS VAH+MEGE+MR +YE WFV+YKVDVVFAGHVHAYERS RISN+ YN+ 
Sbjct  316  IVFMHCPLYNSYVAHYMEGETMRVMYEPWFVEYKVDVVFAGHVHAYERSERISNVAYNIV  375

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D SAPVYIT+GDGGN EGLA +  +PQP YSAFREAS+GH  L+IKNRTHA+
Sbjct  376  NGLCTPIRDPSAPVYITIGDGGNLEGLATQMTEPQPHYSAFREASFGHGILDIKNRTHAY  435

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + W+RN+DG  V  D+  L+N++W
Sbjct  436  FGWHRNEDGYAVEADSVWLYNRYW  459



>emb|CDM84477.1| unnamed protein product [Triticum aestivum]
Length=466

 Score =   292 bits (748),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPYK+S ST   WY+I+RASA+IIVL++YS + KYTPQ+KWL  E  +V+R +TPWL
Sbjct  253  RYHTPYKSSGSTAPYWYSIKRASAYIIVLASYSAYGKYTPQYKWLESEFPKVNRSETPWL  312

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGESMR +YE WFVKYKVD+VFAGHVHAYER++RISN+ YN+ 
Sbjct  313  IVLMHAPWYNSYNYHYMEGESMRVMYEPWFVKYKVDLVFAGHVHAYERTHRISNVAYNII  372

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+PD+SAPVYIT+GDGGNQEGLA    +PQP YSAFREAS+GH+ L+IKNRTHA+
Sbjct  373  NGLCSPIPDQSAPVYITIGDGGNQEGLATNMSEPQPSYSAFREASFGHAILDIKNRTHAY  432

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  VA DA    N++W
Sbjct  433  YAWHRNQDGAAVAADALWFTNRYW  456



>ref|XP_002880886.1| secreted purple acid phosphatase precursor [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH57145.1| secreted purple acid phosphatase precursor [Arabidopsis lyrata 
subsp. lyrata]
Length=469

 Score =   292 bits (748),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPYKAS S + LWY+I+RASA+IIV+S YS + KYTPQ+KWL +EL  V+R +TPWL
Sbjct  255  RYHTPYKASGSISPLWYSIKRASAYIIVMSCYSSYGKYTPQYKWLEKELQGVNRTETPWL  314

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P+Y+S V H+MEGE++R +YE+WFVKYKVDVVFAGHVHAYERS R+SNI YN+ 
Sbjct  315  IVLVHCPLYSSYVHHYMEGETLRVMYEQWFVKYKVDVVFAGHVHAYERSERVSNIAYNIV  374

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+PD+SAPVYIT+GDGGN EGL      PQP+YSAFRE S+GH  LEIKNRTHA+
Sbjct  375  NGLCEPIPDESAPVYITIGDGGNSEGLVTDMMQPQPKYSAFREPSFGHGLLEIKNRTHAY  434

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + WNRN DG  VA D+  L N+FW
Sbjct  435  FSWNRNQDGNSVAADSVWLFNRFW  458



>ref|XP_002458586.1| hypothetical protein SORBIDRAFT_03g036210 [Sorghum bicolor]
 gb|EES03706.1| hypothetical protein SORBIDRAFT_03g036210 [Sorghum bicolor]
Length=476

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTPYKAS ST   WY+I+RASA+IIVL++YS + KYTPQ+KWL  E  +V+R +TPWL
Sbjct  262  RYPTPYKASGSTAPYWYSIKRASAYIIVLASYSAYGKYTPQYKWLEAEFPKVNRSETPWL  321

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR +YE WFVKYKVDVVFAGHVHAYER++RISN+ YNV 
Sbjct  322  IVLMHAPWYNSYNYHYMEGETMRVMYEPWFVKYKVDVVFAGHVHAYERTHRISNVAYNVV  381

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D+SAPVYIT+GDGGNQEGLA     PQP YSAFREAS+GH+ L+IKNRTHA+
Sbjct  382  NGLCTPISDQSAPVYITIGDGGNQEGLATNMSQPQPRYSAFREASFGHAILDIKNRTHAY  441

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  VA D+    N++W
Sbjct  442  YTWHRNQDGSSVAADSMWFTNRYW  465



>ref|XP_002993027.1| hypothetical protein SELMODRAFT_136432 [Selaginella moellendorffii]
 gb|EFJ05866.1| hypothetical protein SELMODRAFT_136432 [Selaginella moellendorffii]
Length=475

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TP+++SKST+QLWY+I RASAHIIVLS+YS + KYTPQW WL+ +L  ++R++TPW+
Sbjct  270  RYQTPHRSSKSTSQLWYSINRASAHIIVLSSYSAYGKYTPQWAWLQNDLQNINRKETPWV  329

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNSN  H+MEGE+MR  +E WFV+Y+VD+VFAGHVHAYERS+R+SNI YNV 
Sbjct  330  IVLMHSPWYNSNTHHYMEGETMRVQFEAWFVQYRVDIVFAGHVHAYERSHRVSNIEYNVV  389

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G   P  ++SAPVYITVGDGGN EGLAG F  PQP YSA+REAS+GH+ LEIKNRTHAF
Sbjct  390  NGQCSPSRNESAPVYITVGDGGNIEGLAGNFMQPQPNYSAYREASFGHAMLEIKNRTHAF  449

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y+W+RN DG+ V +D+  L N+++
Sbjct  450  YYWHRNQDGEAVKSDSTWLTNRYF  473



>ref|XP_002971914.1| hypothetical protein SELMODRAFT_96415 [Selaginella moellendorffii]
 gb|EFJ26831.1| hypothetical protein SELMODRAFT_96415 [Selaginella moellendorffii]
Length=475

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TP+++SKST+QLWY+I RASAHIIVLS+YS + KYTPQW WL+ +L  ++R+KTPW+
Sbjct  270  RYQTPHRSSKSTSQLWYSINRASAHIIVLSSYSAYGKYTPQWAWLQNDLQNINRKKTPWV  329

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNSN+ H+MEGE+MR  +E W V+Y+VD+VFAGHVHAYERS+R+SNI YNV 
Sbjct  330  IVLMHSPWYNSNMYHYMEGETMRVQFEAWLVQYRVDIVFAGHVHAYERSHRVSNIEYNVV  389

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G   P  ++SAPVYITVGDGGN EGLAG F  PQP YSA+REAS+GH+ LEIKNRTHAF
Sbjct  390  NGQCSPSRNESAPVYITVGDGGNIEGLAGNFTQPQPNYSAYREASFGHAMLEIKNRTHAF  449

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y+W+RN DG+ V +D+  L N+++
Sbjct  450  YYWHRNQDGEAVKSDSAWLTNRYF  473



>ref|NP_001239689.1| uncharacterized protein LOC100794124 [Glycine max]
 gb|ADM32495.1| phytase [Glycine max]
Length=444

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PYKAS ST+ LWY+I+RASA+IIV+S+YS   KYTPQ+KWL +EL +V+R +TPWL
Sbjct  229  RYHVPYKASDSTSPLWYSIKRASAYIIVMSSYSALGKYTPQYKWLEKELPKVNRTETPWL  288

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH PIYNS V H+MEGE++R +YE+WFV+YKVDVVFAGHVHAYERS R+SNI YNV 
Sbjct  289  IVLMHSPIYNSYVTHYMEGETVRVMYEKWFVEYKVDVVFAGHVHAYERSERVSNIAYNVV  348

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D+SAPVYIT+GDGGN EGLA    +PQP YSA+REAS+GH  L+IKNRTHA 
Sbjct  349  NGLCRPINDQSAPVYITIGDGGNLEGLATAMTEPQPSYSAYREASFGHGILDIKNRTHAH  408

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + WNRN DG  V  D+  LHN++W
Sbjct  409  FSWNRNQDGYAVVADSVWLHNRYW  432



>ref|XP_002874764.1| secreted purple acid phosphatase precursor [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH51023.1| secreted purple acid phosphatase precursor [Arabidopsis lyrata 
subsp. lyrata]
Length=469

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPYKAS S + LWY+I+RASA+IIV+S YS + KYTPQ+KWL +EL  V+R +TPWL
Sbjct  255  RYHTPYKASGSISPLWYSIKRASAYIIVMSCYSSYGKYTPQYKWLEKELQGVNRTETPWL  314

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P Y+S V H+MEGE++R +YE+WFVKYKVDVVFAGHVHAYERS R+SNI YN+ 
Sbjct  315  IVLVHCPFYHSYVHHYMEGETLRVMYEQWFVKYKVDVVFAGHVHAYERSERVSNIAYNIV  374

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+PD+SAPVYIT+GDGGN EGL      PQP+YSAFREAS+GH  LEIKNRTHA+
Sbjct  375  NGLCEPIPDESAPVYITIGDGGNSEGLVTDMMQPQPKYSAFREASFGHGLLEIKNRTHAY  434

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + WNRN DG   A D+  L N+FW
Sbjct  435  FSWNRNQDGNSTAADSVWLLNRFW  458



>ref|XP_002993062.1| hypothetical protein SELMODRAFT_187173 [Selaginella moellendorffii]
 gb|EFJ05901.1| hypothetical protein SELMODRAFT_187173 [Selaginella moellendorffii]
Length=474

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/202 (67%), Positives = 168/202 (83%), Gaps = 0/202 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TP+++SKST+QLWY+I RASAHIIVLS+YS + KYTPQW WL+ +L  ++R+KTPW+
Sbjct  256  RYQTPHRSSKSTSQLWYSINRASAHIIVLSSYSAYGKYTPQWAWLQNDLQNINRKKTPWV  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNSN+ H+MEGE+MR  +E W V+YKVD+VFAGHVHAYERS+R+SNI YNV 
Sbjct  316  IVLMHSPWYNSNMYHYMEGETMRVQFEAWLVQYKVDIVFAGHVHAYERSHRVSNIEYNVV  375

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G   P  ++SAPVYITVGDGGN EGLAG F  PQP YSA+REAS+GH+ LEIKNRTHAF
Sbjct  376  NGQCSPSRNESAPVYITVGDGGNIEGLAGNFTQPQPNYSAYREASFGHAMLEIKNRTHAF  435

Query  380  YHWNRNDDGKRVATDAFVLHNQ  315
            Y+W+RN DG+ V +D+  L N+
Sbjct  436  YYWHRNQDGEAVKSDSTWLTNR  457



>ref|XP_010510800.1| PREDICTED: fe(3+)-Zn(2+) purple acid phosphatase 12-like [Camelina 
sativa]
Length=470

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 165/205 (80%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPYK+S S + LWY+I+RASA++IV+S YS + KYTPQ+KWL +EL  V+R +TPW+
Sbjct  256  RYQTPYKSSGSISPLWYSIKRASAYVIVMSCYSSYGKYTPQYKWLEKELQGVNRTETPWV  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P Y+S V H+MEGE++R +YE+WFVKYKVDVVFAGHVHAYERS R+SNI YN+ 
Sbjct  316  IVLVHCPFYSSYVHHYMEGETLRVMYEQWFVKYKVDVVFAGHVHAYERSERVSNIAYNIV  375

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D+SAPVYIT+GDGGN EGL      PQP YSAFREAS+GH  LEIKNRTHA+
Sbjct  376  NGLCEPISDESAPVYITIGDGGNSEGLVTDMMQPQPSYSAFREASFGHGLLEIKNRTHAY  435

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            + WNRN DG  +A D+  L N+FWG
Sbjct  436  FSWNRNQDGNSIAADSVWLLNRFWG  460



>ref|XP_006838700.1| PREDICTED: purple acid phosphatase 2 [Amborella trichopoda]
 gb|ERN01269.1| hypothetical protein AMTR_s00002p00249280 [Amborella trichopoda]
Length=461

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY+AS ST+ LWY+I+RASA+IIVLS+YS + KYTPQ++WL  EL +VDR++TPWL
Sbjct  247  RYHTPYRASGSTSSLWYSIKRASAYIIVLSSYSAYGKYTPQYRWLEAELPKVDRKETPWL  306

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR +YE WFV+YKVDVVFAGHVHAYERS RISNI YNV 
Sbjct  307  IVLMHSPWYNSYNYHYMEGETMRVMYEPWFVQYKVDVVFAGHVHAYERSERISNIAYNVV  366

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G   P+ D+SAPVYIT+GDGGN EGLA    +PQP+YSA+REAS+GH+  EIKNRTHA+
Sbjct  367  NGQCTPISDQSAPVYITIGDGGNLEGLATNMTEPQPKYSAYREASFGHAIFEIKNRTHAY  426

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG+ VA D+   +N+FW
Sbjct  427  YTWHRNQDGEAVAADSTWFYNRFW  450



>ref|XP_004506328.1| PREDICTED: purple acid phosphatase-like [Cicer arietinum]
Length=473

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPYKAS+ST+  WY+I+RASAHIIVL++YS + KYTPQ+KWL +EL  V+R +TPWL
Sbjct  258  RYHTPYKASQSTSPFWYSIKRASAHIIVLASYSAYGKYTPQYKWLEQELPTVNRTETPWL  317

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR ++E WFVKYKVDVVFAGHVHAYERS R+SNI YN+ 
Sbjct  318  IVLMHSPWYNSYAYHYMEGETMRVMFESWFVKYKVDVVFAGHVHAYERSERVSNIAYNIV  377

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +GI  P+ D+SAPVYIT+GDGGN EGLA    +PQPEYSAFREAS+GH+  +IKNRTHA 
Sbjct  378  NGICTPIKDQSAPVYITIGDGGNLEGLATNMTEPQPEYSAFREASFGHAIFDIKNRTHAH  437

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  V  D+    N+FW
Sbjct  438  YSWHRNQDGYAVQADSLWFFNRFW  461



>ref|XP_010933142.1| PREDICTED: purple acid phosphatase-like [Elaeis guineensis]
Length=470

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PY+AS ST+  WY+I+RASA+IIVL++YS + KYTPQ++WL  EL +V+R +TPWL
Sbjct  256  RYHVPYRASGSTSPFWYSIKRASAYIIVLASYSAYGKYTPQYRWLEAELPKVNRSETPWL  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR +YE+WFVKYKVDVVFAGHVHAYERSYRISNI YN+ 
Sbjct  316  IVLMHAPWYNSYNYHYMEGETMRVMYEQWFVKYKVDVVFAGHVHAYERSYRISNIAYNIV  375

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G   PVPD+SAPVYIT+GDGGN EGLA    +PQP YSA+REAS+GH+  +IKNRTHA+
Sbjct  376  NGRCKPVPDQSAPVYITIGDGGNLEGLATNMTEPQPSYSAYREASFGHAIFDIKNRTHAY  435

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  VA D+   +N++W
Sbjct  436  YAWHRNQDGNAVAADSMWFYNRYW  459



>ref|XP_010672424.1| PREDICTED: purple acid phosphatase-like [Beta vulgaris subsp. 
vulgaris]
Length=471

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = -2

Query  923  FRYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPW  744
            +R+PTPY+AS ST   WY+I+RASAHIIV+++YS F KYTPQ+KWL +EL +V+R +TPW
Sbjct  256  YRFPTPYQASLSTAPYWYSIKRASAHIIVMASYSAFGKYTPQYKWLMDELPKVNRSETPW  315

Query  743  LIVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNV  564
            LIV+MH P+Y+S V H+MEGE+MR +YE +FVKYKVDV+FAGHVHAYERS RISNI YN+
Sbjct  316  LIVVMHCPMYSSYVHHYMEGETMRVLYEPYFVKYKVDVIFAGHVHAYERSERISNIAYNI  375

Query  563  SSGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHA  384
            S+G+  PV D+SAPV+IT+GDGGN EGL      PQPEYSA+REAS+GH   +IKNRTHA
Sbjct  376  SNGLCDPVSDQSAPVHITIGDGGNLEGLVYEMTQPQPEYSAYREASFGHGIFDIKNRTHA  435

Query  383  FYHWNRNDDGKRVATDAFVLHNQFW  309
            ++ W+RN DG  V  D+  LHN++W
Sbjct  436  YFGWHRNQDGYAVEADSLWLHNRYW  460



>ref|XP_010473111.1| PREDICTED: fe(3+)-Zn(2+) purple acid phosphatase 12-like [Camelina 
sativa]
Length=471

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 165/205 (80%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPYK+S S + LWY+I+RASA++IV+S YS + KYTPQ+KWL +EL  V+R +TPW+
Sbjct  257  RYQTPYKSSGSISPLWYSIKRASAYVIVMSCYSSYGKYTPQYKWLEKELQGVNRTETPWV  316

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P Y+S V H+MEGE++R +YE+WFVKYKVDVVFAGHVHAYERS R+SNI YN+ 
Sbjct  317  IVLVHCPFYSSYVHHYMEGETLRVMYEQWFVKYKVDVVFAGHVHAYERSERVSNIAYNIV  376

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D+SAPVYIT+GDGGN EGL      PQP YSAFREAS+GH  LEIKNRTHA+
Sbjct  377  NGLCEPISDESAPVYITIGDGGNSEGLVTDMMQPQPSYSAFREASFGHGLLEIKNRTHAY  436

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            + WNRN DG  +A D+  L N+FWG
Sbjct  437  FSWNRNQDGNSIAADSVWLINRFWG  461



>ref|XP_011088457.1| PREDICTED: purple acid phosphatase 2 [Sesamum indicum]
Length=467

 Score =   288 bits (738),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PYKAS S+   WY+I+RASA+IIVLS+YS + KYTPQ+KWL EEL +V+R +TPWL
Sbjct  253  RYRVPYKASDSSAPFWYSIKRASAYIIVLSSYSAYGKYTPQYKWLEEELPKVNRSETPWL  312

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR +YE WFV+YKVDVVFAGHVHAYERS R+SNI YN+ 
Sbjct  313  IVLMHSPWYNSYNYHYMEGETMRVMYEPWFVQYKVDVVFAGHVHAYERSERVSNIAYNIV  372

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +GI  PV D+SAPVYIT+GDGGN EGLA    +PQP+YSAFREAS+GH+TL IKNRTHA+
Sbjct  373  NGICTPVSDQSAPVYITIGDGGNLEGLANNMSEPQPKYSAFREASFGHATLAIKNRTHAY  432

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  V  D+    N+FW
Sbjct  433  YSWHRNQDGYAVQADSMWFFNRFW  456



>ref|XP_012078392.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Jatropha curcas]
Length=427

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R+PTPYKAS S + LWY+I+RASA+IIVLS+YS + KYTPQ+ WL +EL +VDR++TPWL
Sbjct  217  RFPTPYKASNSISPLWYSIKRASAYIIVLSSYSAYGKYTPQYVWLEKELKKVDRKETPWL  276

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P YNS   H+MEGE+MR ++E WFV+ KVD+VFAGHVH YERS+R+SNI YN++
Sbjct  277  IVLVHSPWYNSINYHYMEGETMRVMFEPWFVQNKVDLVFAGHVHCYERSHRVSNIRYNIT  336

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G++ P+ D SAP+YIT+GDGGN EGLA  F +PQP YSAFREAS+GH+ LEIKNRTHA+
Sbjct  337  NGLSTPIKDPSAPIYITIGDGGNIEGLADSFTEPQPSYSAFREASFGHAILEIKNRTHAY  396

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN D + VA D+  ++N+FW
Sbjct  397  YSWHRNQDNEPVAADSLWIYNRFW  420



>ref|XP_010910529.1| PREDICTED: purple acid phosphatase-like [Elaeis guineensis]
Length=470

 Score =   288 bits (738),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PY AS ST+  WY+I+RASA+IIVL++YS + KYTPQ+KWL  EL +V+R +TPWL
Sbjct  256  RYHVPYWASGSTSPFWYSIKRASAYIIVLASYSAYGKYTPQYKWLEAELPKVNRSETPWL  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR +YE+W VKYKVDVVFAGHVHAYERSYRISNI YN+ 
Sbjct  316  IVLMHAPWYNSYNYHYMEGETMRVIYEQWLVKYKVDVVFAGHVHAYERSYRISNIAYNIV  375

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G   PVPD+SAPVYIT+GDGGN EGLA    +PQP YSAFREAS+GH+  +IKNRTHA+
Sbjct  376  NGRCKPVPDQSAPVYITIGDGGNLEGLATNMTEPQPSYSAFREASFGHAIFDIKNRTHAY  435

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  VA D+   +N++W
Sbjct  436  YAWHRNQDGNSVAADSMWFYNRYW  459



>ref|XP_006294169.1| hypothetical protein CARUB_v10023164mg [Capsella rubella]
 gb|EOA27067.1| hypothetical protein CARUB_v10023164mg [Capsella rubella]
Length=463

 Score =   288 bits (738),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPYK+S S + LWY+I+RASA++IV+S YS + KYTPQ+KWL +EL  V+R +TPW+
Sbjct  249  RYQTPYKSSGSISPLWYSIKRASAYVIVMSCYSSYGKYTPQYKWLEKELQGVNRTETPWV  308

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P Y+S V H+MEGE++R +YEEWFVKYKVDVVFAGHVHAYERS R+SNI YN+ 
Sbjct  309  IVLVHCPFYSSYVHHYMEGETLRVMYEEWFVKYKVDVVFAGHVHAYERSERVSNIAYNIV  368

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D+SAPVYIT+GDGGN EGL      PQP YSAFREAS+GH  LEIKNRTHA+
Sbjct  369  NGLCEPISDESAPVYITIGDGGNSEGLVTDMMQPQPSYSAFREASFGHGLLEIKNRTHAY  428

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + WNRN DG  VA D+  L N+FW
Sbjct  429  FSWNRNQDGNSVAADSVWLLNRFW  452



>emb|CAA06921.1| purple acid phosphatase [Ipomoea batatas]
Length=465

 Score =   288 bits (738),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PYKAS ST   WY+I+RASA+IIVLS+YS + KYTPQ+KWL EEL +V+R +TPWL
Sbjct  251  RYHVPYKASGSTETFWYSIKRASAYIIVLSSYSAYGKYTPQYKWLEEELPKVNRTETPWL  310

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR +YE WFV++KVD+VFAGHVHAYERS RISN+ YN+ 
Sbjct  311  IVLMHSPWYNSYNYHYMEGETMRVMYEPWFVQHKVDLVFAGHVHAYERSERISNVAYNIV  370

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G   PV D+SAPVYIT+GDGGN EGLA    DPQPEYSAFREAS+GH+TL+IKNRTHA+
Sbjct  371  NGECTPVRDQSAPVYITIGDGGNLEGLATNMTDPQPEYSAFREASFGHATLDIKNRTHAY  430

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  V  D+  + N+FW
Sbjct  431  YSWHRNQDGYAVEADSMWVSNRFW  454



>gb|EMS54176.1| Purple acid phosphatase 2 [Triticum urartu]
Length=483

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPYK+S ST   WY+I+RASA+IIVL++YS + KYTPQ+KWL  E  +V+R +TPWL
Sbjct  270  RYHTPYKSSGSTAPYWYSIKRASAYIIVLASYSAYGKYTPQYKWLESEFPKVNRSETPWL  329

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGESMR +YE WFVKYKVD+VFAGHVHAYER++RISN+ YN+ 
Sbjct  330  IVLMHAPWYNSYNYHYMEGESMRVMYEPWFVKYKVDLVFAGHVHAYERTHRISNVAYNIV  389

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D+SAPVYIT+GDGGNQEGLA    +PQP YSAFREAS+GH+ L+IKNRTHA+
Sbjct  390  NGLCSPIQDQSAPVYITIGDGGNQEGLATNMSEPQPSYSAFREASFGHAILDIKNRTHAY  449

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  VA D+    N++W
Sbjct  450  YAWHRNQDGAAVAADSLWFTNRYW  473



>gb|EYU37834.1| hypothetical protein MIMGU_mgv1a005856mg [Erythranthe guttata]
Length=467

 Score =   288 bits (737),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  P+K+S ST+ LWY+I+RASA++IVLS+YS + KYTPQ+KWL +EL +V+R +TPWL
Sbjct  253  RYHVPFKSSNSTSPLWYSIKRASAYVIVLSSYSAYGKYTPQYKWLEQELPKVNRSETPWL  312

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P YNSN  H+MEGESMR ++E WFVKYKVDVVFAGHVHAYERS+R+SNI YNV 
Sbjct  313  IVLLHSPWYNSNHYHYMEGESMRVMFEPWFVKYKVDVVFAGHVHAYERSHRVSNIAYNVV  372

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +GI  PV D SAPVYIT+GDGGN EGLA     PQPEYSAFREAS+GH+T +IKNRTHA+
Sbjct  373  NGICTPVNDLSAPVYITIGDGGNIEGLANNMTVPQPEYSAFREASFGHATFDIKNRTHAY  432

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  V  D     N++W
Sbjct  433  YGWHRNQDGYAVQADTMWFSNRYW  456



>ref|XP_007222938.1| hypothetical protein PRUPE_ppa005293mg [Prunus persica]
 gb|EMJ24137.1| hypothetical protein PRUPE_ppa005293mg [Prunus persica]
Length=468

 Score =   288 bits (737),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PY+AS ST+ LWY+I+RASA+IIVLS+YS + KYTPQ+KWL +EL +V+R +TPWL
Sbjct  254  RYFVPYEASHSTSPLWYSIKRASAYIIVLSSYSAYGKYTPQYKWLEKELPKVNRTETPWL  313

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNS   H+MEGESMR +YE+WFVKYKVD++FAGHVHAYERS RISNI YN+ 
Sbjct  314  IVLMHSPLYNSYAHHYMEGESMRVMYEQWFVKYKVDIIFAGHVHAYERSERISNIAYNIV  373

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D+SAPVYIT+GDGGN EGL     +PQP YSAFREAS+GH   +IKNR+HAF
Sbjct  374  NGLCSPISDESAPVYITIGDGGNLEGLVTEMTEPQPSYSAFREASFGHGIFDIKNRSHAF  433

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + W+RN DG  V  D+  L N++W
Sbjct  434  FSWHRNQDGYAVEADSLWLKNRYW  457



>ref|NP_001044416.1| Os01g0776600 [Oryza sativa Japonica Group]
 dbj|BAC07354.1| putative purple acid phosphatase [Oryza sativa Japonica Group]
 dbj|BAF06330.1| Os01g0776600 [Oryza sativa Japonica Group]
 gb|EAY76021.1| hypothetical protein OsI_03945 [Oryza sativa Indica Group]
 gb|EAZ13731.1| hypothetical protein OsJ_03653 [Oryza sativa Japonica Group]
 dbj|BAG92599.1| unnamed protein product [Oryza sativa Japonica Group]
Length=465

 Score =   288 bits (737),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 165/205 (80%), Gaps = 0/205 (0%)
 Frame = -2

Query  923  FRYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPW  744
            +RYPTPYKAS ST   WY+++RASA+IIVL++YS + KYTPQ+KWL  E  +V+R +TPW
Sbjct  250  YRYPTPYKASGSTAPFWYSVKRASAYIIVLASYSSYGKYTPQYKWLEAEFPKVNRSETPW  309

Query  743  LIVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNV  564
            LIVL+H P YNS   H+MEGESMR +YE WFVKYKVD+VFAGHVHAYER++RISN+ YN+
Sbjct  310  LIVLLHAPWYNSYNYHYMEGESMRVMYEPWFVKYKVDLVFAGHVHAYERTHRISNVAYNI  369

Query  563  SSGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHA  384
             +G   PV D+SAPVYIT+GDGGNQEGLA     PQP YSAFRE+S+GH+ L+IKNRTHA
Sbjct  370  VNGQCTPVHDQSAPVYITIGDGGNQEGLATNMTAPQPGYSAFRESSFGHAILDIKNRTHA  429

Query  383  FYHWNRNDDGKRVATDAFVLHNQFW  309
            +Y W+RN DG  VA D+    N++W
Sbjct  430  YYTWHRNQDGNAVAADSMWFTNRYW  454



>gb|KDP32671.1| hypothetical protein JCGZ_13669 [Jatropha curcas]
Length=462

 Score =   288 bits (736),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R+PTPYKAS S + LWY+I+RASA+IIVLS+YS + KYTPQ+ WL +EL +VDR++TPWL
Sbjct  252  RFPTPYKASNSISPLWYSIKRASAYIIVLSSYSAYGKYTPQYVWLEKELKKVDRKETPWL  311

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P YNS   H+MEGE+MR ++E WFV+ KVD+VFAGHVH YERS+R+SNI YN++
Sbjct  312  IVLVHSPWYNSINYHYMEGETMRVMFEPWFVQNKVDLVFAGHVHCYERSHRVSNIRYNIT  371

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G++ P+ D SAP+YIT+GDGGN EGLA  F +PQP YSAFREAS+GH+ LEIKNRTHA+
Sbjct  372  NGLSTPIKDPSAPIYITIGDGGNIEGLADSFTEPQPSYSAFREASFGHAILEIKNRTHAY  431

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN D + VA D+  ++N+FW
Sbjct  432  YSWHRNQDNEPVAADSLWIYNRFW  455



>ref|XP_008793996.1| PREDICTED: purple acid phosphatase 2-like [Phoenix dactylifera]
Length=471

 Score =   288 bits (736),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PY+AS ST+  WY+I+RASA+IIVL++YS + KYTPQ++WL  EL +V+R +TPWL
Sbjct  257  RYHVPYRASGSTSPFWYSIKRASAYIIVLASYSAYGKYTPQYEWLEAELPKVNRSETPWL  316

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR +YE+WFVKYKVD VFAGHVHAYERSYRISNI YN+ 
Sbjct  317  IVLMHAPWYNSYNYHYMEGETMRVMYEQWFVKYKVDAVFAGHVHAYERSYRISNIAYNIV  376

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G   PVPD+SAPVYIT+GDGGN EGLA    +PQP YSA+REAS+GH+  +IKNRTHA+
Sbjct  377  NGKCKPVPDQSAPVYITIGDGGNLEGLATNMSEPQPSYSAYREASFGHAIFDIKNRTHAY  436

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  VA D+   +N++W
Sbjct  437  YTWHRNQDGNAVAADSMWFYNRYW  460



>gb|AAX20028.1| purple acid phosphatase [Medicago truncatula]
 gb|KEH29467.1| purple acid phosphatase superfamily protein [Medicago truncatula]
Length=465

 Score =   287 bits (735),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPYKAS+ST+  WY+I+RASAHIIVL++YS + KYTPQ+KWL +EL +V+R +TPWL
Sbjct  250  RYRTPYKASQSTSPFWYSIKRASAHIIVLASYSAYGKYTPQYKWLEQELPKVNRTETPWL  309

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGESMR +YE WFVKYKVDVV+AGHVHAYERS R+SN+ YNV 
Sbjct  310  IVLMHSPWYNSYNYHYMEGESMRVMYEPWFVKYKVDVVYAGHVHAYERSERVSNVAYNVV  369

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +GI  P+ D+SAPVYIT+GDGGN EGLA    +PQPEYSA+REAS+GH+  +IKNRTHA 
Sbjct  370  NGICTPIKDQSAPVYITIGDGGNLEGLATNMTEPQPEYSAYREASFGHAIFDIKNRTHAH  429

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  V  D+    N+FW
Sbjct  430  YSWHRNQDGYSVEADSHWFFNRFW  453



>ref|XP_011093857.1| PREDICTED: purple acid phosphatase 5-like [Sesamum indicum]
Length=427

 Score =   286 bits (732),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  P+KASKST+ LWY+I+RASA+IIVLS+YS + KYTPQ+ WL+EEL +V+R +TPWL
Sbjct  211  RYNVPHKASKSTSPLWYSIKRASAYIIVLSSYSAYGKYTPQYNWLKEELPKVNRAETPWL  270

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P YNSN  H+MEGESMR ++E WFVK+KVD+VFAGHVH+YERS RISN+ YN++
Sbjct  271  IVLLHSPWYNSNNYHYMEGESMRVMFESWFVKHKVDLVFAGHVHSYERSKRISNVKYNIT  330

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G++ PV D SAPVYIT+GDGGN EG+A  F +PQP YSAFREAS+GH+ LE+KNRTHA+
Sbjct  331  NGLSTPVSDASAPVYITIGDGGNIEGIADNFTEPQPSYSAFREASFGHAILELKNRTHAY  390

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN + + VA D+   +N++W
Sbjct  391  YTWHRNQENEAVAADSTWFYNRYW  414



>ref|XP_007017663.1| Purple acid phosphatase 10 isoform 2 [Theobroma cacao]
 gb|EOY14888.1| Purple acid phosphatase 10 isoform 2 [Theobroma cacao]
Length=353

 Score =   283 bits (725),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 163/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PY++S ST+ LWY+I+RASA++IVLS+YS + K TPQ+KWL +EL +VDR +TPWL
Sbjct  139  RYYVPYESSHSTSPLWYSIKRASAYVIVLSSYSAYGKSTPQYKWLSDELPKVDRSETPWL  198

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            I+LMH PIYNSN  H+MEGESMR VYE WFVKYKVDVVFAGHVHAYERS R+SNI YN+ 
Sbjct  199  ILLMHCPIYNSNSHHYMEGESMRVVYESWFVKYKVDVVFAGHVHAYERSKRVSNIAYNIV  258

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  PV D+SAPVYIT+GDGGN +G A    +PQP +SA+REAS+GH   ++KNRTHA 
Sbjct  259  NGMCTPVNDQSAPVYITIGDGGNHDGPAIGMVEPQPSFSAYREASFGHGIFDVKNRTHAC  318

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + W+RN DG+    D+   HN++W
Sbjct  319  FSWHRNQDGRATEADSLWFHNRYW  342



>ref|XP_010664753.1| PREDICTED: purple acid phosphatase 2 isoform X2 [Vitis vinifera]
Length=467

 Score =   287 bits (735),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = -2

Query  923  FRYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPW  744
            +RY  P++ASKST+ LWY+I+RASA+IIV+S+YS F K TPQ+KWL  EL +V+R +TPW
Sbjct  251  YRYQVPFEASKSTSPLWYSIKRASAYIIVMSSYSAFGKSTPQYKWLSYELPKVNRTETPW  310

Query  743  LIVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNV  564
            LIVLMH P+YNS + H+MEGESMR +YE WFV+YKVDVVFAGHVHAYERS R+SNI YN+
Sbjct  311  LIVLMHCPMYNSYIHHYMEGESMRVIYEPWFVEYKVDVVFAGHVHAYERSERVSNIAYNI  370

Query  563  SSGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHA  384
             +G   P+ D+SAPVYIT+GDGGNQ+GLA    +PQP YSA+REAS+GH  L+I+NRTHA
Sbjct  371  VNGKCTPIHDESAPVYITIGDGGNQKGLATGMTEPQPSYSAYREASFGHGILDIRNRTHA  430

Query  383  FYHWNRNDDGKRVATDAFVLHNQFW  309
            ++ WNRN D   V  D+  LHN++W
Sbjct  431  YFGWNRNQDAYAVEADSVWLHNRYW  455



>ref|XP_002280883.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664743.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664744.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664745.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664746.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664747.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664748.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664749.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664751.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664752.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 emb|CBI19778.3| unnamed protein product [Vitis vinifera]
Length=468

 Score =   287 bits (735),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = -2

Query  923  FRYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPW  744
            +RY  P++ASKST+ LWY+I+RASA+IIV+S+YS F K TPQ+KWL  EL +V+R +TPW
Sbjct  252  YRYQVPFEASKSTSPLWYSIKRASAYIIVMSSYSAFGKSTPQYKWLSYELPKVNRTETPW  311

Query  743  LIVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNV  564
            LIVLMH P+YNS + H+MEGESMR +YE WFV+YKVDVVFAGHVHAYERS R+SNI YN+
Sbjct  312  LIVLMHCPMYNSYIHHYMEGESMRVIYEPWFVEYKVDVVFAGHVHAYERSERVSNIAYNI  371

Query  563  SSGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHA  384
             +G   P+ D+SAPVYIT+GDGGNQ+GLA    +PQP YSA+REAS+GH  L+I+NRTHA
Sbjct  372  VNGKCTPIHDESAPVYITIGDGGNQKGLATGMTEPQPSYSAYREASFGHGILDIRNRTHA  431

Query  383  FYHWNRNDDGKRVATDAFVLHNQFW  309
            ++ WNRN D   V  D+  LHN++W
Sbjct  432  YFGWNRNQDAYAVEADSVWLHNRYW  456



>ref|XP_006487340.1| PREDICTED: purple acid phosphatase 2-like [Citrus sinensis]
Length=468

 Score =   287 bits (734),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 161/204 (79%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PY+AS ST   WY+I+RASA+IIVLS+YS + KYTPQ+KWL EEL +V+R +TPWL
Sbjct  254  RYHVPYRASGSTAPFWYSIKRASAYIIVLSSYSAYGKYTPQYKWLEEELPKVNRSETPWL  313

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR +YE WFVKYKVDVVFAGHVHAYERS R+SNI YNV 
Sbjct  314  IVLMHAPWYNSYNYHYMEGETMRVMYEPWFVKYKVDVVFAGHVHAYERSERVSNIAYNVV  373

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  PV D SAPVYIT+GDGGN EGLA    +PQP YSA+REAS+GH+  EIKNRTHA+
Sbjct  374  NGLCSPVKDLSAPVYITIGDGGNHEGLATNMTEPQPAYSAYREASFGHAIFEIKNRTHAY  433

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y WNRN DG  V  D+    N+FW
Sbjct  434  YGWNRNQDGYAVEADSMWFLNRFW  457



>ref|NP_195353.1| purple acid phosphatase 25 [Arabidopsis thaliana]
 sp|O23244.2|PPA25_ARATH RecName: Full=Purple acid phosphatase 25; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA18136.1| purple acid phosphatase like protein [Arabidopsis thaliana]
 emb|CAB16853.1| purple acid phosphatase like protein [Arabidopsis thaliana]
 emb|CAB80301.1| purple acid phosphatase like protein [Arabidopsis thaliana]
 gb|AAQ93684.1| putative purple acid phosphatase [Arabidopsis thaliana]
 gb|AEE86645.1| purple acid phosphatase 25 [Arabidopsis thaliana]
Length=466

 Score =   287 bits (734),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY   YKASKS + LWY+IRRASAHIIVLS+YS + KYTPQ+ WL +EL +V+RE+TPWL
Sbjct  250  RYHNAYKASKSISPLWYSIRRASAHIIVLSSYSAYGKYTPQYVWLEQELKKVNREETPWL  309

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IV++H P YNSN  H+MEGESMR ++E WFV  KVD+V +GHVH+YERS R+SNI YN++
Sbjct  310  IVMVHSPWYNSNNYHYMEGESMRAMFESWFVNSKVDLVLSGHVHSYERSERVSNIKYNIT  369

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G++YPV D SAP+YIT+GDGGN EG+A  F DPQP YSA+REAS+GH+ LEI NRTHA+
Sbjct  370  NGLSYPVKDPSAPIYITIGDGGNIEGIANSFTDPQPSYSAYREASFGHAVLEIYNRTHAY  429

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN D + VA D+ +LHN+++
Sbjct  430  YTWHRNQDNEPVAADSIMLHNRYF  453



>ref|XP_008387992.1| PREDICTED: purple acid phosphatase 2-like [Malus domestica]
Length=531

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PY+AS ST+ LWY+I+RASA+IIVLS+YS + KYTPQ+KWL +EL +V+R +TPWL
Sbjct  316  RYFVPYEASGSTSPLWYSIKRASAYIIVLSSYSAYGKYTPQYKWLEKELPKVNRTETPWL  375

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+Y+S V H+MEGES R +YEEWFV+Y+VDVVFAGHVHAYERS RISN+ YN+S
Sbjct  376  IVLMHSPLYSSYVHHYMEGESFRVMYEEWFVEYEVDVVFAGHVHAYERSERISNVAYNIS  435

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D+SAPVYIT+GDGGN EGL     +PQP YSAFREAS+GH   +IKNRTHAF
Sbjct  436  NGLCTPISDRSAPVYITIGDGGNLEGLVTEMTEPQPSYSAFREASFGHGIFDIKNRTHAF  495

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + W+RN DG  V  D+  L N++W
Sbjct  496  FSWHRNQDGYAVEADSLWLKNRYW  519



>ref|XP_011093859.1| PREDICTED: purple acid phosphatase 2-like isoform X2 [Sesamum 
indicum]
Length=399

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PYKASKST+ LWY+I+RASA+IIVLS+YS + KYTPQ+ WL EEL +V+R +TPWL
Sbjct  182  RYNVPYKASKSTSPLWYSIKRASAYIIVLSSYSAYGKYTPQYNWLEEELPKVNRAETPWL  241

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IV++H P YNSN  HFMEGE+MR ++E WFV+YKVD+VF+GHVHAYERS R+SN+ Y+++
Sbjct  242  IVMVHSPWYNSNNYHFMEGETMRVMFESWFVRYKVDLVFSGHVHAYERSKRVSNVRYDIT  301

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  PV D SAP YI +GDGGN EGLA  F +PQP YSAFREAS+GH+ LE+KNRTHA+
Sbjct  302  NGLCTPVSDASAPAYIVIGDGGNIEGLADNFIEPQPSYSAFREASFGHALLELKNRTHAY  361

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN D + VA D+   +N++W
Sbjct  362  YTWHRNQDSEAVAADSTWFYNRYW  385



>ref|XP_009335656.1| PREDICTED: purple acid phosphatase 2 [Pyrus x bretschneideri]
Length=531

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PY+AS ST+ LWY+I+RASA+I+VLS+YS + KYTPQ+KWL +EL +V+R +TPWL
Sbjct  316  RYFVPYEASGSTSPLWYSIKRASAYILVLSSYSAYGKYTPQYKWLEKELPKVNRTETPWL  375

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNS V H+MEGES R +YEEWFV+Y+VDVVFAGHVHAYERS RISN+ YN+S
Sbjct  376  IVLMHSPLYNSYVHHYMEGESFRVMYEEWFVEYEVDVVFAGHVHAYERSERISNVAYNIS  435

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D+SAPVYIT+GDGGN EGL     +PQP YSAFREAS+GH   +IKNRTHAF
Sbjct  436  NGLCTPISDRSAPVYITIGDGGNLEGLVTEMTEPQPIYSAFREASFGHGIFDIKNRTHAF  495

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + W+RN DG  V  D+  L N++W
Sbjct  496  FSWHRNQDGYAVEADSLWLKNRYW  519



>gb|KEH44359.1| purple acid phosphatase superfamily protein [Medicago truncatula]
Length=467

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPYKAS+ST+  WY+IRRASAHIIVL++YS + KYTPQ++WL +EL +V+R +TPWL
Sbjct  252  RYHTPYKASQSTSPFWYSIRRASAHIIVLASYSGYGKYTPQYQWLEQELPKVNRTETPWL  311

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNSN  H+MEGE+MR +YE WFVKYKVDVV+AGHVHAYER+ R+SNI YNV 
Sbjct  312  IVLMHSPWYNSNNQHYMEGETMRVMYEPWFVKYKVDVVYAGHVHAYERTERVSNIAYNVV  371

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +GI  P+ D+SAPVYIT+GDGGN  G+     +PQPEYSAFREAS+GH+  +IKNRTHA 
Sbjct  372  NGICTPIKDQSAPVYITIGDGGNLGGMETNMTEPQPEYSAFREASFGHAIFDIKNRTHAH  431

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  V  D+    N+FW
Sbjct  432  YSWHRNQDGYSVEADSHWFFNRFW  455



>ref|XP_010315506.1| PREDICTED: LOW QUALITY PROTEIN: purple acid phosphatase 2-like 
[Solanum lycopersicum]
Length=465

 Score =   286 bits (732),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PYKAS ST+ LWY+I+RASA+IIVLS+YS F KYTPQ+KWL +EL +V+R +TPWL
Sbjct  251  RYHVPYKASNSTSPLWYSIKRASAYIIVLSSYSTFGKYTPQYKWLEKELPKVNRSETPWL  310

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
             VL+H P+YNS   H+MEGE+MR VYE WFV+YKVD+VFAGHVHAYER+ RISN+ YNV 
Sbjct  311  FVLVHSPLYNSYNNHYMEGETMRVVYEPWFVQYKVDMVFAGHVHAYERTERISNVAYNVV  370

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G   P+ D+SAP+YIT+GDGGN EGLA    +PQP YSAFREAS+GH+TL IKNRTHA+
Sbjct  371  NGECSPIKDQSAPIYITIGDGGNLEGLATNMTEPQPAYSAFREASFGHATLAIKNRTHAY  430

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  V  D   ++N+FW
Sbjct  431  YSWHRNQDGYAVEADKIWVNNRFW  454



>gb|KFK32700.1| hypothetical protein AALP_AA6G277500 [Arabis alpina]
Length=464

 Score =   286 bits (731),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 163/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPYKAS S + LWY+I+RASA+IIV+S YS +  YTPQ+KWL +E  RV+R +TPWL
Sbjct  250  RYLTPYKASGSISPLWYSIKRASAYIIVMSCYSSYGIYTPQYKWLEKEFQRVNRTETPWL  309

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P Y+S V H+MEGE++R +YE WFVKYKVDVVFAGHVHAYERS R+SNI YN+ 
Sbjct  310  IVLVHSPFYHSYVHHYMEGETLRVLYEPWFVKYKVDVVFAGHVHAYERSERVSNIAYNLV  369

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  PVPD+SAPVYIT+GDGGN EGL     +PQP YSAFRE S+GH  LEIKNRTHA+
Sbjct  370  NGLCEPVPDESAPVYITIGDGGNSEGLLTDMIEPQPSYSAFREPSFGHGLLEIKNRTHAY  429

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + WNRN DG  +  D+ +L N+FW
Sbjct  430  FSWNRNQDGYSIEADSMLLLNRFW  453



>dbj|BAC55156.1| purple acid phosphatase [Nicotiana tabacum]
Length=468

 Score =   286 bits (731),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R+ TPY+ S ST+ LWY+I+RASA+IIV+S+YS F  YTPQWKWL+ EL +V+R +TPWL
Sbjct  255  RFSTPYRVSDSTSPLWYSIKRASAYIIVMSSYSAFGTYTPQWKWLKNELPKVNRSETPWL  314

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+Y+S V H+MEGE+MR +YE WFV YKVDVVFAGHVHAYERS RISN+ YN+ 
Sbjct  315  IVLMHCPMYSSYVHHYMEGETMRVMYEPWFVNYKVDVVFAGHVHAYERSERISNVAYNII  374

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +    PV D+SAPVYIT+GDGGNQEGLA     PQP YSA+REAS+GH  L+IKNRTHA+
Sbjct  375  NRKCSPVRDESAPVYITIGDGGNQEGLATEMTQPQPRYSAYREASFGHGILDIKNRTHAY  434

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + W+RN+DG  V  D+  L N++W
Sbjct  435  FGWHRNNDGYAVEADSLWLFNRYW  458



>emb|CDX77044.1| BnaC04g38390D [Brassica napus]
Length=481

 Score =   286 bits (732),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 163/205 (80%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPYKAS S + LWY+I+RASA+IIV+S YS +  YTPQ+KWLR+E  RV+R++TPWL
Sbjct  261  RYHTPYKASGSISPLWYSIKRASAYIIVMSCYSSYGVYTPQYKWLRKEFQRVNRKETPWL  320

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P Y+S   H+MEGE+MR +YE WFVK KVDVVFAGHVHAYERS R+SNI YN+ 
Sbjct  321  IVLVHCPFYHSYERHYMEGETMRVMYEPWFVKSKVDVVFAGHVHAYERSERVSNIAYNIV  380

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+PD+SAPVYIT+GDGGN EGL      PQP +SAFREAS+GH  L+IKNRTHA+
Sbjct  381  NGLCEPIPDESAPVYITIGDGGNAEGLLTDMMQPQPSFSAFREASFGHGLLDIKNRTHAY  440

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            + WNRNDDG     D+  L N+FWG
Sbjct  441  FSWNRNDDGSSEEADSVWLLNRFWG  465



>ref|XP_004291401.1| PREDICTED: purple acid phosphatase 2 [Fragaria vesca subsp. vesca]
Length=474

 Score =   286 bits (731),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PYKAS ST+ LWY+I+RASA+IIVLS+YS + KYTPQ+KWL +EL +V+R +TPWL
Sbjct  261  RYFVPYKASDSTSPLWYSIKRASAYIIVLSSYSAYGKYTPQYKWLEKELPQVNRTETPWL  320

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P+Y+S V H+MEGESMR +YEEWFV YKVDVVF+GHVHAYERS RISNI YN++
Sbjct  321  IVLVHCPMYSSYVHHYMEGESMRVMYEEWFVDYKVDVVFSGHVHAYERSERISNIAYNIT  380

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P  D+SAPVYIT+GDGGN EGL     +PQP YSAFRE S+GH  LEIKNR++AF
Sbjct  381  NGLCTPTSDQSAPVYITIGDGGNLEGLVTEMTEPQPSYSAFREPSFGHGILEIKNRSYAF  440

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + W+RN DG+ V  D+  L N+ W
Sbjct  441  FSWHRNQDGEAVEADSLWLRNRHW  464



>ref|XP_010113480.1| Purple acid phosphatase 25 [Morus notabilis]
 gb|EXC35507.1| Purple acid phosphatase 25 [Morus notabilis]
Length=467

 Score =   285 bits (730),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  P+KAS+ST+ LWYAI+RASAHIIVLS+YS + KYTPQ+ WL++EL RV+R +TPWL
Sbjct  251  RYHVPHKASQSTSPLWYAIKRASAHIIVLSSYSAYGKYTPQYNWLQQELQRVNRYETPWL  310

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P YNSN  H+MEGESMR ++E WFV+ KVD+VFAGHVH+YERS R+SN+ YN++
Sbjct  311  IVLLHSPWYNSNNYHYMEGESMRVMFESWFVQSKVDIVFAGHVHSYERSERVSNVKYNIT  370

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+++PV D SAP+YIT+GDGGN EGLA  F +PQP YS FREAS+GH+ L+I+NRTHA+
Sbjct  371  NGLSFPVKDPSAPIYITIGDGGNIEGLANNFTEPQPSYSGFREASFGHAILDIRNRTHAY  430

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN D + VA D+  L+N+++
Sbjct  431  YTWHRNQDSEPVAADSIWLYNRYY  454



>ref|XP_009787761.1| PREDICTED: purple acid phosphatase 2-like [Nicotiana sylvestris]
Length=468

 Score =   285 bits (730),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R+ TPY+ S ST+ LWY+I+RASA+IIV+S+YS F  YTPQWKWL+ EL +V+R +TPWL
Sbjct  255  RFSTPYRVSDSTSPLWYSIKRASAYIIVMSSYSAFGTYTPQWKWLKNELPKVNRSETPWL  314

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+Y+S V H+MEGE+MR +YE WFV YKVDVVFAGHVHAYERS RISN+ YN+ 
Sbjct  315  IVLMHCPMYSSYVHHYMEGETMRVMYEPWFVNYKVDVVFAGHVHAYERSERISNVAYNII  374

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +    PV D+SAPVYIT+GDGGNQEGLA     PQP YSA+REAS+GH  L+IKNRTHA+
Sbjct  375  NRKCSPVRDESAPVYITIGDGGNQEGLATEMTQPQPRYSAYREASFGHGILDIKNRTHAY  434

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + W+RN+DG  V  D+  L N++W
Sbjct  435  FGWHRNNDGYAVEADSLWLFNRYW  458



>sp|Q9SDZ9.1|PPAF2_IPOBA RecName: Full=Purple acid phosphatase 2; AltName: Full=Manganese(II) 
purple acid phosphatase 2; Flags: Precursor [Ipomoea 
batatas]
 gb|AAF19822.1|AF200826_1 purple acid phosphatase precursor [Ipomoea batatas]
Length=465

 Score =   285 bits (730),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PYKAS ST   WY I+RASA+IIVLS+YS + KYTPQ+KWL EEL +V+R +TPWL
Sbjct  251  RYHVPYKASGSTETFWYPIKRASAYIIVLSSYSAYGKYTPQYKWLEEELPKVNRTETPWL  310

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR +YE WFV++KVD+VFAGHVHAYERS R+SN+ Y++ 
Sbjct  311  IVLMHSPWYNSYNYHYMEGETMRVMYEPWFVQHKVDLVFAGHVHAYERSERVSNVAYDIV  370

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G   PV D+SAPVYIT+GDGGN EGLA    DPQPEYSAFREAS+GH+TL+IKNRTHA+
Sbjct  371  NGKCTPVRDQSAPVYITIGDGGNLEGLATNMTDPQPEYSAFREASFGHATLDIKNRTHAY  430

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  V  D+  + N+FW
Sbjct  431  YSWHRNQDGYAVEADSMWVSNRFW  454



>ref|XP_006487339.1| PREDICTED: purple acid phosphatase 2-like isoform X2 [Citrus 
sinensis]
Length=426

 Score =   284 bits (726),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 160/204 (78%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PY+AS ST   WY+I+RASA+IIVLS+YS + KYTPQ+KWL EEL +V+R +TPWL
Sbjct  212  RYHVPYRASGSTAPFWYSIKRASAYIIVLSSYSAYGKYTPQYKWLEEELPKVNRSETPWL  271

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR +YE WFVKYKVDVVFAGHVHAYERS R+SNI YNV 
Sbjct  272  IVLMHAPWYNSYNYHYMEGETMRVMYEPWFVKYKVDVVFAGHVHAYERSERVSNIAYNVV  331

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  PV D SAPVYIT+GDGGN EGL     +PQP YSA+REAS+GH+  EIKNRTHA+
Sbjct  332  NGLCSPVKDLSAPVYITIGDGGNLEGLVTNMTEPQPAYSAYREASFGHAIFEIKNRTHAY  391

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y WNRN DG  V  D+    N+FW
Sbjct  392  YGWNRNQDGYAVEADSMWFLNRFW  415



>gb|ERN01270.1| hypothetical protein AMTR_s00002p00249330 [Amborella trichopoda]
Length=460

 Score =   285 bits (729),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PYKAS ST+ LWY+I+RASA+IIVLS+YS + KYTPQ++WL+EE  +V+R +TPW+
Sbjct  248  RYHVPYKASNSTSPLWYSIKRASAYIIVLSSYSAYGKYTPQYQWLQEEFPKVNRSETPWV  307

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P YNS   H+MEGESMR  +E WFVK +VDVVFAGHVHAYERS RISNI YN++
Sbjct  308  IVLLHSPWYNSLDYHYMEGESMRVAFESWFVKNRVDVVFAGHVHAYERSERISNIAYNIT  367

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G++ PV D SAPVYIT+GDGGN EG+A RF +PQP YSA+RE S+GHS  +IKNRTHA+
Sbjct  368  NGLSTPVKDNSAPVYITIGDGGNMEGIANRFTEPQPSYSAYREPSFGHSIFDIKNRTHAY  427

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DGK VA D+   +N++W
Sbjct  428  YTWHRNQDGKAVAGDSAWFYNRYW  451



>gb|KHN22216.1| Purple acid phosphatase 2 [Glycine soja]
Length=407

 Score =   283 bits (724),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PY AS ST+ LWY+I+RAS +IIVLS+YS F KYTPQ+KWL +EL +V+R +TPWL
Sbjct  192  RYHLPYTASNSTSPLWYSIKRASTYIIVLSSYSAFGKYTPQYKWLVKELPKVNRTETPWL  251

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNS V H+MEGE++R +YE+WFV+YKVDVVFAGHVHAYERS R+SNI Y++ 
Sbjct  252  IVLMHSPMYNSYVNHYMEGETVRVLYEKWFVEYKVDVVFAGHVHAYERSKRVSNIAYSIV  311

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D+SAPVYIT+GDGGN EGLA    +PQP YSA+REAS+GH  L+IKNRTHA+
Sbjct  312  NGLHNPINDQSAPVYITIGDGGNIEGLATAMTEPQPSYSAYREASFGHGILDIKNRTHAY  371

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + WNRN DG  V  D+  L+N++W
Sbjct  372  FSWNRNQDGYAVVADSIWLYNRYW  395



>ref|XP_010417871.1| PREDICTED: fe(3+)-Zn(2+) purple acid phosphatase 12 [Camelina 
sativa]
Length=470

 Score =   285 bits (729),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 164/205 (80%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPYK+S S + LWY+I+RASA++IV+S YS + KYTPQ+KWL +EL  V+R +TPW+
Sbjct  256  RYQTPYKSSGSISPLWYSIKRASAYVIVMSCYSSYGKYTPQYKWLEKELQGVNRTETPWV  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P Y+S V H+MEGE++R +YE+WFVKYKV+VVFAGHVHAYERS  +SNI YN+ 
Sbjct  316  IVLVHCPFYSSYVHHYMEGETLRVMYEQWFVKYKVNVVFAGHVHAYERSEHVSNIAYNIV  375

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D+SAPVYIT+GDGGN EGL      PQP YSAFREAS+GH  LEIKNRTHA+
Sbjct  376  NGLCEPISDESAPVYITIGDGGNSEGLVTDMMQPQPSYSAFREASFGHGLLEIKNRTHAY  435

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            + WNRN DG  +A D+  L N+FWG
Sbjct  436  FSWNRNQDGNSIAADSVWLINRFWG  460



>ref|XP_006473581.1| PREDICTED: purple acid phosphatase 2-like isoform X1 [Citrus 
sinensis]
Length=471

 Score =   285 bits (729),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R+  PY+A  ST   WY+IRRASAHIIV+S YS F KYTPQ+KWL +E  +V+R +TPWL
Sbjct  257  RFHLPYRAPYSTAPFWYSIRRASAHIIVMSCYSAFGKYTPQYKWLEKEFPKVNRSETPWL  316

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNS V H+MEGE MR +YE WFV+YKVDVVFAGHVHAYERS R+SNI YNV+
Sbjct  317  IVLMHCPLYNSYVHHYMEGEPMRVLYEPWFVEYKVDVVFAGHVHAYERSERMSNIAYNVT  376

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            + +  PV D+SAPVYIT+GDGGNQEGLA    +PQP YSA+REAS+GH  L++KNRTHA+
Sbjct  377  NALCSPVSDQSAPVYITIGDGGNQEGLAKEMTEPQPRYSAYREASFGHGILDVKNRTHAY  436

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + W+RN D   V  D+  LHN++W
Sbjct  437  FGWHRNQDDYAVEADSVWLHNRYW  460



>ref|XP_006487338.1| PREDICTED: purple acid phosphatase 2-like isoform X1 [Citrus 
sinensis]
Length=468

 Score =   285 bits (729),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 160/204 (78%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PY+AS ST   WY+I+RASA+IIVLS+YS + KYTPQ+KWL EEL +V+R +TPWL
Sbjct  254  RYHVPYRASGSTAPFWYSIKRASAYIIVLSSYSAYGKYTPQYKWLEEELPKVNRSETPWL  313

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR +YE WFVKYKVDVVFAGHVHAYERS R+SNI YNV 
Sbjct  314  IVLMHAPWYNSYNYHYMEGETMRVMYEPWFVKYKVDVVFAGHVHAYERSERVSNIAYNVV  373

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  PV D SAPVYIT+GDGGN EGL     +PQP YSA+REAS+GH+  EIKNRTHA+
Sbjct  374  NGLCSPVKDLSAPVYITIGDGGNLEGLVTNMTEPQPAYSAYREASFGHAIFEIKNRTHAY  433

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y WNRN DG  V  D+    N+FW
Sbjct  434  YGWNRNQDGYAVEADSMWFLNRFW  457



>ref|XP_010028626.1| PREDICTED: purple acid phosphatase-like [Eucalyptus grandis]
 gb|KCW55388.1| hypothetical protein EUGRSUZ_I01297 [Eucalyptus grandis]
Length=466

 Score =   285 bits (728),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PY+ S ST+ LWY+I+RASA+IIVLS+YS +  YTPQ+ WL+EEL +V+R +TPWL
Sbjct  256  RYEIPYRESNSTSPLWYSIKRASAYIIVLSSYSAYAIYTPQYVWLQEELPKVNRSETPWL  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNS   H+MEGESMR V+E W V+YKVDVVFAGHVHAYERS RISN+ YN++
Sbjct  316  IVLMHTPLYNSYNYHYMEGESMRVVFEPWLVQYKVDVVFAGHVHAYERSERISNVAYNIT  375

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+A PV D +APVYIT+GDGGN EGLA    +PQPEYSAFREAS+GH+  +IKNRTHA+
Sbjct  376  NGLATPVSDPNAPVYITIGDGGNIEGLAKNMTEPQPEYSAFREASFGHAIFDIKNRTHAY  435

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y WNRN+DG     D+    N++W
Sbjct  436  YSWNRNNDGIATEADSLWFRNRYW  459



>ref|XP_002307690.1| Iron(III)-zinc(II) purple acid phosphatase precursor family protein 
[Populus trichocarpa]
 gb|EEE94686.1| Iron(III)-zinc(II) purple acid phosphatase precursor family protein 
[Populus trichocarpa]
Length=467

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PY+AS ST+ +WY+I+RASA+IIVLS+YS + KYTPQ+KWL +EL +V+R +TPWL
Sbjct  253  RYHVPYRASGSTSPMWYSIKRASAYIIVLSSYSAYGKYTPQYKWLEKELPKVNRTETPWL  312

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNS   H+MEGE+MR +YE WFV++KVDVVFAGHVHAYERS RISN+ YN+ 
Sbjct  313  IVLMHCPMYNSYAHHYMEGETMRVMYEPWFVEFKVDVVFAGHVHAYERSERISNVAYNIV  372

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D+SAP+YIT+GDGGN EGL     +PQP YSAFRE S+GH  L+IKNRTHA+
Sbjct  373  NGLCAPIRDQSAPIYITIGDGGNLEGLVTSMTEPQPSYSAFREPSFGHGILDIKNRTHAY  432

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + W+RN DG  V  D+  LHN+FW
Sbjct  433  FGWHRNQDGYAVEADSVWLHNRFW  456



>ref|XP_009112387.1| PREDICTED: purple acid phosphatase 10-like isoform X2 [Brassica 
rapa]
Length=462

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY++S ST   WY+I+R  A+IIVL++YS + KYTPQ+KWL +E  +V+R +TPWL
Sbjct  250  RYRTPYRSSGSTEPFWYSIKRGPAYIIVLASYSAYGKYTPQFKWLEKEFPKVNRTETPWL  309

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR +YE WFVKYKVDVVFAGHVHAYERS R+SNI YNV 
Sbjct  310  IVLMHSPWYNSYDYHYMEGETMRVMYEPWFVKYKVDVVFAGHVHAYERSERVSNIAYNVV  369

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +GI  PV DKSAPVYIT+GDGGN EGLA R  +PQP+YSAFREAS+GH+ L IKNRTHA+
Sbjct  370  NGICTPVKDKSAPVYITIGDGGNLEGLATRMTEPQPKYSAFREASFGHAVLSIKNRTHAY  429

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  V  D    +N+FW
Sbjct  430  YGWHRNQDGYAVKGDTMWFYNRFW  453



>ref|XP_011093858.1| PREDICTED: purple acid phosphatase 5-like isoform X1 [Sesamum 
indicum]
Length=464

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PYKASKST+ LWY+I+RASA+IIVLS+YS + KYTPQ+ WL EEL +V+R +TPWL
Sbjct  247  RYNVPYKASKSTSPLWYSIKRASAYIIVLSSYSAYGKYTPQYNWLEEELPKVNRAETPWL  306

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IV++H P YNSN  HFMEGE+MR ++E WFV+YKVD+VF+GHVHAYERS R+SN+ Y+++
Sbjct  307  IVMVHSPWYNSNNYHFMEGETMRVMFESWFVRYKVDLVFSGHVHAYERSKRVSNVRYDIT  366

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  PV D SAP YI +GDGGN EGLA  F +PQP YSAFREAS+GH+ LE+KNRTHA+
Sbjct  367  NGLCTPVSDASAPAYIVIGDGGNIEGLADNFIEPQPSYSAFREASFGHALLELKNRTHAY  426

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN D + VA D+   +N++W
Sbjct  427  YTWHRNQDSEAVAADSTWFYNRYW  450



>emb|CDY26770.1| BnaC09g08970D [Brassica napus]
Length=467

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY++S ST   WY+I+R  A+IIVL++YS + KYTPQ+KWL +E  +V+R +TPWL
Sbjct  255  RYRTPYRSSGSTEPFWYSIKRGPAYIIVLASYSAYGKYTPQFKWLEKEFPKVNRTETPWL  314

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR +YE WFVKYKVDVVFAGHVHAYERS R+SNI YNV 
Sbjct  315  IVLMHSPWYNSYDYHYMEGETMRVMYEPWFVKYKVDVVFAGHVHAYERSERVSNIAYNVV  374

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +GI  PV DKSAPVYIT+GDGGN EGLA R  +PQP+YSAFREAS+GH+ L IKNRTHA+
Sbjct  375  NGICTPVKDKSAPVYITIGDGGNLEGLATRMTEPQPKYSAFREASFGHAVLSIKNRTHAY  434

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  V  D    +N+FW
Sbjct  435  YGWHRNQDGYAVKGDTMWFYNRFW  458



>gb|EMT18687.1| Purple acid phosphatase 2 [Aegilops tauschii]
Length=497

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/202 (66%), Positives = 163/202 (81%), Gaps = 0/202 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPYK+S ST   WY+I+RASA+IIVL++YS + KYTPQ+KWL  E  +V+R +TPWL
Sbjct  253  RYHTPYKSSGSTAPYWYSIKRASAYIIVLASYSAYGKYTPQYKWLESEFPKVNRSETPWL  312

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGESMR +YE WFVKYKVD+VFAGHVHAYER++RISN+ YN+ 
Sbjct  313  IVLMHAPWYNSYNYHYMEGESMRVMYEPWFVKYKVDLVFAGHVHAYERTHRISNVAYNIV  372

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D+SAPVYIT+GDGGNQEGLA    +PQP YSAFREAS+GH+ L+IKNRTHA+
Sbjct  373  NGLCSPIQDQSAPVYITIGDGGNQEGLATNMSEPQPSYSAFREASFGHAILDIKNRTHAY  432

Query  380  YHWNRNDDGKRVATDAFVLHNQ  315
            Y W+RN DG  VA DA    N+
Sbjct  433  YAWHRNQDGAAVAADALWFTNR  454



>gb|ABV89745.1| purple acid phosphatase 12 protein family isoform 4 [Brassica 
napus]
 gb|ABV89747.1| purple acid phosphatase 12 protein family isoform 4 [Brassica 
napus]
Length=526

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 163/205 (80%), Gaps = 0/205 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPYKAS S + LWY+I+RASA+IIV+S YS +  YTPQ+KWLR+E  RV+R++TPWL
Sbjct  306  RYHTPYKASGSISPLWYSIKRASAYIIVMSCYSSYGVYTPQYKWLRKEFQRVNRKETPWL  365

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P Y+S   H+MEGE+MR +YE WFVK KVDVVFAGHVHAYERS R+SNI YN+ 
Sbjct  366  IVLVHCPFYHSYERHYMEGETMRVMYEPWFVKSKVDVVFAGHVHAYERSERVSNIAYNIV  425

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+PD+SAPVYIT+GDGGN EGL      PQP +SAFREAS+GH  L+IKNRTHA+
Sbjct  426  NGLCEPIPDESAPVYITIGDGGNAEGLLTDMMQPQPSFSAFREASFGHGLLDIKNRTHAY  485

Query  380  YHWNRNDDGKRVATDAFVLHNQFWG  306
            + WNRNDDG     D+  L N+FWG
Sbjct  486  FSWNRNDDGSSEEADSVWLLNRFWG  510



>gb|KDO84712.1| hypothetical protein CISIN_1g040421mg, partial [Citrus sinensis]
Length=407

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 161/204 (79%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R+  PY+A  ST   WY+IRRASAHIIV+S YS F KYTPQ+KWL +E  +V+R +TPWL
Sbjct  193  RFHLPYRAPYSTAPFWYSIRRASAHIIVMSCYSAFGKYTPQYKWLEKEFPKVNRSETPWL  252

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNS V H+MEGE MR +YE WFV+YKVDVVFA HVHAYERS R+SNI YNV+
Sbjct  253  IVLMHCPLYNSYVHHYMEGEPMRVLYEPWFVEYKVDVVFAAHVHAYERSERMSNIAYNVT  312

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            + +  PV D+SAPVYIT+GDGGNQEGLA    +PQP YSA+REAS+GH  L++KNRTHA+
Sbjct  313  NALCSPVSDQSAPVYITIGDGGNQEGLAKEMTEPQPRYSAYREASFGHGILDVKNRTHAY  372

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + W+RN D   V  D+  LHN++W
Sbjct  373  FGWHRNQDDYAVEADSVWLHNRYW  396



>ref|XP_007017664.1| Purple acid phosphatase 12 isoform 1 [Theobroma cacao]
 gb|EOY14889.1| Purple acid phosphatase 12 isoform 1 [Theobroma cacao]
Length=465

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 161/204 (79%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PYKAS ST+ LWY+I+RASAHIIV+S+YS +  YTPQ+KWL++E  +V+R +TPWL
Sbjct  255  RYHVPYKASGSTSPLWYSIKRASAHIIVMSSYSAYAIYTPQYKWLQKEFQKVNRTETPWL  314

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P Y+S V H+MEGESMR +YE WFV++KVDVVFAGHVHAYERS RISNI YNV 
Sbjct  315  IVLMHCPFYSSYVHHYMEGESMRVIYEPWFVQHKVDVVFAGHVHAYERSDRISNIAYNVV  374

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D SAPVYIT+GDGGN EGL     +PQP YSAFREAS+GH   +IKNRTHA 
Sbjct  375  NGLCTPISDLSAPVYITIGDGGNLEGLVTEMTEPQPSYSAFREASFGHGIFDIKNRTHAH  434

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + W+RN DG  V  D+   HN++W
Sbjct  435  FSWHRNQDGYAVEADSLWFHNRYW  458



>ref|XP_009112386.1| PREDICTED: purple acid phosphatase 10-like isoform X1 [Brassica 
rapa]
Length=468

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY++S ST   WY+I+R  A+IIVL++YS + KYTPQ+KWL +E  +V+R +TPWL
Sbjct  256  RYRTPYRSSGSTEPFWYSIKRGPAYIIVLASYSAYGKYTPQFKWLEKEFPKVNRTETPWL  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR +YE WFVKYKVDVVFAGHVHAYERS R+SNI YNV 
Sbjct  316  IVLMHSPWYNSYDYHYMEGETMRVMYEPWFVKYKVDVVFAGHVHAYERSERVSNIAYNVV  375

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +GI  PV DKSAPVYIT+GDGGN EGLA R  +PQP+YSAFREAS+GH+ L IKNRTHA+
Sbjct  376  NGICTPVKDKSAPVYITIGDGGNLEGLATRMTEPQPKYSAFREASFGHAVLSIKNRTHAY  435

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  V  D    +N+FW
Sbjct  436  YGWHRNQDGYAVKGDTMWFYNRFW  459



>ref|XP_002280873.1| PREDICTED: purple acid phosphatase 2 [Vitis vinifera]
 emb|CAN60822.1| hypothetical protein VITISV_037054 [Vitis vinifera]
 emb|CBI19779.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  P+ AS ST+ LWY+I+RASA+IIV+S+YS + KYTPQ+KWL  EL +V+R +TPWL
Sbjct  253  RYHVPFLASASTSPLWYSIKRASAYIIVMSSYSAYDKYTPQYKWLANELLKVNRTETPWL  312

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H PIYNS + H+MEGE+MR +YE WFV+YK+DVVFAGHVHAYERS RISNI Y++ 
Sbjct  313  IVLIHCPIYNSYIHHYMEGETMRVMYEAWFVEYKIDVVFAGHVHAYERSERISNIAYDIV  372

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G   P+P++SAPVYIT+GDGGNQEGLA    +PQP YSA+REAS+GH  L+IKNRTHA+
Sbjct  373  NGNCTPIPNESAPVYITIGDGGNQEGLATGMTEPQPSYSAYREASFGHGILDIKNRTHAY  432

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + WNRN D   V  D+  L N++W
Sbjct  433  FGWNRNQDAYAVEADSVWLQNRYW  456



>ref|XP_010320409.1| PREDICTED: LOW QUALITY PROTEIN: purple acid phosphatase 2-like 
[Solanum lycopersicum]
Length=470

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 163/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R+ TPY+ S+ST+ LWY+I+RASA+IIV+S+YS F KYTPQWKWL  EL +V+R +TPWL
Sbjct  255  RFSTPYRESQSTSPLWYSIKRASAYIIVMSSYSAFGKYTPQWKWLTNELPKVNRSETPWL  314

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNS V H+MEGE+MR +YE W VKYKVDVVFAGHVHAYERS R+SN+ YN+ 
Sbjct  315  IVLMHCPMYNSYVHHYMEGETMRVIYEPWLVKYKVDVVFAGHVHAYERSERVSNVAYNII  374

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +    PV D+SAPVYIT+G+GGNQEGLA     PQP YSA+REAS+GH  L+IKNRTHA+
Sbjct  375  NRKCSPVKDESAPVYITIGNGGNQEGLATEMTQPQPRYSAYREASFGHGILDIKNRTHAY  434

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + W+RN DG     D+  L N++W
Sbjct  435  FVWHRNHDGFATEADSLWLLNRYW  458



>ref|XP_002867021.1| ATPAP25/PAP25 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43280.1| ATPAP25/PAP25 [Arabidopsis lyrata subsp. lyrata]
Length=466

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY   YKASKST+ LWY+IRRASAHIIVLS+YS + KYTPQ+ WL +EL +V+RE+TPWL
Sbjct  250  RYHNAYKASKSTSPLWYSIRRASAHIIVLSSYSAYGKYTPQYVWLDQELKKVNREETPWL  309

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IV++H P YNSN  H+MEGESMR ++E WFV  KVD+V +GHVH+YERS R+SNI YN++
Sbjct  310  IVMVHSPWYNSNNYHYMEGESMRAMFESWFVNSKVDLVLSGHVHSYERSERVSNIKYNIT  369

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G++ PV D SAP+YIT+GDGGN EG+A  F DPQP YSA+REAS+GH+ L+I N+THAF
Sbjct  370  NGLSSPVKDPSAPIYITIGDGGNIEGIANSFTDPQPSYSAYREASFGHAVLQIFNKTHAF  429

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN D + +A D+ +LHN+++
Sbjct  430  YTWHRNQDNEPIAADSIMLHNRYF  453



>emb|CDY47461.1| BnaA09g08700D [Brassica napus]
Length=468

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPY++S ST   WY+I+R  A+IIVL++YS + KYTPQ+KWL +E  +V+R +TPWL
Sbjct  256  RYRTPYRSSGSTEPFWYSIKRGPAYIIVLASYSAYGKYTPQFKWLEKEFPKVNRTETPWL  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR +YE WFVKYKVDVVFAGHVHAYERS R+SNI YNV 
Sbjct  316  IVLMHSPWYNSYDYHYMEGETMRVMYEPWFVKYKVDVVFAGHVHAYERSERVSNIAYNVV  375

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +GI  PV DKSAPVYIT+GDGGN EGLA R  +PQP+YSAFREAS+GH+ L IKNRTHA+
Sbjct  376  NGICTPVKDKSAPVYITIGDGGNLEGLATRMTEPQPKYSAFREASFGHAVLSIKNRTHAY  435

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  V  D    +N+FW
Sbjct  436  YGWHRNQDGYAVKGDTMWFYNRFW  459



>ref|XP_012071955.1| PREDICTED: purple acid phosphatase 2-like [Jatropha curcas]
 dbj|BAJ53173.1| JHL18I08.7 [Jatropha curcas]
 gb|KDP38574.1| hypothetical protein JCGZ_04499 [Jatropha curcas]
Length=471

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R+  PY+   ST+ LWY+I+RASA+IIV+S+YS F KYTPQ++WL  EL +V+R +TPWL
Sbjct  257  RFHVPYRECGSTSPLWYSIKRASAYIIVMSSYSAFGKYTPQYRWLINELPKVNRSETPWL  316

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNS   H+MEGE+MR +YEEWFVKYKVDVVFAGHVHAYERS RISNI YN+ 
Sbjct  317  IVLMHAPMYNSYAHHYMEGETMRVMYEEWFVKYKVDVVFAGHVHAYERSERISNIEYNIV  376

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P  D+SAPVYIT+GDGGN EGL     +PQP YSAFREAS+GH  L+I+NR+HAF
Sbjct  377  NGLCTPKSDQSAPVYITIGDGGNLEGLVTEMTEPQPSYSAFREASFGHGLLDIRNRSHAF  436

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + WNRN DG  V  D+  L N++W
Sbjct  437  FSWNRNQDGYAVEADSVWLINRYW  460



>ref|XP_002510464.1| Iron(III)-zinc(II) purple acid phosphatase precursor, putative 
[Ricinus communis]
 gb|EEF52651.1| Iron(III)-zinc(II) purple acid phosphatase precursor, putative 
[Ricinus communis]
Length=469

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R+  PY AS ST+ LWY+I+RASA+IIV+S+YS F KYTPQ+KWL +EL +VDR +TPWL
Sbjct  255  RFHVPYSASGSTSPLWYSIKRASAYIIVMSSYSAFGKYTPQYKWLEQELPKVDRTETPWL  314

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNS V H+MEGE+MR +YE WFV+Y+VDVVFAGHVHAYERS R+SNI YN+ 
Sbjct  315  IVLMHCPMYNSYVGHYMEGETMRVMYETWFVEYQVDVVFAGHVHAYERSKRVSNIAYNIV  374

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G   PV ++SAPVYIT+GDGGN EGL     +PQP YSAFREAS+GH  L+IKN+THA+
Sbjct  375  NGHCIPVYNRSAPVYITIGDGGNLEGLVTEMTEPQPSYSAFREASFGHGLLDIKNKTHAY  434

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + W+RN DG  V  D+  L N++W
Sbjct  435  FSWHRNQDGDAVEADSVRLINRYW  458



>gb|AAA91803.1| secreted purple acid phosphatase precursor [Arabidopsis thaliana]
Length=469

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TP+KAS S + LWY+I+RASA+IIV+S YS +  YTPQ+KWL +EL  V+R +TPWL
Sbjct  255  RYHTPHKASGSISPLWYSIKRASAYIIVMSCYSSYGIYTPQYKWLEKELQGVNRTETPWL  314

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P Y+S V H+MEGE++R +YE+WFVKYKVDVVFAGHVHAYERS R+SNI YN+ 
Sbjct  315  IVLVHSPFYSSYVHHYMEGETLRVMYEQWFVKYKVDVVFAGHVHAYERSERVSNIAYNIV  374

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D+SAP+YIT+GDGGN EGL      PQP+YSAFREAS+GH  LEIKNRTHA+
Sbjct  375  NGLCEPISDESAPIYITIGDGGNSEGLLTDMMQPQPKYSAFREASFGHGLLEIKNRTHAY  434

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + WNRN DG  VA D+  L N+FW
Sbjct  435  FSWNRNQDGNAVAADSVWLLNRFW  458



>ref|XP_010107842.1| Purple acid phosphatase 2 [Morus notabilis]
 gb|EXC17242.1| Purple acid phosphatase 2 [Morus notabilis]
Length=470

 Score =   283 bits (725),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PYKAS ST   WY+I+RASAHIIVL++YS + KYTPQ++WL++EL +V+R +TPWL
Sbjct  256  RYHMPYKASGSTAPFWYSIKRASAHIIVLASYSAYGKYTPQYRWLKDELPKVNRSETPWL  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR +YEEWFV YKVDVVFAGHVHAYERS R+SNI YNV 
Sbjct  316  IVLMHSPWYNSYNYHYMEGETMRVMYEEWFVIYKVDVVFAGHVHAYERSERVSNIAYNVV  375

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +GI  PV D+SAPVYIT+GDGGN EGLA    +PQP YSA+REAS+GH+  +IKNRTHA+
Sbjct  376  NGICSPVKDQSAPVYITIGDGGNLEGLATNMTEPQPAYSAYREASFGHAIFDIKNRTHAY  435

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  V  D+    N+ W
Sbjct  436  YGWHRNQDGNAVEADSMWFSNRHW  459



>ref|NP_180287.2| Fe(3+)-Zn(2+) purple acid phosphatase 12 [Arabidopsis thaliana]
 sp|Q38924.3|PPA12_ARATH RecName: Full=Fe(3+)-Zn(2+) purple acid phosphatase 12; Short=PAP; 
AltName: Full=Iron(III)-zinc(II) purple acid phosphatase 
12; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL57700.1| At2g27190/T22O13.4 [Arabidopsis thaliana]
 gb|AAM91429.1| At2g27190/T22O13.4 [Arabidopsis thaliana]
 gb|AEC07951.1| Fe(3+)-Zn(2+) purple acid phosphatase 12 [Arabidopsis thaliana]
Length=469

 Score =   283 bits (725),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TP+KAS S + LWY+I+RASA+IIV+S YS +  YTPQ+KWL +EL  V+R +TPWL
Sbjct  255  RYHTPHKASGSISPLWYSIKRASAYIIVMSCYSSYGIYTPQYKWLEKELQGVNRTETPWL  314

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P Y+S V H+MEGE++R +YE+WFVKYKVDVVFAGHVHAYERS R+SNI YN+ 
Sbjct  315  IVLVHSPFYSSYVHHYMEGETLRVMYEQWFVKYKVDVVFAGHVHAYERSERVSNIAYNIV  374

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D+SAP+YIT+GDGGN EGL      PQP+YSAFREAS+GH  LEIKNRTHA+
Sbjct  375  NGLCEPISDESAPIYITIGDGGNSEGLLTDMMQPQPKYSAFREASFGHGLLEIKNRTHAY  434

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + WNRN DG  VA D+  L N+FW
Sbjct  435  FSWNRNQDGNAVAADSVWLLNRFW  458



>gb|AAM15913.1|AF492664_1 purple acid phosphatase [Arabidopsis thaliana]
 gb|AAD26885.1| purple acid phosphatase precursor [Arabidopsis thaliana]
Length=469

 Score =   283 bits (725),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TP+KAS S + LWY+I+RASA+IIV+S YS +  YTPQ+KWL +EL  V+R +TPWL
Sbjct  255  RYHTPHKASGSISPLWYSIKRASAYIIVMSCYSSYGIYTPQYKWLEKELQGVNRTETPWL  314

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P Y+S V H+MEGE++R +YE+WFVKYKVDVVFAGHVHAYERS R+SNI YN+ 
Sbjct  315  IVLVHSPFYSSYVHHYMEGETLRVMYEQWFVKYKVDVVFAGHVHAYERSERVSNIAYNIV  374

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D+SAP+YIT+GDGGN EGL      PQP+YSAFREAS+GH  LEIKNRTHA+
Sbjct  375  NGLCEPISDESAPIYITIGDGGNSEGLLTDMMQPQPKYSAFREASFGHGLLEIKNRTHAY  434

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + WNRN DG  VA D+  L N+FW
Sbjct  435  FSWNRNQDGNAVAADSVWLLNRFW  458



>dbj|BAC55154.1| purple acid phosphatase [Nicotiana tabacum]
Length=461

 Score =   283 bits (724),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 163/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYP PY+AS S++ LWY+I+RASA+IIVLSTYS   KYTPQ++WL  EL +V+R++TPWL
Sbjct  251  RYPVPYQASGSSSPLWYSIKRASAYIIVLSTYSATSKYTPQYRWLEAELKKVNRKETPWL  310

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR +YE WFVKYKVD+VFAGHVHAYERS RISNI Y + 
Sbjct  311  IVLMHCPWYNSYGYHYMEGETMRVIYEPWFVKYKVDMVFAGHVHAYERSKRISNIDYKIV  370

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG   P  + SAPVYITVGDGGN EGL  +  +PQP+YSA+RE+S+GH+ LEIKNRTHA+
Sbjct  371  SGECTPASNPSAPVYITVGDGGNIEGLTTKMTEPQPKYSAYRESSFGHAILEIKNRTHAY  430

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG     D+F+  N++W
Sbjct  431  YSWHRNQDGFSAKADSFLFFNRYW  454



>ref|XP_009794994.1| PREDICTED: purple acid phosphatase 2-like [Nicotiana sylvestris]
Length=461

 Score =   283 bits (724),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 163/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYP PY+AS S++ LWY+I+RASA+IIVLSTYS   KYTPQ++WL  EL +V+R++TPWL
Sbjct  251  RYPVPYQASGSSSPLWYSIKRASAYIIVLSTYSATSKYTPQYRWLEAELKKVNRKETPWL  310

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR +YE WFVKYKVD+VFAGHVHAYERS RISNI Y + 
Sbjct  311  IVLMHCPWYNSYGYHYMEGETMRVIYEPWFVKYKVDMVFAGHVHAYERSKRISNIDYKIV  370

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            SG   P  + SAPVYITVGDGGN EGL  +  +PQP+YSA+RE+S+GH+ LEIKNRTHA+
Sbjct  371  SGECTPASNPSAPVYITVGDGGNIEGLTTKMTEPQPKYSAYRESSFGHAILEIKNRTHAY  430

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG     D+F+  N++W
Sbjct  431  YSWHRNQDGFSAKADSFLFFNRYW  454



>ref|XP_009611298.1| PREDICTED: purple acid phosphatase 2-like [Nicotiana tomentosiformis]
Length=468

 Score =   283 bits (725),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 164/203 (81%), Gaps = 0/203 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            R+ TPY+AS ST+ LWY+I+RASA+IIV+S+YS F  YTPQWKWL+ EL +V+R +TPWL
Sbjct  255  RFSTPYRASDSTSPLWYSIKRASAYIIVMSSYSAFGTYTPQWKWLKNELPKVNRSETPWL  314

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+Y+S V H+MEGE+MR +YE WFV YKVDV+FAGHVHAYERS R+SN+ YN+ 
Sbjct  315  IVLMHCPMYSSYVHHYMEGETMRVMYEPWFVNYKVDVIFAGHVHAYERSERVSNVAYNII  374

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +    PV D+SAP+YIT+GDGGNQEGLA     PQP YSA+REAS+GH  L+IKNRTHA+
Sbjct  375  NRKCSPVRDESAPMYITIGDGGNQEGLATEMTQPQPRYSAYREASFGHGILDIKNRTHAY  434

Query  380  YHWNRNDDGKRVATDAFVLHNQF  312
            + W+RNDDG  V  D+  L N++
Sbjct  435  FGWHRNDDGYAVEADSLWLLNRY  457



>ref|XP_006362022.1| PREDICTED: purple acid phosphatase 2-like [Solanum tuberosum]
Length=465

 Score =   283 bits (724),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PYKAS ST+ LWY+I+RASA+IIVLS+YS F KYTPQ+KWL +EL +V+R +TPWL
Sbjct  251  RYHVPYKASNSTSPLWYSIKRASAYIIVLSSYSAFGKYTPQYKWLEKELPKVNRTETPWL  310

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
             VL+H P YNS   H+MEGE+MR VYE WFV+YKVD+VFAGHVHAYER+ RISN+ YNV 
Sbjct  311  FVLVHSPWYNSYNNHYMEGETMRVVYEPWFVQYKVDMVFAGHVHAYERTERISNVAYNVV  370

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G   P+ D+SAP+YIT+GDGGN EGLA    +PQP YSAFREAS+GH+TL IKNRTHA+
Sbjct  371  NGECSPIKDQSAPIYITIGDGGNLEGLATNMSEPQPAYSAFREASFGHATLAIKNRTHAY  430

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  V  D   ++N+FW
Sbjct  431  YSWHRNQDGYAVEADRIWVNNRFW  454



>ref|XP_006423399.1| hypothetical protein CICLE_v10028320mg [Citrus clementina]
 gb|ESR36639.1| hypothetical protein CICLE_v10028320mg [Citrus clementina]
Length=484

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 160/204 (78%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PY+AS ST   WY+I+RASA+IIVLS+YS + KYTPQ +WL EEL +V+R +TPWL
Sbjct  270  RYHVPYRASGSTAPFWYSIKRASAYIIVLSSYSAYGKYTPQNRWLEEELPKVNRSQTPWL  329

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR +YE WFVKYKVDVVFAGHVHAYERS R+SNI YNV 
Sbjct  330  IVLMHAPWYNSYNYHYMEGETMRVMYEPWFVKYKVDVVFAGHVHAYERSERVSNIAYNVV  389

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  PV D SAPVYIT+GDGGN EGLA    +PQP YSA+REAS+GH+  EIKNRTHA+
Sbjct  390  NGLCSPVKDLSAPVYITIGDGGNHEGLATNMTEPQPAYSAYREASFGHAIFEIKNRTHAY  449

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y WNRN DG  V  D+    N+FW
Sbjct  450  YGWNRNQDGYAVEADSMWFLNRFW  473



>ref|XP_010549271.1| PREDICTED: fe(3+)-Zn(2+) purple acid phosphatase 12 [Tarenaya 
hassleriana]
Length=471

 Score =   283 bits (725),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 160/204 (78%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTPY+AS ST+ +WY+++RAS+HIIVLS YS F KYTPQ+KWL +E  RVDR  TPWL
Sbjct  257  RYPTPYQASGSTSPMWYSVKRASSHIIVLSAYSSFGKYTPQYKWLEKEFRRVDRTVTPWL  316

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P Y+S V H+MEGE+MR +YE WFV+YKVD VFAGHVHAYERS R+SNI YN++
Sbjct  317  IVLVHCPFYSSYVHHYMEGETMRVMYEPWFVRYKVDAVFAGHVHAYERSERVSNIAYNIA  376

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G   P+ D SAPVYIT+GDGGN EGL      PQP YSA+REAS+GH  LE+KNRTHA 
Sbjct  377  NGKCEPIYDDSAPVYITIGDGGNLEGLVTEMTQPQPSYSAYREASFGHGILEVKNRTHAR  436

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + W+RN DG  V  D+  L N++W
Sbjct  437  FSWHRNQDGYSVEADSLWLRNRYW  460



>ref|XP_003527865.2| PREDICTED: purple acid phosphatase 2-like [Glycine max]
Length=474

 Score =   283 bits (725),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PY AS ST+ LWY+I+RAS +IIVLS+YS F KYTPQ+KWL +EL +V+R +TPWL
Sbjct  259  RYHLPYTASNSTSPLWYSIKRASTYIIVLSSYSAFGKYTPQYKWLVKELPKVNRTETPWL  318

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNS V H+MEGE++R +YE+WFV+YKVDVVFAGHVHAYERS R+SNI Y++ 
Sbjct  319  IVLMHSPMYNSYVNHYMEGETVRVLYEKWFVEYKVDVVFAGHVHAYERSKRVSNIAYSIV  378

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D+SAPVYIT+GDGGN EGLA    +PQP YSA+REAS+GH  L+IKNRTHA+
Sbjct  379  NGLHNPINDQSAPVYITIGDGGNIEGLATAMTEPQPSYSAYREASFGHGILDIKNRTHAY  438

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + WNRN DG  V  D+  L+N++W
Sbjct  439  FSWNRNQDGYAVVADSIWLYNRYW  462



>ref|XP_007201003.1| hypothetical protein PRUPE_ppa005275mg [Prunus persica]
 gb|EMJ02202.1| hypothetical protein PRUPE_ppa005275mg [Prunus persica]
Length=469

 Score =   283 bits (724),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 163/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PYKAS ST   WY+I+RASA+IIVLS+YS + KYTPQ+KWL +EL +V+R +TPWL
Sbjct  256  RYHVPYKASGSTAPFWYSIKRASAYIIVLSSYSAYGKYTPQYKWLEQELPKVNRSETPWL  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR +YE WFVKYKVDVVFAGHVHAYERS RISN+ YN+ 
Sbjct  316  IVLMHSPWYNSYNYHYMEGETMRVMYEPWFVKYKVDVVFAGHVHAYERSERISNVAYNIV  375

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +GI  PV D+SAPVYIT+GDGGN EGLA    +PQP YSA+REAS+GH+T +IKNRTHA+
Sbjct  376  NGICIPVKDQSAPVYITIGDGGNLEGLATNMTEPQPAYSAYREASFGHATFDIKNRTHAY  435

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  V  D+    N+++
Sbjct  436  YGWHRNQDGYAVTADSMWFFNRYY  459



>gb|KJB58171.1| hypothetical protein B456_009G197600 [Gossypium raimondii]
Length=416

 Score =   281 bits (720),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 161/204 (79%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PY AS ST+ LWY+I+RAS +IIVLS+YS +   TPQ+KWL  EL +V+R +TPWL
Sbjct  198  RYHVPYTASGSTSPLWYSIKRASTYIIVLSSYSAYGTSTPQYKWLERELPKVNRTETPWL  257

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS V H+MEGESMR ++E WFV+YKVDVVFAGHVHAYERS RISNI YN++
Sbjct  258  IVLMHSPFYNSYVHHYMEGESMRVMFEPWFVEYKVDVVFAGHVHAYERSERISNIAYNIA  317

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D SAPVY+T+GDGGN EGL     +PQP YSA+REAS+GH  LEIKNRTHA+
Sbjct  318  NGLCTPIKDPSAPVYLTIGDGGNLEGLVTEMTEPQPNYSAYREASFGHGILEIKNRTHAY  377

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + W+RN DG  V  D+  LHN++W
Sbjct  378  FGWHRNQDGYAVEADSLWLHNRYW  401



>gb|KHG20719.1| Purple acid phosphatase 2 [Gossypium arboreum]
Length=467

 Score =   283 bits (724),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 161/204 (79%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  P+ +S ST+ LWY+I+R SA++IVLS+YS + K TPQ+KWLR+EL +VDR KTPWL
Sbjct  253  RYYVPFASSHSTSPLWYSIKRGSAYLIVLSSYSAYGKSTPQYKWLRDELPKVDRSKTPWL  312

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            I LMH PIY SN  HFMEGE+MR V+E WFVKYKVDVVF+GHVHAYERS RISNI YN+ 
Sbjct  313  IALMHCPIYTSNSHHFMEGETMRVVFESWFVKYKVDVVFSGHVHAYERSKRISNIAYNIV  372

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  PV D+SAPVYIT+GDGGN +G A    +PQP +SA+REAS+GH   +IKNRTHA+
Sbjct  373  NGMCTPVDDQSAPVYITIGDGGNHDGPAIGMMEPQPNFSAYREASFGHGIFDIKNRTHAY  432

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + W+RN DG  V  D+F  HN +W
Sbjct  433  FSWHRNQDGYAVEADSFWFHNSYW  456



>ref|XP_011048849.1| PREDICTED: purple acid phosphatase 2-like isoform X1 [Populus 
euphratica]
Length=467

 Score =   283 bits (723),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PY+AS ST+ +WY+I+RAS ++IVLS+YS + KYTPQ+KWL  EL +V+R  TPWL
Sbjct  253  RYHVPYRASGSTSPMWYSIKRASTYVIVLSSYSAYGKYTPQYKWLETELPKVNRTATPWL  312

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P+YNS   H+MEGE+MR +YE WFVK+KVDVVFAGHVHAYERS RISN+ YN+ 
Sbjct  313  IVLMHCPMYNSYAHHYMEGETMRVMYEPWFVKFKVDVVFAGHVHAYERSERISNVAYNIV  372

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D+SAP+YIT+GDGGN EGL     +PQP YSAFRE S+GH  L+IKNRTHA+
Sbjct  373  NGLCTPIRDQSAPIYITIGDGGNLEGLVTSMTEPQPSYSAFREPSFGHGILDIKNRTHAY  432

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + W+RN DG  V  D+  LHN+FW
Sbjct  433  FGWHRNQDGYAVEADSVWLHNRFW  456



>ref|XP_004290282.1| PREDICTED: purple acid phosphatase [Fragaria vesca subsp. vesca]
Length=470

 Score =   283 bits (724),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TP+KAS ST   WY+I+RASAHIIVLS+YS + KYTPQ+ WL EEL +V+R +TPWL
Sbjct  256  RYRTPFKASGSTAPFWYSIKRASAHIIVLSSYSAYGKYTPQYSWLEEELPKVNRTETPWL  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P YNS   H+MEGE+MR +YE WFVKYKVDVVFAGHVHAYER+ RISNI YN+ 
Sbjct  316  IVLLHSPWYNSYNYHYMEGETMRVMYEAWFVKYKVDVVFAGHVHAYERTERISNIAYNIV  375

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +GI  PV D+SAPVYIT+GDGGN EGLA    +PQP YSAFREAS+GH+T  IKNRTHA+
Sbjct  376  NGICVPVKDQSAPVYITIGDGGNIEGLATNMTEPQPAYSAFREASFGHATFGIKNRTHAY  435

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  V  D+    N+++
Sbjct  436  YSWHRNQDGYAVEADSMWFFNRYY  459



>ref|XP_008377263.1| PREDICTED: purple acid phosphatase-like [Malus domestica]
Length=470

 Score =   283 bits (723),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PYKAS ST+  WY+I+RASA+IIVLS+YS + KYTPQ+KWL E L +V+R +TPWL
Sbjct  257  RYHVPYKASGSTSPFWYSIKRASAYIIVLSSYSAYGKYTPQYKWLEEXLPKVNRSETPWL  316

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR +YE WFVKYKVDVVFAGHVHAYERS R+SN+ YN+ 
Sbjct  317  IVLMHSPWYNSYNYHYMEGETMRVMYEPWFVKYKVDVVFAGHVHAYERSERVSNVAYNIV  376

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +GI  PV D+ APVYIT+GDGGN EGLA    +PQP+YSA+REAS+GH+TL+IKNRTHA+
Sbjct  377  NGICKPVKDQYAPVYITIGDGGNLEGLATNMTEPQPDYSAYREASFGHATLDIKNRTHAY  436

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  V  D+    N+F+
Sbjct  437  YSWHRNQDGYAVKADSMWFFNRFY  460



>ref|XP_009398390.1| PREDICTED: purple acid phosphatase 2-like [Musa acuminata subsp. 
malaccensis]
Length=466

 Score =   283 bits (723),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PY++S ST   WY+I+RASA+IIVL++YS + KYTPQ+KWL EEL +V+R +TPWL
Sbjct  254  RYHVPYRSSGSTAPFWYSIKRASAYIIVLASYSAYGKYTPQYKWLEEELPKVNRSETPWL  313

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGESMR +YE+WFV+ KVDVVFAGHVHAYERS+R+SNI YN+ 
Sbjct  314  IVLMHSPWYNSYNYHYMEGESMRVMYEQWFVQNKVDVVFAGHVHAYERSHRVSNIAYNIV  373

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G   PV D+SAPVYIT+GDGGN EGLA    +PQP YSAFREAS+GH+  EIKNRTHA+
Sbjct  374  NGKCKPVRDESAPVYITIGDGGNLEGLASNMSEPQPSYSAFREASFGHAVFEIKNRTHAY  433

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  VA D+   +N++W
Sbjct  434  YTWHRNQDGDAVAADSMWFYNRYW  457



>ref|XP_006423402.1| hypothetical protein CICLE_v10028369mg [Citrus clementina]
 gb|ESR36642.1| hypothetical protein CICLE_v10028369mg [Citrus clementina]
Length=401

 Score =   280 bits (717),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 158/204 (77%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PY+AS ST   WY+I+RAS +IIVLS+YS + KYTPQ+KWL EEL +V+R +TPWL
Sbjct  187  RYHVPYRASGSTAPFWYSIKRASVYIIVLSSYSAYGKYTPQYKWLEEELPKVNRSETPWL  246

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR +YE W VKYKVDVVFAGHVHAYERS R+SNI YNV 
Sbjct  247  IVLMHAPWYNSYNYHYMEGETMRVMYEPWLVKYKVDVVFAGHVHAYERSERVSNIAYNVV  306

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  PV D SAPVYI +GDGGN EGLA    +PQP YSA+REAS+GH+  EIKNRTHA+
Sbjct  307  NGLCSPVKDLSAPVYIIIGDGGNLEGLATNMTEPQPAYSAYREASFGHAIFEIKNRTHAY  366

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y WNRN DG  V  D+    N+FW
Sbjct  367  YGWNRNQDGYAVEADSMWFLNRFW  390



>ref|XP_004963326.1| PREDICTED: purple acid phosphatase 2-like [Setaria italica]
Length=459

 Score =   282 bits (722),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYPTPY+A+ ST   WY+++ ASAH+IVL++YS + KYTPQW WL++EL RVDR+ TPWL
Sbjct  249  RYPTPYRAAGSTEPFWYSVKIASAHVIVLASYSAYGKYTPQWTWLQDELKRVDRKTTPWL  308

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            +VLMH P YNSN  H+MEGE+MR  +E+W V  K D+V AGHVHAYERS+R+SN+ Y++ 
Sbjct  309  LVLMHSPWYNSNGYHYMEGETMRVQFEQWLVDAKADLVLAGHVHAYERSHRVSNVAYDIV  368

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G + PV D+ APVY+T+GDGGN EG+A  F  PQP YSAFREAS+GH+TLEIKNRTHA+
Sbjct  369  NGKSTPVRDQGAPVYVTIGDGGNIEGIADNFTRPQPSYSAFREASFGHATLEIKNRTHAY  428

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG +V  D   L N++W
Sbjct  429  YAWHRNQDGAKVVADGLWLTNRYW  452



>gb|ABV89741.1| purple acid phosphatase 12 protein family isoform 2 [Brassica 
napus]
 gb|ABV89742.1| purple acid phosphatase 12 protein family isoform 2 [Brassica 
napus]
Length=469

 Score =   283 bits (723),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPYKAS S + LWY+I+RASA+IIV+S YS +  YTPQ+KWL++E  RV+R +TPWL
Sbjct  255  RYHTPYKASGSISPLWYSIKRASAYIIVMSCYSSYGVYTPQYKWLQQEFQRVNRTETPWL  314

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P Y+S V H+MEGE+MR +YE+WFVK KVDVVFAGHVHAYERS R+SNI YN+ 
Sbjct  315  IVLVHCPFYHSYVHHYMEGETMRVLYEQWFVKSKVDVVFAGHVHAYERSERVSNIAYNIV  374

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D+SAPVYIT+GDGGN EGL      PQP YSAFRE S+GH  L+IKNRTHA+
Sbjct  375  NGLCEPISDESAPVYITIGDGGNSEGLLTDMMQPQPSYSAFREPSFGHGLLDIKNRTHAY  434

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            ++WNRN DG  V  D+  L N+FW
Sbjct  435  FNWNRNQDGSSVEADSVWLLNRFW  458



>ref|XP_008236957.1| PREDICTED: purple acid phosphatase-like [Prunus mume]
Length=469

 Score =   282 bits (722),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 163/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PYKAS ST   WY+++RASA+IIVLS+YS + KYTPQ+KWL +EL +V+R +TPWL
Sbjct  256  RYHVPYKASGSTAPFWYSVKRASAYIIVLSSYSAYGKYTPQYKWLEQELPKVNRSETPWL  315

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR +YE WFVKYKVDVVFAGHVHAYERS RISN+ YN+ 
Sbjct  316  IVLMHSPWYNSYNYHYMEGETMRVMYEPWFVKYKVDVVFAGHVHAYERSERISNVAYNIV  375

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +GI  PV D+SAPVYIT+GDGGN EGLA    +PQP YSA+REAS+GH+T +IKNRTHA+
Sbjct  376  NGICIPVKDQSAPVYITIGDGGNLEGLATNMTEPQPAYSAYREASFGHATFDIKNRTHAY  435

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  V  D+    N+++
Sbjct  436  YGWHRNQDGYAVTVDSMWFFNRYY  459



>ref|XP_009408475.1| PREDICTED: purple acid phosphatase 2-like [Musa acuminata subsp. 
malaccensis]
Length=459

 Score =   282 bits (721),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PY++S ST   WY+I+RASA+IIVL++YS + KYTPQ++WL  EL +V+R +TPWL
Sbjct  254  RYHVPYRSSGSTAPFWYSIKRASAYIIVLASYSAYGKYTPQYQWLEAELPKVNRSETPWL  313

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGESMR ++E WFVK KVDVVFAGHVHAYERS+R+SNI YN+ 
Sbjct  314  IVLMHSPWYNSYNYHYMEGESMRVMFEPWFVKNKVDVVFAGHVHAYERSHRVSNIAYNIV  373

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G   PVPD+SAPVYIT+GDGGN EGLA    +PQP+YSAFREAS+GH+  EIKNRTHA+
Sbjct  374  NGKCKPVPDESAPVYITIGDGGNLEGLANNMTEPQPDYSAFREASFGHAIFEIKNRTHAY  433

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  VA D+   +N++W
Sbjct  434  YTWHRNQDGNAVAADSMWFYNRYW  457



>ref|XP_002512962.1| Purple acid phosphatase precursor, putative [Ricinus communis]
 gb|EEF49465.1| Purple acid phosphatase precursor, putative [Ricinus communis]
Length=467

 Score =   282 bits (722),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 160/204 (78%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PYKAS ST   WY+I+RASA+IIVLS+YS + KYTPQ++WL EE  +V+R +TPWL
Sbjct  253  RYHVPYKASGSTTPFWYSIKRASAYIIVLSSYSAYGKYTPQYEWLEEEFPKVNRTETPWL  312

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR +YE WFVKYKVDVVFAGHVHAYERS RISN+ YN+ 
Sbjct  313  IVLMHSPWYNSYNYHYMEGETMRVMYEPWFVKYKVDVVFAGHVHAYERSERISNVAYNIV  372

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G   PV DKSAPVYIT+GDGGN EGLA    DPQP YSA+REAS+GH+  +IKNRTHA+
Sbjct  373  NGKCSPVEDKSAPVYITIGDGGNLEGLATNMTDPQPAYSAYREASFGHAIFDIKNRTHAY  432

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  V  D    +N++W
Sbjct  433  YSWHRNQDGYAVEADTMWFYNRYW  456



>emb|CDP19119.1| unnamed protein product [Coffea canephora]
Length=459

 Score =   282 bits (721),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PYKASKS++ LWY+I+RAS +IIVLS+YS + KYTPQ+ WL++E  +V+R++TPWL
Sbjct  244  RYELPYKASKSSSPLWYSIKRASTYIIVLSSYSAYAKYTPQYDWLQKEFPKVNRKETPWL  303

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P YNSN  H+MEGESMR ++E WFV+ KVD+VFAGHVH YERS RISN+ YN++
Sbjct  304  IVLLHSPWYNSNNYHYMEGESMRVMFESWFVENKVDIVFAGHVHCYERSERISNVRYNIT  363

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
             G++ P+ D SAPVYIT GDGGN EG+A  F DPQP YSA+REAS+GH+ LEIKNRTHA+
Sbjct  364  DGLSTPIKDASAPVYITTGDGGNIEGIANNFIDPQPSYSAYREASFGHAILEIKNRTHAY  423

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN D   VA D+   +N++W
Sbjct  424  YTWHRNQDNMPVAADSMWFYNRYW  447



>gb|ABV89739.1| purple acid phosphatase 12 protein family isoform 1 [Brassica 
napus]
 gb|ABV89740.1| purple acid phosphatase 12 protein family isoform 1 [Brassica 
napus]
Length=469

 Score =   282 bits (722),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPYKAS S + LWY+I+RASA+IIV+S YS +  YTPQ+KWL++E  RV+R +TPWL
Sbjct  255  RYHTPYKASGSISPLWYSIKRASAYIIVMSCYSSYGVYTPQYKWLQQEFQRVNRTETPWL  314

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P Y+S V H+MEGE+MR +YE+WFVK KVDVVFAGHVHAYERS R+SNI YN+ 
Sbjct  315  IVLVHCPFYHSYVHHYMEGETMRVLYEQWFVKSKVDVVFAGHVHAYERSKRVSNIAYNLV  374

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D+SAPVYIT+GDGGN EGL      PQP YSAFRE S+GH  L+IKNRTHA+
Sbjct  375  NGLCEPISDESAPVYITIGDGGNSEGLLTDMMQPQPSYSAFREPSFGHGLLDIKNRTHAY  434

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            ++WNRN DG  V  D+  L N+FW
Sbjct  435  FNWNRNQDGSSVEADSVWLLNRFW  458



>ref|XP_010028628.1| PREDICTED: purple acid phosphatase 2-like [Eucalyptus grandis]
Length=497

 Score =   283 bits (724),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 163/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PY+ S ST   WY+I+RASA+IIVLS+YS + KYTPQ+KWL EEL +VDR +TPWL
Sbjct  285  RYHVPYRKSNSTAPFWYSIKRASAYIIVLSSYSAYGKYTPQYKWLEEELKKVDRTETPWL  344

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IV+MH P YNS   H+MEGE+MR ++E WFVKYKVDVVFAGHVHAYERS R+SNI YN+ 
Sbjct  345  IVMMHSPWYNSYNYHYMEGETMRVMFEPWFVKYKVDVVFAGHVHAYERSERVSNIAYNIV  404

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  PV D+SAPVYIT+GDGGN EGLA    +PQP+YSA+REAS+GH+  +IKNRTHA+
Sbjct  405  NGLCIPVHDQSAPVYITIGDGGNLEGLATNMTEPQPKYSAYREASFGHAMFDIKNRTHAY  464

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y+W+RN DG  V  D+    N+FW
Sbjct  465  YNWHRNQDGYAVEADSMWFFNRFW  488



>ref|XP_007017662.1| Purple acid phosphatase 10 isoform 1 [Theobroma cacao]
 gb|EOY14887.1| Purple acid phosphatase 10 isoform 1 [Theobroma cacao]
Length=467

 Score =   282 bits (721),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 163/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PY++S ST+ LWY+I+RASA++IVLS+YS + K TPQ+KWL +EL +VDR +TPWL
Sbjct  253  RYYVPYESSHSTSPLWYSIKRASAYVIVLSSYSAYGKSTPQYKWLSDELPKVDRSETPWL  312

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            I+LMH PIYNSN  H+MEGESMR VYE WFVKYKVDVVFAGHVHAYERS R+SNI YN+ 
Sbjct  313  ILLMHCPIYNSNSHHYMEGESMRVVYESWFVKYKVDVVFAGHVHAYERSKRVSNIAYNIV  372

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  PV D+SAPVYIT+GDGGN +G A    +PQP +SA+REAS+GH   ++KNRTHA 
Sbjct  373  NGMCTPVNDQSAPVYITIGDGGNHDGPAIGMVEPQPSFSAYREASFGHGIFDVKNRTHAC  432

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            + W+RN DG+    D+   HN++W
Sbjct  433  FSWHRNQDGRATEADSLWFHNRYW  456



>gb|KCW55391.1| hypothetical protein EUGRSUZ_I01302 [Eucalyptus grandis]
Length=474

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 163/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PY+ S ST   WY+I+RASA+IIVLS+YS + KYTPQ+KWL EEL +VDR +TPWL
Sbjct  262  RYHVPYRKSNSTAPFWYSIKRASAYIIVLSSYSAYGKYTPQYKWLEEELKKVDRTETPWL  321

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IV+MH P YNS   H+MEGE+MR ++E WFVKYKVDVVFAGHVHAYERS R+SNI YN+ 
Sbjct  322  IVMMHSPWYNSYNYHYMEGETMRVMFEPWFVKYKVDVVFAGHVHAYERSERVSNIAYNIV  381

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  PV D+SAPVYIT+GDGGN EGLA    +PQP+YSA+REAS+GH+  +IKNRTHA+
Sbjct  382  NGLCIPVHDQSAPVYITIGDGGNLEGLATNMTEPQPKYSAYREASFGHAMFDIKNRTHAY  441

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y+W+RN DG  V  D+    N+FW
Sbjct  442  YNWHRNQDGYAVEADSMWFFNRFW  465



>ref|XP_009614460.1| PREDICTED: purple acid phosphatase 2-like [Nicotiana tomentosiformis]
Length=466

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PY+AS ST+ LWY+I+RASA+IIVLS+YS + KYTPQ+KWL EEL +V+R +TPWL
Sbjct  251  RYHVPYRASNSTSPLWYSIKRASAYIIVLSSYSAYGKYTPQYKWLEEELPKVNRTETPWL  310

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P YNS   H+MEGE+MR +YE WFVKYKVD+VFAGHVHAYER+ RISN+ YNV 
Sbjct  311  IVLLHSPWYNSYNYHYMEGETMRVMYEPWFVKYKVDIVFAGHVHAYERTERISNVAYNVV  370

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G   P+ D+SAP+Y+T+GDGGN EGLA    +PQP YSAFREAS+GH+TL IKNRTHA+
Sbjct  371  NGECTPIRDQSAPIYVTIGDGGNLEGLATNMTEPQPAYSAFREASFGHATLAIKNRTHAY  430

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  V  D   ++N+ W
Sbjct  431  YSWHRNQDGYAVEADKIWVNNRIW  454



>ref|NP_176033.1| purple acid phosphatase 6 [Arabidopsis thaliana]
 sp|Q9C510.1|PPA6_ARATH RecName: Full=Purple acid phosphatase 6; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG50924.1|AC069159_25 purple acid phosphatase, putative [Arabidopsis thaliana]
 gb|AAG51511.1|AC058785_14 purple acid phosphatase, putative [Arabidopsis thaliana]
 gb|ABE65716.1| calcineurin-like phosphoesterase family protein [Arabidopsis 
thaliana]
 gb|ABH04466.1| At1g56360 [Arabidopsis thaliana]
 gb|AEE33383.1| purple acid phosphatase 6 [Arabidopsis thaliana]
Length=466

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 164/202 (81%), Gaps = 0/202 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RYP  YKAS+ST+ LWY++RRASAHIIVLS+YS + KYTPQ+ WL +EL  V+RE+TPWL
Sbjct  250  RYPNAYKASQSTSPLWYSVRRASAHIIVLSSYSAYGKYTPQYIWLEQELKNVNREETPWL  309

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IV++H P YNSN  H+MEGESMR ++E W V  KVD+V +GHVHAYERS RISNI YN++
Sbjct  310  IVIVHSPWYNSNNYHYMEGESMRVMFESWLVNSKVDLVLSGHVHAYERSERISNIKYNIT  369

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G++ PV D +AP+YIT+GDGGN EG+A  F DPQP YSA+REAS+GH+ LEI NRTHA 
Sbjct  370  NGLSSPVKDPNAPIYITIGDGGNIEGIANSFVDPQPSYSAYREASFGHAVLEIMNRTHAQ  429

Query  380  YHWNRNDDGKRVATDAFVLHNQ  315
            Y W+RN D + VA D+ +LHN+
Sbjct  430  YTWHRNQDNEPVAADSIMLHNR  451



>gb|ABV89757.1| purple acid phosphatase 12 protein family isoform 7 [Brassica 
napus]
 gb|ABV89759.1| purple acid phosphatase 12 protein family isoform 7 [Brassica 
napus]
Length=469

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPYKAS S + LWY+I+RASA+IIV+S YS +  YTPQ+KWL++E  RV+R +TPWL
Sbjct  255  RYHTPYKASGSISPLWYSIKRASAYIIVMSCYSSYGVYTPQYKWLQQEFQRVNRTETPWL  314

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P Y+S V H+MEGE+MR +YE+WFVK KVDVVFAGHVHAYERS R+SNI YN+ 
Sbjct  315  IVLVHCPFYHSYVHHYMEGETMRVLYEQWFVKAKVDVVFAGHVHAYERSKRVSNIAYNLV  374

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D+SAPVYIT+GDGGN EGL      PQP YSAFRE S+GH  L+IKNRTHA+
Sbjct  375  NGLCEPISDESAPVYITIGDGGNSEGLLTDMMQPQPSYSAFREPSFGHGLLDIKNRTHAY  434

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            ++WNRN DG  V  D+  L N+FW
Sbjct  435  FNWNRNQDGSSVEADSVWLLNRFW  458



>emb|CDY48179.1| BnaA04g15430D [Brassica napus]
Length=469

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPYKAS S + LWY+I+RASA+IIV+S YS +  YTPQ+KWL++E  RV+R +TPWL
Sbjct  255  RYHTPYKASGSISPLWYSIKRASAYIIVMSCYSSYGVYTPQYKWLQQEFQRVNRTETPWL  314

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P Y+S V H+MEGE+MR +YE+WFVK KVDVVFAGHVHAYERS R+SNI YN+ 
Sbjct  315  IVLVHCPFYHSYVHHYMEGETMRVMYEQWFVKSKVDVVFAGHVHAYERSKRVSNIAYNLV  374

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D+SAPVYIT+GDGGN EGL      PQP YSAFRE S+GH  L+IKNRTHA+
Sbjct  375  NGLCEPISDESAPVYITIGDGGNSEGLLTDMMQPQPSYSAFREPSFGHGLLDIKNRTHAY  434

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            ++WNRN DG  V  D+  L N+FW
Sbjct  435  FNWNRNQDGSSVEADSVWLLNRFW  458



>ref|XP_009140744.1| PREDICTED: fe(3+)-Zn(2+) purple acid phosphatase 12 [Brassica 
rapa]
Length=469

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 162/204 (79%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY TPYKAS S + LWY+I+RASA+IIV+S YS +  YTPQ+KWL++E  RV+R +TPWL
Sbjct  255  RYHTPYKASGSISPLWYSIKRASAYIIVMSCYSSYGVYTPQYKWLQQEFQRVNRTETPWL  314

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVL+H P Y+S V H+MEGE+MR +YE+WFVK KVDVVFAGHVHAYERS R+SNI YN+ 
Sbjct  315  IVLVHCPFYHSYVHHYMEGETMRVLYEQWFVKSKVDVVFAGHVHAYERSKRVSNIAYNLV  374

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  P+ D+SAPVYIT+GDGGN EGL      PQP YSAFRE S+GH  L+IKNRTHA+
Sbjct  375  NGLCEPISDESAPVYITIGDGGNSEGLLTDMMQPQPSYSAFREPSFGHGLLDIKNRTHAY  434

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            ++WNRN DG  V  D+  L N+FW
Sbjct  435  FNWNRNQDGSSVEADSVWLLNRFW  458



>ref|NP_001240926.1| uncharacterized protein LOC100807555 precursor [Glycine max]
 gb|ADM32496.1| phytase [Glycine max]
 gb|KHN32421.1| Purple acid phosphatase [Glycine soja]
Length=464

 Score =   281 bits (720),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 163/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  920  RYPTPYKASKSTNQLWYAIRRASAHIIVLSTYSPFVKYTPQWKWLREELTRVDREKTPWL  741
            RY  PYKAS+ST+  WY+I+RASAHIIVL++YS + KYTPQ+KWL +EL +V+R +TPWL
Sbjct  249  RYHVPYKASQSTSPFWYSIKRASAHIIVLASYSAYGKYTPQYKWLEKELPKVNRTETPWL  308

Query  740  IVLMHVPIYNSNVAHFMEGESMRTVYEEWFVKYKVDVVFAGHVHAYERSYRISNIHYNVS  561
            IVLMH P YNS   H+MEGE+MR +YE WFV+YKVDVVFAGHVHAYERS R+SN+ YN+ 
Sbjct  309  IVLMHSPWYNSYNYHYMEGETMRVMYEPWFVQYKVDVVFAGHVHAYERSERVSNVAYNIV  368

Query  560  SGIAYPVPDKSAPVYITVGDGGNQEGLAGRFRDPQPEYSAFREASYGHSTLEIKNRTHAF  381
            +G+  PV DKSAPVYIT+GDGGN EGLA    +PQP+YSAFREAS+GH+  +I NRTHA 
Sbjct  369  NGLCAPVNDKSAPVYITIGDGGNLEGLATNMTEPQPKYSAFREASFGHAIFDITNRTHAH  428

Query  380  YHWNRNDDGKRVATDAFVLHNQFW  309
            Y W+RN DG  V  D+    N++W
Sbjct  429  YSWHRNQDGVAVEADSLWFFNRYW  452



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2172931915458