BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4039

Length=850
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU36436.1|  hypothetical protein MIMGU_mgv1a014341mg                328   5e-110   Erythranthe guttata [common monkey flower]
ref|XP_010112882.1|  hypothetical protein L484_017718                   330   3e-108   Morus notabilis
ref|XP_011074286.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    330   3e-108   Sesamum indicum [beniseed]
ref|XP_008229748.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    329   8e-108   Prunus mume [ume]
ref|XP_007215619.1|  hypothetical protein PRUPE_ppa007922mg             328   1e-107   Prunus persica
gb|KDO64247.1|  hypothetical protein CISIN_1g022650mg                   320   5e-107   Citrus sinensis [apfelsine]
ref|XP_009591169.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    327   5e-107   Nicotiana tomentosiformis
ref|XP_009771009.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    326   7e-107   Nicotiana sylvestris
ref|XP_002522591.1|  Endoplasmic reticulum-Golgi intermediate com...    319   2e-106   
ref|XP_006429689.1|  hypothetical protein CICLE_v10012850mg             318   5e-106   
ref|XP_002307923.1|  hypothetical protein POPTR_0006s02470g             324   6e-106   Populus trichocarpa [western balsam poplar]
ref|XP_011040642.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    323   1e-105   Populus euphratica
ref|XP_009787019.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    323   2e-105   Nicotiana sylvestris
gb|KDO64243.1|  hypothetical protein CISIN_1g022650mg                   319   8e-105   Citrus sinensis [apfelsine]
ref|XP_007048889.1|  Endoplasmic reticulum vesicle transporter pr...    320   1e-104   
ref|XP_006481288.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    320   1e-104   Citrus sinensis [apfelsine]
ref|XP_004243621.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    320   1e-104   Solanum lycopersicum
ref|XP_010036056.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    320   2e-104   Eucalyptus grandis [rose gum]
ref|XP_007048888.1|  Endoplasmic reticulum vesicle transporter pr...    320   2e-104   Theobroma cacao [chocolate]
ref|XP_008342279.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    319   4e-104   
ref|XP_010656946.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    319   4e-104   Vitis vinifera
ref|XP_011467640.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    317   3e-103   Fragaria vesca subsp. vesca
ref|XP_004303918.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    317   3e-103   Fragaria vesca subsp. vesca
ref|XP_009377930.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    317   4e-103   Pyrus x bretschneideri [bai li]
ref|XP_008380042.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    317   4e-103   
ref|XP_010314961.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    316   6e-103   Solanum lycopersicum
ref|XP_010313686.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    316   6e-103   Solanum lycopersicum
ref|XP_012081271.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    315   1e-102   Jatropha curcas
emb|CDP16085.1|  unnamed protein product                                315   2e-102   Coffea canephora [robusta coffee]
ref|XP_007145973.1|  hypothetical protein PHAVU_006G002400g             315   3e-102   Phaseolus vulgaris [French bean]
ref|XP_010245571.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    314   3e-102   Nelumbo nucifera [Indian lotus]
ref|XP_002322569.2|  hypothetical protein POPTR_0016s02310g             315   3e-102   
ref|XP_011008533.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    314   6e-102   Populus euphratica
ref|XP_011010108.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    313   7e-102   Populus euphratica
ref|XP_010245563.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    315   8e-102   Nelumbo nucifera [Indian lotus]
ref|XP_003542168.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    311   8e-101   Glycine max [soybeans]
ref|XP_006351995.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    311   8e-101   Solanum tuberosum [potatoes]
ref|XP_004502082.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    310   1e-100   Cicer arietinum [garbanzo]
ref|XP_010688789.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    311   2e-100   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB40581.1|  hypothetical protein B456_007G069900                    309   3e-100   Gossypium raimondii
ref|XP_006605681.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    309   5e-100   Glycine max [soybeans]
ref|XP_010525178.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    309   5e-100   Tarenaya hassleriana [spider flower]
ref|XP_010525179.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    309   5e-100   Tarenaya hassleriana [spider flower]
gb|KHG20152.1|  Endoplasmic reticulum-Golgi intermediate compartm...    302   7e-100   Gossypium arboreum [tree cotton]
ref|XP_008463181.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    308   7e-100   Cucumis melo [Oriental melon]
gb|KJB75348.1|  hypothetical protein B456_012G039800                    306   1e-99    Gossypium raimondii
gb|ACU19028.1|  unknown                                                 307   2e-99    Glycine max [soybeans]
gb|KJB75343.1|  hypothetical protein B456_012G039800                    307   2e-99    Gossypium raimondii
ref|XP_009408557.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    306   4e-99    
gb|KEH35189.1|  endoplasmic reticulum vesicle transporter               306   6e-99    Medicago truncatula
ref|XP_002458688.1|  hypothetical protein SORBIDRAFT_03g038260          306   7e-99    Sorghum bicolor [broomcorn]
ref|XP_011655240.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    305   1e-98    Cucumis sativus [cucumbers]
ref|XP_009145393.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    305   1e-98    Brassica rapa
gb|KJB75344.1|  hypothetical protein B456_012G039800                    306   1e-98    Gossypium raimondii
ref|XP_006858296.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    305   2e-98    Amborella trichopoda
ref|NP_001051473.1|  Os03g0784400                                       304   4e-98    
gb|EEC76283.1|  hypothetical protein OsI_13786                          303   5e-98    Oryza sativa Indica Group [Indian rice]
ref|XP_004982677.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    303   7e-98    Setaria italica
ref|XP_006650685.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    303   1e-97    Oryza brachyantha
ref|XP_003558212.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    302   2e-97    Brachypodium distachyon [annual false brome]
ref|NP_001131002.1|  DUF1692 domain, endoplasmic reticulum vescic...    299   4e-97    Zea mays [maize]
ref|XP_009135799.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    301   5e-97    Brassica rapa
ref|XP_008654279.1|  PREDICTED: DUF1692 domain, endoplasmic retic...    300   1e-96    Zea mays [maize]
emb|CDY24301.1|  BnaC03g42740D                                          300   2e-96    Brassica napus [oilseed rape]
ref|XP_002883352.1|  hypothetical protein ARALYDRAFT_479742             300   2e-96    
ref|XP_010923701.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    299   3e-96    Elaeis guineensis
ref|XP_010923699.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    299   3e-96    Elaeis guineensis
ref|XP_010466507.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    299   3e-96    Camelina sativa [gold-of-pleasure]
emb|CDY37404.1|  BnaC05g30260D                                          299   3e-96    Brassica napus [oilseed rape]
ref|XP_006298011.1|  hypothetical protein CARUB_v10014056mg             298   6e-96    Capsella rubella
ref|XP_010532527.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    298   8e-96    Tarenaya hassleriana [spider flower]
ref|XP_010511216.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    298   8e-96    Camelina sativa [gold-of-pleasure]
ref|XP_006406186.1|  hypothetical protein EUTSA_v10021173mg             296   1e-95    
ref|XP_008794432.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    298   1e-95    Phoenix dactylifera
ref|XP_006406187.1|  hypothetical protein EUTSA_v10021173mg             296   1e-95    
ref|NP_188868.2|  Endoplasmic reticulum vesicle transporter protein     297   2e-95    Arabidopsis thaliana [mouse-ear cress]
gb|KJB75346.1|  hypothetical protein B456_012G039800                    295   8e-95    Gossypium raimondii
dbj|BAJ84787.1|  predicted protein                                      295   9e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS71314.1|  hypothetical protein M569_03444                         295   1e-94    Genlisea aurea
ref|XP_009407709.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    295   2e-94    Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT22267.1|  hypothetical protein F775_30192                         296   2e-94    
gb|KJB75347.1|  hypothetical protein B456_012G039800                    295   3e-94    Gossypium raimondii
gb|KJB75349.1|  hypothetical protein B456_012G039800                    296   3e-94    Gossypium raimondii
gb|EMS49840.1|  hypothetical protein TRIUR3_11686                       296   1e-92    Triticum urartu
ref|XP_008348329.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    278   2e-89    
gb|KDO37536.1|  hypothetical protein CISIN_1g041965mg                   271   1e-87    Citrus sinensis [apfelsine]
dbj|BAB17274.1|  unnamed protein product                                272   6e-86    Arabidopsis thaliana [mouse-ear cress]
gb|AFK38705.1|  unknown                                                 261   2e-84    Medicago truncatula
gb|KJB75345.1|  hypothetical protein B456_012G039800                    263   1e-82    Gossypium raimondii
ref|XP_001754824.1|  predicted protein                                  251   9e-78    
ref|XP_002993277.1|  hypothetical protein SELMODRAFT_431378             243   1e-74    
ref|XP_004959338.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    194   3e-56    
ref|XP_005651581.1|  DUF1692-domain-containing protein                  190   4e-54    Coccomyxa subellipsoidea C-169
ref|XP_005826990.1|  hypothetical protein GUITHDRAFT_154283             161   4e-43    Guillardia theta CCMP2712
ref|XP_009608372.1|  PREDICTED: probable endoplasmic reticulum-Go...    141   3e-36    Nicotiana tomentosiformis
ref|XP_008804335.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    143   5e-36    
ref|XP_008804334.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    143   5e-36    Phoenix dactylifera
ref|XP_004355625.1|  endoplasmic reticulum-golgi intermediate com...    142   6e-36    Cavenderia fasciculata
gb|EYU18489.1|  hypothetical protein MIMGU_mgv1a008051mg                142   1e-35    Erythranthe guttata [common monkey flower]
ref|XP_005839166.1|  hypothetical protein GUITHDRAFT_65491              143   1e-35    Guillardia theta CCMP2712
ref|XP_002285801.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    141   3e-35    
gb|EEE61111.1|  hypothetical protein OsJ_15023                          140   3e-35    Oryza sativa Japonica Group [Japonica rice]
emb|CAE02574.2|  OSJNBa0006M15.17                                       141   4e-35    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010934993.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    141   4e-35    Elaeis guineensis
ref|XP_005232398.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    138   8e-35    
ref|XP_005534206.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    140   9e-35    
ref|XP_001759631.1|  predicted protein                                  139   1e-34    
ref|XP_005438238.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    138   1e-34    
gb|KDO64244.1|  hypothetical protein CISIN_1g022650mg                   135   1e-34    Citrus sinensis [apfelsine]
gb|EMS52396.1|  hypothetical protein TRIUR3_27593                       139   2e-34    Triticum urartu
ref|XP_002958233.1|  hypothetical protein VOLCADRAFT_69193              138   2e-34    Volvox carteri f. nagariensis
ref|XP_005534205.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    139   2e-34    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_010239982.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    137   2e-34    
ref|XP_008802686.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    138   2e-34    
ref|XP_006033884.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    138   3e-34    
gb|KFO97972.1|  Endoplasmic reticulum-Golgi intermediate compartm...    137   3e-34    Calypte anna
ref|XP_007042992.1|  Endoplasmic reticulum vesicle transporter pr...    138   3e-34    
ref|XP_008802685.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    138   4e-34    Phoenix dactylifera
ref|XP_008504578.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    138   4e-34    Calypte anna
ref|XP_006266817.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    138   4e-34    Alligator mississippiensis
dbj|BAJ87561.1|  predicted protein                                      137   6e-34    Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA57059.1|  TPA: hypothetical protein ZEAMMB73_408305              129   8e-34    
ref|XP_002191084.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    137   8e-34    Taeniopygia guttata
ref|XP_009559309.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    137   8e-34    Cuculus canorus
dbj|BAK05850.1|  predicted protein                                      137   8e-34    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003579883.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    137   9e-34    Brachypodium distachyon [annual false brome]
gb|KFO76211.1|  Endoplasmic reticulum-Golgi intermediate compartm...    136   9e-34    Cuculus canorus
ref|NP_001148795.1|  LOC100282412                                       137   1e-33    Zea mays [maize]
ref|XP_001690702.1|  hypothetical protein CHLREDRAFT_180779             139   1e-33    Chlamydomonas reinhardtii
ref|XP_002439992.1|  hypothetical protein SORBIDRAFT_09g023960          137   1e-33    Sorghum bicolor [broomcorn]
ref|XP_008932726.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    136   1e-33    
gb|KFO52827.1|  Endoplasmic reticulum-Golgi intermediate compartm...    136   1e-33    Corvus brachyrhynchos
gb|KFW74284.1|  Endoplasmic reticulum-Golgi intermediate compartm...    136   1e-33    Manacus vitellinus
gb|ACN35132.1|  unknown                                                 137   1e-33    Zea mays [maize]
ref|XP_002447951.1|  hypothetical protein SORBIDRAFT_06g018670          137   1e-33    Sorghum bicolor [broomcorn]
ref|XP_008627777.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    136   1e-33    
ref|XP_009917276.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   1e-33    Haliaeetus albicilla
ref|XP_010411485.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    136   1e-33    
ref|XP_010019924.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    135   1e-33    Nestor notabilis
ref|XP_002264644.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    136   2e-33    Vitis vinifera
ref|XP_005428461.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    135   2e-33    
ref|XP_008568949.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    136   2e-33    Galeopterus variegatus [Malayan flying lemur]
ref|XP_010198765.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    135   2e-33    Colius striatus
gb|KFV71275.1|  Endoplasmic reticulum-Golgi intermediate compartm...    135   2e-33    Picoides pubescens
gb|AFW82389.1|  putative DUF1692 domain containing protein              140   2e-33    
gb|AFW85973.1|  putative DUF1692 domain containing protein              140   2e-33    
dbj|GAM20914.1|  hypothetical protein SAMD00019534_040890               136   2e-33    Acytostelium subglobosum LB1
gb|KEH31232.1|  endoplasmic reticulum vesicle transporter               134   2e-33    Medicago truncatula
emb|CDP01031.1|  unnamed protein product                                134   2e-33    Coffea canephora [robusta coffee]
ref|XP_009369662.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    136   2e-33    Pyrus x bretschneideri [bai li]
gb|EPS71395.1|  hypothetical protein M569_03362                         136   2e-33    Genlisea aurea
ref|XP_003568216.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    136   2e-33    Brachypodium distachyon [annual false brome]
ref|NP_001132255.1|  DUF1692 domain, endoplasmic reticulum vescic...    136   2e-33    Zea mays [maize]
gb|KFQ56065.1|  Endoplasmic reticulum-Golgi intermediate compartm...    135   2e-33    Nestor notabilis
ref|XP_009097046.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    136   2e-33    
ref|XP_008378547.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    136   2e-33    Malus domestica [apple tree]
gb|KFP23539.1|  Endoplasmic reticulum-Golgi intermediate compartm...    135   2e-33    Colius striatus
ref|XP_008568816.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    136   2e-33    Galeopterus variegatus [Malayan flying lemur]
ref|XP_006652356.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    136   2e-33    Oryza brachyantha
gb|KFQ65052.1|  Endoplasmic reticulum-Golgi intermediate compartm...    135   2e-33    Pelecanus crispus
ref|XP_008568883.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    136   2e-33    Galeopterus variegatus [Malayan flying lemur]
ref|XP_009373163.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    136   2e-33    Pyrus x bretschneideri [bai li]
ref|XP_005774403.1|  hypothetical protein EMIHUDRAFT_430522             136   3e-33    Emiliania huxleyi CCMP1516
ref|XP_005496545.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    135   3e-33    Zonotrichia albicollis
ref|XP_011464591.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    135   3e-33    Fragaria vesca subsp. vesca
ref|XP_009578622.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    130   3e-33    Fulmarus glacialis
ref|XP_009708266.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    130   3e-33    Cariama cristata
ref|XP_010105897.1|  hypothetical protein L484_021555                   135   3e-33    Morus notabilis
gb|AFW78473.1|  DUF1692 domain, endoplasmic reticulum vescicle tr...    133   3e-33    
ref|XP_005147588.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    135   3e-33    Melopsittacus undulatus
gb|ETE61956.1|  Endoplasmic reticulum-Golgi intermediate compartm...    134   4e-33    Ophiophagus hannah
ref|XP_009884638.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   4e-33    Charadrius vociferus
gb|KGL94343.1|  Endoplasmic reticulum-Golgi intermediate compartm...    134   4e-33    Charadrius vociferus
ref|XP_005514697.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    134   4e-33    
ref|XP_005147587.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    135   4e-33    Melopsittacus undulatus
ref|XP_004975824.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    135   4e-33    Setaria italica
emb|CDQ64042.1|  unnamed protein product                                135   4e-33    Oncorhynchus mykiss
ref|XP_009931564.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   4e-33    Opisthocomus hoazin [hoatzin]
ref|XP_009471655.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    134   4e-33    Nipponia nippon
gb|KFR09655.1|  Endoplasmic reticulum-Golgi intermediate compartm...    134   4e-33    Opisthocomus hoazin [hoatzin]
gb|EMC76893.1|  Endoplasmic reticulum-Golgi intermediate compartm...    134   4e-33    
gb|KDO80920.1|  hypothetical protein CISIN_1g016587mg                   133   5e-33    Citrus sinensis [apfelsine]
gb|KFR06735.1|  Endoplasmic reticulum-Golgi intermediate compartm...    134   5e-33    Nipponia nippon
ref|XP_009097047.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    135   5e-33    Serinus canaria [canary]
ref|XP_009946915.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    134   5e-33    Leptosomus discolor
ref|XP_004504780.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    135   5e-33    Cicer arietinum [garbanzo]
ref|XP_009419691.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    135   5e-33    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009488027.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    134   6e-33    Pelecanus crispus
ref|XP_010294012.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   6e-33    Phaethon lepturus
gb|EMS61746.1|  hypothetical protein TRIUR3_13518                       135   6e-33    Triticum urartu
ref|XP_008219664.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    135   6e-33    Prunus mume [ume]
ref|XP_007227487.1|  hypothetical protein PRUPE_ppa007001mg             135   6e-33    Prunus persica
ref|XP_005986793.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    135   6e-33    Latimeria chalumnae
ref|NP_001087591.1|  endoplasmic reticulum-Golgi intermediate com...    135   7e-33    Xenopus laevis [clawed frog]
gb|KEH31231.1|  endoplasmic reticulum vesicle transporter               134   7e-33    Medicago truncatula
ref|XP_010080198.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   7e-33    Pterocles gutturalis
ref|XP_005986794.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   7e-33    Latimeria chalumnae
ref|XP_008319387.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   9e-33    
ref|XP_006202669.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   9e-33    Vicugna pacos
ref|XP_009636179.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    134   9e-33    Egretta garzetta
ref|XP_006188640.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   9e-33    Camelus ferus
ref|XP_006202670.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   9e-33    Vicugna pacos
ref|XP_009904016.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    135   9e-33    Picoides pubescens
ref|XP_008319388.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   9e-33    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_006188641.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   9e-33    Camelus ferus
ref|XP_010261264.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   1e-32    Nelumbo nucifera [Indian lotus]
ref|XP_004961675.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   1e-32    Setaria italica
ref|XP_009973938.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    134   1e-32    Tyto alba [Schleiereule]
gb|KFP09370.1|  Endoplasmic reticulum-Golgi intermediate compartm...    133   1e-32    Egretta garzetta
ref|XP_007018816.1|  Endoplasmic reticulum vesicle transporter pr...    134   1e-32    
ref|XP_010133714.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    133   1e-32    Buceros rhinoceros silvestris
gb|KFV55314.1|  Endoplasmic reticulum-Golgi intermediate compartm...    133   1e-32    Gavia stellata
ref|XP_005496546.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   1e-32    
ref|XP_009009462.1|  hypothetical protein HELRODRAFT_105492             134   1e-32    Helobdella robusta
gb|KFV43899.1|  Endoplasmic reticulum-Golgi intermediate compartm...    133   1e-32    Tyto alba [Schleiereule]
ref|XP_004687301.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   1e-32    Condylura cristata
ref|XP_007258563.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    133   1e-32    
ref|XP_009812641.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    133   1e-32    Gavia stellata
ref|NP_001158869.1|  Endoplasmic reticulum-Golgi intermediate com...    134   1e-32    Salmo salar
ref|XP_004237893.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   1e-32    Solanum lycopersicum
ref|XP_006654573.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   1e-32    Oryza brachyantha
ref|XP_010901817.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   1e-32    Esox lucius
ref|XP_002977139.1|  hypothetical protein SELMODRAFT_271242             134   1e-32    Selaginella moellendorffii
ref|XP_004687302.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   1e-32    Condylura cristata
ref|XP_002513896.1|  Endoplasmic reticulum-Golgi intermediate com...    134   1e-32    Ricinus communis
ref|XP_006750457.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   1e-32    Leptonychotes weddellii
ref|NP_001141198.1|  uncharacterized protein LOC100273285               134   1e-32    Zea mays [maize]
ref|XP_009386733.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   1e-32    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010901818.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   1e-32    Esox lucius
ref|XP_006472628.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   1e-32    Citrus sinensis [apfelsine]
ref|XP_012067840.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   2e-32    Jatropha curcas
ref|XP_008373201.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   2e-32    Malus domestica [apple tree]
ref|XP_007429095.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    133   2e-32    Python bivittatus
ref|XP_007258561.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   2e-32    Astyanax mexicanus [blind cave fish]
ref|XP_003220521.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   2e-32    Anolis carolinensis [Carolina anole]
ref|XP_007258562.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    133   2e-32    Astyanax mexicanus [blind cave fish]
emb|CDO97460.1|  unnamed protein product                                133   2e-32    Coffea canephora [robusta coffee]
gb|KHG11605.1|  Endoplasmic reticulum-Golgi intermediate compartm...    133   2e-32    Gossypium arboreum [tree cotton]
ref|XP_003220520.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    133   2e-32    Anolis carolinensis [Carolina anole]
ref|XP_006921817.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    133   2e-32    Pteropus alecto
gb|ACC68956.1|  serologically defined breast cancer antigen 84 is...    133   2e-32    Rhinolophus ferrumequinum
ref|XP_007429094.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    133   2e-32    Python bivittatus
ref|XP_001764962.1|  predicted protein                                  133   2e-32    
ref|XP_004946986.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   2e-32    
ref|XP_009677582.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   3e-32    Struthio camelus australis
ref|XP_004548890.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    133   3e-32    Maylandia zebra
gb|KGL78646.1|  Endoplasmic reticulum-Golgi intermediate compartm...    132   3e-32    Tinamus guttatus
gb|KFV83582.1|  Endoplasmic reticulum-Golgi intermediate compartm...    132   3e-32    Struthio camelus australis
ref|XP_005018101.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   3e-32    
ref|XP_010720552.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   3e-32    Meleagris gallopavo [common turkey]
ref|XP_008237176.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    133   3e-32    Prunus mume [ume]
ref|NP_001091124.1|  ERGIC and golgi 3                                  133   3e-32    Xenopus laevis [clawed frog]
ref|XP_008696377.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   3e-32    Ursus maritimus [white bear]
gb|KJB79682.1|  hypothetical protein B456_013G061900                    133   3e-32    Gossypium raimondii
ref|XP_011219561.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   3e-32    
ref|XP_011376631.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    133   3e-32    Pteropus vampyrus
ref|XP_010215006.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   3e-32    Tinamus guttatus
ref|XP_001098982.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    133   3e-32    
ref|XP_004548891.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    133   3e-32    Maylandia zebra
ref|XP_009327626.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    129   3e-32    Pygoscelis adeliae
gb|KHN39214.1|  Endoplasmic reticulum-Golgi intermediate compartm...    132   3e-32    Glycine soja [wild soybean]
ref|XP_004062113.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   3e-32    
ref|XP_001371575.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    133   3e-32    Monodelphis domestica
gb|KFM75670.1|  Endoplasmic reticulum-Golgi intermediate compartm...    130   3e-32    Stegodyphus mimosarum
ref|XP_001098885.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    133   3e-32    
ref|XP_003524744.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    133   4e-32    Glycine max [soybeans]
ref|XP_010939627.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   4e-32    Elaeis guineensis
ref|XP_007932792.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   4e-32    Orycteropus afer afer
gb|KCW66744.1|  hypothetical protein EUGRSUZ_F00498                     132   4e-32    Eucalyptus grandis [rose gum]
ref|XP_010060169.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   4e-32    Eucalyptus grandis [rose gum]
ref|XP_011596146.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    134   4e-32    Aquila chrysaetos canadensis
ref|XP_006126746.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   4e-32    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_009509474.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    127   4e-32    Phalacrocorax carbo [common cormorant]
ref|XP_004668176.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   4e-32    Jaculus jaculus
ref|XP_851879.3|  PREDICTED: endoplasmic reticulum-Golgi intermed...    132   4e-32    Canis lupus familiaris [dogs]
ref|XP_003642492.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   4e-32    
ref|XP_005329943.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   5e-32    
ref|NP_001270982.1|  endoplasmic reticulum-Golgi intermediate com...    132   5e-32    Macaca fascicularis [crab eating macaque]
ref|XP_008053667.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   5e-32    Carlito syrichta
ref|XP_001371602.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   5e-32    
ref|XP_864582.3|  PREDICTED: endoplasmic reticulum-Golgi intermed...    132   5e-32    
ref|XP_005002790.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   5e-32    
ref|XP_005294107.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   5e-32    
ref|XP_001754958.1|  predicted protein                                  132   5e-32    
ref|XP_008053668.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   5e-32    
ref|XP_007932793.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   5e-32    
ref|XP_005384847.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   5e-32    
ref|NP_001242045.1|  uncharacterized protein LOC100781612               132   5e-32    
ref|XP_008445347.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   5e-32    
ref|XP_004668177.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   5e-32    
ref|XP_003467839.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   5e-32    
ref|NP_938408.1|  endoplasmic reticulum-Golgi intermediate compar...    132   5e-32    
gb|EPQ16115.1|  Endoplasmic reticulum-Golgi intermediate compartm...    132   5e-32    
gb|AAX46646.1|  serologically defined breast cancer antigen 84 is...    132   5e-32    
ref|XP_004888660.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   5e-32    
ref|XP_004630919.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   5e-32    
ref|XP_003642491.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   5e-32    
ref|NP_057050.1|  endoplasmic reticulum-Golgi intermediate compar...    132   5e-32    
ref|XP_005329944.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   5e-32    
ref|XP_010638254.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   5e-32    
ref|XP_003788179.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   5e-32    
ref|XP_004612590.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   5e-32    
ref|XP_002747285.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   5e-32    
ref|XP_003788180.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   5e-32    
ref|XP_004888661.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   5e-32    
ref|XP_004272824.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   5e-32    
ref|XP_005384848.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   6e-32    
ref|XP_004585821.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   6e-32    
ref|NP_001126130.1|  endoplasmic reticulum-Golgi intermediate com...    132   6e-32    
ref|XP_004585820.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   6e-32    
dbj|BAJ86415.1|  predicted protein                                      132   6e-32    
ref|XP_003759313.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   6e-32    
ref|XP_002747286.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   6e-32    
ref|XP_006144123.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   6e-32    
ref|XP_009337894.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   6e-32    
ref|XP_004630918.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   6e-32    
ref|XP_004430531.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   6e-32    
ref|NP_001164802.1|  endoplasmic reticulum-Golgi intermediate com...    132   6e-32    
ref|XP_004272825.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   6e-32    
ref|XP_010638253.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   6e-32    
ref|XP_007447834.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   6e-32    
ref|XP_011087876.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   6e-32    
ref|NP_001001226.1|  endoplasmic reticulum-Golgi intermediate com...    132   6e-32    
ref|XP_008173907.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   6e-32    
ref|XP_007193280.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   6e-32    
ref|XP_007447835.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   6e-32    
gb|ACQ63006.1|  serologically defined breast cancer antigen 84 is...    132   6e-32    
ref|XP_004946984.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   6e-32    
ref|XP_004370458.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   6e-32    
ref|XP_004370457.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   6e-32    
ref|XP_004746602.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   6e-32    
gb|EFB21643.1|  hypothetical protein PANDA_004535                       132   6e-32    
ref|XP_004393167.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   6e-32    
ref|XP_002916455.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   6e-32    
ref|XP_003983624.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   7e-32    
ref|XP_007159091.1|  hypothetical protein PHAVU_002G207900g             132   7e-32    
ref|XP_004946985.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   7e-32    
gb|AFW83755.1|  hypothetical protein ZEAMMB73_317062                    136   7e-32    
ref|XP_007073687.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   7e-32    
ref|XP_003411726.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   7e-32    
ref|XP_010589943.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   7e-32    
ref|XP_004430532.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   7e-32    
ref|XP_004393168.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   7e-32    
ref|XP_004612591.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   7e-32    
ref|XP_001929458.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   7e-32    
ref|XP_006881541.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   7e-32    
ref|XP_010562891.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmic ...    131   7e-32    
ref|XP_006500064.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   8e-32    
ref|XP_006089521.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   8e-32    
ref|XP_007101787.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   8e-32    
ref|XP_008838971.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   8e-32    
ref|XP_011908066.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   8e-32    
ref|XP_006988325.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   8e-32    
ref|XP_004014575.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   8e-32    
ref|XP_002302286.1|  hypothetical protein POPTR_0002s09500g             132   8e-32    
ref|XP_003448415.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   8e-32    
ref|XP_011219560.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   8e-32    
ref|XP_008696376.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   8e-32    
dbj|BAC11054.1|  unnamed protein product                                132   8e-32    
ref|XP_003501188.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   8e-32    
ref|XP_005900090.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   8e-32    
ref|XP_006089522.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   8e-32    
gb|ACJ84247.1|  unknown                                                 132   8e-32    
gb|ABF57320.1|  serologically defined breast cancer antigen 84          131   8e-32    
ref|XP_007522702.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   8e-32    
ref|XP_006881542.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   9e-32    
gb|ABF57305.1|  serologically defined breast cancer antigen 84          131   9e-32    
ref|NP_079792.1|  endoplasmic reticulum-Golgi intermediate compar...    131   9e-32    
ref|NP_001029525.2|  endoplasmic reticulum-Golgi intermediate com...    131   9e-32    
ref|XP_004014574.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   9e-32    
ref|XP_010269218.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   9e-32    
ref|NP_001100003.1|  endoplasmic reticulum-Golgi intermediate com...    131   9e-32    
ref|XP_011908067.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    132   9e-32    
ref|XP_001929457.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   9e-32    
ref|XP_008406424.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   9e-32    
ref|XP_009390586.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   9e-32    
ref|XP_008838972.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   9e-32    
ref|XP_006351793.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   1e-31    
ref|XP_008838973.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   1e-31    
ref|XP_003448416.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   1e-31    
ref|XP_011013540.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   1e-31    
ref|XP_005294106.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   1e-31    
ref|XP_007522703.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   1e-31    
ref|XP_004150658.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   1e-31    
ref|XP_007544069.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   1e-31    
ref|XP_005810881.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   1e-31    
ref|XP_008406425.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   1e-31    
ref|XP_010269216.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   1e-31    
ref|XP_005810880.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   1e-31    
ref|XP_002306582.1|  hypothetical protein POPTR_0005s16700g             131   1e-31    
ref|XP_009419975.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   1e-31    
ref|XP_009349444.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   1e-31    
ref|XP_007544071.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   1e-31    
ref|XP_007053985.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    130   1e-31    
gb|KJB59935.1|  hypothetical protein B456_009G281900                    129   1e-31    
ref|XP_005879911.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   1e-31    
gb|KFK42194.1|  hypothetical protein AALP_AA2G223600                    131   1e-31    
ref|XP_003273622.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    130   2e-31    
ref|XP_007969802.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    128   2e-31    
ref|XP_006875766.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   2e-31    
ref|XP_006875767.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    130   2e-31    
ref|XP_008810997.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    130   2e-31    
ref|XP_006354000.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    130   2e-31    
ref|XP_012084622.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    130   2e-31    
gb|ELK29631.1|  Endoplasmic reticulum-Golgi intermediate compartm...    130   2e-31    
ref|XP_006235376.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    131   2e-31    
ref|XP_009595173.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    130   2e-31    
ref|XP_009595172.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    130   2e-31    
ref|XP_004698301.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    130   2e-31    
ref|XP_005057037.1|  PREDICTED: uncharacterized protein LOC101821551    134   2e-31    
ref|XP_005084715.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    130   2e-31    
emb|CDX87479.1|  BnaA07g33940D                                          130   2e-31    
ref|XP_009106456.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    130   3e-31    
ref|XP_004230558.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    130   3e-31    
ref|XP_004746600.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    130   3e-31    
ref|NP_001028277.1|  endoplasmic reticulum-Golgi intermediate com...    130   4e-31    
emb|CDX88415.1|  BnaC06g38590D                                          130   4e-31    
ref|XP_006639728.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    130   4e-31    
ref|NP_957309.1|  endoplasmic reticulum-Golgi intermediate compar...    130   4e-31    
gb|EFA85803.1|  endoplasmic reticulum-golgi intermediate compartm...    130   4e-31    
ref|XP_006639727.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    129   5e-31    
ref|XP_008808176.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    129   5e-31    
ref|XP_006783095.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    129   5e-31    
dbj|GAM26503.1|  hypothetical protein SAMD00019534_096780               129   5e-31    
ref|XP_008790817.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    128   6e-31    
ref|XP_011012659.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    129   6e-31    
emb|CAI42843.1|  ERGIC and golgi 3                                      129   6e-31    
gb|KJB59936.1|  hypothetical protein B456_009G281900                    129   6e-31    
gb|KHG13361.1|  Endoplasmic reticulum-Golgi intermediate compartm...    129   6e-31    
ref|XP_006783096.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    129   7e-31    
ref|XP_007907500.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    129   7e-31    
ref|XP_010676904.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    129   7e-31    
ref|XP_007907499.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    129   8e-31    
gb|ACA64886.1|  endoplasmic reticulum-Golgi intermediate compartm...    126   9e-31    
gb|EHB05461.1|  Endoplasmic reticulum-Golgi intermediate compartm...    129   9e-31    
ref|XP_011434519.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    129   1e-30    
gb|EAW76200.1|  ERGIC and golgi 3, isoform CRA_b                        125   1e-30    
ref|XP_009860519.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    129   1e-30    
gb|EPY78282.1|  endoplasmic reticulum-Golgi intermediate compartm...    129   1e-30    
ref|XP_003976749.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    128   1e-30    
gb|EKC31342.1|  Endoplasmic reticulum-Golgi intermediate compartm...    129   1e-30    
gb|EYU23218.1|  hypothetical protein MIMGU_mgv1a007992mg                128   1e-30    
ref|XP_008790816.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    128   2e-30    
ref|NP_001055898.1|  Os05g0490200                                       128   2e-30    
ref|XP_004482494.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    127   2e-30    
ref|XP_792057.3|  PREDICTED: endoplasmic reticulum-Golgi intermed...    128   2e-30    
ref|XP_006144122.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    128   2e-30    
ref|XP_008382039.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    127   2e-30    
ref|XP_010530623.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    127   2e-30    
ref|XP_003558026.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    127   3e-30    
ref|XP_003542443.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    127   3e-30    
gb|KHN26081.1|  Endoplasmic reticulum-Golgi intermediate compartm...    127   3e-30    
gb|ERZ99514.1|  hypothetical protein GLOINDRAFT_339028                  125   3e-30    
emb|CDY41876.1|  BnaA08g06230D                                          127   3e-30    
ref|XP_003385402.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    127   3e-30    
ref|XP_004340798.1|  golgi family protein, putative                     127   3e-30    
ref|XP_011238033.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    127   3e-30    
ref|XP_007141162.1|  hypothetical protein PHAVU_008G172300g             127   3e-30    
gb|ELR53293.1|  Endoplasmic reticulum-Golgi intermediate compartm...    127   4e-30    
ref|XP_004142610.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    127   4e-30    
ref|XP_010065587.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    127   4e-30    
ref|XP_003544786.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    127   4e-30    
ref|XP_006826951.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    127   4e-30    
gb|EYU34273.1|  hypothetical protein MIMGU_mgv1a014288mg                122   5e-30    
gb|KFK24003.1|  hypothetical protein AALP_AAs67745U000100               126   6e-30    
ref|XP_008444108.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    126   6e-30    
ref|XP_009767797.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    126   6e-30    
ref|XP_009107911.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    126   7e-30    
ref|XP_004514266.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    126   7e-30    
ref|XP_010908611.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    126   7e-30    
ref|XP_001693564.1|  predicted protein                                  126   8e-30    
ref|XP_003615024.1|  Endoplasmic reticulum-Golgi intermediate com...    126   8e-30    
gb|KJB59090.1|  hypothetical protein B456_009G238700                    126   9e-30    
gb|EHH19745.1|  Serologically defined breast cancer antigen NY-BR-84    126   9e-30    
ref|XP_005604807.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    125   1e-29    
ref|XP_629760.1|  endoplasmic reticulum-golgi intermediate compar...    125   1e-29    
gb|EDL06163.1|  ERGIC and golgi 3, isoform CRA_c                        123   1e-29    
ref|XP_005363118.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    125   1e-29    
emb|CDX91746.1|  BnaC08g06650D                                          126   1e-29    
ref|XP_005568911.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    125   1e-29    
ref|XP_006305055.1|  hypothetical protein CARUB_v10009420mg             125   1e-29    
ref|XP_001634898.1|  predicted protein                                  125   1e-29    
gb|ABF95668.1|  Serologically defined breast cancer antigen NY-BR...    125   1e-29    
ref|XP_006650004.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    125   1e-29    
ref|XP_005568912.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    125   2e-29    
ref|XP_005363119.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    125   2e-29    
ref|XP_009621173.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    126   2e-29    
ref|XP_001762360.1|  predicted protein                                  125   2e-29    
emb|CDY00433.1|  BnaC07g13930D                                          124   2e-29    
gb|KHG05263.1|  Endoplasmic reticulum-Golgi intermediate compartm...    125   2e-29    
ref|XP_011908064.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    125   2e-29    
ref|XP_011908065.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    125   2e-29    
gb|EXX73752.1|  Erv46p                                                  125   2e-29    
ref|XP_010498683.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    125   3e-29    
ref|XP_002891208.1|  hypothetical protein ARALYDRAFT_891247             124   3e-29    
ref|NP_001154394.1|  Endoplasmic reticulum vesicle transporter pr...    124   3e-29    
ref|XP_010477480.1|  PREDICTED: endoplasmic reticulum-Golgi inter...    124   3e-29    
emb|CDY46631.1|  BnaA07g10650D                                          124   3e-29    
ref|XP_002893216.1|  hypothetical protein ARALYDRAFT_472456             124   3e-29    
gb|KFK44311.1|  hypothetical protein AALP_AA1G241700                    124   3e-29    



>gb|EYU36436.1| hypothetical protein MIMGU_mgv1a014341mg [Erythranthe guttata]
Length=193

 Score =   328 bits (842),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 167/180 (93%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVAQMIF+GSSHVNVSHIIHDLSFGPKYPGIHNP
Sbjct  16   RVYGV--LDVQRVAGNFHISVHGLNIFVAQMIFEGSSHVNVSHIIHDLSFGPKYPGIHNP  73

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RIL   SGTFKYYIKIVPTEY+Y+SKEVLPTNQFSV+EY+S IHEFDR WPAVYF
Sbjct  74   LDETSRILRGASGTFKYYIKIVPTEYKYISKEVLPTNQFSVTEYFSPIHEFDRNWPAVYF  133

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTI+EERRSFLHFITRLCAVLGGTFALTGMLDRWMYR +E+ TKPNARSTVR
Sbjct  134  LYDLSPITVTIREERRSFLHFITRLCAVLGGTFALTGMLDRWMYRFIESFTKPNARSTVR  193



>ref|XP_010112882.1| hypothetical protein L484_017718 [Morus notabilis]
 gb|EXC35017.1| hypothetical protein L484_017718 [Morus notabilis]
Length=348

 Score =   330 bits (845),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 168/180 (93%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVAQMIF+GS HVNVSHIIHDLSFGPKYPGIHNP
Sbjct  171  RVYGV--LDVQRVAGNFHISVHGLNIFVAQMIFEGSKHVNVSHIIHDLSFGPKYPGIHNP  228

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGTERILH  SG FKYYIKIVPTEYRY+ KEVLPTNQFSV+EY+S + +FDR+WPAVYF
Sbjct  229  LDGTERILHDTSGVFKYYIKIVPTEYRYIWKEVLPTNQFSVTEYFSPMKDFDRSWPAVYF  288

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRL+EAVTKPNARS +R
Sbjct  289  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLLEAVTKPNARSVLR  348



>ref|XP_011074286.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Sesamum indicum]
 ref|XP_011074287.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Sesamum indicum]
Length=351

 Score =   330 bits (845),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 168/180 (93%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVAQMIF+GSSHVNVSHIIHDLSFGPKYPGIHNP
Sbjct  174  RVYGV--LDVQRVAGNFHISVHGLNIFVAQMIFEGSSHVNVSHIIHDLSFGPKYPGIHNP  231

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RIL   SGTFKYYIKIVPTEY+Y+SKEVLPTNQFSV+EY+S I EFDRAWPAVYF
Sbjct  232  LDDTVRILRGASGTFKYYIKIVPTEYKYISKEVLPTNQFSVTEYFSPISEFDRAWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTI+EERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEA+TKPN+RS +R
Sbjct  292  LYDLSPITVTIREERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEALTKPNSRSIIR  351



>ref|XP_008229748.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Prunus mume]
Length=351

 Score =   329 bits (843),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 154/173 (89%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -1

Query  826  LDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERI  647
            LDVQR AGNFHISVHGLNIFVAQMIF+GS +VNVSHIIHDLSFGPKYPGIHNPLDGTERI
Sbjct  179  LDVQRVAGNFHISVHGLNIFVAQMIFEGSKNVNVSHIIHDLSFGPKYPGIHNPLDGTERI  238

Query  646  LHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPI  467
            LH  SGTFKYYIK+VPTEYRY+SKEVLPTNQFSV+EY+S + +FDR WPAVYFLYDLSPI
Sbjct  239  LHDTSGTFKYYIKVVPTEYRYISKEVLPTNQFSVTEYFSPMKQFDRTWPAVYFLYDLSPI  298

Query  466  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYR +EAVTKPNARS +R
Sbjct  299  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRFLEAVTKPNARSVLR  351



>ref|XP_007215619.1| hypothetical protein PRUPE_ppa007922mg [Prunus persica]
 gb|EMJ16818.1| hypothetical protein PRUPE_ppa007922mg [Prunus persica]
Length=351

 Score =   328 bits (842),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/173 (88%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -1

Query  826  LDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERI  647
            LDVQR AGNFHISVHGLNIFVAQMIF+GS +VN+SHIIHDLSFGPKYPGIHNPLDGTERI
Sbjct  179  LDVQRVAGNFHISVHGLNIFVAQMIFEGSKNVNISHIIHDLSFGPKYPGIHNPLDGTERI  238

Query  646  LHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPI  467
            LH  SGTFKYYIK+VPTEYRY+SKEVLPTNQFSV+EY+S + +FDR WPAVYFLYDLSPI
Sbjct  239  LHDTSGTFKYYIKVVPTEYRYISKEVLPTNQFSVTEYFSPMKQFDRTWPAVYFLYDLSPI  298

Query  466  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYR +EAVTKPNARS +R
Sbjct  299  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRFLEAVTKPNARSVLR  351



>gb|KDO64247.1| hypothetical protein CISIN_1g022650mg [Citrus sinensis]
Length=179

 Score =   320 bits (821),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  844  MQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPL  665
            MQ    LDVQR AGNFHISVHGLNI+VAQMIF G+ +VNVSH+IHDLSFGPKYPGIHNPL
Sbjct  1    MQVYGVLDVQRVAGNFHISVHGLNIYVAQMIFGGAKNVNVSHVIHDLSFGPKYPGIHNPL  60

Query  664  DGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFL  485
            DGT R+LH  SGTFKYYIKIVPTEYRY+SK+VLPTNQFSV+EY+S I+EFDR WPAVYFL
Sbjct  61   DGTVRMLHDTSGTFKYYIKIVPTEYRYISKDVLPTNQFSVTEYFSTINEFDRTWPAVYFL  120

Query  484  YDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            YDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWMYRL+EA+TKP+ARS +R
Sbjct  121  YDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMYRLLEALTKPSARSVLR  179



>ref|XP_009591169.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Nicotiana tomentosiformis]
 ref|XP_009591170.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Nicotiana tomentosiformis]
Length=348

 Score =   327 bits (837),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 166/180 (92%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVAQMIF GS+HVNVSHIIHDLSFGPKYPGIHNP
Sbjct  171  RVYGV--LDVQRVAGNFHISVHGLNIFVAQMIFGGSTHVNVSHIIHDLSFGPKYPGIHNP  228

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGTERIL   SGTFKYYIKIVPTEYRYLSKEVLPTNQFSV+EY+S I+EFDR WPAVYF
Sbjct  229  LDGTERILRGASGTFKYYIKIVPTEYRYLSKEVLPTNQFSVTEYFSPINEFDRTWPAVYF  288

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTI+EERRSFLHFITRLCAVLGGTFALTGMLD+WMYR +EAV K N+RS VR
Sbjct  289  LYDLSPITVTIREERRSFLHFITRLCAVLGGTFALTGMLDKWMYRFLEAVMKKNSRSLVR  348



>ref|XP_009771009.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Nicotiana sylvestris]
 ref|XP_009771010.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Nicotiana sylvestris]
Length=348

 Score =   326 bits (836),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 166/180 (92%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVAQMIF GS+HVNVSHIIHDLSFGPKYPGIHNP
Sbjct  171  RVYGV--LDVQRVAGNFHISVHGLNIFVAQMIFGGSTHVNVSHIIHDLSFGPKYPGIHNP  228

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGTERIL   SGTFKYYIKIVPTEYRYLSKEVLPTNQFSV+EY+S I+EFDR WPAVYF
Sbjct  229  LDGTERILRGASGTFKYYIKIVPTEYRYLSKEVLPTNQFSVTEYFSPINEFDRTWPAVYF  288

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTI+EERRSFLHFITRLCAVLGGTFALTGMLD+WMYR +EAV K N+RS VR
Sbjct  289  LYDLSPITVTIREERRSFLHFITRLCAVLGGTFALTGMLDKWMYRFLEAVMKKNSRSLVR  348



>ref|XP_002522591.1| Endoplasmic reticulum-Golgi intermediate compartment protein, 
putative [Ricinus communis]
 gb|EEF39792.1| Endoplasmic reticulum-Golgi intermediate compartment protein, 
putative [Ricinus communis]
Length=191

 Score =   319 bits (818),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 163/176 (93%), Gaps = 2/176 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVAQMIF G+ HVNVSHIIHDLSFGPK+PG+HNP
Sbjct  16   RVYGV--LDVQRVAGNFHISVHGLNIFVAQMIFDGAIHVNVSHIIHDLSFGPKFPGLHNP  73

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSV+EY+S + E+DR WPAVYF
Sbjct  74   LDGTARILHDASGTFKYYIKIVPTEYRYISKEVLPTNQFSVTEYFSPMSEYDRTWPAVYF  133

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNAR  320
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRL+EAVTKPN R
Sbjct  134  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLLEAVTKPNTR  189



>ref|XP_006429689.1| hypothetical protein CICLE_v10012850mg [Citrus clementina]
 gb|ESR42929.1| hypothetical protein CICLE_v10012850mg [Citrus clementina]
 gb|KDO64246.1| hypothetical protein CISIN_1g022650mg [Citrus sinensis]
Length=193

 Score =   318 bits (816),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 167/180 (93%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNI+VAQMIF G+ +VNVSH+IHDLSFGPKYPGIHNP
Sbjct  16   RVYGV--LDVQRVAGNFHISVHGLNIYVAQMIFGGAKNVNVSHVIHDLSFGPKYPGIHNP  73

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT R+LH  SGTFKYYIKIVPTEYRY+SK+VLPTNQFSV+EY+S I+EFDR WPAVYF
Sbjct  74   LDGTVRMLHDTSGTFKYYIKIVPTEYRYISKDVLPTNQFSVTEYFSTINEFDRTWPAVYF  133

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWMYRL+EA+TKP+ARS +R
Sbjct  134  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMYRLLEALTKPSARSVLR  193



>ref|XP_002307923.1| hypothetical protein POPTR_0006s02470g [Populus trichocarpa]
 gb|EEE91446.1| hypothetical protein POPTR_0006s02470g [Populus trichocarpa]
Length=351

 Score =   324 bits (830),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 165/180 (92%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVAQMIF G+ HVNVSHIIHDLSFGPKYPGIHNP
Sbjct  174  RVYGV--LDVQRVAGNFHISVHGLNIFVAQMIFDGAKHVNVSHIIHDLSFGPKYPGIHNP  231

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSV+EY+S + +FDR WPAVYF
Sbjct  232  LDGTTRILHETSGTFKYYIKIVPTEYRYISKEVLPTNQFSVTEYFSPMTDFDRTWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWM RL+EA+TKPN RS +R
Sbjct  292  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMCRLLEALTKPNPRSVLR  351



>ref|XP_011040642.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Populus euphratica]
 ref|XP_011004481.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Populus euphratica]
Length=351

 Score =   323 bits (828),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 165/180 (92%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVAQMIF G+ HVNVSHIIHDLSFGPKYPGIHNP
Sbjct  174  RIYGV--LDVQRVAGNFHISVHGLNIFVAQMIFDGAKHVNVSHIIHDLSFGPKYPGIHNP  231

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSV+EY+S + +FD+ WPAVYF
Sbjct  232  LDGTTRILHETSGTFKYYIKIVPTEYRYISKEVLPTNQFSVTEYFSPMTDFDKTWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWM RL+EA+TKPN RS +R
Sbjct  292  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMCRLLEALTKPNPRSVLR  351



>ref|XP_009787019.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Nicotiana sylvestris]
Length=350

 Score =   323 bits (827),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 167/180 (93%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVAQMIF+GS+HVNVSHIIHDLSFGPKYPGIHNP
Sbjct  173  RVYGV--LDVQRVAGNFHISVHGLNIFVAQMIFEGSTHVNVSHIIHDLSFGPKYPGIHNP  230

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RIL   SGTFKY+IK+VPTEYRY+SKEVLPTNQFSV+EY+S I+EFDR WPAVYF
Sbjct  231  LDGTSRILRGASGTFKYFIKVVPTEYRYISKEVLPTNQFSVTEYFSPINEFDRTWPAVYF  290

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTI+EERRSFLH ITRLCAVLGGTFALTGMLDRWMY+L+EAVT+ N+R+ VR
Sbjct  291  LYDLSPITVTIREERRSFLHLITRLCAVLGGTFALTGMLDRWMYKLLEAVTEKNSRTIVR  350



>gb|KDO64243.1| hypothetical protein CISIN_1g022650mg [Citrus sinensis]
Length=294

 Score =   319 bits (817),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 167/180 (93%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNI+VAQMIF G+ +VNVSH+IHDLSFGPKYPGIHNP
Sbjct  117  RVYGV--LDVQRVAGNFHISVHGLNIYVAQMIFGGAKNVNVSHVIHDLSFGPKYPGIHNP  174

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT R+LH  SGTFKYYIKIVPTEYRY+SK+VLPTNQFSV+EY+S I+EFDR WPAVYF
Sbjct  175  LDGTVRMLHDTSGTFKYYIKIVPTEYRYISKDVLPTNQFSVTEYFSTINEFDRTWPAVYF  234

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWMYRL+EA+TKP+ARS +R
Sbjct  235  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMYRLLEALTKPSARSVLR  294



>ref|XP_007048889.1| Endoplasmic reticulum vesicle transporter protein isoform 2 [Theobroma 
cacao]
 gb|EOX93046.1| Endoplasmic reticulum vesicle transporter protein isoform 2 [Theobroma 
cacao]
Length=352

 Score =   320 bits (821),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 166/180 (92%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNI+VAQMIF G++HVNVSH+IHDLSFGPKYPG+HNP
Sbjct  175  RVYGV--LDVQRVAGNFHISVHGLNIYVAQMIFGGATHVNVSHMIHDLSFGPKYPGLHNP  232

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSVSEY+S +HEFDR WPAVYF
Sbjct  233  LDGTVRILHDTSGTFKYYIKIVPTEYRYISKEVLPTNQFSVSEYFSPMHEFDRTWPAVYF  292

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWM+RL+E +TKP+ +  +R
Sbjct  293  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMFRLIEGLTKPSHKGVLR  352



>ref|XP_006481288.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Citrus sinensis]
 ref|XP_006481289.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Citrus sinensis]
Length=351

 Score =   320 bits (821),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 167/180 (93%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNI+VAQMIF G+ +VNVSH+IHDLSFGPKYPGIHNP
Sbjct  174  RVYGV--LDVQRVAGNFHISVHGLNIYVAQMIFGGAKNVNVSHVIHDLSFGPKYPGIHNP  231

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT R+LH  SGTFKYYIKIVPTEYRY+SK+VLPTNQFSV+EY+S I+EFDR WPAVYF
Sbjct  232  LDGTVRMLHDTSGTFKYYIKIVPTEYRYISKDVLPTNQFSVTEYFSTINEFDRTWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWMYRL+EA+TKP+ARS +R
Sbjct  292  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMYRLLEALTKPSARSVLR  351



>ref|XP_004243621.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Solanum lycopersicum]
Length=348

 Score =   320 bits (821),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 165/180 (92%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVAQMIF G++HVNVSHIIHDLSFGPKYPG HNP
Sbjct  171  RVYGV--LDVQRVAGNFHISVHGLNIFVAQMIFGGTTHVNVSHIIHDLSFGPKYPGGHNP  228

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGTERIL   SGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEY+S I+EFDR WPAVYF
Sbjct  229  LDGTERILRGASGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYFSPINEFDRTWPAVYF  288

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTI+EERR+FLHFITRLCAVLGGTFALTGMLD+WM+R +EAV K N+RS VR
Sbjct  289  LYDLSPITVTIREERRNFLHFITRLCAVLGGTFALTGMLDKWMFRFLEAVMKKNSRSLVR  348



>ref|XP_010036056.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Eucalyptus grandis]
 gb|KCW47581.1| hypothetical protein EUGRSUZ_K01330 [Eucalyptus grandis]
 gb|KCW47582.1| hypothetical protein EUGRSUZ_K01330 [Eucalyptus grandis]
Length=355

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 165/180 (92%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVAQMIF+G+ HVNVSH+IHDLSFGPKYPG+HNP
Sbjct  178  RVYGV--LDVQRVAGNFHISVHGLNIFVAQMIFEGAMHVNVSHVIHDLSFGPKYPGLHNP  235

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RIL   SGTFKYYIKIVPTEYRY+SKEVLPTNQFSV+EY+S ++E+DR WPA+YF
Sbjct  236  LDETARILQGASGTFKYYIKIVPTEYRYISKEVLPTNQFSVTEYFSPMNEYDRTWPAIYF  295

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRL+EA++KPN RS  R
Sbjct  296  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLLEALSKPNPRSVFR  355



>ref|XP_007048888.1| Endoplasmic reticulum vesicle transporter protein isoform 1 [Theobroma 
cacao]
 gb|EOX93045.1| Endoplasmic reticulum vesicle transporter protein isoform 1 [Theobroma 
cacao]
Length=351

 Score =   320 bits (820),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 166/180 (92%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNI+VAQMIF G++HVNVSH+IHDLSFGPKYPG+HNP
Sbjct  174  RVYGV--LDVQRVAGNFHISVHGLNIYVAQMIFGGATHVNVSHMIHDLSFGPKYPGLHNP  231

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSVSEY+S +HEFDR WPAVYF
Sbjct  232  LDGTVRILHDTSGTFKYYIKIVPTEYRYISKEVLPTNQFSVSEYFSPMHEFDRTWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWM+RL+E +TKP+ +  +R
Sbjct  292  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMFRLIEGLTKPSHKGVLR  351



>ref|XP_008342279.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Malus domestica]
Length=352

 Score =   319 bits (818),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 163/174 (94%), Gaps = 1/174 (1%)
 Frame = -1

Query  826  LDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERI  647
            LDVQR AGNFHISVHGLNIF AQMIF+GS +VNVSHIIHDLSFGPKYPGIHNPLDGT+RI
Sbjct  179  LDVQRVAGNFHISVHGLNIFAAQMIFEGSRNVNVSHIIHDLSFGPKYPGIHNPLDGTDRI  238

Query  646  LHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPI  467
            LH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSV+EY+S + +FDR WPAVYFLYDLSPI
Sbjct  239  LHDTSGTFKYYIKIVPTEYRYISKEVLPTNQFSVTEYFSPMKQFDRTWPAVYFLYDLSPI  298

Query  466  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVT-KPNARSTVR  308
            TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYR VEA+T KP+ARS +R
Sbjct  299  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRFVEALTAKPHARSVLR  352



>ref|XP_010656946.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Vitis vinifera]
 emb|CBI31774.3| unnamed protein product [Vitis vinifera]
Length=351

 Score =   319 bits (818),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 163/180 (91%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVAQMIF G+ HVNVSHIIHDLSFGPKYPG+HNP
Sbjct  174  RVYGV--LDVQRVAGNFHISVHGLNIFVAQMIFDGAIHVNVSHIIHDLSFGPKYPGLHNP  231

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RIL   SGTFKYYIKIVPTEYRY+SKEVLPTNQFSV EY+S ++EFDR WPAVYF
Sbjct  232  LDGTVRILRGASGTFKYYIKIVPTEYRYISKEVLPTNQFSVMEYFSPMNEFDRTWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSP+TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYR +E +TKPNA+S  R
Sbjct  292  LYDLSPVTVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRFLEMLTKPNAKSVYR  351



>ref|XP_011467640.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Fragaria vesca subsp. vesca]
Length=348

 Score =   317 bits (812),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 165/180 (92%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVAQMIF GS +VNVSH+IHDLSFGPKYPGIHNP
Sbjct  171  RVYGV--LDVQRVAGNFHISVHGLNIFVAQMIFGGSKNVNVSHMIHDLSFGPKYPGIHNP  228

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGTERILH  SG FKYYIK+VPTEYRY+SK+VLPTNQFSV+EYYS + ++DR+WP VYF
Sbjct  229  LDGTERILHDTSGIFKYYIKVVPTEYRYISKQVLPTNQFSVTEYYSPMKQYDRSWPGVYF  288

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERR FLHFITRLCAVLGGTFALTGMLDRWM+R VEA+TKP+ARS +R
Sbjct  289  LYDLSPITVTIKEERRKFLHFITRLCAVLGGTFALTGMLDRWMFRFVEALTKPSARSVLR  348



>ref|XP_004303918.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Fragaria vesca subsp. vesca]
Length=347

 Score =   317 bits (812),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 165/180 (92%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVAQMIF GS +VNVSH+IHDLSFGPKYPGIHNP
Sbjct  170  RVYGV--LDVQRVAGNFHISVHGLNIFVAQMIFGGSKNVNVSHMIHDLSFGPKYPGIHNP  227

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGTERILH  SG FKYYIK+VPTEYRY+SK+VLPTNQFSV+EYYS + ++DR+WP VYF
Sbjct  228  LDGTERILHDTSGIFKYYIKVVPTEYRYISKQVLPTNQFSVTEYYSPMKQYDRSWPGVYF  287

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERR FLHFITRLCAVLGGTFALTGMLDRWM+R VEA+TKP+ARS +R
Sbjct  288  LYDLSPITVTIKEERRKFLHFITRLCAVLGGTFALTGMLDRWMFRFVEALTKPSARSVLR  347



>ref|XP_009377930.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Pyrus x bretschneideri]
Length=355

 Score =   317 bits (812),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 163/174 (94%), Gaps = 1/174 (1%)
 Frame = -1

Query  826  LDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERI  647
            LDVQR AGNFHISVHGLNIF AQMIF+GS +VNVSHIIHDLSFGPKYPGIHNPLDGT+RI
Sbjct  182  LDVQRVAGNFHISVHGLNIFAAQMIFEGSRNVNVSHIIHDLSFGPKYPGIHNPLDGTDRI  241

Query  646  LHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPI  467
            LH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSV+EY+S + +FDR WPAVYFLYDLSPI
Sbjct  242  LHDTSGTFKYYIKIVPTEYRYISKEVLPTNQFSVTEYFSPMKQFDRTWPAVYFLYDLSPI  301

Query  466  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVT-KPNARSTVR  308
            TVTIKEERRSFLHFITRLCAVLGGTFALTG+LDRWMYR VEA+T KP+ARS +R
Sbjct  302  TVTIKEERRSFLHFITRLCAVLGGTFALTGLLDRWMYRFVEALTAKPHARSVLR  355



>ref|XP_008380042.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Malus domestica]
Length=371

 Score =   317 bits (813),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 162/174 (93%), Gaps = 1/174 (1%)
 Frame = -1

Query  826  LDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERI  647
            LDVQR AGNFHISVHGLNIFVAQMIF GS +VNVSHIIHDLSFGPKYPGIHNPLDGT+RI
Sbjct  198  LDVQRVAGNFHISVHGLNIFVAQMIFGGSKNVNVSHIIHDLSFGPKYPGIHNPLDGTDRI  257

Query  646  LHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPI  467
            LH  SGTFKYYIKIVPTEYRY+SKEVL TNQFSV+EY+S + +FDR+WPAVYFLYDLSPI
Sbjct  258  LHDTSGTFKYYIKIVPTEYRYISKEVLXTNQFSVTEYFSPMKQFDRSWPAVYFLYDLSPI  317

Query  466  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVT-KPNARSTVR  308
            TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYR VEA+T KP ARS +R
Sbjct  318  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRFVEALTAKPKARSVLR  371



>ref|XP_010314961.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Solanum lycopersicum]
Length=350

 Score =   316 bits (810),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 166/180 (92%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFH+SVHGLNIFVAQMIF+ S+HVNVSHIIHDLSFGPKYPGIHNP
Sbjct  173  RVYGV--LDVQRVAGNFHLSVHGLNIFVAQMIFEKSTHVNVSHIIHDLSFGPKYPGIHNP  230

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RIL   SGTFKYYIK+VPTEYRY+SKEVLPTNQFSV+EY+S IH+F+R WPAVYF
Sbjct  231  LDGTSRILRGTSGTFKYYIKVVPTEYRYISKEVLPTNQFSVTEYFSPIHDFERTWPAVYF  290

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTI+EERRSFLHFITRLCAVLGGTFALTGMLD WMY+++E+VTK N+R+ VR
Sbjct  291  LYDLSPITVTIREERRSFLHFITRLCAVLGGTFALTGMLDGWMYKILESVTKKNSRTIVR  350



>ref|XP_010313686.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Solanum lycopersicum]
Length=350

 Score =   316 bits (810),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 166/180 (92%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFH+SVHGLNIFVAQMIF+ S+HVNVSHIIHDLSFGPKYPGIHNP
Sbjct  173  RVYGV--LDVQRVAGNFHLSVHGLNIFVAQMIFEKSTHVNVSHIIHDLSFGPKYPGIHNP  230

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RIL   SGTFKYYIK+VPTEYRY+SKEVLPTNQFSV+EY+S IH+F+R WPAVYF
Sbjct  231  LDGTSRILRGTSGTFKYYIKVVPTEYRYISKEVLPTNQFSVTEYFSPIHDFERTWPAVYF  290

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTI+EERRSFLHFITRLCAVLGGTFALTGMLD WMY+++E+VTK N+R+ VR
Sbjct  291  LYDLSPITVTIREERRSFLHFITRLCAVLGGTFALTGMLDGWMYKILESVTKKNSRTIVR  350



>ref|XP_012081271.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Jatropha curcas]
 gb|KDP30124.1| hypothetical protein JCGZ_18119 [Jatropha curcas]
Length=348

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 160/176 (91%), Gaps = 2/176 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVAQMIF G +HVNVSHIIHDLSFGPKYPG+HNP
Sbjct  174  RVYGV--LDVQRVAGNFHISVHGLNIFVAQMIFDGPTHVNVSHIIHDLSFGPKYPGLHNP  231

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSV+EY+S +  FDR WPAVYF
Sbjct  232  LDGTTRILHDASGTFKYYIKIVPTEYRYISKEVLPTNQFSVTEYFSPMDGFDRTWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNAR  320
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRL+E +TK N R
Sbjct  292  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLLEVLTKQNTR  347



>emb|CDP16085.1| unnamed protein product [Coffea canephora]
Length=351

 Score =   315 bits (807),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 163/180 (91%), Gaps = 3/180 (2%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVAQMIF GSSHVNVSHIIHDLSFGPKYPGIHNP
Sbjct  175  RVYGV--LDVQRVAGNFHISVHGLNIFVAQMIFGGSSHVNVSHIIHDLSFGPKYPGIHNP  232

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RIL   SGTFKYYIKIVPTEY YLSKEVLPTNQFSV+EY+S ++EFDR WPAVYF
Sbjct  233  LDGTTRILRGTSGTFKYYIKIVPTEYNYLSKEVLPTNQFSVTEYFSPMNEFDRTWPAVYF  292

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERR+FLHFITRLCAVLGGTFALTGMLDRWMYRL+EA  KP  RS +R
Sbjct  293  LYDLSPITVTIKEERRNFLHFITRLCAVLGGTFALTGMLDRWMYRLLEAFIKPK-RSLLR  351



>ref|XP_007145973.1| hypothetical protein PHAVU_006G002400g [Phaseolus vulgaris]
 gb|ESW17967.1| hypothetical protein PHAVU_006G002400g [Phaseolus vulgaris]
Length=348

 Score =   315 bits (806),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 162/176 (92%), Gaps = 2/176 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNI+VAQMIF G+ +VNVSH+IHDLSFGPKYPGIHNP
Sbjct  174  RVYGV--LDVQRVAGNFHISVHGLNIYVAQMIFDGAKNVNVSHVIHDLSFGPKYPGIHNP  231

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIK+VPTEYRY+SKEVLPTNQFSVSEYYS I++FDR WPAVYF
Sbjct  232  LDDTNRILHDTSGTFKYYIKVVPTEYRYISKEVLPTNQFSVSEYYSPINQFDRTWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNAR  320
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFA+TGMLDRWMYRL+EA+TK  ++
Sbjct  292  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFAVTGMLDRWMYRLIEALTKSKSK  347



>ref|XP_010245571.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Nelumbo nucifera]
 ref|XP_010245576.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Nelumbo nucifera]
Length=349

 Score =   314 bits (805),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 161/173 (93%), Gaps = 0/173 (0%)
 Frame = -1

Query  826  LDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERI  647
            LDVQR AGNFHISVHGLNIFVAQ IF+GSSHVNVSH+IHDLSFGPKYPGIHNPLDGT RI
Sbjct  177  LDVQRVAGNFHISVHGLNIFVAQQIFEGSSHVNVSHMIHDLSFGPKYPGIHNPLDGTVRI  236

Query  646  LHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPI  467
            L   SGTFKYYIKIVPTEYRYLSK+VLPTNQFSV+EY+  ++E+DR WPAVYFLYDLSPI
Sbjct  237  LRDTSGTFKYYIKIVPTEYRYLSKDVLPTNQFSVTEYFVPMNEYDRTWPAVYFLYDLSPI  296

Query  466  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRL+E+ TK ++RS +R
Sbjct  297  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLLESFTKSSSRSILR  349



>ref|XP_002322569.2| hypothetical protein POPTR_0016s02310g [Populus trichocarpa]
 gb|ABK93267.1| unknown [Populus trichocarpa]
 gb|EEF04330.2| hypothetical protein POPTR_0016s02310g [Populus trichocarpa]
Length=366

 Score =   315 bits (807),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 161/177 (91%), Gaps = 2/177 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVAQMIF G+ HVNVSHIIHDLSFGPKYPGIHNP
Sbjct  189  RVYGV--LDVQRVAGNFHISVHGLNIFVAQMIFDGAKHVNVSHIIHDLSFGPKYPGIHNP  246

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RIL   SG FKYYIKIVPTEYRY+SK+VLPTNQFSV+EY+S I +FDR WPAVYF
Sbjct  247  LDGTARILRETSGIFKYYIKIVPTEYRYISKDVLPTNQFSVTEYFSPITDFDRTWPAVYF  306

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARS  317
            LYDLSPITVTIKEERRSFLHFITRLCA+LGGTFALTGMLDRWMYRL+EA+TKPN  S
Sbjct  307  LYDLSPITVTIKEERRSFLHFITRLCAILGGTFALTGMLDRWMYRLLEALTKPNRGS  363



>ref|XP_011008533.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Populus euphratica]
Length=351

 Score =   314 bits (804),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 162/177 (92%), Gaps = 2/177 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVAQMIF G+ HVNVSHIIHDLSFGP+YPGIHNP
Sbjct  174  RVYGV--LDVQRVAGNFHISVHGLNIFVAQMIFDGAKHVNVSHIIHDLSFGPQYPGIHNP  231

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRY+SK+VL TNQFSV+EY+S I +F+R WPAVYF
Sbjct  232  LDGTARILHETSGTFKYYIKIVPTEYRYISKDVLSTNQFSVTEYFSPITDFERTWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARS  317
            LYDLSPITVTIKEERRSFLHFITRLCA+LGGTFALTGMLDRWMYRL+EA+TKPN  S
Sbjct  292  LYDLSPITVTIKEERRSFLHFITRLCAILGGTFALTGMLDRWMYRLLEALTKPNRGS  348



>ref|XP_011010108.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Populus euphratica]
Length=351

 Score =   313 bits (803),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 162/177 (92%), Gaps = 2/177 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVAQMIF G+ HVNVSHIIHDLSFGP+YPGIHNP
Sbjct  174  RVYGV--LDVQRVAGNFHISVHGLNIFVAQMIFDGAKHVNVSHIIHDLSFGPQYPGIHNP  231

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRY+SK+VL TNQFSV+EY+S I +F+R WPAVYF
Sbjct  232  LDGTARILHETSGTFKYYIKIVPTEYRYISKDVLSTNQFSVTEYFSPITDFERTWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARS  317
            LYDLSPITVTIKEERRSFLHFITRLCA+LGGTFALTGMLDRWMYRL+EA+TKPN  S
Sbjct  292  LYDLSPITVTIKEERRSFLHFITRLCAILGGTFALTGMLDRWMYRLLEALTKPNRGS  348



>ref|XP_010245563.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Nelumbo nucifera]
Length=384

 Score =   315 bits (806),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 161/173 (93%), Gaps = 0/173 (0%)
 Frame = -1

Query  826  LDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERI  647
            LDVQR AGNFHISVHGLNIFVAQ IF+GSSHVNVSH+IHDLSFGPKYPGIHNPLDGT RI
Sbjct  212  LDVQRVAGNFHISVHGLNIFVAQQIFEGSSHVNVSHMIHDLSFGPKYPGIHNPLDGTVRI  271

Query  646  LHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPI  467
            L   SGTFKYYIKIVPTEYRYLSK+VLPTNQFSV+EY+  ++E+DR WPAVYFLYDLSPI
Sbjct  272  LRDTSGTFKYYIKIVPTEYRYLSKDVLPTNQFSVTEYFVPMNEYDRTWPAVYFLYDLSPI  331

Query  466  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRL+E+ TK ++RS +R
Sbjct  332  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLLESFTKSSSRSILR  384



>ref|XP_003542168.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Glycine max]
 gb|KHN19824.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3 [Glycine soja]
Length=351

 Score =   311 bits (796),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 161/176 (91%), Gaps = 2/176 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNI+VAQMIF G+ +VNVSH IHDLSFGPKYPG+HNP
Sbjct  177  RVYGV--LDVQRVAGNFHISVHGLNIYVAQMIFDGAKNVNVSHFIHDLSFGPKYPGLHNP  234

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIK+VPTEYRY+SKEVLPTNQFSVSEYYS I++FDR WPAVYF
Sbjct  235  LDDTTRILHDTSGTFKYYIKVVPTEYRYISKEVLPTNQFSVSEYYSPINQFDRTWPAVYF  294

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNAR  320
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFA+TGMLDRWMYRL+EA+TK  ++
Sbjct  295  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFAVTGMLDRWMYRLLEALTKSKSK  350



>ref|XP_006351995.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Solanum tuberosum]
 ref|XP_006351996.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Solanum tuberosum]
Length=350

 Score =   311 bits (796),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 164/180 (91%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ G+  LDVQR AGNFH+SVHG+NIFVAQMIF+ S+HVNVSHIIHDLSFGPKYPGIHNP
Sbjct  173  RVYGI--LDVQRVAGNFHLSVHGMNIFVAQMIFEKSTHVNVSHIIHDLSFGPKYPGIHNP  230

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RIL   SGTFKYYIK+VPTEYRY+SKEV PTNQFSV+EY+S IH+F+R WPAVYF
Sbjct  231  LDGTSRILRGSSGTFKYYIKVVPTEYRYISKEVSPTNQFSVTEYFSPIHDFERTWPAVYF  290

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTI+EERRSFLHFITRLCAVLGGTFALTGMLD WMY+++E+ TK N+R+ VR
Sbjct  291  LYDLSPITVTIREERRSFLHFITRLCAVLGGTFALTGMLDGWMYKILESFTKKNSRTIVR  350



>ref|XP_004502082.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Cicer arietinum]
Length=351

 Score =   310 bits (795),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 162/177 (92%), Gaps = 3/177 (2%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNI+VAQMIF G+ +VNVSH+IHDLSFGPK+PG HNP
Sbjct  176  RVYGV--LDVQRVAGNFHISVHGLNIYVAQMIFDGAKNVNVSHVIHDLSFGPKFPGHHNP  233

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLI-HEFDRAWPAVY  491
            LDGT RILH  SGTFKYYIK+VPTEYRY+SKEVLPTNQFSV+EY+S I  +FDR WPAVY
Sbjct  234  LDGTTRILHDASGTFKYYIKVVPTEYRYISKEVLPTNQFSVTEYFSPITSQFDRTWPAVY  293

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNAR  320
            FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFA+TGMLDRWMYRLVEAVTKP A+
Sbjct  294  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFAVTGMLDRWMYRLVEAVTKPKAK  350



>ref|XP_010688789.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010688790.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010688791.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Beta vulgaris subsp. vulgaris]
Length=381

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 160/179 (89%), Gaps = 2/179 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVAQMIF GS+HVNVSH+IHDLSFGP YPGIHNP
Sbjct  205  RIYGV--LDVQRVAGNFHISVHGLNIFVAQMIFDGSNHVNVSHMIHDLSFGPSYPGIHNP  262

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RIL   SGTFKYYIKIVPTEY+Y+SK+VLPTNQFSV+EY+S + +FDR WPAVYF
Sbjct  263  LDGTVRILRGTSGTFKYYIKIVPTEYKYISKDVLPTNQFSVTEYFSPMKDFDRTWPAVYF  322

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTV  311
            LYDLSPITVTI+EERRSFLHF+TRLCAVLGGTFALTGMLDRWMYRLVE V KP  R  +
Sbjct  323  LYDLSPITVTIREERRSFLHFLTRLCAVLGGTFALTGMLDRWMYRLVEMVMKPTKRGVI  381



>gb|KJB40581.1| hypothetical protein B456_007G069900 [Gossypium raimondii]
 gb|KJB40582.1| hypothetical protein B456_007G069900 [Gossypium raimondii]
 gb|KJB40583.1| hypothetical protein B456_007G069900 [Gossypium raimondii]
Length=351

 Score =   309 bits (792),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 161/180 (89%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNI+VAQMIF G++HVNVSH+IHDLSFGPKYPG+HNP
Sbjct  174  RVYGV--LDVQRVAGNFHISVHGLNIYVAQMIFGGATHVNVSHMIHDLSFGPKYPGLHNP  231

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRY+ KEVLPTNQFS SEY+S + E+DR+WPAVYF
Sbjct  232  LDGTVRILHETSGTFKYYIKIVPTEYRYIWKEVLPTNQFSASEYFSPMKEYDRSWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRL+E VTK +     R
Sbjct  292  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLIEEVTKASGTRAYR  351



>ref|XP_006605681.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Glycine max]
 ref|XP_006605682.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Glycine max]
 gb|KHN48838.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3 [Glycine soja]
Length=347

 Score =   309 bits (791),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 160/176 (91%), Gaps = 2/176 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNI+VAQMIF G+ +VNVSH IHDLSFGPKYPG+HNP
Sbjct  173  RVYGV--LDVQRVAGNFHISVHGLNIYVAQMIFDGAKNVNVSHFIHDLSFGPKYPGLHNP  230

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIK+VPTEYRY+SKEVLPTNQFSVSEYYS I++FDR WPAVYF
Sbjct  231  LDDTTRILHDTSGTFKYYIKVVPTEYRYISKEVLPTNQFSVSEYYSPINQFDRTWPAVYF  290

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNAR  320
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFA+TGMLDRWMYRL+E +TK  ++
Sbjct  291  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFAVTGMLDRWMYRLLETLTKSKSK  346



>ref|XP_010525178.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010525180.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Tarenaya hassleriana]
Length=356

 Score =   309 bits (791),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 164/181 (91%), Gaps = 3/181 (2%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNI+VAQ IF GS +VNVSHIIHDLSFGPKYPGIHNP
Sbjct  178  RVYGV--LDVQRVAGNFHISVHGLNIYVAQTIFGGSKNVNVSHIIHDLSFGPKYPGIHNP  235

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRYLSKEVL TNQFSV+EYY  + EFDR WPAVYF
Sbjct  236  LDGTVRILHDTSGTFKYYIKIVPTEYRYLSKEVLSTNQFSVTEYYLPMREFDRTWPAVYF  295

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVT-KPNARSTV  311
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWM+RL+E++T KP++RS +
Sbjct  296  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMFRLIESLTRKPSSRSIL  355

Query  310  R  308
            +
Sbjct  356  K  356



>ref|XP_010525179.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Tarenaya hassleriana]
Length=355

 Score =   309 bits (791),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 164/181 (91%), Gaps = 3/181 (2%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNI+VAQ IF GS +VNVSHIIHDLSFGPKYPGIHNP
Sbjct  177  RVYGV--LDVQRVAGNFHISVHGLNIYVAQTIFGGSKNVNVSHIIHDLSFGPKYPGIHNP  234

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRYLSKEVL TNQFSV+EYY  + EFDR WPAVYF
Sbjct  235  LDGTVRILHDTSGTFKYYIKIVPTEYRYLSKEVLSTNQFSVTEYYLPMREFDRTWPAVYF  294

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVT-KPNARSTV  311
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWM+RL+E++T KP++RS +
Sbjct  295  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMFRLIESLTRKPSSRSIL  354

Query  310  R  308
            +
Sbjct  355  K  355



>gb|KHG20152.1| Endoplasmic reticulum-Golgi intermediate compartment 3 [Gossypium 
arboreum]
Length=181

 Score =   302 bits (774),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  826  LDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERI  647
            LDVQR AGNFHISVH LNI+VAQMIF G++HVNVSH+IHDLSFGPKYPG+HNPLD T RI
Sbjct  9    LDVQRVAGNFHISVHALNIYVAQMIFGGATHVNVSHMIHDLSFGPKYPGLHNPLDDTVRI  68

Query  646  LHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPI  467
            LH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSVSEY+S ++EFDR WPAVYFLYDLSPI
Sbjct  69   LHDTSGTFKYYIKIVPTEYRYISKEVLPTNQFSVSEYFSPMNEFDRTWPAVYFLYDLSPI  128

Query  466  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNAR  320
            TVTIKEERRSFLHF TRL AVLGGTFALTGMLDRWMYRL++A+T  +AR
Sbjct  129  TVTIKEERRSFLHFTTRLSAVLGGTFALTGMLDRWMYRLIKALTTTSAR  177



>ref|XP_008463181.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Cucumis melo]
 ref|XP_008463182.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Cucumis melo]
Length=346

 Score =   308 bits (789),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 161/176 (91%), Gaps = 2/176 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVAQMIF GS HVNVSH+IHDLSFGPKYPGIHNP
Sbjct  171  RVYGV--LDVQRVAGNFHISVHGLNIFVAQMIFGGSKHVNVSHMIHDLSFGPKYPGIHNP  228

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEY+Y+SK+VLPTNQFSV+EY+S + + DR+WPAVYF
Sbjct  229  LDGTVRILHDTSGTFKYYIKIVPTEYKYISKDVLPTNQFSVTEYFSPMTDSDRSWPAVYF  288

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNAR  320
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFA+TGMLDRWM+R +EA+TKP  R
Sbjct  289  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFAVTGMLDRWMFRFLEALTKPKRR  344



>gb|KJB75348.1| hypothetical protein B456_012G039800 [Gossypium raimondii]
Length=293

 Score =   306 bits (783),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 161/180 (89%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVH LNI+VAQMIF G+ HVNVSH+IHDLSFGPKYPG+HNP
Sbjct  116  RVYGV--LDVQRVAGNFHISVHALNIYVAQMIFGGAKHVNVSHMIHDLSFGPKYPGLHNP  173

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSVSEY+S ++EFDR WPAVYF
Sbjct  174  LDDTVRILHDTSGTFKYYIKIVPTEYRYISKEVLPTNQFSVSEYFSPMNEFDRTWPAVYF  233

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEE RSFLHFITRL AVLGGTFALTGMLDRWMYRL++A+T P+AR   R
Sbjct  234  LYDLSPITVTIKEECRSFLHFITRLSAVLGGTFALTGMLDRWMYRLIKALTTPSARGAYR  293



>gb|ACU19028.1| unknown [Glycine max]
Length=347

 Score =   307 bits (786),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 159/176 (90%), Gaps = 2/176 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNI+VAQMIF G+ +VNVSH IHDLSFGPKYPG+HNP
Sbjct  173  RVYGV--LDVQRVAGNFHISVHGLNIYVAQMIFDGAKNVNVSHFIHDLSFGPKYPGLHNP  230

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIK+VPTEYRY+SKEVLPTNQFSVSEYYS I++FDR WPAVYF
Sbjct  231  LDDTTRILHDTSGTFKYYIKVVPTEYRYISKEVLPTNQFSVSEYYSPINQFDRTWPAVYF  290

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNAR  320
            LYDLSPITVTIKEERRSF HFITRLCAVLGGTFA+TGMLDRWMYRL+E +TK  ++
Sbjct  291  LYDLSPITVTIKEERRSFFHFITRLCAVLGGTFAVTGMLDRWMYRLLETLTKSKSK  346



>gb|KJB75343.1| hypothetical protein B456_012G039800 [Gossypium raimondii]
Length=350

 Score =   307 bits (786),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 161/180 (89%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVH LNI+VAQMIF G+ HVNVSH+IHDLSFGPKYPG+HNP
Sbjct  173  RVYGV--LDVQRVAGNFHISVHALNIYVAQMIFGGAKHVNVSHMIHDLSFGPKYPGLHNP  230

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSVSEY+S ++EFDR WPAVYF
Sbjct  231  LDDTVRILHDTSGTFKYYIKIVPTEYRYISKEVLPTNQFSVSEYFSPMNEFDRTWPAVYF  290

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEE RSFLHFITRL AVLGGTFALTGMLDRWMYRL++A+T P+AR   R
Sbjct  291  LYDLSPITVTIKEECRSFLHFITRLSAVLGGTFALTGMLDRWMYRLIKALTTPSARGAYR  350



>ref|XP_009408557.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Musa acuminata subsp. malaccensis]
Length=350

 Score =   306 bits (784),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 159/180 (88%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHIS+HGLNIFVAQ IF G+  VNVSH+IHDLSFGP YPGIHNP
Sbjct  173  RVYGV--LDVQRVAGNFHISIHGLNIFVAQQIFGGAKLVNVSHVIHDLSFGPSYPGIHNP  230

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT R+LH  SGTFKYYIKIVPTEYRYLSKEVLPTNQFSV+EYY  I   DR+WPAVYF
Sbjct  231  LDGTTRMLHDTSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVTEYYVPIRVTDRSWPAVYF  290

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLHF+TRLCAVLGGTFALTGMLDRW YR+VEAVTK  +RS +R
Sbjct  291  LYDLSPITVTIKEERRSFLHFLTRLCAVLGGTFALTGMLDRWTYRIVEAVTKSKSRSVLR  350



>gb|KEH35189.1| endoplasmic reticulum vesicle transporter [Medicago truncatula]
Length=355

 Score =   306 bits (784),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 158/178 (89%), Gaps = 3/178 (2%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNI+VAQMIF    +VNVSH+IHDLSFGPKYPGIHNP
Sbjct  180  RVYGV--LDVQRVAGNFHISVHGLNIYVAQMIFDAGKNVNVSHVIHDLSFGPKYPGIHNP  237

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLI-HEFDRAWPAVY  491
            LD T RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSV+EY+S I  +FDR WPAVY
Sbjct  238  LDETSRILHDASGTFKYYIKIVPTEYRYISKEVLPTNQFSVTEYFSPITSQFDRTWPAVY  297

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARS  317
            FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFA+TGMLDRWMYRLVEA TKP  + 
Sbjct  298  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFAVTGMLDRWMYRLVEAATKPKNKK  355



>ref|XP_002458688.1| hypothetical protein SORBIDRAFT_03g038260 [Sorghum bicolor]
 gb|EES03808.1| hypothetical protein SORBIDRAFT_03g038260 [Sorghum bicolor]
Length=350

 Score =   306 bits (783),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 143/173 (83%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -1

Query  826  LDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERI  647
            LDVQR AGNFHISVHGLNIFVA+ IF+GSSHVNVSH+IH+LSFGPKYPGIHNPLD T RI
Sbjct  178  LDVQRVAGNFHISVHGLNIFVAEKIFEGSSHVNVSHVIHELSFGPKYPGIHNPLDETSRI  237

Query  646  LHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPI  467
            LH  SGTFKYYIK+VPTEY+YLSK+VLPTNQFSV+EY+  I   DRAWPAVYFLYDLSPI
Sbjct  238  LHDTSGTFKYYIKVVPTEYKYLSKKVLPTNQFSVTEYFLPIRPSDRAWPAVYFLYDLSPI  297

Query  466  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            TVTIKEERR+FLHFITRLCAVLGGTFA+TGMLDRWMYRL+E+VT    RS +R
Sbjct  298  TVTIKEERRNFLHFITRLCAVLGGTFAMTGMLDRWMYRLIESVTNSKTRSVLR  350



>ref|XP_011655240.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Cucumis sativus]
 ref|XP_011655241.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Cucumis sativus]
 gb|KGN51067.1| hypothetical protein Csa_5G426440 [Cucumis sativus]
Length=346

 Score =   305 bits (782),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 160/177 (90%), Gaps = 2/177 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVAQMIF GS HVNVSH+IHDLSFGPKYPGIHNP
Sbjct  171  RVYGV--LDVQRVAGNFHISVHGLNIFVAQMIFGGSKHVNVSHMIHDLSFGPKYPGIHNP  228

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RIL   SGTFKYYIKIVPTEY+Y+SK VLPTNQFSV+EY+S + + DR+WPAVYF
Sbjct  229  LDGTVRILRDTSGTFKYYIKIVPTEYKYISKAVLPTNQFSVTEYFSPMTDSDRSWPAVYF  288

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARS  317
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFA+TGMLDRWM+R +EA+TKP  R+
Sbjct  289  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFAVTGMLDRWMFRFLEALTKPKRRT  345



>ref|XP_009145393.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Brassica rapa]
 emb|CDY10632.1| BnaA05g17300D [Brassica napus]
Length=350

 Score =   305 bits (782),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 162/178 (91%), Gaps = 3/178 (2%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNI+VAQMIF GS +VNVSH+IHDLSFGPKYPGIHNP
Sbjct  172  RVYGV--LDVQRVAGNFHISVHGLNIYVAQMIFGGSKNVNVSHMIHDLSFGPKYPGIHNP  229

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRYLSK++L TNQ+SV+EYY+ ++EFDR WPAVYF
Sbjct  230  LDGTNRILHDTSGTFKYYIKIVPTEYRYLSKDILTTNQYSVTEYYTPMNEFDRTWPAVYF  289

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVT-KPNARS  317
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWM+R++E+ T KP+ RS
Sbjct  290  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMFRIIESFTKKPSTRS  347



>gb|KJB75344.1| hypothetical protein B456_012G039800 [Gossypium raimondii]
Length=388

 Score =   306 bits (785),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 161/180 (89%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVH LNI+VAQMIF G+ HVNVSH+IHDLSFGPKYPG+HNP
Sbjct  211  RVYGV--LDVQRVAGNFHISVHALNIYVAQMIFGGAKHVNVSHMIHDLSFGPKYPGLHNP  268

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSVSEY+S ++EFDR WPAVYF
Sbjct  269  LDDTVRILHDTSGTFKYYIKIVPTEYRYISKEVLPTNQFSVSEYFSPMNEFDRTWPAVYF  328

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEE RSFLHFITRL AVLGGTFALTGMLDRWMYRL++A+T P+AR   R
Sbjct  329  LYDLSPITVTIKEECRSFLHFITRLSAVLGGTFALTGMLDRWMYRLIKALTTPSARGAYR  388



>ref|XP_006858296.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Amborella trichopoda]
 gb|ERN19763.1| hypothetical protein AMTR_s00064p00067290 [Amborella trichopoda]
Length=354

 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = -1

Query  826  LDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERI  647
            LDVQR AGNFHISVHGLNIFVAQ IF+G+ HVNVSH IHDLSFGPKYPGI NPLDGT+RI
Sbjct  181  LDVQRVAGNFHISVHGLNIFVAQQIFEGAMHVNVSHEIHDLSFGPKYPGIQNPLDGTKRI  240

Query  646  LHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPI  467
            L   SGTFKYYIKIVPTEYRY+ KEVLPTNQFSV+EY+  +HEFDR WPAVYFLYDLSPI
Sbjct  241  LRDASGTFKYYIKIVPTEYRYIWKEVLPTNQFSVTEYFVPMHEFDRTWPAVYFLYDLSPI  300

Query  466  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNA  323
            TVTIKEERRSFLHF+TRLCAVLGGTFALTGMLDRWMYRL+EA+TK ++
Sbjct  301  TVTIKEERRSFLHFLTRLCAVLGGTFALTGMLDRWMYRLLEAITKKHS  348



>ref|NP_001051473.1| Os03g0784400 [Oryza sativa Japonica Group]
 gb|AAK72889.1|AC091123_8 unknown protein [Oryza sativa Japonica Group]
 gb|ABF99217.1| Serologically defined breast cancer antigen NY-BR-84, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF13387.1| Os03g0784400 [Oryza sativa Japonica Group]
 dbj|BAG96099.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE60050.1| hypothetical protein OsJ_12848 [Oryza sativa Japonica Group]
Length=350

 Score =   304 bits (778),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 160/181 (88%), Gaps = 3/181 (2%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVA+ IF GSSHVNVSHIIHDLSFGPKYPGIHNP
Sbjct  172  RVYGV--LDVQRVAGNFHISVHGLNIFVAEKIFDGSSHVNVSHIIHDLSFGPKYPGIHNP  229

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR-AWPAVY  491
            LD T RILH  SGTFKYYIKIVPTEYRYLSK+VLPTNQFSV+EY+      DR AWPAVY
Sbjct  230  LDETTRILHDTSGTFKYYIKIVPTEYRYLSKQVLPTNQFSVTEYFVPKRATDRSAWPAVY  289

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTV  311
            FLYDLSPITVTIKEERR+FLHF+TRLCAVLGGTFA+TGMLDRWMYRL+E+VTK   RS +
Sbjct  290  FLYDLSPITVTIKEERRNFLHFLTRLCAVLGGTFAMTGMLDRWMYRLIESVTKSKTRSVL  349

Query  310  R  308
            R
Sbjct  350  R  350



>gb|EEC76283.1| hypothetical protein OsI_13786 [Oryza sativa Indica Group]
Length=350

 Score =   303 bits (777),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 160/181 (88%), Gaps = 3/181 (2%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVA+ IF GSSHVNVSHIIHDLSFGPKYPGIHNP
Sbjct  172  RVYGV--LDVQRVAGNFHISVHGLNIFVAEKIFDGSSHVNVSHIIHDLSFGPKYPGIHNP  229

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR-AWPAVY  491
            LD T RILH  SGTFKYYIKIVPTEYRYLSK+VLPTNQFSV+EY+      DR AWPAVY
Sbjct  230  LDETTRILHDTSGTFKYYIKIVPTEYRYLSKQVLPTNQFSVTEYFVPKRATDRSAWPAVY  289

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTV  311
            FLYDLSPITVTIKEERR+FLHF+TRLCAVLGGTFA+TGMLDRWMYRL+E+VTK   RS +
Sbjct  290  FLYDLSPITVTIKEERRNFLHFLTRLCAVLGGTFAMTGMLDRWMYRLIESVTKSKTRSVL  349

Query  310  R  308
            R
Sbjct  350  R  350



>ref|XP_004982677.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Setaria italica]
Length=350

 Score =   303 bits (776),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 156/173 (90%), Gaps = 0/173 (0%)
 Frame = -1

Query  826  LDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERI  647
            LDVQR AGNFHISVHGLNIFVA+ IF+GSSHVNVSH+IHDLSFGPKYPGIHNPLD T R+
Sbjct  178  LDVQRVAGNFHISVHGLNIFVAEKIFEGSSHVNVSHVIHDLSFGPKYPGIHNPLDETSRV  237

Query  646  LHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPI  467
            LH  SGTFKYYIK+VPTEYRYLSK+VL TNQFSV+EY+  I   DRAWPAVYFLYDLSPI
Sbjct  238  LHDTSGTFKYYIKVVPTEYRYLSKKVLLTNQFSVTEYFLPIRPTDRAWPAVYFLYDLSPI  297

Query  466  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            TVTIKEERR+FLHF+TRLCAVLGGTFA+TGMLDRWMYRL+E+VT    RS +R
Sbjct  298  TVTIKEERRNFLHFLTRLCAVLGGTFAMTGMLDRWMYRLIESVTNSKTRSVLR  350



>ref|XP_006650685.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Oryza brachyantha]
Length=351

 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 160/181 (88%), Gaps = 3/181 (2%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVA+ IF GSSHVNVSH+IHDLSFGPKYPG+HNP
Sbjct  173  RVYGV--LDVQRVAGNFHISVHGLNIFVAEKIFDGSSHVNVSHVIHDLSFGPKYPGLHNP  230

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR-AWPAVY  491
            LD T RILH  SGTFKYYIKIVPTEYRYLSK+VLPTNQFSV+EY+      DR +WPAVY
Sbjct  231  LDDTTRILHDTSGTFKYYIKIVPTEYRYLSKQVLPTNQFSVTEYFVPKRATDRSSWPAVY  290

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTV  311
            FLYDLSPITVTIKEERR+FLHFITRLCAVLGGTFA+TGMLDRWMYRL+E+VTK   RS +
Sbjct  291  FLYDLSPITVTIKEERRNFLHFITRLCAVLGGTFAMTGMLDRWMYRLIESVTKSKTRSVL  350

Query  310  R  308
            R
Sbjct  351  R  351



>ref|XP_003558212.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Brachypodium distachyon]
Length=349

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -1

Query  826  LDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERI  647
            LDVQR AGNFHISVHGLNI+VA+ IF+GSSHVNVSH+IH+LSFGPKYPGIHNPLD T RI
Sbjct  177  LDVQRVAGNFHISVHGLNIYVAEKIFEGSSHVNVSHVIHELSFGPKYPGIHNPLDDTTRI  236

Query  646  LHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPI  467
            LH  SGTFKYYIK+VPTEYRYLSK+VLPTNQFSV+EY+  I   DR+WPAVYFLYDLSPI
Sbjct  237  LHDASGTFKYYIKVVPTEYRYLSKQVLPTNQFSVTEYFVPIRPADRSWPAVYFLYDLSPI  296

Query  466  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            TVTIKEERR+FLHFITRLCAVLGGTFA+TGMLDRWMYR++E+V+    RS +R
Sbjct  297  TVTIKEERRNFLHFITRLCAVLGGTFAMTGMLDRWMYRIIESVSSSKPRSVLR  349



>ref|NP_001131002.1| DUF1692 domain, endoplasmic reticulum vescicle transporter protein 
[Zea mays]
 gb|ACF79423.1| unknown [Zea mays]
 gb|AFW84738.1| DUF1692 domain, endoplasmic reticulum vescicle transporter protein 
[Zea mays]
Length=293

 Score =   299 bits (766),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 156/173 (90%), Gaps = 0/173 (0%)
 Frame = -1

Query  826  LDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERI  647
            LDVQR AGNFHISVHGLNIFVA+ IF+GS+HVNVSH+IH+LSFGPKYPGIHNPLD T RI
Sbjct  121  LDVQRVAGNFHISVHGLNIFVAEKIFEGSNHVNVSHVIHELSFGPKYPGIHNPLDETSRI  180

Query  646  LHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPI  467
            LH  SGTFKYYIK+VPTEY+YLSK+VLPTNQFSV+EY+  I   DRAWPAVYFLYDLSPI
Sbjct  181  LHDTSGTFKYYIKVVPTEYKYLSKKVLPTNQFSVTEYFLPIRPTDRAWPAVYFLYDLSPI  240

Query  466  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            TVTIKEERR+FLHF+TRLCAVLGGTFA+TGMLDRWMY+L++ VT    RS +R
Sbjct  241  TVTIKEERRNFLHFVTRLCAVLGGTFAMTGMLDRWMYQLIKTVTNSKTRSVLR  293



>ref|XP_009135799.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Brassica rapa]
 ref|XP_009135800.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Brassica rapa]
 emb|CDX92937.1| BnaA03g36590D [Brassica napus]
Length=353

 Score =   301 bits (771),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 160/178 (90%), Gaps = 3/178 (2%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFH+SVHGLNI+VAQMIF GS +VNVSH+IHDLSFGPKYPGIHNP
Sbjct  175  RVYGV--LDVQRVAGNFHVSVHGLNIYVAQMIFGGSKNVNVSHMIHDLSFGPKYPGIHNP  232

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RIL   SGTFKYYIKIVPTEYRYLSK+VL TNQ+SV+EYY+ ++EFDR WPAVYF
Sbjct  233  LDDTNRILRDTSGTFKYYIKIVPTEYRYLSKDVLTTNQYSVTEYYTPMNEFDRTWPAVYF  292

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVT-KPNARS  317
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWM+RL+E+ T KP+ RS
Sbjct  293  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMFRLIESFTKKPSTRS  350



>ref|XP_008654279.1| PREDICTED: DUF1692 domain, endoplasmic reticulum vescicle transporter 
protein isoform X1 [Zea mays]
 gb|ACF88129.1| unknown [Zea mays]
 gb|ACG25763.1| serologically defined breast cancer antigen NY-BR-84 [Zea mays]
 gb|ACG31724.1| serologically defined breast cancer antigen NY-BR-84 [Zea mays]
 gb|AFW84737.1| DUF1692 domain, endoplasmic reticulum vescicle transporter protein 
[Zea mays]
Length=350

 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 156/173 (90%), Gaps = 0/173 (0%)
 Frame = -1

Query  826  LDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERI  647
            LDVQR AGNFHISVHGLNIFVA+ IF+GS+HVNVSH+IH+LSFGPKYPGIHNPLD T RI
Sbjct  178  LDVQRVAGNFHISVHGLNIFVAEKIFEGSNHVNVSHVIHELSFGPKYPGIHNPLDETSRI  237

Query  646  LHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPI  467
            LH  SGTFKYYIK+VPTEY+YLSK+VLPTNQFSV+EY+  I   DRAWPAVYFLYDLSPI
Sbjct  238  LHDTSGTFKYYIKVVPTEYKYLSKKVLPTNQFSVTEYFLPIRPTDRAWPAVYFLYDLSPI  297

Query  466  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            TVTIKEERR+FLHF+TRLCAVLGGTFA+TGMLDRWMY+L++ VT    RS +R
Sbjct  298  TVTIKEERRNFLHFVTRLCAVLGGTFAMTGMLDRWMYQLIKTVTNSKTRSVLR  350



>emb|CDY24301.1| BnaC03g42740D [Brassica napus]
Length=353

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 160/178 (90%), Gaps = 3/178 (2%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFH+SVHGLNI+VAQMIF GS +VNVSH+IHDLSFGPKYPGIHNP
Sbjct  175  RVYGV--LDVQRVAGNFHVSVHGLNIYVAQMIFGGSKNVNVSHMIHDLSFGPKYPGIHNP  232

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RIL   SGTFKYYIKIVPTEYRYLSK+VL TNQ+SV+EYY+ ++EFDR WPAVYF
Sbjct  233  LDDTNRILRDTSGTFKYYIKIVPTEYRYLSKDVLTTNQYSVTEYYTPMNEFDRTWPAVYF  292

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVT-KPNARS  317
            LYDLSPITVTI+EERRSFLH ITRLCAVLGGTFALTGMLDRWM+RL+E+ T KP+ RS
Sbjct  293  LYDLSPITVTIREERRSFLHLITRLCAVLGGTFALTGMLDRWMFRLIESFTKKPSTRS  350



>ref|XP_002883352.1| hypothetical protein ARALYDRAFT_479742 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59611.1| hypothetical protein ARALYDRAFT_479742 [Arabidopsis lyrata subsp. 
lyrata]
Length=354

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 157/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNI+VAQMIF GS +VNVSH+IHDLSFGPKYPGIHNP
Sbjct  179  RVYGV--LDVQRVAGNFHISVHGLNIYVAQMIFGGSKNVNVSHMIHDLSFGPKYPGIHNP  236

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIKIVPTEYRYLSK+VL TNQ+SV+EYY+ + EFDR WPAVYF
Sbjct  237  LDDTNRILHDTSGTFKYYIKIVPTEYRYLSKDVLSTNQYSVTEYYTPMTEFDRTWPAVYF  296

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNA  323
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWM+RL+E+  K ++
Sbjct  297  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMFRLIESFNKKSS  351



>ref|XP_010923701.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Elaeis guineensis]
 ref|XP_010923702.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Elaeis guineensis]
Length=350

 Score =   299 bits (766),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 157/180 (87%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGL+I VAQ IF G   VNVSH+IHDLSFGP YPGIHNP
Sbjct  173  RVYGV--LDVQRVAGNFHISVHGLSIHVAQQIFNGLKDVNVSHVIHDLSFGPSYPGIHNP  230

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRYLSK VLPTNQFSV+EY+  + E +R+WPAVYF
Sbjct  231  LDGTTRILHDTSGTFKYYIKIVPTEYRYLSKTVLPTNQFSVTEYFIPLREIERSWPAVYF  290

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYR++EA T+  +RS +R
Sbjct  291  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRIIEAATQSKSRSMLR  350



>ref|XP_010923699.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Elaeis guineensis]
 ref|XP_010923700.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Elaeis guineensis]
Length=351

 Score =   299 bits (766),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 157/180 (87%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGL+I VAQ IF G   VNVSH+IHDLSFGP YPGIHNP
Sbjct  174  RVYGV--LDVQRVAGNFHISVHGLSIHVAQQIFNGLKDVNVSHVIHDLSFGPSYPGIHNP  231

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRYLSK VLPTNQFSV+EY+  + E +R+WPAVYF
Sbjct  232  LDGTTRILHDTSGTFKYYIKIVPTEYRYLSKTVLPTNQFSVTEYFIPLREIERSWPAVYF  291

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYR++EA T+  +RS +R
Sbjct  292  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRIIEAATQSKSRSMLR  351



>ref|XP_010466507.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Camelina sativa]
 ref|XP_010466508.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Camelina sativa]
Length=358

 Score =   299 bits (766),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 158/178 (89%), Gaps = 3/178 (2%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNI+VAQMIF GS +VNVSH+IHDLSFGPKYPGIHNP
Sbjct  181  RVYGV--LDVQRVAGNFHISVHGLNIYVAQMIFGGSKNVNVSHMIHDLSFGPKYPGIHNP  238

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T R+LH  SGTFKYYIKIVPTEYRYLSK+VL TNQ+SV+EYY+ + EFDR WPAVYF
Sbjct  239  LDDTNRMLHDTSGTFKYYIKIVPTEYRYLSKDVLSTNQYSVTEYYTPMTEFDRTWPAVYF  298

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK-PNARS  317
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWM+R +E+  K P+ RS
Sbjct  299  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMFRFIESFNKNPSTRS  356



>emb|CDY37404.1| BnaC05g30260D [Brassica napus]
Length=350

 Score =   299 bits (765),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 160/178 (90%), Gaps = 3/178 (2%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFH+SVHGLNI+VAQMIF GS +VNVSH+IHDLSFGPKYPGIHNP
Sbjct  172  RVYGV--LDVQRVAGNFHVSVHGLNIYVAQMIFGGSKNVNVSHMIHDLSFGPKYPGIHNP  229

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRYLSK++L TNQ+S++EYY+ ++ FDR WPAVYF
Sbjct  230  LDGTNRILHDTSGTFKYYIKIVPTEYRYLSKDILTTNQYSLTEYYTPMNAFDRTWPAVYF  289

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVT-KPNARS  317
            LYDLSPITVTIKEERRSF+H ITRLCAVLGGTFALTGMLDRWM+R++E  T KP+ RS
Sbjct  290  LYDLSPITVTIKEERRSFVHLITRLCAVLGGTFALTGMLDRWMFRMIEYFTKKPSTRS  347



>ref|XP_006298011.1| hypothetical protein CARUB_v10014056mg [Capsella rubella]
 ref|XP_006298012.1| hypothetical protein CARUB_v10014056mg [Capsella rubella]
 gb|EOA30909.1| hypothetical protein CARUB_v10014056mg [Capsella rubella]
 gb|EOA30910.1| hypothetical protein CARUB_v10014056mg [Capsella rubella]
Length=356

 Score =   298 bits (764),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 158/178 (89%), Gaps = 3/178 (2%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNI+VAQMIF GS +VNVSH+IHDLSFGPKYPGIHNP
Sbjct  179  RVYGV--LDVQRVAGNFHISVHGLNIYVAQMIFGGSKNVNVSHMIHDLSFGPKYPGIHNP  236

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T R+LH  SGTFKYYIKIVPTEYRYLSK+VL TNQ+SV+EYY+ + +FDR WPAVYF
Sbjct  237  LDDTNRMLHETSGTFKYYIKIVPTEYRYLSKDVLSTNQYSVTEYYTPMTDFDRTWPAVYF  296

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK-PNARS  317
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWM+RL+E+  K  N RS
Sbjct  297  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMFRLIESFNKNTNTRS  354



>ref|XP_010532527.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Tarenaya hassleriana]
Length=353

 Score =   298 bits (763),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 161/181 (89%), Gaps = 3/181 (2%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNI+VAQMIF GS +VNVSH IHDLSFGPKYPGIHNP
Sbjct  175  RVYGV--LDVQRVAGNFHISVHGLNIYVAQMIFGGSKNVNVSHTIHDLSFGPKYPGIHNP  232

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT R+LH  SGTFKYYIKIVPTEY YLSKEVL TNQFSV+EYY  ++EFDR WP VYF
Sbjct  233  LDGTVRMLHDTSGTFKYYIKIVPTEYGYLSKEVLSTNQFSVTEYYLPMNEFDRTWPGVYF  292

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK-PNARSTV  311
            LYDLSPITV IKEERRSFLHF+TRLCAVLGGTFALTGMLDRWM+RL+E++TK P++ S +
Sbjct  293  LYDLSPITVAIKEERRSFLHFLTRLCAVLGGTFALTGMLDRWMFRLLESITKRPSSGSRL  352

Query  310  R  308
            +
Sbjct  353  K  353



>ref|XP_010511216.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Camelina sativa]
 ref|XP_010511224.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Camelina sativa]
 ref|XP_010488250.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Camelina sativa]
 ref|XP_010488252.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Camelina sativa]
Length=358

 Score =   298 bits (763),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 158/178 (89%), Gaps = 3/178 (2%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNI+VAQMIF GS +VNVSH+IHDLSFGPKYPGIHNP
Sbjct  181  RVYGV--LDVQRVAGNFHISVHGLNIYVAQMIFGGSKNVNVSHMIHDLSFGPKYPGIHNP  238

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T R+LH  SGTFKYYIKIVPTEY+YLSK+VL TNQ+SV+EYY+ + EFDR WPAVYF
Sbjct  239  LDDTNRMLHDTSGTFKYYIKIVPTEYKYLSKDVLSTNQYSVTEYYTPMTEFDRTWPAVYF  298

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK-PNARS  317
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWM+R +E+  K P+ RS
Sbjct  299  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMFRFIESFNKNPSTRS  356



>ref|XP_006406186.1| hypothetical protein EUTSA_v10021173mg [Eutrema salsugineum]
 gb|ESQ47639.1| hypothetical protein EUTSA_v10021173mg [Eutrema salsugineum]
Length=312

 Score =   296 bits (758),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 158/178 (89%), Gaps = 3/178 (2%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFH+SVHGLNI+VAQMIF  S +VNVSH+IHDLSFGPKYPGIHNP
Sbjct  134  RVYGV--LDVQRVAGNFHVSVHGLNIYVAQMIFGSSKNVNVSHMIHDLSFGPKYPGIHNP  191

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RIL   SGTFKYYIK+VPTEYRYLSK+VL TNQ+SV+EYY+ ++EFDR WPAVYF
Sbjct  192  LDDTNRILRDTSGTFKYYIKVVPTEYRYLSKDVLSTNQYSVTEYYTPMNEFDRTWPAVYF  251

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVT-KPNARS  317
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWM+R +E+ T KP+ RS
Sbjct  252  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMFRFIESFTKKPSTRS  309



>ref|XP_008794432.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Phoenix dactylifera]
 ref|XP_008794433.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Phoenix dactylifera]
 ref|XP_008794434.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Phoenix dactylifera]
Length=352

 Score =   298 bits (762),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 156/180 (87%), Gaps = 2/180 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGL+I VAQ IF G   VNVSH+IHDLSFGP YPGIHNP
Sbjct  175  RVYGV--LDVQRVAGNFHISVHGLSIHVAQQIFDGLKDVNVSHVIHDLSFGPTYPGIHNP  232

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT RILH  SGTFKYYIKIVPTEYRYLSK VLPTNQFSV+EY+  + E +R+WPAVYF
Sbjct  233  LDGTTRILHDTSGTFKYYIKIVPTEYRYLSKAVLPTNQFSVTEYFVPLREIERSWPAVYF  292

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEER SFLHFITRLCAVLGGTFALTGMLDRWMYR++EA TK  +RS +R
Sbjct  293  LYDLSPITVTIKEERPSFLHFITRLCAVLGGTFALTGMLDRWMYRIIEAATKSKSRSILR  352



>ref|XP_006406187.1| hypothetical protein EUTSA_v10021173mg [Eutrema salsugineum]
 gb|ESQ47640.1| hypothetical protein EUTSA_v10021173mg [Eutrema salsugineum]
Length=313

 Score =   296 bits (758),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 158/178 (89%), Gaps = 3/178 (2%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFH+SVHGLNI+VAQMIF  S +VNVSH+IHDLSFGPKYPGIHNP
Sbjct  135  RVYGV--LDVQRVAGNFHVSVHGLNIYVAQMIFGSSKNVNVSHMIHDLSFGPKYPGIHNP  192

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RIL   SGTFKYYIK+VPTEYRYLSK+VL TNQ+SV+EYY+ ++EFDR WPAVYF
Sbjct  193  LDDTNRILRDTSGTFKYYIKVVPTEYRYLSKDVLSTNQYSVTEYYTPMNEFDRTWPAVYF  252

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVT-KPNARS  317
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWM+R +E+ T KP+ RS
Sbjct  253  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMFRFIESFTKKPSTRS  310



>ref|NP_188868.2| Endoplasmic reticulum vesicle transporter protein [Arabidopsis 
thaliana]
 gb|AAK43988.1|AF370173_1 unknown protein [Arabidopsis thaliana]
 dbj|BAD43192.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43746.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43970.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44059.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD94071.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE76618.1| Endoplasmic reticulum vesicle transporter protein [Arabidopsis 
thaliana]
Length=354

 Score =   297 bits (760),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 158/178 (89%), Gaps = 3/178 (2%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNI+VAQMIF GS +VNVSH+IHDLSFGPKYPGIHNP
Sbjct  179  RVYGV--LDVQRVAGNFHISVHGLNIYVAQMIFGGSKNVNVSHMIHDLSFGPKYPGIHNP  236

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIKIVPTEYRYLSK+VL TNQ+SV+EY++ + EFDR WPAVYF
Sbjct  237  LDDTNRILHDTSGTFKYYIKIVPTEYRYLSKDVLSTNQYSVTEYFTPMTEFDRTWPAVYF  296

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVT-KPNARS  317
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTGMLDRWM+R +E+   KP+ R+
Sbjct  297  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMFRFIESFNKKPSTRA  354



>gb|KJB75346.1| hypothetical protein B456_012G039800 [Gossypium raimondii]
Length=347

 Score =   295 bits (756),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 158/180 (88%), Gaps = 5/180 (3%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVH LNI+VAQMIF G+ HVNVSH+IHDLSFGPKYPG+HNP
Sbjct  173  RVYGV--LDVQRVAGNFHISVHALNIYVAQMIFGGAKHVNVSHMIHDLSFGPKYPGLHNP  230

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSVSEY+S ++EFDR WPAVYF
Sbjct  231  LDDTVRILHDTSGTFKYYIKIVPTEYRYISKEVLPTNQFSVSEYFSPMNEFDRTWPAVYF  290

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEE RSFLHFITRL AVLGGTFALT   DRWMYRL++A+T P+AR   R
Sbjct  291  LYDLSPITVTIKEECRSFLHFITRLSAVLGGTFALT---DRWMYRLIKALTTPSARGAYR  347



>dbj|BAJ84787.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85349.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   295 bits (756),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 138/173 (80%), Positives = 153/173 (88%), Gaps = 0/173 (0%)
 Frame = -1

Query  826  LDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERI  647
            LDVQR AGNFHISVHGLNIFVA  IF GSSHVNVSH+IH LSFGP+YPGIHNPLD T RI
Sbjct  176  LDVQRVAGNFHISVHGLNIFVANQIFDGSSHVNVSHVIHRLSFGPEYPGIHNPLDDTSRI  235

Query  646  LHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPI  467
            LH  SGTFKYYIK+VPTEYRYLSK VLPTNQFSV+EY+  I   DR+WPAVYFLYDLSPI
Sbjct  236  LHDTSGTFKYYIKVVPTEYRYLSKGVLPTNQFSVTEYFVPIRPTDRSWPAVYFLYDLSPI  295

Query  466  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            TVTI+EERR+FLHFITRLCAVLGGTFA+TGMLDRWMYR++E+++    RS +R
Sbjct  296  TVTIREERRNFLHFITRLCAVLGGTFAMTGMLDRWMYRIIESISSSKPRSGMR  348



>gb|EPS71314.1| hypothetical protein M569_03444, partial [Genlisea aurea]
Length=357

 Score =   295 bits (755),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/173 (80%), Positives = 155/173 (90%), Gaps = 0/173 (0%)
 Frame = -1

Query  826  LDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERI  647
            L+VQR AGNFHISVHGLNI VAQ IF GS+HVNVSH+IHDL FGPKYPGIHNPLD T RI
Sbjct  185  LEVQRVAGNFHISVHGLNIIVAQKIFDGSAHVNVSHVIHDLGFGPKYPGIHNPLDDTVRI  244

Query  646  LHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPI  467
            LH  SGTFKYYIKIVPTEY+Y+SKEVLPTNQFSV+EY+S + +  R+WPAV+FLYDLSPI
Sbjct  245  LHETSGTFKYYIKIVPTEYKYISKEVLPTNQFSVTEYFSPMDKDSRSWPAVFFLYDLSPI  304

Query  466  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            TVTI+EERRSF HFITRLCAVLGGTFALTGMLD+WM+RL+ A+TKP   S+VR
Sbjct  305  TVTIREERRSFRHFITRLCAVLGGTFALTGMLDKWMHRLIGAMTKPRTGSSVR  357



>ref|XP_009407709.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Musa acuminata subsp. malaccensis]
Length=352

 Score =   295 bits (754),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 149/173 (86%), Gaps = 0/173 (0%)
 Frame = -1

Query  826  LDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERI  647
            LDVQR AGNFH+SVHGLN FVAQ IF G+ +VNVSH+IHDLSFGPKYPGIHNPLDGT RI
Sbjct  180  LDVQRVAGNFHVSVHGLNFFVAQQIFDGAKNVNVSHVIHDLSFGPKYPGIHNPLDGTTRI  239

Query  646  LHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPI  467
            LH  SGTFKYYIKIVPTEYRYLS  V+PTNQFSV+EY+      DR+WPAVYFLYDLSPI
Sbjct  240  LHDTSGTFKYYIKIVPTEYRYLSHRVMPTNQFSVTEYFVPTRAIDRSWPAVYFLYDLSPI  299

Query  466  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
             VTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYR++EA TK    S  R
Sbjct  300  IVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRIIEAFTKSKTGSIFR  352



>gb|EMT22267.1| hypothetical protein F775_30192 [Aegilops tauschii]
Length=393

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/173 (80%), Positives = 153/173 (88%), Gaps = 0/173 (0%)
 Frame = -1

Query  826  LDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERI  647
            LDVQR AGNFHISVHGLNIFVA  IF GSSHVNVSH+IH LSFGP+YPGIHNPLD T RI
Sbjct  176  LDVQRVAGNFHISVHGLNIFVANQIFDGSSHVNVSHVIHRLSFGPEYPGIHNPLDDTSRI  235

Query  646  LHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPI  467
            LH  SGTFKYYIK+VPTEYRYLSK VLPTNQFSV+EY+  I   DR+WPAVYFLYDLSPI
Sbjct  236  LHDTSGTFKYYIKVVPTEYRYLSKGVLPTNQFSVTEYFVPIRPTDRSWPAVYFLYDLSPI  295

Query  466  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            TVTI+EERR+FLHFITRLCAVLGGTFA+TGMLDRWMYR++E+++    RS +R
Sbjct  296  TVTIREERRNFLHFITRLCAVLGGTFAMTGMLDRWMYRIIESISSSKPRSGMR  348



>gb|KJB75347.1| hypothetical protein B456_012G039800 [Gossypium raimondii]
Length=385

 Score =   295 bits (756),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 158/180 (88%), Gaps = 5/180 (3%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVH LNI+VAQMIF G+ HVNVSH+IHDLSFGPKYPG+HNP
Sbjct  211  RVYGV--LDVQRVAGNFHISVHALNIYVAQMIFGGAKHVNVSHMIHDLSFGPKYPGLHNP  268

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIKIVPTEYRY+SKEVLPTNQFSVSEY+S ++EFDR WPAVYF
Sbjct  269  LDDTVRILHDTSGTFKYYIKIVPTEYRYISKEVLPTNQFSVSEYFSPMNEFDRTWPAVYF  328

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            LYDLSPITVTIKEE RSFLHFITRL AVLGGTFALT   DRWMYRL++A+T P+AR   R
Sbjct  329  LYDLSPITVTIKEECRSFLHFITRLSAVLGGTFALT---DRWMYRLIKALTTPSARGAYR  385



>gb|KJB75349.1| hypothetical protein B456_012G039800 [Gossypium raimondii]
Length=406

 Score =   296 bits (757),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 161/198 (81%), Gaps = 20/198 (10%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVH LNI+VAQMIF G+ HVNVSH+IHDLSFGPKYPG+HNP
Sbjct  211  RVYGV--LDVQRVAGNFHISVHALNIYVAQMIFGGAKHVNVSHMIHDLSFGPKYPGLHNP  268

Query  667  LDGTERILHAGSGTFKYYIK------------------IVPTEYRYLSKEVLPTNQFSVS  542
            LD T RILH  SGTFKYYIK                  IVPTEYRY+SKEVLPTNQFSVS
Sbjct  269  LDDTVRILHDTSGTFKYYIKRASIKLLRRLHSNIGCLQIVPTEYRYISKEVLPTNQFSVS  328

Query  541  EYYSLIHEFDRAWPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRW  362
            EY+S ++EFDR WPAVYFLYDLSPITVTIKEE RSFLHFITRL AVLGGTFALTGMLDRW
Sbjct  329  EYFSPMNEFDRTWPAVYFLYDLSPITVTIKEECRSFLHFITRLSAVLGGTFALTGMLDRW  388

Query  361  MYRLVEAVTKPNARSTVR  308
            MYRL++A+T P+AR   R
Sbjct  389  MYRLIKALTTPSARGAYR  406



>gb|EMS49840.1| hypothetical protein TRIUR3_11686 [Triticum urartu]
Length=532

 Score =   296 bits (757),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/173 (80%), Positives = 153/173 (88%), Gaps = 0/173 (0%)
 Frame = -1

Query  826  LDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERI  647
            LDVQR AGNFHISVHGLNIFVA  IF GSSHVNVSH+IH LSFGP+YPGIHNPLD T RI
Sbjct  176  LDVQRVAGNFHISVHGLNIFVANQIFDGSSHVNVSHVIHRLSFGPEYPGIHNPLDDTSRI  235

Query  646  LHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPI  467
            LH  SGTFKYYIK+VPTEYRYLSK VLPTNQFSV+EY+  I   DR+WPAVYFLYDLSPI
Sbjct  236  LHDTSGTFKYYIKVVPTEYRYLSKGVLPTNQFSVTEYFVPIRPTDRSWPAVYFLYDLSPI  295

Query  466  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            TVTI+EERR+FLHFITRLCAVLGGTFA+TGMLDRWMYR++E+++    RS +R
Sbjct  296  TVTIREERRNFLHFITRLCAVLGGTFAMTGMLDRWMYRIIESISSSKPRSGMR  348



>ref|XP_008348329.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like, partial [Malus domestica]
Length=259

 Score =   278 bits (712),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 147/158 (93%), Gaps = 2/158 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVAQMIF GS +VNVSHI+HD+SFGPKYPGIHNP
Sbjct  94   RVFGV--LDVQRVAGNFHISVHGLNIFVAQMIFGGSKNVNVSHIVHDMSFGPKYPGIHNP  151

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LDGT+RILH  SGTFKYYIKIVPTEYRY+SKEVL TNQFSV+EY+S + +FDR+WPAVYF
Sbjct  152  LDGTDRILHDTSGTFKYYIKIVPTEYRYISKEVLSTNQFSVTEYFSPMKQFDRSWPAVYF  211

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGM  374
            LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTG+
Sbjct  212  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGL  249



>gb|KDO37536.1| hypothetical protein CISIN_1g041965mg [Citrus sinensis]
Length=166

 Score =   271 bits (692),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = -1

Query  754  IFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSK  575
            IF G+ +VNVSH+IHDLSFGPKYPGIHNPLDGT R+LH  SGTFKYYIKIVPTEYRY+SK
Sbjct  18   IFGGAKNVNVSHVIHDLSFGPKYPGIHNPLDGTVRMLHDTSGTFKYYIKIVPTEYRYISK  77

Query  574  EVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGG  395
            +VLPTNQFSV+EY+S  +EFDR WPAVYFLYDLSPITVTIKEERRSFLH ITRLCAVLGG
Sbjct  78   DVLPTNQFSVTEYFSTFNEFDRTWPAVYFLYDLSPITVTIKEERRSFLHLITRLCAVLGG  137

Query  394  TFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            TFALTGMLDRWMYRL+EA+TKP+ARS +R
Sbjct  138  TFALTGMLDRWMYRLLEALTKPSARSVLR  166



>dbj|BAB17274.1| unnamed protein product [Arabidopsis thaliana]
Length=333

 Score =   272 bits (695),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 142/157 (90%), Gaps = 2/157 (1%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNI+VAQMIF GS +VNVSH+IHDLSFGPKYPGIHNP
Sbjct  179  RVYGV--LDVQRVAGNFHISVHGLNIYVAQMIFGGSKNVNVSHMIHDLSFGPKYPGIHNP  236

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYF  488
            LD T RILH  SGTFKYYIKIVPTEYRYLSK+VL TNQ+SV+EY++ + EFDR WPAVYF
Sbjct  237  LDDTNRILHDTSGTFKYYIKIVPTEYRYLSKDVLSTNQYSVTEYFTPMTEFDRTWPAVYF  296

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTG  377
            LYDLSPITVTIKEERRSFLH ITRLCAVLGGTFALTG
Sbjct  297  LYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTG  333



>gb|AFK38705.1| unknown [Medicago truncatula]
Length=148

 Score =   261 bits (668),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 132/148 (89%), Gaps = 1/148 (1%)
 Frame = -1

Query  757  MIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLS  578
            MIF    +VNVSH+IHDLSFGPKYPGIHNPLD T RILH  SGTFKYYIKIVPTEYRY+S
Sbjct  1    MIFDAGKNVNVSHVIHDLSFGPKYPGIHNPLDETSRILHDASGTFKYYIKIVPTEYRYIS  60

Query  577  KEVLPTNQFSVSEYYSLI-HEFDRAWPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVL  401
            KEVLPTNQFSV+EY+S I  +FDR WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVL
Sbjct  61   KEVLPTNQFSVTEYFSPITSQFDRTWPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVL  120

Query  400  GGTFALTGMLDRWMYRLVEAVTKPNARS  317
            GGTFA+TGMLDRWMYRLVEA TKP  + 
Sbjct  121  GGTFAVTGMLDRWMYRLVEAATKPKNKK  148



>gb|KJB75345.1| hypothetical protein B456_012G039800 [Gossypium raimondii]
Length=322

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -1

Query  754  IFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSK  575
            IF G+ HVNVSH+IHDLSFGPKYPG+HNPLD T RILH  SGTFKYYIKIVPTEYRY+SK
Sbjct  174  IFGGAKHVNVSHMIHDLSFGPKYPGLHNPLDDTVRILHDTSGTFKYYIKIVPTEYRYISK  233

Query  574  EVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGG  395
            EVLPTNQFSVSEY+S ++EFDR WPAVYFLYDLSPITVTIKEE RSFLHFITRL AVLGG
Sbjct  234  EVLPTNQFSVSEYFSPMNEFDRTWPAVYFLYDLSPITVTIKEECRSFLHFITRLSAVLGG  293

Query  394  TFALTGMLDRWMYRLVEAVTKPNARSTVR  308
            TFALTGMLDRWMYRL++A+T P+AR   R
Sbjct  294  TFALTGMLDRWMYRLIKALTTPSARGAYR  322



>ref|XP_001754824.1| predicted protein [Physcomitrella patens]
 gb|EDQ80278.1| predicted protein [Physcomitrella patens]
Length=347

 Score =   251 bits (642),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = -1

Query  826  LDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERI  647
            LDV+R AGNFHIS+HGL+++VA  IF+    VNVSH+IHDLSFGP YPG HNPLDG+ERI
Sbjct  176  LDVERVAGNFHISMHGLSLYVASKIFEAGYEVNVSHVIHDLSFGPTYPGHHNPLDGSERI  235

Query  646  LHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPI  467
            LH  SGTFKY++KIVPTEY YL  EV+PTNQFSV+EYY      DR++PAVYF+YDLSPI
Sbjct  236  LHDTSGTFKYFLKIVPTEYHYLHGEVMPTNQFSVTEYYQRTKPSDRSYPAVYFVYDLSPI  295

Query  466  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAV  338
             VTI+E RR+F HFITRLCAVLGGTFA+TGMLDRWM R+++ V
Sbjct  296  VVTIREHRRNFGHFITRLCAVLGGTFAVTGMLDRWMSRIIDFV  338



>ref|XP_002993277.1| hypothetical protein SELMODRAFT_431378 [Selaginella moellendorffii]
 ref|XP_002994225.1| hypothetical protein SELMODRAFT_236933 [Selaginella moellendorffii]
 gb|EFJ04730.1| hypothetical protein SELMODRAFT_236933 [Selaginella moellendorffii]
 gb|EFJ05698.1| hypothetical protein SELMODRAFT_431378 [Selaginella moellendorffii]
Length=333

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 135/168 (80%), Gaps = 4/168 (2%)
 Frame = -1

Query  826  LDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERI  647
            LDV+R AGNFHIS+HG+++     IF     VNVSHII+DLSFGPKYPGIHNPLD T RI
Sbjct  167  LDVERVAGNFHISMHGMSL----QIFHSVKEVNVSHIINDLSFGPKYPGIHNPLDRTVRI  222

Query  646  LHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPI  467
            L   +GTFKY+IKIVPTEYRYL+   LPTNQFSV EYY    + D +WPAVYFLYDLSPI
Sbjct  223  LRDTAGTFKYFIKIVPTEYRYLNGGKLPTNQFSVGEYYLAARDDDISWPAVYFLYDLSPI  282

Query  466  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNA  323
            TV IKEERRSF H +TR CA++GGTF+LTGMLDRW+YRLVE++T+   
Sbjct  283  TVLIKEERRSFGHLLTRFCAIVGGTFSLTGMLDRWIYRLVESITRAKG  330



>ref|XP_004959338.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Setaria italica]
Length=297

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -1

Query  826  LDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERI  647
            LDVQR AGNFHISVHGLNIFVA+ IF+GSSHVNVSH+IHDLSFGPKYPGIHNPLD T RI
Sbjct  178  LDVQRVAGNFHISVHGLNIFVAEKIFEGSSHVNVSHVIHDLSFGPKYPGIHNPLDETTRI  237

Query  646  LHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFL  485
            LH  SGTFKYYIK+VPTEYRYLSK+VLPTNQFSV+EY+  I   DRAWP   F+
Sbjct  238  LHDTSGTFKYYIKVVPTEYRYLSKKVLPTNQFSVTEYFLPIRPTDRAWPGNCFI  291



>ref|XP_005651581.1| DUF1692-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE27037.1| DUF1692-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=327

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 120/163 (74%), Gaps = 0/163 (0%)
 Frame = -1

Query  826  LDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERI  647
            LD+QR AGNF +SVH  + F    +   ++ +N SHIIH +SFGP +PG  NPLDG ERI
Sbjct  160  LDLQRVAGNFRVSVHVEDFFALTRLQADTTGINSSHIIHRVSFGPTFPGQVNPLDGAERI  219

Query  646  LHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPI  467
            L   SGTFKY++K+VPTEY++ +     TNQ+SV+EY +++H+ +   P+V+F YD+SPI
Sbjct  220  LDKESGTFKYFLKVVPTEYQWSAGTRTTTNQYSVTEYDTVVHKGEMQMPSVWFSYDISPI  279

Query  466  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAV  338
            +VTI E R+SF H + R CAV+GG FA+TGM DRW++R+V A+
Sbjct  280  SVTISEIRKSFAHLLVRFCAVVGGVFAVTGMFDRWVHRIVTAI  322



>ref|XP_005826990.1| hypothetical protein GUITHDRAFT_154283 [Guillardia theta CCMP2712]
 gb|EKX40010.1| hypothetical protein GUITHDRAFT_154283 [Guillardia theta CCMP2712]
Length=331

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 110/153 (72%), Gaps = 3/153 (2%)
 Frame = -1

Query  829  TLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTER  650
            TL+ Q+ +GNFH+S+H  +  V   +F   + VN SHI++ LSFG  YPG+ NPLDG  +
Sbjct  158  TLNAQKVSGNFHLSLHAQDFHVLAQVFPDRATVNTSHIVNHLSFGRDYPGLKNPLDGEMK  217

Query  649  ILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSP  470
            +L  GSGTF+YYIKIVPT++ +L   ++ TNQ+SV++++  + +    +PAVYF+YD+SP
Sbjct  218  VLDQGSGTFEYYIKIVPTKFHHLDGTIIDTNQYSVTDHFRKLQD---GFPAVYFIYDISP  274

Query  469  ITVTIKEERRSFLHFITRLCAVLGGTFALTGML  371
            I V +K+ ++SF H+ T+LCA+ GG + +TG L
Sbjct  275  IMVRVKQWKQSFSHYATQLCAITGGMYVVTGQL  307



>ref|XP_009608372.1| PREDICTED: probable endoplasmic reticulum-Golgi intermediate 
compartment protein 3 [Nicotiana tomentosiformis]
Length=264

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 73/81 (90%), Gaps = 2/81 (2%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNIFVAQMIF+GS+HVNVSHIIHDLSFGPKYPGIHNP
Sbjct  173  RVYGV--LDVQRVAGNFHISVHGLNIFVAQMIFEGSTHVNVSHIIHDLSFGPKYPGIHNP  230

Query  667  LDGTERILHAGSGTFKYYIKI  605
            LDGT RIL   SGTFKY+IK+
Sbjct  231  LDGTSRILRGASGTFKYFIKV  251



>ref|XP_008804335.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Phoenix dactylifera]
Length=356

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 109/170 (64%), Gaps = 6/170 (4%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMI-FQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            LDV + AGNFH     S H  NI V  ++ FQ  S+ ++SH I+ LSFG ++PG+ NPLD
Sbjct  180  LDVNKVAGNFHFVPGKSFHKSNIHVHDLLAFQAESY-DISHKINKLSFGKEFPGVINPLD  238

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLY  482
            G +    A SG ++Y+IK+VPT Y  +    + +NQFSV+E++   + + +  P V+F Y
Sbjct  239  GAQWTRQASSGMYQYFIKVVPTIYTDIRGRKIHSNQFSVTEHFKDGNVYPKPPPGVFFFY  298

Query  481  DLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            D SPI V   EE +S LHF+T LCA++GG F ++G++D ++Y    A+ K
Sbjct  299  DFSPIKVIFTEENKSLLHFLTNLCAIVGGVFTVSGIIDAFIYHGQRAIKK  348



>ref|XP_008804334.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Phoenix dactylifera]
Length=384

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 109/170 (64%), Gaps = 6/170 (4%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMI-FQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            LDV + AGNFH     S H  NI V  ++ FQ  S+ ++SH I+ LSFG ++PG+ NPLD
Sbjct  208  LDVNKVAGNFHFVPGKSFHKSNIHVHDLLAFQAESY-DISHKINKLSFGKEFPGVINPLD  266

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLY  482
            G +    A SG ++Y+IK+VPT Y  +    + +NQFSV+E++   + + +  P V+F Y
Sbjct  267  GAQWTRQASSGMYQYFIKVVPTIYTDIRGRKIHSNQFSVTEHFKDGNVYPKPPPGVFFFY  326

Query  481  DLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            D SPI V   EE +S LHF+T LCA++GG F ++G++D ++Y    A+ K
Sbjct  327  DFSPIKVIFTEENKSLLHFLTNLCAIVGGVFTVSGIIDAFIYHGQRAIKK  376



>ref|XP_004355625.1| endoplasmic reticulum-golgi intermediate compartment protein 
3 [Dictyostelium fasciculatum]
 gb|EGG17141.1| endoplasmic reticulum-golgi intermediate compartment protein 
3 [Dictyostelium fasciculatum]
Length=335

 Score =   142 bits (358),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 110/174 (63%), Gaps = 12/174 (7%)
 Frame = -1

Query  826  LDVQRGAGNFHIS------VHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPL  665
            ++V + AGNFH +       H +++   Q  F+GS   N+SH I+ LSFG  +PGI NPL
Sbjct  157  INVNKVAGNFHFAPGKSFQQHHMHVHDLQA-FKGS--FNLSHSINRLSFGNDFPGIKNPL  213

Query  664  DGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR---AWPAV  494
            DG  +    GSG F+YYIK+VPT Y  L+   + TNQFSV+E+Y L+ + D      P +
Sbjct  214  DGVTKTEMVGSGMFQYYIKVVPTLYEGLNGNRISTNQFSVTEHYRLLAKKDEEPSGLPGL  273

Query  493  YFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            +F+YDLSPI + + E+ +SF  F+T +CA++GG F + G+LD  +Y+  + + K
Sbjct  274  FFMYDLSPIMMKVSEQGKSFASFLTSVCAIVGGVFTVAGILDSMIYKTTKNLKK  327



>gb|EYU18489.1| hypothetical protein MIMGU_mgv1a008051mg [Erythranthe guttata]
Length=386

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 107/171 (63%), Gaps = 5/171 (3%)
 Frame = -1

Query  829  TLDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            +L+V + AGNFH     S H  N+ +  ++   S   N+SH I+ LSFG   PGI NPLD
Sbjct  208  SLEVNKVAGNFHFAPGKSFHQTNMHLLDLLALQSESYNISHKINKLSFGDSIPGIVNPLD  267

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVYFL  485
            G E +    +G ++Y++K+VPT Y  +    + +NQFSV+E+Y    E   R+ P ++F 
Sbjct  268  GVEWVQIRPNGVYQYFLKVVPTIYTNIKGHTIQSNQFSVTEHYKSSEEDQYRSLPGIFFF  327

Query  484  YDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            YDLSPI VT  EE  SFLHF+T +CA++GG F + G++D ++Y   +A+ K
Sbjct  328  YDLSPIKVTFTEEHASFLHFLTHICAIVGGVFTVAGIVDSFIYHGQKAIRK  378



>ref|XP_005839166.1| hypothetical protein GUITHDRAFT_65491 [Guillardia theta CCMP2712]
 gb|EKX52186.1| hypothetical protein GUITHDRAFT_65491 [Guillardia theta CCMP2712]
Length=425

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 97/160 (61%), Gaps = 5/160 (3%)
 Frame = -1

Query  820  VQRGAGNFHIS-----VHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGT  656
            V + AGNFH S        + +    ++    +  NVSH I+ LSFG KYPG  NPLDG 
Sbjct  255  VNKVAGNFHFSPGKSFSQQVGVHFQDLLVLRKTDYNVSHAINHLSFGRKYPGRVNPLDGV  314

Query  655  ERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDL  476
             RI    S  ++Y++K+VPT+Y+Y +  +L TNQFS +E    +  F R  P V+F YDL
Sbjct  315  VRICEFRSAMYQYFVKVVPTQYQYRNGTILSTNQFSTTENTRQLEGFTRGLPGVFFFYDL  374

Query  475  SPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMY  356
            SPI  T+ E   SFLHF+T LCA++GG F + G++D  +Y
Sbjct  375  SPIKATLAERNNSFLHFLTGLCAIIGGVFTVMGIIDSTIY  414



>ref|XP_002285801.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Vitis vinifera]
 ref|XP_010664314.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Vitis vinifera]
 emb|CBI19141.3| unnamed protein product [Vitis vinifera]
Length=386

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 108/171 (63%), Gaps = 7/171 (4%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            L+V + AGNFH     S    NI V  ++       N+SH I+ L+FG  +PG+ NPLDG
Sbjct  209  LEVNKVAGNFHFAPGKSFQQSNIHVHDLLAFQKDSFNISHKINRLAFGDYFPGVVNPLDG  268

Query  658  TERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR--AWPAVYFL  485
             + I    SG ++Y+IK+VPT Y ++S   + TNQFSV+E++    E  R  + P V+F 
Sbjct  269  VQWIQATPSGMYQYFIKVVPTVYTHVSGHTISTNQFSVTEHFRNA-ELGRLQSLPGVFFF  327

Query  484  YDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            YDLSPI VT  EE  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  328  YDLSPIKVTFTEEHVSFLHFLTNVCAIVGGVFTVSGILDSFIYHSQKAIKK  378



>gb|EEE61111.1| hypothetical protein OsJ_15023 [Oryza sativa Japonica Group]
Length=369

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 112/171 (65%), Gaps = 7/171 (4%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMI-FQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            L+V + AGNFH     S    N+ V  ++ FQ  S  NVSH I+ LSFG ++PG+ NPLD
Sbjct  192  LEVNKVAGNFHFAPGKSFQKANVHVHDLLPFQKDS-FNVSHKINKLSFGQRFPGVVNPLD  250

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVYFL  485
            G + + H+  G ++Y+IK+VPT Y  +++ ++ +NQFSV+E++        +A P V+F 
Sbjct  251  GAQWMQHSSYGMYQYFIKVVPTVYTDINEHIILSNQFSVTEHFRSSESGRIQAVPGVFFF  310

Query  484  YDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            YDLSPI VT  E+  SFLHF+T +CA++GG F ++G++D ++Y    A+ K
Sbjct  311  YDLSPIKVTFTEQHVSFLHFLTNVCAIVGGVFTVSGIIDSFVYHGQRAIKK  361



>emb|CAE02574.2| OSJNBa0006M15.17 [Oryza sativa Japonica Group]
 emb|CAH67017.1| H0523F07.5 [Oryza sativa Indica Group]
 gb|EEC77387.1| hypothetical protein OsI_16129 [Oryza sativa Indica Group]
Length=386

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 112/171 (65%), Gaps = 7/171 (4%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMI-FQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            L+V + AGNFH     S    N+ V  ++ FQ  S  NVSH I+ LSFG ++PG+ NPLD
Sbjct  209  LEVNKVAGNFHFAPGKSFQKANVHVHDLLPFQKDS-FNVSHKINKLSFGQRFPGVVNPLD  267

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVYFL  485
            G + + H+  G ++Y+IK+VPT Y  +++ ++ +NQFSV+E++        +A P V+F 
Sbjct  268  GAQWMQHSSYGMYQYFIKVVPTVYTDINEHIILSNQFSVTEHFRSSESGRIQAVPGVFFF  327

Query  484  YDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            YDLSPI VT  E+  SFLHF+T +CA++GG F ++G++D ++Y    A+ K
Sbjct  328  YDLSPIKVTFTEQHVSFLHFLTNVCAIVGGVFTVSGIIDSFVYHGQRAIKK  378



>ref|XP_010934993.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Elaeis guineensis]
Length=384

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 106/169 (63%), Gaps = 4/169 (2%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            LDV + AGNFH     S H   I V  ++   +   ++SH I+ LSFG ++PG+ NPLDG
Sbjct  208  LDVNKVAGNFHFMPGKSFHHSKIHVHDLLAFQTESYDISHKINKLSFGEEFPGVINPLDG  267

Query  658  TERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYD  479
             +    A SGT++Y+IK+VPT Y  +    + +NQFSV+E++   + + +  P V+F YD
Sbjct  268  AQWTQKASSGTYQYFIKVVPTIYTDIRGRKIHSNQFSVTEHFKDGNVYPKPPPGVFFFYD  327

Query  478  LSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             SPI V   EE +S LHF+T LCA++GG F ++G++D ++Y    A+ K
Sbjct  328  FSPIKVIFTEESKSLLHFLTNLCAIIGGVFTVSGIIDAFVYHGQRAIKK  376



>ref|XP_005232398.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like, partial [Falco peregrinus]
Length=300

 Score =   138 bits (348),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 105/178 (59%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  122  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  174

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+   H  S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  175  IVNPLDGTDVTAHQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  234

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  235  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGIFTVAGLIDSLIYHSARAIQK  292



>ref|XP_005534206.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Pseudopodoces humilis]
Length=390

 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 105/178 (59%), Gaps = 13/178 (7%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I    +   G  ++NV+H I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIRFHDLQSFGLDNINVTHYIKHLSFGMDYPG  264

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT  I    S  F+Y++K+VPT YR +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  265  IVNPLDGTAVIAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTRHEKIANGLLGDQG  324

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  325  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  382



>ref|XP_001759631.1| predicted protein [Physcomitrella patens]
 gb|EDQ75543.1| predicted protein [Physcomitrella patens]
Length=382

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 107/177 (60%), Gaps = 5/177 (3%)
 Frame = -1

Query  829  TLDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            TL+  + AGNFH     S    N+ V  ++  G    NVSH I+++SFG +YPG  NPLD
Sbjct  206  TLEANKVAGNFHFAPGKSFQQANMHVHDLMAFGKDSFNVSHKINEISFGVRYPGAVNPLD  265

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF-DRAWPAVYFL  485
              ERI     G ++Y+IK+VPT Y       + TNQF+V++++  +    D A P V+F 
Sbjct  266  KLERIQTTTHGMYQYFIKVVPTVYTDTRGRKISTNQFAVTDHFKGVGPGEDHALPGVFFF  325

Query  484  YDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNARST  314
            YDLSPI V   E+R SF HF+T +CA++GG F+++G++D ++Y   + + K   + T
Sbjct  326  YDLSPIKVKFTEKRMSFFHFLTNVCAIVGGVFSVSGIIDAFVYHGQKQIKKRLGKDT  382



>ref|XP_005438238.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Falco cherrug]
Length=308

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 105/178 (59%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  130  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  182

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+   H  S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  183  IVNPLDGTDVTAHQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  242

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  243  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGIFTVAGLIDSLIYHSARAIQK  300



>gb|KDO64244.1| hypothetical protein CISIN_1g022650mg [Citrus sinensis]
Length=201

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 73/83 (88%), Gaps = 2/83 (2%)
 Frame = -1

Query  847  RMQGVCTLDVQRGAGNFHISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNP  668
            R+ GV  LDVQR AGNFHISVHGLNI+VAQMIF G+ +VNVSH+IHDLSFGPKYPGIHNP
Sbjct  117  RVYGV--LDVQRVAGNFHISVHGLNIYVAQMIFGGAKNVNVSHVIHDLSFGPKYPGIHNP  174

Query  667  LDGTERILHAGSGTFKYYIKIVP  599
            LDGT R+LH  SGTFKYYIK+ P
Sbjct  175  LDGTVRMLHDTSGTFKYYIKVWP  197



>gb|EMS52396.1| hypothetical protein TRIUR3_27593 [Triticum urartu]
Length=407

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 113/172 (66%), Gaps = 9/172 (5%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMI-FQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            L++ + AGNFH     S    N+ V  ++ FQ  S  N+SH I+ LSFG  +PG+ NPLD
Sbjct  230  LEINKVAGNFHFAPGKSFQQSNVHVHDLLPFQKDS-FNLSHKINKLSFGEPFPGVINPLD  288

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR--AWPAVYF  488
            G + I H+  G  +Y++K+VPT Y +L+++++ +NQFSV+E +S   +  R  A P V+F
Sbjct  289  GAQWIQHSSYGMAQYFVKVVPTVYSHLNEQIILSNQFSVTE-HSRSGDSGRVQALPGVFF  347

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             YDLSPI VT  E   SFLHF+T +CA++GG F ++G++D ++Y    A+TK
Sbjct  348  FYDLSPIKVTFTERHVSFLHFLTNVCAIVGGVFTVSGIIDSFVYHGQRAITK  399



>ref|XP_002958233.1| hypothetical protein VOLCADRAFT_69193 [Volvox carteri f. nagariensis]
 gb|EFJ40687.1| hypothetical protein VOLCADRAFT_69193 [Volvox carteri f. nagariensis]
Length=337

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 104/173 (60%), Gaps = 12/173 (7%)
 Frame = -1

Query  829  TLDVQRGAGNFHISVHGLNIFVAQMIFQ--GSSHV----NVSHIIHDLSFGPKYPGIHNP  668
            T+DV+R AG  H SVH   +F  QM+ Q  G+  +    N+SH I  L FGP YPG  NP
Sbjct  168  TMDVKRVAGRLHFSVHQNMVF--QMLPQLLGAHRIPKVANISHTIKHLGFGPHYPGQLNP  225

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAW-PAVY  491
            LDG  R++     +FKY++K+VPTEY      V  T+Q+SV+EY       +  + P + 
Sbjct  226  LDGYVRMVKGPPQSFKYFLKVVPTEYYNRLGRVTETHQYSVTEY---TQPLEPGYVPTLD  282

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
              YDLSPI +TI E   S LHF+ RLCAV+GG FA+T M DRW+   V  VTK
Sbjct  283  VHYDLSPIVMTINERPPSLLHFVVRLCAVVGGAFAITRMTDRWVDWFVRLVTK  335



>ref|XP_005534205.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Pseudopodoces humilis]
Length=383

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 104/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++NV+H I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINVTHYIKHLSFGMDYPG  257

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT  I    S  F+Y++K+VPT YR +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  258  IVNPLDGTAVIAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTRHEKIANGLLGDQG  317

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  318  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  375



>ref|XP_010239982.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Brachypodium distachyon]
Length=297

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 110/171 (64%), Gaps = 7/171 (4%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMI-FQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            +++ + AGNFH     S    N+ V  ++ FQ  S  NVSH I+ LSFG  +PG+ NPLD
Sbjct  120  VEINKVAGNFHFAPGKSFQQSNVHVHDLLPFQKDS-FNVSHKINKLSFGEPFPGVVNPLD  178

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVYFL  485
            G     H+  G ++Y++K+VPT Y +++++++ +NQFSV+E+         +A P V+F 
Sbjct  179  GAHWFQHSPYGMYQYFVKVVPTVYSHINEQIILSNQFSVTEHARSSESVRMQALPGVFFF  238

Query  484  YDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            YDLSPI VT  E   SFLHF+T +CA++GG F ++G++D ++Y    A+TK
Sbjct  239  YDLSPIKVTFTERHVSFLHFLTNVCAIVGGVFTVSGIIDSFVYHGQRAITK  289



>ref|XP_008802686.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Phoenix dactylifera]
Length=357

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 105/169 (62%), Gaps = 4/169 (2%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            LDV + AGNFH     S H   I V  ++   +   ++SH I+ LSFG ++PG+ NPLDG
Sbjct  181  LDVNKVAGNFHFMPGKSFHHSKIRVHDLLAFPTESYDISHKINKLSFGKEFPGVINPLDG  240

Query  658  TERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYD  479
             +    A SG ++Y+IK+VPT Y  +    + +NQFSV+E++   + + +  P V+F YD
Sbjct  241  AQWTQEASSGMYQYFIKVVPTIYTDIRGRKIHSNQFSVTEHFKDGNVYPKPPPGVFFFYD  300

Query  478  LSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             SPI V   EE +S LHF+T LCA++GG F ++G++D ++Y    A+ K
Sbjct  301  FSPIKVIFTEETKSLLHFLTNLCAIVGGVFTVSGIIDAFIYHGQRAIKK  349



>ref|XP_006033884.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Alligator sinensis]
Length=356

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 105/178 (59%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  178  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  230

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+ I    S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  231  IMNPLDGTDVIAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLIGDQG  290

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  291  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGVFTVAGLIDSLIYHSSRAIQK  348



>gb|KFO97972.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Calypte anna]
Length=330

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 105/178 (59%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  152  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  204

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+   H  S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  205  IVNPLDGTDVTAHQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  264

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  265  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGLIDSLIYHSARAIQK  322



>ref|XP_007042992.1| Endoplasmic reticulum vesicle transporter protein [Theobroma 
cacao]
 gb|EOX98823.1| Endoplasmic reticulum vesicle transporter protein [Theobroma 
cacao]
Length=386

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 110/164 (67%), Gaps = 7/164 (4%)
 Frame = -1

Query  829  TLDVQRGAGNFHI----SVHGLNIFVAQMI-FQGSSHVNVSHIIHDLSFGPKYPGIHNPL  665
            +L+V + AGNFH     S H  NIF++ ++ FQ  S+ N+SH I+ L+FG  +PG+ NPL
Sbjct  208  SLEVNKVAGNFHFAPGKSFHQTNIFLSDLLAFQKDSY-NISHRINRLAFGEYFPGVVNPL  266

Query  664  DGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHE-FDRAWPAVYF  488
            DG + I    +G ++Y+IK+VPT Y  +    + +NQ+SV++++  +   +  + P V+F
Sbjct  267  DGAQWIHETSNGMYQYFIKVVPTIYTDIRGRTVHSNQYSVTQHFKNLEVIYPNSHPGVFF  326

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMY  356
            +YD SPI VT KEE  SFLHFIT +CAV+GG F + G++D ++Y
Sbjct  327  IYDFSPIKVTFKEEHISFLHFITNICAVIGGIFTVAGIIDSFVY  370



>ref|XP_008802685.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Phoenix dactylifera]
Length=384

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 105/169 (62%), Gaps = 4/169 (2%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            LDV + AGNFH     S H   I V  ++   +   ++SH I+ LSFG ++PG+ NPLDG
Sbjct  208  LDVNKVAGNFHFMPGKSFHHSKIRVHDLLAFPTESYDISHKINKLSFGKEFPGVINPLDG  267

Query  658  TERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYD  479
             +    A SG ++Y+IK+VPT Y  +    + +NQFSV+E++   + + +  P V+F YD
Sbjct  268  AQWTQEASSGMYQYFIKVVPTIYTDIRGRKIHSNQFSVTEHFKDGNVYPKPPPGVFFFYD  327

Query  478  LSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             SPI V   EE +S LHF+T LCA++GG F ++G++D ++Y    A+ K
Sbjct  328  FSPIKVIFTEETKSLLHFLTNLCAIVGGVFTVSGIIDAFIYHGQRAIKK  376



>ref|XP_008504578.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum-Golgi intermediate 
compartment protein 3 [Calypte anna]
Length=391

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 105/178 (59%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  213  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  265

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+   H  S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  266  IVNPLDGTDVTAHQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  325

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  326  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGLIDSLIYHSARAIQK  383



>ref|XP_006266817.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Alligator mississippiensis]
Length=383

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 105/178 (59%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  257

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+ I    S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  258  IMNPLDGTDVIAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLIGDQG  317

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  318  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGVFTVAGLIDSLIYHSSRAIQK  375



>dbj|BAJ87561.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99855.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93512.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=383

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 106/169 (63%), Gaps = 6/169 (4%)
 Frame = -1

Query  826  LDVQRGAGNFHIS----VHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            LDV + AGNFH +     +  N+ + ++  +G    N++H I+ LSFG ++PG  NPLDG
Sbjct  209  LDVSKVAGNFHFAPGKGYYESNVDMPELSAEGG--FNITHKINKLSFGTEFPGAVNPLDG  266

Query  658  TERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYD  479
             +    A  GT++Y+IK+VPT Y  +    + +NQFSV+E++   +   R  P V+F YD
Sbjct  267  AQWTQPASDGTYQYFIKVVPTIYNDIRGRKIDSNQFSVTEHFRDGNVQPRPQPGVFFFYD  326

Query  478  LSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             SPI V   EE RSFLH++T LCA++GG F + G++D ++Y   +A+ K
Sbjct  327  FSPIKVIFTEENRSFLHYLTNLCAIVGGIFTVAGIIDSFIYHGQKALKK  375



>tpg|DAA57059.1| TPA: hypothetical protein ZEAMMB73_408305, partial [Zea mays]
Length=75

 Score =   129 bits (324),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  526  IHEFDRAWPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLV  347
            I   +RAWPAVYFLYDLSPITVTIKEERR+FLHFITRLCAVLGGTFA+TGMLDRWMYRLV
Sbjct  3    IRPTERAWPAVYFLYDLSPITVTIKEERRNFLHFITRLCAVLGGTFAMTGMLDRWMYRLV  62

Query  346  EAVTKPNARSTVR  308
            E+VT    RS +R
Sbjct  63   ESVTNSKTRSVLR  75



>ref|XP_002191084.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform 1 [Taeniopygia guttata]
Length=383

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 104/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  257

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT       S  F+Y++K+VPT YR +  EV+ TNQFSV+++  + +    D+ 
Sbjct  258  IVNPLDGTAVTAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTQHEKIANGLLGDQG  317

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  318  LPGVFVLYELSPMMVKLTEKHRSFTHFVTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  375



>ref|XP_009559309.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Cuculus canorus]
Length=365

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 105/178 (59%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H I  LSFG  YPG
Sbjct  182  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHYIKHLSFGRDYPG  239

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+     GS  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  240  IVNPLDGTDVTAQQGSMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  299

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  300  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  357



>dbj|BAK05850.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 113/172 (66%), Gaps = 9/172 (5%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMI-FQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            L++ + AGNFH     S    N+ V  ++ FQ  S  N+SH I+ LSFG  +PG+ NPLD
Sbjct  214  LEINKVAGNFHFAPGKSFQQSNVHVHDLLPFQKDS-FNLSHKINKLSFGEPFPGVINPLD  272

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR--AWPAVYF  488
            G + I H+  G  +Y++K+VPT Y +++++++ +NQFSV+E +S   +  R  A P V+F
Sbjct  273  GAQWIQHSSYGMAQYFVKVVPTVYSHINEQIILSNQFSVTE-HSRSGDSGRVQALPGVFF  331

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             YDLSPI VT  E   SFLHF+T +CA++GG F ++G++D ++Y    A+TK
Sbjct  332  FYDLSPIKVTFTERHVSFLHFLTNVCAIVGGVFTVSGIIDSFVYHGQRAITK  383



>ref|XP_003579883.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Brachypodium distachyon]
Length=386

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 110/171 (64%), Gaps = 7/171 (4%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMI-FQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            +++ + AGNFH     S    N+ V  ++ FQ  S  NVSH I+ LSFG  +PG+ NPLD
Sbjct  209  VEINKVAGNFHFAPGKSFQQSNVHVHDLLPFQKDS-FNVSHKINKLSFGEPFPGVVNPLD  267

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVYFL  485
            G     H+  G ++Y++K+VPT Y +++++++ +NQFSV+E+         +A P V+F 
Sbjct  268  GAHWFQHSPYGMYQYFVKVVPTVYSHINEQIILSNQFSVTEHARSSESVRMQALPGVFFF  327

Query  484  YDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            YDLSPI VT  E   SFLHF+T +CA++GG F ++G++D ++Y    A+TK
Sbjct  328  YDLSPIKVTFTERHVSFLHFLTNVCAIVGGVFTVSGIIDSFVYHGQRAITK  378



>gb|KFO76211.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Cuculus canorus]
Length=353

 Score =   136 bits (343),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 104/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  176  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  228

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+     GS  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  229  IVNPLDGTDVTAQQGSMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  288

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  289  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  346



>ref|NP_001148795.1| LOC100282412 [Zea mays]
 gb|ACF82571.1| unknown [Zea mays]
 gb|ACG32935.1| serologically defined breast cancer antigen NY-BR-84 [Zea mays]
 tpg|DAA37500.1| TPA: DUF1692 domain, endoplasmic reticulum vescicle transporter 
protein [Zea mays]
Length=386

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 110/171 (64%), Gaps = 7/171 (4%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMI-FQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            ++V + AGNFH     S    N+ V  ++ FQ  S  NVSH I+ LSFG  +PG+ NPLD
Sbjct  209  IEVNKVAGNFHFAPGKSFQQSNVHVHDLLPFQKDS-FNVSHKINRLSFGEYFPGVVNPLD  267

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVYFL  485
            G   + H+  G ++Y+IK+VPT Y  +++ ++ +NQFSV+E++        +A P V+F 
Sbjct  268  GANWVQHSSYGMYQYFIKVVPTVYTDINEHIILSNQFSVTEHFRSGESGRMQALPGVFFF  327

Query  484  YDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            YDLSPI VT  E+  SFLHF+T +CA++GG F ++G++D ++Y    A+ K
Sbjct  328  YDLSPIKVTFTEQHVSFLHFLTNVCAIVGGVFTVSGIIDSFVYHSQRAIKK  378



>ref|XP_001690702.1| hypothetical protein CHLREDRAFT_180779 [Chlamydomonas reinhardtii]
 gb|EDO96229.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=656

 Score =   139 bits (351),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 107/177 (60%), Gaps = 12/177 (7%)
 Frame = -1

Query  829  TLDVQRGAGNFHISVHGLNIFVAQMIFQ--GSSHV----NVSHIIHDLSFGPKYPGIHNP  668
            T  V+R AG  H+SVH   +F  QM+ Q  G+ H+    N+SH+I  L FGP YPG  NP
Sbjct  86   TPQVKRVAGRLHLSVHQNMVF--QMLPQLLGTHHIPKILNMSHVIKHLGFGPHYPGQLNP  143

Query  667  LDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAW-PAVY  491
            LDG  R++     ++KY++K+VPTEY         T+Q+SV+EY        R + PAV 
Sbjct  144  LDGYVRMVGREPFSYKYFLKVVPTEYYNRLGRATETHQYSVTEY---AQPLQRGYAPAVD  200

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTKPNAR  320
              YDLSPI +TI E   S LHF+ RLCAV+GG FA+T + DRW+  LV  V K  AR
Sbjct  201  VHYDLSPIVMTINERPPSLLHFVVRLCAVVGGVFAITRLTDRWVDWLVRLVNKAAAR  257



>ref|XP_002439992.1| hypothetical protein SORBIDRAFT_09g023960 [Sorghum bicolor]
 gb|EES18422.1| hypothetical protein SORBIDRAFT_09g023960 [Sorghum bicolor]
Length=384

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 109/170 (64%), Gaps = 7/170 (4%)
 Frame = -1

Query  826  LDVQRGAGNFHIS----VHGLNIFVAQM-IFQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            LDV + AGNFH +     +  NI V ++ + +G    N++H I+ LSFG ++PG+ NPLD
Sbjct  209  LDVSKVAGNFHFAPGKGFYESNIDVPELSVLEGG--FNITHKINKLSFGTEFPGVVNPLD  266

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLY  482
            G + I  A  GT++Y+IK+VPT Y  +    + +NQFSV+E++   +   +  P V+F Y
Sbjct  267  GAQWIQPASDGTYQYFIKVVPTIYTDIRGHNIHSNQFSVTEHFRDGNILPKPQPGVFFFY  326

Query  481  DLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            D SPI V   EE RS LH++T LCA++GG F ++G++D ++Y   +A+ K
Sbjct  327  DFSPIKVIFTEENRSLLHYLTNLCAIVGGVFTVSGIIDSFIYHGQKALKK  376



>ref|XP_008932726.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Manacus vitellinus]
Length=334

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  156  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  208

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT       S  F+Y++K+VPT YR +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  209  IVNPLDGTAVTAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTRHEKIANGLLGDQG  268

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  269  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  326



>gb|KFO52827.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Corvus brachyrhynchos]
Length=336

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  158  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  210

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT       S  F+Y++K+VPT YR +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  211  IVNPLDGTAVTAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTRHEKIANGLLGDQG  270

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  271  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  328



>gb|KFW74284.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Manacus vitellinus]
Length=338

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  160  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  212

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT       S  F+Y++K+VPT YR +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  213  IVNPLDGTAVTAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTRHEKIANGLLGDQG  272

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  273  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  330



>gb|ACN35132.1| unknown [Zea mays]
 tpg|DAA37502.1| TPA: DUF1692 domain, endoplasmic reticulum vescicle transporter 
protein [Zea mays]
Length=391

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 111/171 (65%), Gaps = 7/171 (4%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMI-FQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            ++V + AGNFH     S    N+ V  ++ FQ  S  NVSH I+ LSFG  +PG+ NPLD
Sbjct  214  IEVNKVAGNFHFAPGKSFQQSNVHVHDLLPFQKDS-FNVSHKINRLSFGEYFPGVVNPLD  272

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYY-SLIHEFDRAWPAVYFL  485
            G   + H+  G ++Y+IK+VPT Y  +++ ++ +NQFSV+E++ S      +A P V+F 
Sbjct  273  GANWVQHSSYGMYQYFIKVVPTVYTDINEHIILSNQFSVTEHFRSGESGRMQALPGVFFF  332

Query  484  YDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            YDLSPI VT  E+  SFLHF+T +CA++GG F ++G++D ++Y    A+ K
Sbjct  333  YDLSPIKVTFTEQHVSFLHFLTNVCAIVGGVFTVSGIIDSFVYHSQRAIKK  383



>ref|XP_002447951.1| hypothetical protein SORBIDRAFT_06g018670 [Sorghum bicolor]
 gb|EES12279.1| hypothetical protein SORBIDRAFT_06g018670 [Sorghum bicolor]
Length=386

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 110/171 (64%), Gaps = 7/171 (4%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMI-FQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            ++V + AGNFH     S    N+ V  ++ FQ  S  NVSH I+ LSFG  +PG+ NPLD
Sbjct  209  IEVNKVAGNFHFAPGKSFQQSNVHVHDLLPFQKDS-FNVSHKINRLSFGEYFPGVVNPLD  267

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVYFL  485
            G   + H+  G ++Y+IK+VPT Y  +++ ++ +NQFSV+E++        +A P V+F 
Sbjct  268  GASWVQHSSYGMYQYFIKVVPTVYTDINEHIILSNQFSVTEHFRSGESGRMQALPGVFFF  327

Query  484  YDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            YDLSPI VT  E+  SFLHF+T +CA++GG F ++G++D ++Y    A+ K
Sbjct  328  YDLSPIKVTFTEQHVSFLHFLTNVCAIVGGVFTVSGIIDSFVYHSQRAIKK  378



>ref|XP_008627777.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Corvus brachyrhynchos]
Length=341

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  163  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  215

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT       S  F+Y++K+VPT YR +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  216  IVNPLDGTAVTAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTRHEKIANGLLGDQG  275

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  276  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  333



>ref|XP_009917276.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Haliaeetus albicilla]
Length=174

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 99/172 (58%), Gaps = 20/172 (12%)
 Frame = -1

Query  808  AGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            AGNFH           + VH L  F       G  ++N++H I  LSFG  YPGI NPLD
Sbjct  2    AGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPGIVNPLD  54

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAVYF  488
            GT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V+ 
Sbjct  55   GTDVAAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGVFV  114

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  115  LYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  166



>ref|XP_010411485.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Corvus cornix cornix]
Length=359

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  181  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  233

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT       S  F+Y++K+VPT YR +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  234  IVNPLDGTAVTAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTRHEKIANGLLGDQG  293

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  294  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  351



>ref|XP_010019924.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Nestor notabilis]
Length=335

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 105/178 (59%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H I  LSFG  YPG
Sbjct  152  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHYIKHLSFGRDYPG  209

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  210  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  269

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  270  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGLIDSLIYHSARAIQK  327



>ref|XP_002264644.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Vitis vinifera]
 emb|CBI29463.3| unnamed protein product [Vitis vinifera]
Length=386

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 105/170 (62%), Gaps = 5/170 (3%)
 Frame = -1

Query  826  LDVQRGAGNFHIS----VHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            L+V + AGNFH S     +  NI V  ++       N+SH I+ L+FG  +PG+ NPLDG
Sbjct  209  LEVNKVAGNFHFSPGKGFYQSNIHVNDLLAISKDGYNISHRINKLAFGDHFPGVVNPLDG  268

Query  658  TERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYY-SLIHEFDRAWPAVYFLY  482
             +    A  G ++Y+IK+VPT Y  +    + +NQFSV+E++ S       + P VYF Y
Sbjct  269  AQWFQDAPDGMYQYFIKVVPTIYTDIRGHTIQSNQFSVTEHFRSAEPGRPHSLPGVYFFY  328

Query  481  DLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            DLSPI VT KEE  SFLHF+T +CA++GG F ++G++D ++Y    A+ K
Sbjct  329  DLSPIKVTSKEEHSSFLHFMTNICAIVGGIFTVSGIIDSFVYHGHRAIKK  378



>ref|XP_005428461.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Geospiza fortis]
Length=339

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  161  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  213

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT       S  F+Y++K+VPT YR +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  214  IVNPLDGTAITAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTRHEKIANGLLGDQG  273

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  274  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  331



>ref|XP_008568949.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X3 [Galeopterus variegatus]
Length=370

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 104/178 (58%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H I  LSFG  YPG
Sbjct  187  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHYIQHLSFGEDYPG  244

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLD T       S  F+Y++K+VPT Y  +  EVL TNQFSV+ +  + +    D+ 
Sbjct  245  IVNPLDSTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQG  304

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+RRSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  305  LPGVFVLYELSPMMVKLTEKRRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQK  362



>ref|XP_010198765.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum-Golgi intermediate 
compartment protein 3, partial [Colius striatus]
Length=343

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 105/178 (59%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H I  LSFG  YPG
Sbjct  160  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHYIKHLSFGRDYPG  217

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  218  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  277

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  278  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGLIDSLIYHSARAIQK  335



>gb|KFV71275.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Picoides pubescens]
Length=330

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  152  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  204

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  205  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  264

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA+LGG F + G +D  +Y    A+ K
Sbjct  265  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAILGGIFTVAGFIDSLIYHSARAIQK  322



>gb|AFW82389.1| putative DUF1692 domain containing protein [Zea mays]
Length=1061

 Score =   140 bits (354),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 62/79 (78%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -1

Query  613  IKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPITVTIKEERRSF  434
            +K+VPTEY+YLSK++LPTNQ SV+EY+  I   +RAWPAVYFLYDLSPIT TIKEERR+F
Sbjct  501  LKVVPTEYKYLSKKILPTNQGSVTEYFLSIRPTERAWPAVYFLYDLSPITFTIKEERRNF  560

Query  433  LHFITRLCAVLGGTFALTG  377
            LHFITRLCAVLGGTFA+TG
Sbjct  561  LHFITRLCAVLGGTFAMTG  579



>gb|AFW85973.1| putative DUF1692 domain containing protein [Zea mays]
Length=1070

 Score =   140 bits (354),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 62/79 (78%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -1

Query  613  IKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYDLSPITVTIKEERRSF  434
            +K+VPTEY+YLSK++LPTNQ SV+EY+  I   +RAWPAVYFLYDLSPIT TIKEERR+F
Sbjct  515  LKVVPTEYKYLSKKILPTNQGSVTEYFLSIRPTERAWPAVYFLYDLSPITFTIKEERRNF  574

Query  433  LHFITRLCAVLGGTFALTG  377
            LHFITRLCAVLGGTFA+TG
Sbjct  575  LHFITRLCAVLGGTFAMTG  593



>dbj|GAM20914.1| hypothetical protein SAMD00019534_040890 [Acytostelium subglobosum 
LB1]
Length=376

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 109/172 (63%), Gaps = 12/172 (7%)
 Frame = -1

Query  820  VQRGAGNFHISV------HGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            V + AGNFH +       H +++   Q  F+G+   N+SH I+ LSFG  +PGI NPLDG
Sbjct  200  VNKVAGNFHFAPGKSFQNHHMHVHDIQS-FKGT--FNMSHTINRLSFGFDFPGIKNPLDG  256

Query  658  TERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLI---HEFDRAWPAVYF  488
              +   AG+G F+YYIK+VPT Y  +S  V+ TNQ+SV+E+Y L+    E     P ++F
Sbjct  257  VTKTEIAGTGMFQYYIKVVPTTYEGISGHVIATNQYSVTEHYRLLGKQGEELSGLPGLFF  316

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            +YDLSPI + + E  RSF  F+TR+CA++GG F + G+ D ++Y+  ++  +
Sbjct  317  MYDLSPIMMRVVETSRSFATFLTRVCAIIGGVFTVAGIFDSFIYQTTKSFKR  368



>gb|KEH31232.1| endoplasmic reticulum vesicle transporter [Medicago truncatula]
Length=295

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 107/171 (63%), Gaps = 7/171 (4%)
 Frame = -1

Query  829  TLDVQRGAGNFHISVHGLN-----IFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPL  665
            +L+V + AGNFH +  G +     IF+A ++    +H N+SH I+ LSFG  YPG+ NPL
Sbjct  119  SLEVNKVAGNFHFAT-GQSFLQSAIFLADLLALQDNHYNISHQINKLSFGHHYPGLVNPL  177

Query  664  DGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFL  485
            DG + +     G ++Y+IK+VPT Y  +   V+ +NQ+SV+E++    E   A P V+F 
Sbjct  178  DGIKWVQGNDHGMYQYFIKVVPTVYTDIRGRVIHSNQYSVTEHFKS-SELGAAVPGVFFF  236

Query  484  YDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            YD+SPI V  KEE   FLHF+T +CA++GG F + G++D  +Y   + + K
Sbjct  237  YDISPIKVNFKEEHIPFLHFLTNICAIIGGIFTIAGIVDSSIYYGQKTIKK  287



>emb|CDP01031.1| unnamed protein product [Coffea canephora]
Length=297

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 107/171 (63%), Gaps = 7/171 (4%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            LDV + AGNFH     S    N+ +  ++       N+SH I+ L+FG  +PG+ NPLDG
Sbjct  120  LDVNKVAGNFHFAPGKSFQQANVHIHDLLAFQKDSFNISHKINRLAFGDYFPGVVNPLDG  179

Query  658  TERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR--AWPAVYFL  485
             E +    +G ++Y+IK+VPT Y  ++   + +NQFSV+E++    E  R  + P V+F 
Sbjct  180  VEWMQQTPNGMYQYFIKVVPTVYTDVNGHNIQSNQFSVTEHFKGA-EIGRLQSIPGVFFF  238

Query  484  YDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            YDLSPI VT  E+  SFLHF+T +CA++GG F ++G++D ++Y   +A+ K
Sbjct  239  YDLSPIKVTFTEQHVSFLHFLTNVCAIIGGVFTVSGIIDSFVYHGQKAIKK  289



>ref|XP_009369662.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Pyrus x bretschneideri]
Length=387

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 104/170 (61%), Gaps = 5/170 (3%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            L+V + AGNFH     S    N+ V  ++       N+SH I+ LSFG  +PG+ NPLDG
Sbjct  210  LEVNKVAGNFHFAPGKSFQQSNVHVHDLLAFQKDSFNISHTINRLSFGDYFPGVVNPLDG  269

Query  658  TERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAW-PAVYFLY  482
                    SG ++Y+IK+VPT Y  +S   + +NQFSV+E+Y      +  + P V+F Y
Sbjct  270  VHWTQDNPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHYRGTEMGNLQFLPGVFFFY  329

Query  481  DLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            DLSPI VT  EE  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  330  DLSPIKVTFTEEHISFLHFLTNVCAIVGGVFTVSGILDSFIYHGQKAIKK  379



>gb|EPS71395.1| hypothetical protein M569_03362 [Genlisea aurea]
Length=385

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 106/171 (62%), Gaps = 5/171 (3%)
 Frame = -1

Query  829  TLDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            +L+V R AGN H+    S+    I + +M+       N+SH I+ LSFG   PG+ NPLD
Sbjct  207  SLEVNRVAGNLHLVTGKSLQVPGIQLLEMLSLNDQSYNISHKINKLSFGDPIPGVVNPLD  266

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVYFL  485
            G + +    +G ++Y+IK+VPT Y  +    + +NQFSV+E+Y    E   R+ P V+F+
Sbjct  267  GAQWVQEKPNGIYQYFIKVVPTVYTDIRGHTIQSNQFSVTEHYKSPEEDRFRSSPGVFFV  326

Query  484  YDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            YDLSPI VT  E    FLHF+T +CA++GG F++ GM+D ++Y   +A+ K
Sbjct  327  YDLSPIQVTFTEHHTPFLHFLTHICAIVGGIFSVAGMVDSFVYHGQKAIRK  377



>ref|XP_003568216.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Brachypodium distachyon]
Length=384

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 107/170 (63%), Gaps = 7/170 (4%)
 Frame = -1

Query  826  LDVQRGAGNFHIS----VHGLNIFVAQMI-FQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            LDV + AGNFH +     +  N+ V ++   +G    N++H I+ LSFG ++PG+ NPLD
Sbjct  209  LDVSKVAGNFHFAPGRGFYESNVDVPELSSLEGG--FNITHKINKLSFGTEFPGVVNPLD  266

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLY  482
            G +    A  GT++Y+IK+VPT Y       + +NQFSV+E++   +   R  P V+F Y
Sbjct  267  GAQWTQPASDGTYQYFIKVVPTNYTDTRGRKIDSNQFSVTEHFRDGNVHPRPQPGVFFFY  326

Query  481  DLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            D SPI V   EE +SFLH++T LCA++GG F ++G++D ++Y   +A+ K
Sbjct  327  DFSPIKVIFTEENKSFLHYLTNLCAIVGGIFTVSGIIDSFIYHGQKALKK  376



>ref|NP_001132255.1| DUF1692 domain, endoplasmic reticulum vescicle transporter protein 
[Zea mays]
 gb|ACF81030.1| unknown [Zea mays]
 gb|ACN28701.1| unknown [Zea mays]
 gb|AFW82352.1| DUF1692 domain, endoplasmic reticulum vescicle transporter protein 
[Zea mays]
Length=384

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 109/170 (64%), Gaps = 7/170 (4%)
 Frame = -1

Query  826  LDVQRGAGNFHIS----VHGLNIFVAQM-IFQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            LDV + AGNFH +     +  NI V ++ + +G    N+SH I+ LSFG ++PG+ NPLD
Sbjct  209  LDVSKVAGNFHFAPGKGFYESNIDVPELSLLEGG--FNISHKINKLSFGTEFPGVVNPLD  266

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLY  482
            G +    A  GT++Y+IK+VPT Y  +    + +NQFSV+E++   +   ++ P V+F Y
Sbjct  267  GAQWTQPASDGTYQYFIKVVPTIYTDIRGRGIHSNQFSVTEHFRDGNVRPKSQPGVFFFY  326

Query  481  DLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            D SPI V   EE RS LH++T LCA++GG F ++G++D ++Y   +A+ K
Sbjct  327  DFSPIKVIFTEENRSLLHYLTNLCAIVGGVFTVSGIIDSFIYHGQKALKK  376



>gb|KFQ56065.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Nestor notabilis]
Length=330

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 104/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  152  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  204

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  205  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  264

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  265  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGLIDSLIYHSARAIQK  322



>ref|XP_009097046.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Serinus canaria]
Length=390

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 103/178 (58%), Gaps = 13/178 (7%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I    +   G   +N++H I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIRFHDLQSFGLDSINMTHYIKHLSFGRDYPG  264

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT       S  F+Y++K+VPT YR +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  265  IVNPLDGTAVTAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTRHEKIANGLLGDQG  324

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  325  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  382



>ref|XP_008378547.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Malus domestica]
Length=386

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 104/170 (61%), Gaps = 5/170 (3%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            L+V + AGNFH     S    N+ V  ++       N+SH I+ LSFG  +PG+ NPLDG
Sbjct  209  LEVNKVAGNFHFAPGKSFQQSNVHVHDLLAFQKDSFNISHTINRLSFGDYFPGVVNPLDG  268

Query  658  TERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAW-PAVYFLY  482
                    SG ++Y+IK+VPT Y  +S   + +NQFSV+E+Y      +  + P V+F Y
Sbjct  269  VHWTQDNPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHYRGTEMGNLQFLPGVFFFY  328

Query  481  DLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            DLSPI VT  EE  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  329  DLSPIKVTFTEEHISFLHFLTNVCAIVGGVFTVSGILDSFIYHGQKAIKK  378



>gb|KFP23539.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Colius striatus]
Length=330

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 104/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  152  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  204

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  205  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  264

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  265  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGLIDSLIYHSARAIQK  322



>ref|XP_008568816.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Galeopterus variegatus]
Length=388

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 104/178 (58%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHYIQHLSFGEDYPG  262

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLD T       S  F+Y++K+VPT Y  +  EVL TNQFSV+ +  + +    D+ 
Sbjct  263  IVNPLDSTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQG  322

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+RRSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  323  LPGVFVLYELSPMMVKLTEKRRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQK  380



>ref|XP_006652356.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Oryza brachyantha]
Length=386

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 110/171 (64%), Gaps = 7/171 (4%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMI-FQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            L+V + AGNFH     S    N+ V  ++ FQ  S  NVSH I+ LSFG  +PG+ NPLD
Sbjct  209  LEVNKVAGNFHFAPGKSFQKSNVHVHDLLPFQKDS-FNVSHKINKLSFGQHFPGVVNPLD  267

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVYFL  485
              + + H+  G ++Y+IK+VPT Y  +++ ++ +NQFSV+E++        +A P V+F 
Sbjct  268  RAQWVQHSSYGMYQYFIKVVPTVYTDINEHIILSNQFSVTEHFRSSESGRIQAVPGVFFF  327

Query  484  YDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            YDLSPI VT  E+  SFLHF+T +CA++GG F ++G++D ++Y    A+ K
Sbjct  328  YDLSPIKVTFTEQHVSFLHFLTNVCAIVGGVFTVSGIIDSFVYHGQRAIKK  378



>gb|KFQ65052.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Pelecanus crispus]
Length=329

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 104/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  152  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHHIKHLSFGRDYPG  204

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+   H  S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  205  IVNPLDGTDVTAHQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  264

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  265  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSACAIQK  322



>ref|XP_008568883.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Galeopterus variegatus]
Length=383

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIQHLSFGEDYPG  257

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLD T       S  F+Y++K+VPT Y  +  EVL TNQFSV+ +  + +    D+ 
Sbjct  258  IVNPLDSTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQG  317

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+RRSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  318  LPGVFVLYELSPMMVKLTEKRRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQK  375



>ref|XP_009373163.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Pyrus x bretschneideri]
Length=386

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 104/170 (61%), Gaps = 5/170 (3%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            L+V + AGNFH     S    N+ V  ++       N+SH I+ LSFG  +PG+ NPLDG
Sbjct  209  LEVNKVAGNFHFAPGKSFQQSNVHVHDLLAFQKDSFNISHTINRLSFGDYFPGVVNPLDG  268

Query  658  TERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAW-PAVYFLY  482
                    SG ++Y+IK+VPT Y  +S   + +NQFSV+E+Y      +  + P V+F Y
Sbjct  269  VHWTQDNPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHYRGAEMGNLQFLPGVFFFY  328

Query  481  DLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            DLSPI VT  EE  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  329  DLSPIKVTFTEEHISFLHFLTNVCAIVGGVFTVSGILDSFIYHGQKAIKK  378



>ref|XP_005774403.1| hypothetical protein EMIHUDRAFT_430522 [Emiliania huxleyi CCMP1516]
 ref|XP_005778028.1| hypothetical protein EMIHUDRAFT_418794 [Emiliania huxleyi CCMP1516]
 gb|EOD21974.1| hypothetical protein EMIHUDRAFT_430522 [Emiliania huxleyi CCMP1516]
 gb|EOD25599.1| hypothetical protein EMIHUDRAFT_418794 [Emiliania huxleyi CCMP1516]
Length=406

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 103/164 (63%), Gaps = 7/164 (4%)
 Frame = -1

Query  826  LDVQRGAGNFHISV-HGLNIFVAQMIFQ----GSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            L+V + AGN H++          Q++ +     S   N+SH+IH LSFG  YPG  +PLD
Sbjct  233  LEVNKVAGNVHLAPGKAFQSAQGQLVHEFKPFDSHGYNISHVIHSLSFGVHYPGRQSPLD  292

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAW--PAVYF  488
             +  ILH GSG F+YY+K+VPT Y + S   L + Q+SV+E +   H+    +  P V+F
Sbjct  293  ESTMILHNGSGVFQYYLKVVPTTYVFASGRNLTSCQYSVTEQFKSAHDPRNGFVLPGVFF  352

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMY  356
            +YD+SPI VT +EER +F +F+T LCA++GG F + G++D  +Y
Sbjct  353  IYDISPIMVTFREERPAFSYFLTSLCAIVGGVFTVAGIVDSCIY  396



>ref|XP_005496545.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Zonotrichia albicollis]
Length=383

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  257

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT       S  F+Y++K+VPT YR +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  258  IVNPLDGTAITAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTRHEKIANGLLGDQG  317

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  318  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  375



>ref|XP_011464591.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum-Golgi intermediate 
compartment protein 3-like [Fragaria vesca subsp. 
vesca]
Length=386

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 104/170 (61%), Gaps = 5/170 (3%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            L+V + AGNFH     S    N+ V  ++       N+SH I+ LSFG  +PG+ NPLDG
Sbjct  209  LEVNKVAGNFHFAPGKSFQQSNVHVHDLLAFQKDSFNISHTINRLSFGDYFPGVVNPLDG  268

Query  658  TERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAW-PAVYFLY  482
                    SG ++Y+IK+VPT Y  +S   + +NQFSV+E+Y      +  + P V+F Y
Sbjct  269  VHWTQDNPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHYRGTEIGNLQFLPGVFFFY  328

Query  481  DLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            DLSPI VT  EE  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  329  DLSPIKVTFTEEHISFLHFLTNVCAIVGGVFTVSGILDSFIYHGQKAIKK  378



>ref|XP_009578622.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Fulmarus glacialis]
Length=159

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 95/156 (61%), Gaps = 9/156 (6%)
 Frame = -1

Query  793  ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERILHAGSGTFKYY  614
            + +H L  F       G  ++N++H I  LSFG  YPGI NPLDGT+      S  F+Y+
Sbjct  3    VEIHDLQSF-------GLDNINMTHYIKHLSFGRDYPGIVNPLDGTDVTAQQASMMFQYF  55

Query  613  IKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAVYFLYDLSPITVTIKEERR  440
            +K+VPT Y  +  EV+ TNQFSV+ +  + +    D+  P V+ LY+LSP+ V + E+ R
Sbjct  56   VKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQGLPGVFVLYELSPMMVKLTEKHR  115

Query  439  SFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            SF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  116  SFTHFLTGVCAIVGGIFTVAGLIDSLIYHSARAIQK  151



>ref|XP_009708266.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Cariama cristata]
Length=174

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 98/172 (57%), Gaps = 20/172 (12%)
 Frame = -1

Query  808  AGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            AGNFH           + VH L  F       G  ++N++H I  LSFG  YPGI NPLD
Sbjct  2    AGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPGIVNPLD  54

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAVYF  488
            GT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  +      D+  P V+ 
Sbjct  55   GTDVTAEQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIASGLLGDQGLPGVFV  114

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  115  LYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  166



>ref|XP_010105897.1| hypothetical protein L484_021555 [Morus notabilis]
 gb|EXC06716.1| hypothetical protein L484_021555 [Morus notabilis]
Length=386

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 105/170 (62%), Gaps = 5/170 (3%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            L+V + AGNFH     S H  N+ V  ++       N+SH I+ L+FG  +PG+ NPLDG
Sbjct  209  LEVNKVAGNFHFAPGKSFHQSNVHVHDLLTFQKDSFNISHKINRLAFGDYFPGVVNPLDG  268

Query  658  TERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAW-PAVYFLY  482
             +      SG ++Y+IK+VPT Y  +S   + +NQFSV+E++      +  + P V+F Y
Sbjct  269  VKWTQETPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFRNSELGNLQFLPGVFFFY  328

Query  481  DLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            DLSPI VT  EE  SFLHF+T +CA++GG F ++G+LD ++Y    A+ K
Sbjct  329  DLSPIKVTFTEEHISFLHFLTNVCAIVGGVFTVSGILDSFIYHGQRAIKK  378



>gb|AFW78473.1| DUF1692 domain, endoplasmic reticulum vescicle transporter protein, 
partial [Zea mays]
Length=284

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 108/170 (64%), Gaps = 7/170 (4%)
 Frame = -1

Query  826  LDVQRGAGNFHIS----VHGLNIFVAQM-IFQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            LDV + AGNFH +     +  NI V ++ + +G    N++H I+ LSFG ++PG+ NPLD
Sbjct  109  LDVSKVAGNFHFAPGKGFYESNIDVPELSLLEGG--FNITHKINKLSFGTEFPGVVNPLD  166

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLY  482
            G +    A  GT++Y+IK+VPT Y  +    + +NQFSV+E++   +   +  P V+F Y
Sbjct  167  GAQWTQPASDGTYQYFIKVVPTIYTDIRGHNIHSNQFSVTEHFRDGNVRPKPQPGVFFFY  226

Query  481  DLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            D SPI V   EE RS LH++T LCA++GG F ++G++D ++Y   +A+ K
Sbjct  227  DFSPIKVIFTEESRSLLHYLTNLCAIVGGVFTVSGIIDSFIYHGQKALKK  276



>ref|XP_005147588.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Melopsittacus undulatus]
Length=388

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 105/178 (59%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHYIKHLSFGRDYPG  262

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  263  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  322

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  323  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGLIDSLIYHSARAIQK  380



>gb|ETE61956.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3 [Ophiophagus hannah]
Length=327

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 101/165 (61%), Gaps = 6/165 (4%)
 Frame = -1

Query  808  AGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDGTERILH  641
            AGNFH     S    ++ V  +   G  ++N++HII  LSFG  YPG+ NPLDGT    H
Sbjct  155  AGNFHFAPGKSFQQSHVHVHDLQSYGLDNINITHIIRHLSFGKDYPGLVNPLDGTVVTAH  214

Query  640  AGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRAWPAVYFLYDLSPI  467
              S  F+Y++K+VPT Y  +  E++ TNQFSV+ +  + +    D+  P V+ LY+LSP+
Sbjct  215  QASMMFQYFVKVVPTVYMKVDGEMVRTNQFSVTRHEKIANGLIGDQGLPGVFVLYELSPM  274

Query  466  TVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  275  MVKLTEKHRSFTHFLTGVCAIIGGVFTVAGLIDSLIYHSARAIQK  319



>ref|XP_009884638.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Charadrius vociferus]
Length=344

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 104/178 (58%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H I  LSFG  YPG
Sbjct  161  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHYIKHLSFGRDYPG  218

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  219  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  278

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  279  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGIFTVAGFIDSLIYHSARAIQK  336



>gb|KGL94343.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Charadrius vociferus]
Length=336

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  158  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  210

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  211  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  270

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  271  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGIFTVAGFIDSLIYHSARAIQK  328



>ref|XP_005514697.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum-Golgi intermediate 
compartment protein 3, partial [Columba livia]
Length=343

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 104/178 (58%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H I  LSFG  YPG
Sbjct  160  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHYIKHLSFGRDYPG  217

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  218  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  277

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  278  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  335



>ref|XP_005147587.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Melopsittacus undulatus]
Length=383

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 104/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  257

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  258  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  317

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  318  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGLIDSLIYHSARAIQK  375



>ref|XP_004975824.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Setaria italica]
Length=386

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 109/171 (64%), Gaps = 7/171 (4%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMI-FQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            ++V + AGNFH     S    N+ V  ++ FQ  S  NVSH I+ LSFG  +PG+ NPLD
Sbjct  209  IEVNKVAGNFHFAPGKSFQQSNVHVHDLLPFQKDS-FNVSHKINKLSFGEHFPGVVNPLD  267

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVYFL  485
              + + H+  G ++Y+IK+VPT Y  ++  ++ +NQFSV+E++        +A P V+F 
Sbjct  268  RAQWVQHSSYGMYQYFIKVVPTVYTDINDRIILSNQFSVTEHFRSSESGRIQALPGVFFF  327

Query  484  YDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            YDLSPI VT  E+  SFLHF+T +CA++GG F ++G++D ++Y    A+ K
Sbjct  328  YDLSPIKVTFTEQHVSFLHFLTNVCAIVGGVFTVSGIIDSFVYHGQRAIKK  378



>emb|CDQ64042.1| unnamed protein product [Oncorhynchus mykiss]
Length=388

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 106/178 (60%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H+I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHLIKHLSFGRDYPG  262

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  ++Y++KIVPT Y     EV+ TNQFSV+ +  + +    D+ 
Sbjct  263  IVNPLDGTDVAAPQASMMYQYFVKIVPTIYVKWDGEVVKTNQFSVTRHEKVANGLIGDQG  322

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V   E++RSF HF+T LCA++GG F + G++D  +Y   +A+ K
Sbjct  323  LPGVFVLYELSPMMVKFTEKQRSFTHFLTGLCAIVGGVFTVAGLIDSLIYHSAKAIQK  380



>ref|XP_009931564.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Opisthocomus hoazin]
Length=305

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 104/178 (58%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH   I   Q    G  ++N++H I  LSFG  YPG
Sbjct  122  LEVNKVAGNFHFAPGKSFQQSHVHVHAAEIHDLQSF--GLDNINMTHYIKHLSFGRDYPG  179

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            + NPLDGT+     GS  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  180  LVNPLDGTDITAQQGSMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  239

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ +
Sbjct  240  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQR  297



>ref|XP_009471655.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum-Golgi intermediate 
compartment protein 3 [Nipponia nippon]
Length=342

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  164  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  216

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  217  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  276

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  277  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  334



>gb|KFR09655.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Opisthocomus hoazin]
Length=308

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 104/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  130  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  182

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            + NPLDGT+     GS  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  183  LVNPLDGTDITAQQGSMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  242

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ +
Sbjct  243  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQR  300



>gb|EMC76893.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Columba livia]
Length=330

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  152  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  204

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  205  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  264

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  265  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  322



>gb|KDO80920.1| hypothetical protein CISIN_1g016587mg [Citrus sinensis]
 gb|KDO80921.1| hypothetical protein CISIN_1g016587mg [Citrus sinensis]
Length=297

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 103/170 (61%), Gaps = 5/170 (3%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            L+V + AGNFH     S H   + V  ++       N+SH I+ L+FG  +PG+ NPLDG
Sbjct  120  LEVNKVAGNFHFAPGKSFHQSGVHVHDILAFQRDSFNISHKINKLAFGEHFPGVVNPLDG  179

Query  658  TERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVYFLY  482
                    SG ++Y+IK+VPT Y  +S   + +NQFSV+E++    +   +  P V+F Y
Sbjct  180  VRWTQETPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFRSSEQGRLQTLPGVFFFY  239

Query  481  DLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            DLSPI VT  EE  SFLHF+T +CA++GG F ++G++D ++Y    A+ K
Sbjct  240  DLSPIKVTFTEEHVSFLHFLTNVCAIVGGVFTVSGIIDAFIYHGQRAIKK  289



>gb|KFR06735.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Nipponia nippon]
Length=330

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  152  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  204

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  205  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  264

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  265  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  322



>ref|XP_009097047.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Serinus canaria]
Length=383

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 102/178 (57%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G   +N++H I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDSINMTHYIKHLSFGRDYPG  257

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT       S  F+Y++K+VPT YR +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  258  IVNPLDGTAVTAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTRHEKIANGLLGDQG  317

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  318  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  375



>ref|XP_009946915.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum-Golgi intermediate 
compartment protein 3, partial [Leptosomus discolor]
Length=358

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 104/178 (58%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H I  LSFG  YPG
Sbjct  175  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHYIKHLSFGRDYPG  232

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  233  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  292

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  293  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGIFTVAGFIDSLIYHSARAIQK  350



>ref|XP_004504780.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Cicer arietinum]
Length=385

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 104/170 (61%), Gaps = 4/170 (2%)
 Frame = -1

Query  829  TLDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            +L+V + AGNFH     S     IF+A ++    +H N+SH I+ LSFG  YPG+ NPLD
Sbjct  208  SLEVNKVAGNFHFATGQSFLQSAIFLADLLALQDNHYNISHQINKLSFGHHYPGLVNPLD  267

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLY  482
            G +       G ++Y+IK+VPT Y  +   V+ +NQ+SV+E++        A P V+F Y
Sbjct  268  GVKWFQGTSHGMYQYFIKVVPTVYTDIRGRVIHSNQYSVTEHFKSSELGTAAVPGVFFFY  327

Query  481  DLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            D+SPI VT KEE   FLHF+T +CA++GG F + G++D  +Y   + + K
Sbjct  328  DISPIKVTFKEEHIPFLHFMTNICAIIGGIFTVAGIVDSSIYYGQKTIKK  377



>ref|XP_009419691.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Musa acuminata subsp. malaccensis]
Length=384

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 102/169 (60%), Gaps = 4/169 (2%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            L+V R AGNFH     S HG   F+  ++   + + N+SH I+ LSFG ++PG+ NPLDG
Sbjct  208  LEVSRVAGNFHFAPGKSFHGSYSFLQDLLGIQTDNYNISHTINKLSFGKEFPGVVNPLDG  267

Query  658  TERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYD  479
             + I    SG ++Y+IK+VPT Y  +    + +NQFSV+E++     + +  P VYF+YD
Sbjct  268  VKWIHKTTSGMYQYFIKVVPTIYIDIRGHKIHSNQFSVTEHFRDADVYPKPPPGVYFIYD  327

Query  478  LSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             SPI V   EE  S LH  T  CA++GG F + G++D ++Y    A+ K
Sbjct  328  FSPIKVIFTEENASLLHLFTNACAIIGGVFTVAGIIDAFVYHGHRAIKK  376



>ref|XP_009488027.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum-Golgi intermediate 
compartment protein 3, partial [Pelecanus crispus]
Length=362

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 105/178 (59%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H I  LSFG  YPG
Sbjct  179  LEVNKVAGNFHFAPGKSFQQSHVHVHTVEIHDLQSF--GLDNINMTHHIKHLSFGRDYPG  236

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+   H  S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  237  IVNPLDGTDVTAHQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  296

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  297  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSACAIQK  354



>ref|XP_010294012.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Phaethon lepturus]
 gb|KFQ69900.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Phaethon lepturus]
Length=330

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  152  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  204

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  205  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  264

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  265  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSAHAIQK  322



>gb|EMS61746.1| hypothetical protein TRIUR3_13518 [Triticum urartu]
Length=391

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 107/177 (60%), Gaps = 14/177 (8%)
 Frame = -1

Query  826  LDVQRGAGNFHIS----VHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            LDV + AGNFH +     +  N+ V ++  +G    N++H I+ LSFG ++PG  NPLDG
Sbjct  209  LDVSKVAGNFHFAPGKGYYESNVDVPELTAEGG--FNITHKINKLSFGTEFPGAVNPLDG  266

Query  658  TERILH--------AGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAW  503
            T +           A  GT++Y+IK+VPT Y  +    + +NQFSV+E++   +   R  
Sbjct  267  TNQFHEHSAQWTQPASDGTYQYFIKVVPTIYNDIRGRKIDSNQFSVTEHFRDGNVQPRPQ  326

Query  502  PAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            P V+F YD SPI V   EE RSFLH++T LCA++GG F + G++D ++Y   +A+ K
Sbjct  327  PGVFFFYDFSPIKVIFTEENRSFLHYLTNLCAIVGGIFTVAGIIDSFIYHGQKALKK  383



>ref|XP_008219664.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Prunus mume]
Length=386

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 104/170 (61%), Gaps = 5/170 (3%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            L+V + AGNFH     S    N+ V  ++       N+SH I+ LSFG  +PG+ NPLDG
Sbjct  209  LEVNKVAGNFHFAPGKSFQQSNVHVHDLLAFQKDSFNISHTINRLSFGDYFPGVVNPLDG  268

Query  658  TERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAW-PAVYFLY  482
                    SG ++Y+IK+VPT Y  +S   + +NQFSV+E++      +  + P V+F Y
Sbjct  269  VHWAQATPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFRGTEVGNLQYLPGVFFFY  328

Query  481  DLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            DLSPI VT  EE  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  329  DLSPIKVTFTEEHISFLHFLTNVCAIVGGVFTVSGILDSFIYHGQKAIKK  378



>ref|XP_007227487.1| hypothetical protein PRUPE_ppa007001mg [Prunus persica]
 gb|EMJ28686.1| hypothetical protein PRUPE_ppa007001mg [Prunus persica]
Length=386

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 104/170 (61%), Gaps = 5/170 (3%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            L+V + AGNFH     S    N+ V  ++       N+SH I+ LSFG  +PG+ NPLDG
Sbjct  209  LEVNKVAGNFHFAPGKSFQQSNVHVHDLLAFQKDSFNISHTINRLSFGDYFPGVVNPLDG  268

Query  658  TERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAW-PAVYFLY  482
                    SG ++Y+IK+VPT Y  +S   + +NQFSV+E++      +  + P V+F Y
Sbjct  269  VHWAQATPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFRGTEVGNLQYLPGVFFFY  328

Query  481  DLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            DLSPI VT  EE  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  329  DLSPIKVTFTEEHISFLHFLTNVCAIVGGVFTVSGILDSFIYHGQKAIKK  378



>ref|XP_005986793.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Latimeria chalumnae]
Length=390

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 104/178 (58%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H I  LSFG  YPG
Sbjct  207  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHNIKHLSFGKDYPG  264

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++KIVPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  265  IVNPLDGTKVFAEQASMMFQYFVKIVPTIYVNIDGEVVRTNQFSVTRHEKVANGLIGDQG  324

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V   E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  325  LPGVFVLYELSPMMVKFTEKHRSFTHFLTGVCAIIGGVFTVAGLIDSLIYHSARAIQK  382



>ref|NP_001087591.1| endoplasmic reticulum-Golgi intermediate compartment protein 
3 [Xenopus laevis]
 sp|Q66KH2.1|ERGI3_XENLA RecName: Full=Endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Xenopus laevis]
 gb|AAH80394.1| MGC83277 protein [Xenopus laevis]
Length=389

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 104/178 (58%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H I  LSFG  YPG
Sbjct  206  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHEIKHLSFGKDYPG  263

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            + NPLDGT  +    S  F+Y++KIVPT Y  +  EVL TNQFSV+ +  + +    D+ 
Sbjct  264  LVNPLDGTSIVAMQSSMMFQYFVKIVPTVYVKVDGEVLRTNQFSVTRHEKMTNGLIGDQG  323

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V   E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  324  LPGVFVLYELSPMMVKFTEKHRSFTHFLTGVCAIIGGVFTVAGLIDSLIYYSTRAIQK  381



>gb|KEH31231.1| endoplasmic reticulum vesicle transporter [Medicago truncatula]
Length=384

 Score =   134 bits (338),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 105/170 (62%), Gaps = 5/170 (3%)
 Frame = -1

Query  829  TLDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            +L+V + AGNFH     S     IF+A ++    +H N+SH I+ LSFG  YPG+ NPLD
Sbjct  208  SLEVNKVAGNFHFATGQSFLQSAIFLADLLALQDNHYNISHQINKLSFGHHYPGLVNPLD  267

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLY  482
            G + +     G ++Y+IK+VPT Y  +   V+ +NQ+SV+E++    E   A P V+F Y
Sbjct  268  GIKWVQGNDHGMYQYFIKVVPTVYTDIRGRVIHSNQYSVTEHFKS-SELGAAVPGVFFFY  326

Query  481  DLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            D+SPI V  KEE   FLHF+T +CA++GG F + G++D  +Y   + + K
Sbjct  327  DISPIKVNFKEEHIPFLHFLTNICAIIGGIFTIAGIVDSSIYYGQKTIKK  376



>ref|XP_010080198.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Pterocles gutturalis]
 gb|KFV13924.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Pterocles gutturalis]
Length=330

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  152  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  204

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  E++ TNQFSV+ +  + +    D+ 
Sbjct  205  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEIVRTNQFSVTRHEKIANGLLGDQG  264

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  265  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  322



>ref|XP_005986794.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Latimeria chalumnae]
Length=385

 Score =   134 bits (338),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  207  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHNIKHLSFGKDYPG  259

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++KIVPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  260  IVNPLDGTKVFAEQASMMFQYFVKIVPTIYVNIDGEVVRTNQFSVTRHEKVANGLIGDQG  319

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V   E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  320  LPGVFVLYELSPMMVKFTEKHRSFTHFLTGVCAIIGGVFTVAGLIDSLIYHSARAIQK  377



>ref|XP_008319387.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Cynoglossus semilaevis]
Length=389

 Score =   134 bits (338),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 104/178 (58%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H+I  LSFG  YPG
Sbjct  206  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHLIKHLSFGKDYPG  263

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  ++Y++KIVPT Y     EVL TNQFSV+ +  + +    D+ 
Sbjct  264  IVNPLDGTDVNAPQASMMYQYFVKIVPTIYVKTDGEVLKTNQFSVTRHEKVANGLIGDQG  323

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V   E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  324  LPGVFVLYELSPMMVKFTEKHRSFTHFLTGVCAIVGGVFTVAGLIDSLIYHSARAIQK  381



>ref|XP_006202669.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Vicugna pacos]
Length=388

 Score =   134 bits (338),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 104/178 (58%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHYIQHLSFGEDYPG  262

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLD T  I    S  F+Y++K+VPT Y  +  EVL TNQFSV+ +  + +    D+ 
Sbjct  263  IVNPLDRTNVIAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLMGDQG  322

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  323  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQK  380



>ref|XP_009636179.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum-Golgi intermediate 
compartment protein 3, partial [Egretta garzetta]
Length=346

 Score =   134 bits (336),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 104/178 (58%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H I  LSFG  YPG
Sbjct  163  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHYIKHLSFGRDYPG  220

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  221  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  280

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  281  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSACAIQK  338



>ref|XP_006188640.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Camelus ferus]
 ref|XP_010959106.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X3 [Camelus bactrianus]
 ref|XP_010973481.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X3 [Camelus dromedarius]
Length=388

 Score =   134 bits (338),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 104/178 (58%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHYIQHLSFGEDYPG  262

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLD T  I    S  F+Y++K+VPT Y  +  EVL TNQFSV+ +  + +    D+ 
Sbjct  263  IVNPLDRTNVIAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLMGDQG  322

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  323  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQK  380



>ref|XP_006202670.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Vicugna pacos]
Length=383

 Score =   134 bits (338),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIQHLSFGEDYPG  257

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLD T  I    S  F+Y++K+VPT Y  +  EVL TNQFSV+ +  + +    D+ 
Sbjct  258  IVNPLDRTNVIAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLMGDQG  317

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  318  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQK  375



>ref|XP_009904016.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Picoides pubescens]
Length=448

 Score =   135 bits (340),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 104/178 (58%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H I  LSFG  YPG
Sbjct  265  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHYIKHLSFGRDYPG  322

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  323  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  382

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA+LGG F + G +D  +Y    A+ K
Sbjct  383  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAILGGIFTVAGFIDSLIYHSARAIQK  440



>ref|XP_008319388.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Cynoglossus semilaevis]
Length=384

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H+I  LSFG  YPG
Sbjct  206  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHLIKHLSFGKDYPG  258

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  ++Y++KIVPT Y     EVL TNQFSV+ +  + +    D+ 
Sbjct  259  IVNPLDGTDVNAPQASMMYQYFVKIVPTIYVKTDGEVLKTNQFSVTRHEKVANGLIGDQG  318

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V   E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  319  LPGVFVLYELSPMMVKFTEKHRSFTHFLTGVCAIVGGVFTVAGLIDSLIYHSARAIQK  376



>ref|XP_006188641.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Camelus ferus]
 ref|XP_010959107.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X4 [Camelus bactrianus]
 ref|XP_010973482.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X4 [Camelus dromedarius]
Length=383

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIQHLSFGEDYPG  257

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLD T  I    S  F+Y++K+VPT Y  +  EVL TNQFSV+ +  + +    D+ 
Sbjct  258  IVNPLDRTNVIAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLMGDQG  317

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  318  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQK  375



>ref|XP_010261264.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Nelumbo nucifera]
Length=385

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 107/171 (63%), Gaps = 7/171 (4%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            L+V + AGNFH     S    N+ V  ++       N+SH I+ L+FG  +PGI NPLD 
Sbjct  208  LEVNKVAGNFHFAPGKSFQQSNVHVHDLLAFQKDSFNISHKINRLAFGEYFPGIVNPLDR  267

Query  658  TERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR--AWPAVYFL  485
             + +    SG ++Y+IK+VPT Y  ++   + +NQFSV+E++    EF R  + P V+F 
Sbjct  268  VQWVQQTPSGMYQYFIKVVPTVYTDVNGHTIQSNQFSVTEHFRNA-EFGRPQSLPGVFFF  326

Query  484  YDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            YDLSPI VT  EE  SFLHF+T +CA++GG F ++G++D ++Y   +A+ K
Sbjct  327  YDLSPIKVTFTEEHVSFLHFLTSVCAIVGGIFTVSGIVDSFIYHGQKAIKK  377



>ref|XP_004961675.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Setaria italica]
Length=384

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 108/170 (64%), Gaps = 7/170 (4%)
 Frame = -1

Query  826  LDVQRGAGNFHIS----VHGLNIFVAQM-IFQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            LDV + AGNFH +     +  N+ V ++ + +G    N++H I+ LSFG ++PG+ NPLD
Sbjct  209  LDVSKVAGNFHFAPGKGFYESNVDVPELSVLEGG--FNITHKINKLSFGTEFPGVVNPLD  266

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLY  482
            G +    A  GT++Y+IK+VPT Y  +    + +NQFSV+E++   +   +  P V+F Y
Sbjct  267  GAQWAQPASDGTYQYFIKVVPTIYTDIRGRKIHSNQFSVTEHFRDGNVRPKPQPGVFFFY  326

Query  481  DLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            D SPI V   EE RS LH++T LCA++GG F ++G++D ++Y   +A+ K
Sbjct  327  DFSPIKVIFTEENRSLLHYLTNLCAIVGGVFTVSGIIDSFIYHGQKALKK  376



>ref|XP_009973938.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum-Golgi intermediate 
compartment protein 3, partial [Tyto alba]
Length=346

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 104/178 (58%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H I  LSFG  YPG
Sbjct  163  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHYIKHLSFGRDYPG  220

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ +NQFSV+ +  + +    D+ 
Sbjct  221  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRSNQFSVTRHEKIANGLLGDQG  280

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  281  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGIFTVAGFIDSLVYHSARAIQK  338



>gb|KFP09370.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Egretta garzetta]
Length=330

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  152  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  204

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  205  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  264

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  265  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSACAIQK  322



>ref|XP_007018816.1| Endoplasmic reticulum vesicle transporter protein isoform 1 [Theobroma 
cacao]
 gb|EOY16041.1| Endoplasmic reticulum vesicle transporter protein isoform 1 [Theobroma 
cacao]
Length=386

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 105/171 (61%), Gaps = 7/171 (4%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            L+V + AGNFH     S    N+ V  ++       N+SH I+ L+FG  +PG+ NPLDG
Sbjct  209  LEVNKVAGNFHFAPGKSFQQSNVHVHDLLAFQKDSFNISHKINRLAFGDYFPGVVNPLDG  268

Query  658  TERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR--AWPAVYFL  485
                    SG ++Y+IK+VPT Y  +S   + +NQFSV+E++    E +R  + P V+F 
Sbjct  269  VHWTQEQPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFKGA-EINRLQSLPGVFFF  327

Query  484  YDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            YDLSPI VT  E+  SFLHF+T +CA++GG F ++G+LD ++Y    A+ K
Sbjct  328  YDLSPIKVTFTEQHVSFLHFLTNVCAIVGGVFTVSGILDSFIYHGQRAIKK  378



>ref|XP_010133714.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3, partial [Buceros rhinoceros silvestris]
Length=330

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  152  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  204

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  205  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  264

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  265  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSACAIQK  322



>gb|KFV55314.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Gavia stellata]
Length=330

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  152  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  204

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  205  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  264

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  265  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSACAIQK  322



>ref|XP_005496546.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Zonotrichia albicollis]
Length=390

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 104/178 (58%), Gaps = 13/178 (7%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + V+ + I    +   G  ++N++H I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVYAVEIRFHDLQSFGLDNINMTHYIKHLSFGRDYPG  264

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT       S  F+Y++K+VPT YR +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  265  IVNPLDGTAITAQQASMMFQYFVKVVPTVYRKVDGEVVRTNQFSVTRHEKIANGLLGDQG  324

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  325  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  382



>ref|XP_009009462.1| hypothetical protein HELRODRAFT_105492 [Helobdella robusta]
 gb|ESO12742.1| hypothetical protein HELRODRAFT_105492 [Helobdella robusta]
Length=383

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 103/172 (60%), Gaps = 7/172 (4%)
 Frame = -1

Query  826  LDVQRGAGNFH----ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            L+V + AGNFH    +S    ++ V  M   G++  N SH ++ LSFG  YPG +NPLDG
Sbjct  204  LEVNKVAGNFHMAPGVSFSQNHMHVHDMQAIGTTSFNTSHTVNHLSFGEDYPGQNNPLDG  263

Query  658  TERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEY---YSLIHEFDRAWPAVYF  488
            +    H  S  F YY+K+VPT Y  L+ E + TNQ+SV+++   Y+     D   P ++F
Sbjct  264  SVLTAHQLSTMFHYYVKVVPTTYSKLNGETIYTNQYSVTKHTKIYTTGFFGDSGLPGIFF  323

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             Y+LSP+ V   E+RRSF HF+T +CA++GG F + G+ D  +Y    A+ K
Sbjct  324  TYELSPMMVKYTEKRRSFTHFLTGVCAIVGGVFTVAGLFDSLLYHSSRAIQK  375



>gb|KFV43899.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Tyto alba]
Length=330

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  152  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  204

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ +NQFSV+ +  + +    D+ 
Sbjct  205  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRSNQFSVTRHEKIANGLLGDQG  264

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  265  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGIFTVAGFIDSLVYHSARAIQK  322



>ref|XP_004687301.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Condylura cristata]
Length=388

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 104/178 (58%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHYIRHLSFGEDYPG  262

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLD T  I    S  F+Y++K+VPT Y  +  EVL TNQFSV+ +  + +    D+ 
Sbjct  263  IVNPLDRTNVIAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLMGDQG  322

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  323  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQK  380



>ref|XP_007258563.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X3 [Astyanax mexicanus]
Length=351

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 104/178 (58%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H+I  LSFG  YPG
Sbjct  168  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHLIKHLSFGKDYPG  225

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT       S  ++Y++KIVPT Y     EV+ TNQFSV+ +  + +    D+ 
Sbjct  226  IVNPLDGTNVAAPQASMMYQYFVKIVPTVYVKGDGEVVKTNQFSVTRHEKVANGLIGDQG  285

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V   E++RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  286  LPGVFVLYELSPMMVKFTEKQRSFTHFLTGVCAIIGGVFTVAGLIDSLIYHSARAIQK  343



>ref|XP_009812641.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum-Golgi intermediate 
compartment protein 3, partial [Gavia stellata]
Length=334

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  156  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  208

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  209  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLLGDQG  268

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  269  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIVGGIFTVAGFIDSLIYHSACAIQK  326



>ref|NP_001158869.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3 [Salmo salar]
 gb|ACN10649.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3 [Salmo salar]
Length=388

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 106/178 (60%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H+I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHLIKHLSFGRDYPG  262

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  ++Y++KIVPT Y     EV+ TNQFSV+ +  + +    D+ 
Sbjct  263  IVNPLDGTDVAAPQASMMYQYFVKIVPTIYVKWDGEVVKTNQFSVTRHEKVANGLIGDQG  322

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V   E++RSF HF+T +CA++GG F + G++D  +Y   +A+ K
Sbjct  323  LPGVFVLYELSPMMVKFTEKQRSFTHFLTGVCAIVGGVFTVAGLIDSLIYHSAKAIQK  380



>ref|XP_004237893.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Solanum lycopersicum]
Length=386

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 110/172 (64%), Gaps = 9/172 (5%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMI-FQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            L+V + AGNFH     S    N+ V  ++ FQ  S+ N+SH I+ L++G  +PG+ NPLD
Sbjct  209  LEVNKVAGNFHFAPGKSFQQSNVHVHDLLTFQKDSY-NISHKINRLTYGEYFPGVVNPLD  267

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDR--AWPAVYF  488
            G +       G ++Y+IK+VPT Y  +S   + TNQFSV+E++    +F R  + P V+F
Sbjct  268  GVKWTQETPHGMYQYFIKVVPTVYTDVSGHTIQTNQFSVTEHFKGA-DFGRFQSIPGVFF  326

Query  487  LYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             YDLSPI VT  E+  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  327  FYDLSPIKVTFTEQHASFLHFLTNVCAIVGGVFTVSGILDSFIYHGQKAIKK  378



>ref|XP_006654573.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Oryza brachyantha]
Length=384

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 106/171 (62%), Gaps = 9/171 (5%)
 Frame = -1

Query  826  LDVQRGAGNFHIS------VHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPL  665
            LDV + AGNFH +         +N+    ++ QG    N++H I+ LSFG ++PG+ NPL
Sbjct  209  LDVSKVAGNFHFAPGKGFYQSNINVPELSVLEQG---FNITHKINKLSFGTEFPGVVNPL  265

Query  664  DGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFL  485
            +G +    A  GT++Y+IK+VPT Y  L    + +NQFSV+E++   +   +  P V+F 
Sbjct  266  NGAQWTQPASDGTYQYFIKVVPTIYTDLRGRKIHSNQFSVTEHFRDGNVRPKPQPGVFFF  325

Query  484  YDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            YD SPI V   EE RS LH++T LCA++GG F ++G++D ++Y   +A+ K
Sbjct  326  YDFSPIKVIFTEENRSLLHYLTNLCAIVGGVFTVSGIIDSFIYHGQKALKK  376



>ref|XP_010901817.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Esox lucius]
Length=388

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 106/178 (60%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H+I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHLIKHLSFGRDYPG  262

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  ++Y++KIVPT Y     EV+ TNQFSV+ +  + +    D+ 
Sbjct  263  IVNPLDGTDVAAPQASMMYQYFVKIVPTIYVKWDGEVVKTNQFSVTRHEKVANGLIGDQG  322

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V   E++RSF HF+T +CA++GG F + G++D  +Y   +A+ K
Sbjct  323  LPGVFVLYELSPMMVKFTEKQRSFTHFLTGVCAIVGGVFTVAGLIDSLIYHSAKAIQK  380



>ref|XP_002977139.1| hypothetical protein SELMODRAFT_271242 [Selaginella moellendorffii]
 ref|XP_002992135.1| hypothetical protein SELMODRAFT_162191 [Selaginella moellendorffii]
 gb|EFJ06790.1| hypothetical protein SELMODRAFT_162191 [Selaginella moellendorffii]
 gb|EFJ21748.1| hypothetical protein SELMODRAFT_271242 [Selaginella moellendorffii]
Length=386

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 107/171 (63%), Gaps = 5/171 (3%)
 Frame = -1

Query  829  TLDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            +L+V + AGNFH     S    ++ V  +        NVSH I++LSFG ++PG+ NPLD
Sbjct  208  SLEVNKVAGNFHFAPGKSFSQQHVHVHDVQSLHKEKFNVSHYINELSFGARFPGVVNPLD  267

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVYFL  485
              +RI    S  ++Y+IK+VPT Y  ++   + TNQFSV++++  +   + R+ P V+F 
Sbjct  268  KEKRIQKFPSAMYQYFIKVVPTAYTDMTGHKIVTNQFSVTDHFKAVEGLNGRSLPGVFFF  327

Query  484  YDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            Y+LSPI V   E + SFLHF+T +CA++GG F ++G++D ++Y    A+ K
Sbjct  328  YELSPIKVLFTERKTSFLHFLTNVCAIIGGVFTVSGIIDSFIYHGHRAIKK  378



>ref|XP_004687302.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Condylura cristata]
Length=383

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIRHLSFGEDYPG  257

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLD T  I    S  F+Y++K+VPT Y  +  EVL TNQFSV+ +  + +    D+ 
Sbjct  258  IVNPLDRTNVIAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLMGDQG  317

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  318  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQK  375



>ref|XP_002513896.1| Endoplasmic reticulum-Golgi intermediate compartment protein, 
putative [Ricinus communis]
 gb|EEF48479.1| Endoplasmic reticulum-Golgi intermediate compartment protein, 
putative [Ricinus communis]
Length=386

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 104/170 (61%), Gaps = 5/170 (3%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            L+V + AGNFH     S    N+ V  ++       N+SH I+ L+FG  +PG+ NPLDG
Sbjct  209  LEVNKVAGNFHFAPGKSFQQSNVHVHDLLAFQKDSFNISHKINRLAFGDYFPGVVNPLDG  268

Query  658  TERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVYFLY  482
                    SG ++Y+IK+VPT Y  +S   + +NQFSV+E++        ++ P V+F Y
Sbjct  269  VHWTQETPSGMYQYFIKVVPTVYTDVSGYTIQSNQFSVTEHFRSAEAGRLQSLPGVFFFY  328

Query  481  DLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            DLSPI VT  EE  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  329  DLSPIKVTFTEEHVSFLHFLTNVCAIVGGVFTVSGILDSFIYHGQKAIKK  378



>ref|XP_006750457.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Leptonychotes weddellii]
Length=268

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 103/178 (58%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H I  LSFG  YPG
Sbjct  85   LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHHIRHLSFGEDYPG  142

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLD T       S  F+Y++K+VPT Y  +  EVL TNQFSV+ +  + +    D+ 
Sbjct  143  IVNPLDRTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLMGDQG  202

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  203  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQK  260



>ref|NP_001141198.1| uncharacterized protein LOC100273285 [Zea mays]
 gb|ACF85689.1| unknown [Zea mays]
 gb|ACR36949.1| unknown [Zea mays]
 gb|AFW78472.1| DUF1692 domain, endoplasmic reticulum vescicle transporter protein 
[Zea mays]
Length=384

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 108/170 (64%), Gaps = 7/170 (4%)
 Frame = -1

Query  826  LDVQRGAGNFHIS----VHGLNIFVAQM-IFQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            LDV + AGNFH +     +  NI V ++ + +G    N++H I+ LSFG ++PG+ NPLD
Sbjct  209  LDVSKVAGNFHFAPGKGFYESNIDVPELSLLEGG--FNITHKINKLSFGTEFPGVVNPLD  266

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLY  482
            G +    A  GT++Y+IK+VPT Y  +    + +NQFSV+E++   +   +  P V+F Y
Sbjct  267  GAQWTQPASDGTYQYFIKVVPTIYTDIRGHNIHSNQFSVTEHFRDGNVRPKPQPGVFFFY  326

Query  481  DLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            D SPI V   EE RS LH++T LCA++GG F ++G++D ++Y   +A+ K
Sbjct  327  DFSPIKVIFTEESRSLLHYLTNLCAIVGGVFTVSGIIDSFIYHGQKALKK  376



>ref|XP_009386733.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Musa acuminata subsp. malaccensis]
Length=384

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 100/169 (59%), Gaps = 4/169 (2%)
 Frame = -1

Query  826  LDVQRGAGNFHIS----VHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            LDV + AGNFH S     H   I    ++   +   N+SH I+ LSFG ++PG+ NPLD 
Sbjct  208  LDVSKVAGNFHFSPGKSFHQSGIHAHDLLAFQTESYNISHRINKLSFGKEFPGVVNPLDR  267

Query  658  TERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYD  479
             +       G ++Y+IK+VPT Y  +    + +NQFSV+E++     + R  P VYF YD
Sbjct  268  AQWKQGGSFGMYQYFIKVVPTIYHGIRGHKINSNQFSVTEHFRDESVYPRPLPGVYFFYD  327

Query  478  LSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             SPI V   EE RS LHF+T+LCA++GG F ++G++D ++Y     + K
Sbjct  328  FSPIKVIFTEENRSILHFLTQLCAIIGGVFTVSGIIDAFVYHGARTIKK  376



>ref|XP_010901818.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Esox lucius]
Length=383

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 105/178 (59%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H+I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHLIKHLSFGRDYPG  257

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  ++Y++KIVPT Y     EV+ TNQFSV+ +  + +    D+ 
Sbjct  258  IVNPLDGTDVAAPQASMMYQYFVKIVPTIYVKWDGEVVKTNQFSVTRHEKVANGLIGDQG  317

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V   E++RSF HF+T +CA++GG F + G++D  +Y   +A+ K
Sbjct  318  LPGVFVLYELSPMMVKFTEKQRSFTHFLTGVCAIVGGVFTVAGLIDSLIYHSAKAIQK  375



>ref|XP_006472628.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Citrus sinensis]
 gb|KDO80919.1| hypothetical protein CISIN_1g016587mg [Citrus sinensis]
Length=386

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 103/170 (61%), Gaps = 5/170 (3%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            L+V + AGNFH     S H   + V  ++       N+SH I+ L+FG  +PG+ NPLDG
Sbjct  209  LEVNKVAGNFHFAPGKSFHQSGVHVHDILAFQRDSFNISHKINKLAFGEHFPGVVNPLDG  268

Query  658  TERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVYFLY  482
                    SG ++Y+IK+VPT Y  +S   + +NQFSV+E++    +   +  P V+F Y
Sbjct  269  VRWTQETPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFRSSEQGRLQTLPGVFFFY  328

Query  481  DLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            DLSPI VT  EE  SFLHF+T +CA++GG F ++G++D ++Y    A+ K
Sbjct  329  DLSPIKVTFTEEHVSFLHFLTNVCAIVGGVFTVSGIIDAFIYHGQRAIKK  378



>ref|XP_012067840.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Jatropha curcas]
 ref|XP_012067841.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Jatropha curcas]
Length=386

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 104/170 (61%), Gaps = 5/170 (3%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            L+V + AGNFH     S    N+ V  ++       N+SH I+ L+FG  +PG+ NPLDG
Sbjct  209  LEVNKVAGNFHFAPGKSFQQSNVHVHDLLAFQKDSFNISHKINRLTFGEYFPGVVNPLDG  268

Query  658  TERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVYFLY  482
                    SG ++Y++K+VPT Y  +S   + +NQFSV+E++        +A P V+F Y
Sbjct  269  VHWTQETPSGMYQYFLKVVPTVYTDVSGHTIQSNQFSVTEHFRSAEAGRLQALPGVFFFY  328

Query  481  DLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            DLSPI VT  E+  SFLHF+T +CA++GG F ++G+LD ++Y   +A+ K
Sbjct  329  DLSPIKVTFTEQHVSFLHFLTNVCAIVGGVFTVSGILDSFIYHGQKAIKK  378



>ref|XP_008373201.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like [Malus domestica]
Length=389

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 106/173 (61%), Gaps = 9/173 (5%)
 Frame = -1

Query  829  TLDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            +L+V + AGNFH     S H  N+ +  ++   +   N+SH I+ L+FG  +PG+ NPLD
Sbjct  211  SLEVNKVAGNFHFIPGKSFHQSNVHLHDLLAFPTDSYNISHKINRLAFGDYFPGVQNPLD  270

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYY---SLIHEFDRAWPAVY  491
            G +      SG ++Y+IK+VPT Y  +    + +NQ+SV+E+Y    L H   +  P V+
Sbjct  271  GVQWTQERPSGVYQYFIKVVPTIYTNIIGRTIFSNQYSVTEHYKSSELGHS--QMLPGVF  328

Query  490  FLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            F YDLSPI VT KEE   FLHF+T +CA++GG F + G++D ++Y    A+ K
Sbjct  329  FFYDLSPIKVTFKEEHVPFLHFMTHICAIIGGIFTIAGLIDSFIYYGQRAIKK  381



>ref|XP_007429095.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Python bivittatus]
Length=372

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  194  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNMNMTHFIRHLSFGKDYPG  246

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            + NPLDGT       S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  247  LVNPLDGTVVAAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLIGDQG  306

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  307  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGVFTVAGLIDSLIYHSARAIQK  364



>ref|XP_007258561.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Astyanax mexicanus]
Length=388

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 104/178 (58%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H+I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHLIKHLSFGKDYPG  262

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT       S  ++Y++KIVPT Y     EV+ TNQFSV+ +  + +    D+ 
Sbjct  263  IVNPLDGTNVAAPQASMMYQYFVKIVPTVYVKGDGEVVKTNQFSVTRHEKVANGLIGDQG  322

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V   E++RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  323  LPGVFVLYELSPMMVKFTEKQRSFTHFLTGVCAIIGGVFTVAGLIDSLIYHSARAIQK  380



>ref|XP_003220521.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Anolis carolinensis]
Length=388

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 104/178 (58%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++HII  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHIIKHLSFGRDYPG  262

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT       S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  263  IVNPLDGTVVSAQQASMMFQYFVKVVPTIYMKVDGEVVRTNQFSVTRHEKIANGLIGDQG  322

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y     + K
Sbjct  323  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGVFTVAGLIDSLIYHSARVIQK  380



>ref|XP_007258562.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X2 [Astyanax mexicanus]
Length=383

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H+I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHLIKHLSFGKDYPG  257

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT       S  ++Y++KIVPT Y     EV+ TNQFSV+ +  + +    D+ 
Sbjct  258  IVNPLDGTNVAAPQASMMYQYFVKIVPTVYVKGDGEVVKTNQFSVTRHEKVANGLIGDQG  317

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V   E++RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  318  LPGVFVLYELSPMMVKFTEKQRSFTHFLTGVCAIIGGVFTVAGLIDSLIYHSARAIQK  375



>emb|CDO97460.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 103/171 (60%), Gaps = 5/171 (3%)
 Frame = -1

Query  829  TLDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            +L+V R AGNFH     S H  N+ V  ++   +   N+SH I+ L+FG   PG+ NPLD
Sbjct  208  SLEVNRVAGNFHFTLGKSFHQSNVHVHDLLALSTESYNISHKINKLAFGDSIPGVVNPLD  267

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYY-SLIHEFDRAWPAVYFL  485
            G        +G  +Y+IK+VPT Y  +    + +NQFSV+E++ S      R  P V+F 
Sbjct  268  GVHWEHETPNGMHQYFIKVVPTIYTDIRGRSIESNQFSVTEHFKSSEAGHSRTLPGVFFF  327

Query  484  YDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            YDLSPI VT KE+  SFLHF+T +CA++GG F + G++D  +Y   +A+ K
Sbjct  328  YDLSPIKVTYKEDHASFLHFMTHICAIVGGIFTIAGIVDALIYHGQKALKK  378



>gb|KHG11605.1| Endoplasmic reticulum-Golgi intermediate compartment 3 [Gossypium 
arboreum]
Length=387

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 100/163 (61%), Gaps = 5/163 (3%)
 Frame = -1

Query  829  TLDVQRGAGNFHIS----VHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLD  662
            +L+V R AGNFH +     H  NIF   ++       N+SH I+ L+FG  +PG+ NPLD
Sbjct  209  SLEVNRVAGNFHFAPGKTFHQSNIFFDDLMSVHKDSYNISHRINRLAFGEYFPGVVNPLD  268

Query  661  GTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFD-RAWPAVYFL  485
            G        +G ++Y+IK+VPT Y  +    + +NQ+SV+E++  +      + P V+F 
Sbjct  269  GGHWTHETSNGMYQYFIKVVPTIYTDIRGRTVKSNQYSVTEHFKDLEYISPNSQPGVFFY  328

Query  484  YDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMY  356
            YD SPI VT KEE  SFLHFIT +CAV+GG F + G++D ++Y
Sbjct  329  YDFSPIKVTFKEEHSSFLHFITNICAVIGGIFTVAGIIDTFVY  371



>ref|XP_003220520.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Anolis carolinensis]
Length=383

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++HII  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHIIKHLSFGRDYPG  257

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT       S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  258  IVNPLDGTVVSAQQASMMFQYFVKVVPTIYMKVDGEVVRTNQFSVTRHEKIANGLIGDQG  317

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y     + K
Sbjct  318  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGVFTVAGLIDSLIYHSARVIQK  375



>ref|XP_006921817.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Pteropus alecto]
 ref|XP_011376633.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X2 [Pteropus vampyrus]
 gb|ELK04141.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3 [Pteropus alecto]
Length=383

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 102/178 (57%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIRHLSFGEDYPG  257

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLD T       S  F+Y++K+VPT Y  L  EVL TNQFSV+ +  + +    D+ 
Sbjct  258  IVNPLDRTNVTAPQASMMFQYFVKVVPTVYMKLDGEVLRTNQFSVTRHEKVANGLLGDQG  317

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  318  LPGVFVLYELSPMVVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQK  375



>gb|ACC68956.1| serologically defined breast cancer antigen 84 isoform a (predicted) 
[Rhinolophus ferrumequinum]
Length=388

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 103/178 (58%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHYIRHLSFGEDYPG  262

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLD T       S  F+Y++K+VPT Y  L  EVL TNQFSV+ +  + +    D+ 
Sbjct  263  IVNPLDRTNVTAPQASMMFQYFVKVVPTVYMKLDGEVLRTNQFSVTRHEKVANGLLGDQG  322

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  323  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQK  380



>ref|XP_007429094.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X1 [Python bivittatus]
Length=383

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 103/178 (58%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  205  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNMNMTHFIRHLSFGKDYPG  257

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            + NPLDGT       S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  258  LVNPLDGTVVAAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLIGDQG  317

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  318  LPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGVFTVAGLIDSLIYHSARAIQK  375



>ref|XP_001764962.1| predicted protein [Physcomitrella patens]
 gb|EDQ70178.1| predicted protein [Physcomitrella patens]
Length=385

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 102/169 (60%), Gaps = 4/169 (2%)
 Frame = -1

Query  826  LDVQRGAGNFHI----SVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPGIHNPLDG  659
            L+V + AGNFH     S     + +  ++   +   NVSH I++LSFG  +PG  NPLD 
Sbjct  209  LEVNKVAGNFHFAPGKSFQQSAMHLLDLMGFITDSFNVSHTINELSFGAHFPGAVNPLDK  268

Query  658  TERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEFDRAWPAVYFLYD  479
               I    +G ++Y+IK+VPT Y  +    + TNQFSV+E+Y+      R  P V+F YD
Sbjct  269  VTNIQKDLNGMYQYFIKVVPTVYTDIKGRKISTNQFSVTEHYTAGDHGPRFVPGVFFFYD  328

Query  478  LSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
            LSPI V   EER SFLHF+T +CA++GG +++ G++D ++Y    A+ K
Sbjct  329  LSPIKVKFSEERPSFLHFLTNVCAIVGGVYSIAGIIDSFVYHGHRAIKK  377



>ref|XP_004946986.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X5 [Gallus gallus]
 ref|XP_004946997.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 isoform X5 [Gallus gallus]
Length=335

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 103/178 (58%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H I  LSFG  YPG
Sbjct  152  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHYIKHLSFGRDYPG  209

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  210  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLIGDQG  269

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ R F HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  270  LPGVFVLYELSPMMVKLTEKHRPFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  327



>ref|XP_009677582.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Struthio camelus australis]
Length=339

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 103/178 (58%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H I  LSFG  YPG
Sbjct  156  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHYIKHLSFGRDYPG  213

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  214  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLIGDQG  273

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ R F HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  274  LPGVFVLYELSPMMVKLTEKHRPFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  331



>ref|XP_004548890.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Maylandia zebra]
 ref|XP_005724450.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Pundamilia nyererei]
 ref|XP_005947006.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3-like isoform X1 [Haplochromis burtoni]
Length=389

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 104/178 (58%), Gaps = 15/178 (8%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH + I   Q    G  ++N++H+I  LSFG  YPG
Sbjct  206  LEVNKVAGNFHFAPGKSFQQSHVHVHAVEIHDLQSF--GLDNINMTHLIKHLSFGKDYPG  263

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            + NPLDGT+      S  ++Y++KIVPT Y     EV+ TNQFSV+ +  + +    D+ 
Sbjct  264  LVNPLDGTDVTAPQASMMYQYFVKIVPTIYVKTDGEVVKTNQFSVTRHEKVANGLIGDQG  323

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V   E+ RSF HF+T +CA++GG F + G++D  +Y    A+ K
Sbjct  324  LPGVFVLYELSPMMVKFTEKHRSFTHFLTGVCAIIGGVFTVAGLIDSLIYHSARAIQK  381



>gb|KGL78646.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Tinamus guttatus]
Length=330

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 102/178 (57%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  152  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  204

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  205  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLIGDQG  264

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ R F HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  265  LPGVFVLYELSPMMVKLTEKHRPFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  322



>gb|KFV83582.1| Endoplasmic reticulum-Golgi intermediate compartment protein 
3, partial [Struthio camelus australis]
Length=330

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 102/178 (57%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  152  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  204

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  205  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLIGDQG  264

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ R F HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  265  LPGVFVLYELSPMMVKLTEKHRPFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  322



>ref|XP_005018101.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Anas platyrhynchos]
Length=334

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 102/178 (57%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  156  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  208

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  209  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLIGDQG  268

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ R F HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  269  LPGVFVLYELSPMMVKLTEKHRPFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  326



>ref|XP_010720552.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment 
protein 3 [Meleagris gallopavo]
Length=346

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 102/178 (57%), Gaps = 20/178 (11%)
 Frame = -1

Query  826  LDVQRGAGNFH-----------ISVHGLNIFVAQMIFQGSSHVNVSHIIHDLSFGPKYPG  680
            L+V + AGNFH           + VH L  F       G  ++N++H I  LSFG  YPG
Sbjct  168  LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSF-------GLDNINMTHYIKHLSFGRDYPG  220

Query  679  IHNPLDGTERILHAGSGTFKYYIKIVPTEYRYLSKEVLPTNQFSVSEYYSLIHEF--DRA  506
            I NPLDGT+      S  F+Y++K+VPT Y  +  EV+ TNQFSV+ +  + +    D+ 
Sbjct  221  IVNPLDGTDVTAQQASMMFQYFVKVVPTVYMKVDGEVVRTNQFSVTRHEKIANGLIGDQG  280

Query  505  WPAVYFLYDLSPITVTIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRLVEAVTK  332
             P V+ LY+LSP+ V + E+ R F HF+T +CA++GG F + G +D  +Y    A+ K
Sbjct  281  LPGVFVLYELSPMMVKLTEKHRPFTHFLTGVCAIVGGIFTVAGFIDSLIYHSARAIQK  338



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1853757769455