BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4036

Length=1228
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAB37246.1|  calmodulin-binding protein                              351   5e-112   Nicotiana tabacum [American tobacco]
ref|XP_010323248.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    345   1e-108   
gb|KDP22927.1|  hypothetical protein JCGZ_01764                         328   4e-102   Jatropha curcas
ref|XP_012089652.1|  PREDICTED: uncharacterized protein LOC105648014    328   5e-102   Jatropha curcas
emb|CDP02958.1|  unnamed protein product                                327   7e-102   Coffea canephora [robusta coffee]
ref|XP_002526232.1|  calmodulin binding protein, putative               318   3e-100   
ref|XP_011079310.1|  PREDICTED: uncharacterized protein LOC105162855    318   3e-98    Sesamum indicum [beniseed]
ref|XP_006453423.1|  hypothetical protein CICLE_v10007720mg             314   9e-97    
ref|XP_007014160.1|  Calmodulin-binding protein isoform 1               311   1e-95    
ref|XP_007014163.1|  Calmodulin-binding protein isoform 4               309   1e-94    
gb|KDO62470.1|  hypothetical protein CISIN_1g006542mg                   308   3e-94    Citrus sinensis [apfelsine]
ref|XP_010047003.1|  PREDICTED: uncharacterized protein LOC104435...    305   3e-93    Eucalyptus grandis [rose gum]
gb|KDO62471.1|  hypothetical protein CISIN_1g006542mg                   303   2e-92    Citrus sinensis [apfelsine]
gb|KJB83411.1|  hypothetical protein B456_013G246400                    299   5e-91    Gossypium raimondii
ref|XP_002325070.1|  calmodulin-binding family protein                  299   1e-90    Populus trichocarpa [western balsam poplar]
ref|XP_010103014.1|  hypothetical protein L484_022898                   297   3e-90    Morus notabilis
gb|KHG27572.1|  Cytochrome P450                                         296   5e-90    Gossypium arboreum [tree cotton]
ref|XP_011044001.1|  PREDICTED: uncharacterized protein LOC105139309    296   1e-89    Populus euphratica
ref|XP_006366189.1|  PREDICTED: uncharacterized protein LOC102581064    295   1e-89    
ref|XP_011018189.1|  PREDICTED: uncharacterized protein LOC105121292    294   6e-89    Populus euphratica
ref|XP_010259794.1|  PREDICTED: uncharacterized protein LOC104599111    283   1e-84    
ref|XP_008453624.1|  PREDICTED: uncharacterized protein LOC103494282    279   2e-83    Cucumis melo [Oriental melon]
gb|KJB22129.1|  hypothetical protein B456_004G031000                    279   3e-83    Gossypium raimondii
ref|XP_010265460.1|  PREDICTED: uncharacterized protein LOC104603...    278   3e-83    Nelumbo nucifera [Indian lotus]
ref|XP_010265459.1|  PREDICTED: uncharacterized protein LOC104603...    277   5e-83    Nelumbo nucifera [Indian lotus]
ref|XP_010265458.1|  PREDICTED: uncharacterized protein LOC104603...    278   8e-83    
ref|XP_010265456.1|  PREDICTED: uncharacterized protein LOC104603...    278   1e-82    Nelumbo nucifera [Indian lotus]
ref|XP_010656822.1|  PREDICTED: uncharacterized protein LOC100264...    273   7e-82    
gb|KHG10046.1|  Protein very KIND                                       275   9e-82    Gossypium arboreum [tree cotton]
emb|CBI17793.3|  unnamed protein product                                275   1e-81    Vitis vinifera
ref|XP_002270522.1|  PREDICTED: uncharacterized protein LOC100264...    275   1e-81    Vitis vinifera
ref|XP_004146305.1|  PREDICTED: uncharacterized protein LOC101216741    271   2e-80    Cucumis sativus [cucumbers]
ref|XP_007154785.1|  hypothetical protein PHAVU_003G147800g             268   2e-79    Phaseolus vulgaris [French bean]
ref|XP_007225676.1|  hypothetical protein PRUPE_ppa002789mg             266   1e-78    Prunus persica
ref|XP_011457401.1|  PREDICTED: uncharacterized protein LOC101314910    265   4e-78    Fragaria vesca subsp. vesca
ref|XP_003542171.1|  PREDICTED: uncharacterized protein LOC100790...    265   8e-78    Glycine max [soybeans]
gb|KHN22715.1|  hypothetical protein glysoja_027603                     263   2e-77    Glycine soja [wild soybean]
ref|XP_003549493.1|  PREDICTED: uncharacterized protein LOC100803...    260   3e-76    Glycine max [soybeans]
gb|EYU20920.1|  hypothetical protein MIMGU_mgv1a002870mg                260   3e-76    Erythranthe guttata [common monkey flower]
gb|KHN17575.1|  hypothetical protein glysoja_005772                     260   4e-76    Glycine soja [wild soybean]
ref|XP_003610155.1|  Calmodulin-binding protein                         258   4e-75    Medicago truncatula
ref|XP_010914125.1|  PREDICTED: uncharacterized protein LOC105039615    257   5e-75    Elaeis guineensis
ref|XP_004507834.1|  PREDICTED: uncharacterized protein LOC101488...    256   7e-75    
ref|XP_004507832.1|  PREDICTED: uncharacterized protein LOC101488...    256   8e-75    Cicer arietinum [garbanzo]
ref|XP_004507831.1|  PREDICTED: uncharacterized protein LOC101488...    256   3e-74    Cicer arietinum [garbanzo]
ref|XP_008800271.1|  PREDICTED: uncharacterized protein LOC103714689    251   7e-73    Phoenix dactylifera
ref|XP_010536924.1|  PREDICTED: uncharacterized protein LOC104811802    249   4e-72    Tarenaya hassleriana [spider flower]
ref|XP_010913644.1|  PREDICTED: uncharacterized protein LOC105039256    249   7e-72    Elaeis guineensis
ref|XP_008805417.1|  PREDICTED: uncharacterized protein LOC103718396    249   7e-72    Phoenix dactylifera
ref|XP_010929241.1|  PREDICTED: uncharacterized protein LOC105050...    247   3e-71    Elaeis guineensis
ref|XP_010929240.1|  PREDICTED: uncharacterized protein LOC105050...    248   3e-71    Elaeis guineensis
ref|XP_008808337.1|  PREDICTED: uncharacterized protein LOC103720426    244   3e-70    Phoenix dactylifera
gb|EYU20919.1|  hypothetical protein MIMGU_mgv1a002870mg                239   1e-68    Erythranthe guttata [common monkey flower]
ref|XP_010688497.1|  PREDICTED: uncharacterized protein LOC104902420    238   6e-68    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006401191.1|  hypothetical protein EUTSA_v10012939mg             234   3e-66    Eutrema salsugineum [saltwater cress]
ref|XP_002866219.1|  calmodulin-binding protein                         231   5e-65    
ref|XP_006281432.1|  hypothetical protein CARUB_v10027506mg             227   1e-63    Capsella rubella
ref|XP_009388351.1|  PREDICTED: uncharacterized protein LOC103975166    216   2e-62    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010452498.1|  PREDICTED: uncharacterized protein LOC104734591    224   2e-62    Camelina sativa [gold-of-pleasure]
emb|CAB71126.1|  calmodulin-binding protein                             213   7e-62    Cicer arietinum [garbanzo]
ref|XP_010646160.1|  PREDICTED: uncharacterized protein LOC100256775    221   9e-62    Vitis vinifera
ref|XP_010483282.1|  PREDICTED: uncharacterized protein LOC104761843    222   1e-61    Camelina sativa [gold-of-pleasure]
emb|CAN66517.1|  hypothetical protein VITISV_001611                     221   1e-61    Vitis vinifera
emb|CBI23322.3|  unnamed protein product                                221   1e-61    Vitis vinifera
emb|CDY69506.1|  BnaCnng63910D                                          221   3e-61    Brassica napus [oilseed rape]
ref|XP_009589610.1|  PREDICTED: uncharacterized protein LOC104086953    219   4e-61    Nicotiana tomentosiformis
ref|XP_010443447.1|  PREDICTED: uncharacterized protein LOC104726314    220   5e-61    Camelina sativa [gold-of-pleasure]
ref|XP_009120276.1|  PREDICTED: uncharacterized protein LOC103845193    220   5e-61    Brassica rapa
ref|XP_004952753.1|  PREDICTED: uncharacterized protein LOC101756...    219   6e-61    Setaria italica
emb|CDY49721.1|  BnaA10g11510D                                          219   6e-61    Brassica napus [oilseed rape]
ref|XP_004952755.1|  PREDICTED: uncharacterized protein LOC101756...    219   8e-61    Setaria italica
gb|ABK95891.1|  unknown                                                 211   9e-61    Populus trichocarpa [western balsam poplar]
ref|XP_009794879.1|  PREDICTED: uncharacterized protein LOC104241635    218   1e-60    Nicotiana sylvestris
ref|XP_010092630.1|  hypothetical protein L484_006392                   218   2e-60    Morus notabilis
ref|NP_200566.1|  Calmodulin-binding protein                            216   7e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011043288.1|  PREDICTED: uncharacterized protein LOC105138...    216   2e-59    Populus euphratica
ref|XP_009398635.1|  PREDICTED: uncharacterized protein LOC103983171    214   8e-59    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002316655.1|  calmodulin-binding protein 60-C                    213   1e-58    Populus trichocarpa [western balsam poplar]
ref|XP_006384008.1|  hypothetical protein POPTR_0004s03510g             213   2e-58    
ref|XP_004485707.1|  PREDICTED: uncharacterized protein LOC101498971    212   2e-58    Cicer arietinum [garbanzo]
ref|XP_008645829.1|  PREDICTED: uncharacterized protein LOC103627...    212   3e-58    Zea mays [maize]
ref|XP_008678706.1|  PREDICTED: uncharacterized protein LOC103653644    212   3e-58    Zea mays [maize]
gb|KDP20890.1|  hypothetical protein JCGZ_21361                         211   4e-58    Jatropha curcas
gb|AGT16661.1|  hypothetical protein SHCRBa_107_F16_R_30                212   4e-58    Saccharum hybrid cultivar R570
dbj|BAJ94992.1|  predicted protein                                      212   4e-58    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_012091499.1|  PREDICTED: uncharacterized protein LOC105649...    211   4e-58    Jatropha curcas
ref|XP_011001128.1|  PREDICTED: uncharacterized protein LOC105108501    211   1e-57    Populus euphratica
ref|XP_008224946.1|  PREDICTED: uncharacterized protein LOC103324...    210   1e-57    Prunus mume [ume]
ref|XP_008645828.1|  PREDICTED: uncharacterized protein LOC103627...    211   1e-57    Zea mays [maize]
ref|XP_008224944.1|  PREDICTED: uncharacterized protein LOC103324...    210   1e-57    Prunus mume [ume]
ref|XP_012091498.1|  PREDICTED: uncharacterized protein LOC105649...    211   2e-57    
gb|KEH36516.1|  calmodulin-binding protein                              209   4e-57    Medicago truncatula
ref|XP_004232807.1|  PREDICTED: uncharacterized protein LOC101255950    209   4e-57    Solanum lycopersicum
ref|XP_008383819.1|  PREDICTED: uncharacterized protein LOC103446473    208   1e-56    
ref|XP_007213593.1|  hypothetical protein PRUPE_ppa002740mg             208   1e-56    Prunus persica
ref|XP_009606926.1|  PREDICTED: uncharacterized protein LOC104101...    206   1e-56    
ref|XP_009606927.1|  PREDICTED: uncharacterized protein LOC104101...    206   3e-56    Nicotiana tomentosiformis
ref|XP_007025783.1|  Calmodulin-binding protein isoform 2               206   6e-56    
ref|XP_007025782.1|  Calmodulin-binding protein isoform 1               206   7e-56    
ref|NP_001047151.1|  Os02g0562300                                       206   9e-56    
ref|XP_002452291.1|  hypothetical protein SORBIDRAFT_04g023100          205   9e-56    Sorghum bicolor [broomcorn]
ref|XP_002524676.1|  calmodulin binding protein, putative               201   2e-55    
ref|XP_010696621.1|  PREDICTED: uncharacterized protein LOC104909...    204   2e-55    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010696620.1|  PREDICTED: uncharacterized protein LOC104909...    204   2e-55    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004293506.1|  PREDICTED: uncharacterized protein LOC101308261    204   3e-55    Fragaria vesca subsp. vesca
ref|XP_006347126.1|  PREDICTED: uncharacterized protein LOC102591443    204   3e-55    Solanum tuberosum [potatoes]
gb|EEC73417.1|  hypothetical protein OsI_07682                          204   4e-55    Oryza sativa Indica Group [Indian rice]
ref|XP_010539448.1|  PREDICTED: uncharacterized protein LOC104813528    203   5e-55    Tarenaya hassleriana [spider flower]
ref|XP_010235560.1|  PREDICTED: uncharacterized protein LOC100846...    203   6e-55    Brachypodium distachyon [annual false brome]
ref|XP_003575160.1|  PREDICTED: uncharacterized protein LOC100846...    202   1e-54    Brachypodium distachyon [annual false brome]
ref|XP_006449222.1|  hypothetical protein CICLE_v10014600mg             202   1e-54    Citrus clementina [clementine]
gb|KDO75730.1|  hypothetical protein CISIN_1g006875mg                   202   1e-54    Citrus sinensis [apfelsine]
ref|XP_006467892.1|  PREDICTED: uncharacterized protein LOC102626942    202   2e-54    Citrus sinensis [apfelsine]
gb|KDO75734.1|  hypothetical protein CISIN_1g006875mg                   201   2e-54    Citrus sinensis [apfelsine]
ref|XP_006449221.1|  hypothetical protein CICLE_v10014600mg             201   2e-54    
ref|XP_006647388.1|  PREDICTED: uncharacterized protein LOC102720...    202   2e-54    Oryza brachyantha
ref|XP_010525739.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    201   3e-54    Tarenaya hassleriana [spider flower]
ref|XP_006647389.1|  PREDICTED: uncharacterized protein LOC102720...    201   4e-54    Oryza brachyantha
ref|XP_009375849.1|  PREDICTED: uncharacterized protein LOC103964...    200   7e-54    Pyrus x bretschneideri [bai li]
ref|XP_009376054.1|  PREDICTED: uncharacterized protein LOC103964...    200   7e-54    Pyrus x bretschneideri [bai li]
ref|XP_010467708.1|  PREDICTED: uncharacterized protein LOC104747723    199   9e-54    Camelina sativa [gold-of-pleasure]
ref|XP_010414641.1|  PREDICTED: uncharacterized protein LOC104700762    199   9e-54    Camelina sativa [gold-of-pleasure]
ref|XP_006297211.1|  hypothetical protein CARUB_v10013220mg             199   1e-53    Capsella rubella
ref|XP_007148242.1|  hypothetical protein PHAVU_006G191900g             199   1e-53    Phaseolus vulgaris [French bean]
ref|XP_010489590.1|  PREDICTED: uncharacterized protein LOC104767243    198   2e-53    Camelina sativa [gold-of-pleasure]
ref|XP_006845603.1|  PREDICTED: uncharacterized protein LOC18435496     198   3e-53    Amborella trichopoda
ref|XP_004504984.1|  PREDICTED: uncharacterized protein LOC101509425    196   1e-52    Cicer arietinum [garbanzo]
ref|XP_008364142.1|  PREDICTED: uncharacterized protein LOC103427...    196   1e-52    Malus domestica [apple tree]
ref|XP_008364144.1|  PREDICTED: uncharacterized protein LOC103427...    196   1e-52    
gb|AAL11615.1|AF424622_1  At2g18750/MSF3.13                             189   2e-52    Arabidopsis thaliana [mouse-ear cress]
emb|CDO99627.1|  unnamed protein product                                194   7e-52    Coffea canephora [robusta coffee]
ref|XP_009394895.1|  PREDICTED: uncharacterized protein LOC103980282    194   7e-52    Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU42432.1|  hypothetical protein MIMGU_mgv1a025463mg                194   1e-51    Erythranthe guttata [common monkey flower]
gb|KDO75731.1|  hypothetical protein CISIN_1g006875mg                   193   2e-51    Citrus sinensis [apfelsine]
ref|XP_011096210.1|  PREDICTED: uncharacterized protein LOC105175464    194   2e-51    Sesamum indicum [beniseed]
ref|XP_002886266.1|  calmodulin-binding protein                         193   2e-51    Arabidopsis lyrata subsp. lyrata
ref|XP_003529298.1|  PREDICTED: uncharacterized protein LOC100812605    193   2e-51    Glycine max [soybeans]
gb|KHN07315.1|  hypothetical protein glysoja_027405                     192   7e-51    Glycine soja [wild soybean]
ref|XP_006361013.1|  PREDICTED: uncharacterized protein LOC102605248    191   1e-50    Solanum tuberosum [potatoes]
ref|XP_003545838.1|  PREDICTED: uncharacterized protein LOC100802...    190   3e-50    Glycine max [soybeans]
ref|NP_565441.2|  Calmodulin-binding protein                            189   8e-50    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009761692.1|  PREDICTED: uncharacterized protein LOC104213...    188   9e-50    Nicotiana sylvestris
ref|XP_009761691.1|  PREDICTED: uncharacterized protein LOC104213...    188   1e-49    Nicotiana sylvestris
ref|XP_011043290.1|  PREDICTED: uncharacterized protein LOC105138...    188   2e-49    Populus euphratica
emb|CDY02746.1|  BnaC02g11430D                                          187   2e-49    
ref|XP_011043289.1|  PREDICTED: uncharacterized protein LOC105138...    187   2e-49    Populus euphratica
gb|EAY94271.1|  hypothetical protein OsI_16040                          188   2e-49    Oryza sativa Indica Group [Indian rice]
ref|NP_001052891.1|  Os04g0444200                                       187   4e-49    
emb|CDY29246.1|  BnaA06g25110D                                          187   4e-49    Brassica napus [oilseed rape]
ref|XP_010057559.1|  PREDICTED: uncharacterized protein LOC104445366    186   5e-49    Eucalyptus grandis [rose gum]
ref|XP_003532556.1|  PREDICTED: uncharacterized protein LOC100806393    186   5e-49    Glycine max [soybeans]
gb|KHN00110.1|  hypothetical protein glysoja_028638                     186   6e-49    Glycine soja [wild soybean]
ref|XP_002869655.1|  calmodulin-binding protein                         185   1e-48    
ref|XP_009126828.1|  PREDICTED: uncharacterized protein LOC103851701    184   2e-48    Brassica rapa
gb|KJB57646.1|  hypothetical protein B456_009G173400                    184   3e-48    Gossypium raimondii
ref|XP_010327019.1|  PREDICTED: uncharacterized protein LOC101268...    183   4e-48    
ref|XP_010327020.1|  PREDICTED: uncharacterized protein LOC101268...    183   5e-48    
ref|XP_009150716.1|  PREDICTED: uncharacterized protein LOC103874061    184   5e-48    
ref|XP_004248099.1|  PREDICTED: uncharacterized protein LOC101268...    183   6e-48    Solanum lycopersicum
gb|EYU27904.1|  hypothetical protein MIMGU_mgv1a0037712mg               182   7e-48    Erythranthe guttata [common monkey flower]
ref|XP_004248098.1|  PREDICTED: uncharacterized protein LOC101268...    183   7e-48    Solanum lycopersicum
gb|ACN34699.1|  unknown                                                 176   8e-48    Zea mays [maize]
gb|KHG24590.1|  eukaryotic translation initiation factor 3 subunit m    182   2e-47    Gossypium arboreum [tree cotton]
ref|XP_003608224.1|  Calmodulin-binding protein                         182   2e-47    Medicago truncatula
ref|XP_010433589.1|  PREDICTED: uncharacterized protein LOC104717678    181   3e-47    Camelina sativa [gold-of-pleasure]
gb|ACJ85726.1|  unknown                                                 169   4e-47    Medicago truncatula
ref|XP_010438831.1|  PREDICTED: uncharacterized protein LOC104722380    181   4e-47    Camelina sativa [gold-of-pleasure]
ref|XP_007159256.1|  hypothetical protein PHAVU_002G222600g             180   8e-47    Phaseolus vulgaris [French bean]
gb|AFW62647.1|  hypothetical protein ZEAMMB73_771415                    171   9e-47    
ref|NP_001130446.1|  uncharacterized protein LOC100191543               177   2e-46    
emb|CDY59992.1|  BnaA02g35270D                                          179   2e-46    Brassica napus [oilseed rape]
ref|XP_009112562.1|  PREDICTED: uncharacterized protein LOC103837921    179   2e-46    Brassica rapa
emb|CDY30302.1|  BnaA09g09750D                                          179   2e-46    Brassica napus [oilseed rape]
ref|XP_002446536.1|  hypothetical protein SORBIDRAFT_06g017740          179   3e-46    Sorghum bicolor [broomcorn]
ref|XP_008667039.1|  PREDICTED: uncharacterized protein LOC100191...    177   9e-46    
ref|XP_008667040.1|  PREDICTED: uncharacterized protein LOC100191...    177   1e-45    Zea mays [maize]
tpg|DAA37640.1|  TPA: hypothetical protein ZEAMMB73_428755              174   1e-45    
gb|AFW71858.1|  hypothetical protein ZEAMMB73_193945                    166   2e-45    
ref|XP_009414724.1|  PREDICTED: uncharacterized protein LOC103995757    176   2e-45    
ref|XP_010448369.1|  PREDICTED: uncharacterized protein LOC104730...    173   2e-44    Camelina sativa [gold-of-pleasure]
ref|XP_010448367.1|  PREDICTED: uncharacterized protein LOC104730...    173   3e-44    Camelina sativa [gold-of-pleasure]
ref|XP_008349259.1|  PREDICTED: uncharacterized protein LOC103412486    164   6e-44    
ref|XP_002316656.1|  calmodulin-binding protein 60-C                    172   7e-44    Populus trichocarpa [western balsam poplar]
emb|CAB39601.1|  putative calmodulin-binding protein                    169   3e-43    Arabidopsis thaliana [mouse-ear cress]
ref|NP_194310.3|  Calmodulin-binding protein                            170   3e-43    Arabidopsis thaliana [mouse-ear cress]
gb|EMS55488.1|  hypothetical protein TRIUR3_12862                       170   3e-43    Triticum urartu
ref|XP_006409114.1|  hypothetical protein EUTSA_v10022604mg             169   8e-43    Eutrema salsugineum [saltwater cress]
gb|EEC72606.1|  hypothetical protein OsI_06079                          168   2e-42    Oryza sativa Indica Group [Indian rice]
ref|XP_004975724.1|  PREDICTED: uncharacterized protein LOC101760...    168   2e-42    Setaria italica
ref|XP_006282572.1|  hypothetical protein CARUB_v10004387mg             167   4e-42    Capsella rubella
ref|XP_004975725.1|  PREDICTED: uncharacterized protein LOC101760...    167   4e-42    Setaria italica
emb|CDY59605.1|  BnaC03g74590D                                          167   4e-42    Brassica napus [oilseed rape]
ref|NP_001046071.1|  Os02g0177800                                       166   6e-42    
emb|CDY52577.1|  BnaCnng22620D                                          166   8e-42    Brassica napus [oilseed rape]
gb|EEE56432.1|  hypothetical protein OsJ_05602                          165   3e-41    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003570530.1|  PREDICTED: uncharacterized protein LOC100822237    163   6e-41    Brachypodium distachyon [annual false brome]
gb|EMS66476.1|  hypothetical protein TRIUR3_28909                       164   8e-41    Triticum urartu
gb|EMT06125.1|  hypothetical protein F775_27254                         161   4e-40    
gb|AFW66308.1|  hypothetical protein ZEAMMB73_910550                    156   4e-40    
emb|CAD40976.1|  OSJNBa0027P08.1                                        150   5e-40    Oryza sativa Japonica Group [Japonica rice]
gb|EMT33137.1|  hypothetical protein F775_28653                         163   5e-40    
gb|AFW70388.1|  calmodulin binding protein                              157   6e-39    
ref|XP_006646962.1|  PREDICTED: uncharacterized protein LOC102709708    157   7e-39    Oryza brachyantha
dbj|BAJ96828.1|  predicted protein                                      157   1e-38    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAN65367.1|  calmodulin-binding protein 60-A                         145   2e-38    Phaseolus vulgaris [French bean]
dbj|BAK04468.1|  predicted protein                                      156   2e-38    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001152440.1|  LOC100286080                                       156   2e-38    Zea mays [maize]
gb|ACG47634.1|  calmodulin binding protein                              156   2e-38    Zea mays [maize]
ref|NP_001150045.1|  calmodulin binding protein                         156   2e-38    Zea mays [maize]
ref|XP_004951715.1|  PREDICTED: uncharacterized protein LOC101768423    151   6e-37    Setaria italica
gb|EMT26442.1|  hypothetical protein F775_27587                         150   1e-36    
ref|XP_002453396.1|  hypothetical protein SORBIDRAFT_04g005240          150   2e-36    Sorghum bicolor [broomcorn]
gb|KJB68601.1|  hypothetical protein B456_010G254300                    149   5e-36    Gossypium raimondii
gb|AAA33446.1|  calmodulin-binding protein                              135   1e-34    Zea mays [maize]
gb|EMS66803.1|  hypothetical protein TRIUR3_04882                       142   6e-34    Triticum urartu
gb|AAA33447.1|  calmodulin-binding protein                              133   4e-32    Zea mays [maize]
ref|XP_002535531.1|  hypothetical protein RCOM_2098470                  129   2e-31    
gb|ABR25523.1|  calmodulin binding protein cellular communication...    124   7e-31    Oryza sativa Indica Group [Indian rice]
emb|CDX89394.1|  BnaA01g14990D                                          129   2e-29    
ref|XP_009139545.1|  PREDICTED: uncharacterized protein LOC103863555    129   3e-29    Brassica rapa
gb|KHG17962.1|  Insulin-like receptor                                   128   3e-29    Gossypium arboreum [tree cotton]
gb|AFK38635.1|  unknown                                                 120   4e-29    Medicago truncatula
gb|AAN65369.1|  calmodulin-binding protein 60-C                         120   6e-29    Phaseolus vulgaris [French bean]
emb|CDX94414.1|  BnaC01g17700D                                          127   7e-29    
ref|XP_002532915.1|  hypothetical protein RCOM_1318360                  122   8e-29    
gb|KDO59439.1|  hypothetical protein CISIN_1g007350mg                   120   3e-26    Citrus sinensis [apfelsine]
ref|XP_011043291.1|  PREDICTED: uncharacterized protein LOC105138...    120   3e-26    Populus euphratica
gb|KDO59436.1|  hypothetical protein CISIN_1g007350mg                   120   3e-26    Citrus sinensis [apfelsine]
gb|AAN65370.1|  calmodulin-binding protein 60-D                         116   5e-26    Phaseolus vulgaris [French bean]
gb|KJB69416.1|  hypothetical protein B456_011G022600                    119   6e-26    Gossypium raimondii
gb|AHI49901.1|  calmodulin-binding protein                              109   1e-25    Lavandula angustifolia [lavender]
ref|XP_006473988.1|  PREDICTED: uncharacterized protein LOC102629839    119   1e-25    Citrus sinensis [apfelsine]
ref|XP_012071464.1|  PREDICTED: uncharacterized protein LOC105633...    118   2e-25    Jatropha curcas
ref|XP_010265653.1|  PREDICTED: uncharacterized protein LOC104603341    118   2e-25    Nelumbo nucifera [Indian lotus]
ref|XP_002523509.1|  calmodulin binding protein, putative               114   1e-24    
ref|XP_007138149.1|  hypothetical protein PHAVU_009G184300g             115   1e-24    Phaseolus vulgaris [French bean]
ref|XP_002535201.1|  hypothetical protein RCOM_0245460                  108   4e-24    
emb|CBI18672.3|  unnamed protein product                                113   4e-24    Vitis vinifera
ref|XP_003633161.1|  PREDICTED: uncharacterized protein LOC100255894    114   4e-24    Vitis vinifera
gb|KJB27328.1|  hypothetical protein B456_004G291200                    113   6e-24    Gossypium raimondii
gb|KJB27327.1|  hypothetical protein B456_004G291200                    113   7e-24    Gossypium raimondii
gb|KHG21283.1|  pentafunctional arom polypeptide                        113   9e-24    Gossypium arboreum [tree cotton]
ref|NP_001291237.1|  uncharacterized LOC105121148                       112   1e-23    Populus euphratica
emb|CDY20299.1|  BnaC04g36570D                                          112   2e-23    Brassica napus [oilseed rape]
gb|EAZ30858.1|  hypothetical protein OsJ_14930                          111   4e-23    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011017983.1|  PREDICTED: uncharacterized protein LOC105121148    111   5e-23    Populus euphratica
ref|XP_007011980.1|  Calmodulin-binding protein isoform 1               109   2e-22    
ref|XP_009366145.1|  PREDICTED: uncharacterized protein LOC103955955    108   4e-22    Pyrus x bretschneideri [bai li]
emb|CDY46137.1|  BnaA04g14250D                                          108   5e-22    Brassica napus [oilseed rape]
ref|XP_009140532.1|  PREDICTED: uncharacterized protein LOC103864...    108   5e-22    
ref|XP_009140533.1|  PREDICTED: uncharacterized protein LOC103864...    107   6e-22    Brassica rapa
ref|XP_009358482.1|  PREDICTED: uncharacterized protein LOC103949109    106   1e-21    Pyrus x bretschneideri [bai li]
ref|XP_008336916.1|  PREDICTED: uncharacterized protein LOC103400014    106   2e-21    
ref|XP_001782625.1|  predicted protein                                  106   3e-21    
ref|XP_012071465.1|  PREDICTED: uncharacterized protein LOC105633...    105   3e-21    Jatropha curcas
ref|XP_002527587.1|  hypothetical protein RCOM_1566570                99.4    3e-21    
emb|CAN60089.1|  hypothetical protein VITISV_005487                   98.6    5e-21    Vitis vinifera
ref|XP_010548510.1|  PREDICTED: uncharacterized protein LOC104819913    104   8e-21    
ref|XP_008384593.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    104   1e-20    
ref|XP_006453636.1|  hypothetical protein CICLE_v10008603mg             104   1e-20    Citrus clementina [clementine]
ref|XP_003546611.1|  PREDICTED: uncharacterized protein LOC100775528    103   1e-20    Glycine max [soybeans]
ref|XP_002878744.1|  calmodulin-binding protein                         103   2e-20    
ref|XP_002324557.1|  calmodulin-binding protein 60-D                    103   2e-20    
ref|XP_006404953.1|  hypothetical protein EUTSA_v10000138mg             102   3e-20    
gb|KFK32663.1|  hypothetical protein AALP_AA6G272300                    102   3e-20    Arabis alpina [alpine rockcress]
ref|XP_007203768.1|  hypothetical protein PRUPE_ppa002988mg             102   4e-20    Prunus persica
ref|XP_006295420.1|  hypothetical protein CARUB_v10024519mg             102   4e-20    
ref|XP_010419299.1|  PREDICTED: uncharacterized protein LOC104705005  95.9    5e-20    Camelina sativa [gold-of-pleasure]
gb|AHM26861.1|  calmodulin-binding protein                            97.4    5e-20    Anthurium andraeanum [flamingo-lily]
gb|AFK33712.1|  unknown                                               98.6    5e-20    Medicago truncatula
ref|XP_004287109.1|  PREDICTED: uncharacterized protein LOC101306949    101   7e-20    Fragaria vesca subsp. vesca
ref|NP_973527.1|  Calmodulin-binding protein                            100   1e-19    Arabidopsis thaliana [mouse-ear cress]
ref|NP_180007.2|  Calmodulin-binding protein                            100   1e-19    Arabidopsis thaliana [mouse-ear cress]
gb|AAD18103.1|  putative calmodulin-binding protein                     100   2e-19    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006587151.1|  PREDICTED: uncharacterized protein LOC100808...  99.8    2e-19    
ref|XP_010049867.1|  PREDICTED: uncharacterized protein LOC104438419  99.8    3e-19    Eucalyptus grandis [rose gum]
ref|XP_003533889.1|  PREDICTED: uncharacterized protein LOC100808...  99.8    3e-19    Glycine max [soybeans]
ref|XP_009127322.1|  PREDICTED: uncharacterized protein LOC103852...  98.6    3e-19    Brassica rapa
gb|KCW45621.1|  hypothetical protein EUGRSUZ_L006162                  95.9    4e-19    Eucalyptus grandis [rose gum]
ref|XP_010417184.1|  PREDICTED: uncharacterized protein LOC104702949  95.1    4e-19    
ref|XP_009127315.1|  PREDICTED: uncharacterized protein LOC103852...  99.0    6e-19    
emb|CDX68716.1|  BnaC01g07370D                                        98.2    8e-19    
ref|XP_010472432.1|  PREDICTED: uncharacterized protein LOC104752066  98.2    1e-18    
gb|KEH37860.1|  calmodulin-binding protein                            97.8    1e-18    
ref|XP_004488927.1|  PREDICTED: uncharacterized protein LOC101515...  97.8    1e-18    
ref|XP_010039935.1|  PREDICTED: uncharacterized protein LOC104428671  94.0    1e-18    
emb|CDY28237.1|  BnaA01g06120D                                        97.1    2e-18    
ref|XP_008242948.1|  PREDICTED: uncharacterized protein LOC103341237  95.9    5e-18    
ref|XP_010429400.1|  PREDICTED: uncharacterized protein LOC104713...  94.4    2e-17    
ref|XP_010429406.1|  PREDICTED: uncharacterized protein LOC104713...  94.4    2e-17    
ref|XP_006412639.1|  hypothetical protein EUTSA_v10024817mg           93.6    3e-17    
gb|AAL32934.1|  putative calmodulin-binding protein                   89.4    9e-17    
ref|XP_002309326.2|  calmodulin-binding protein 60-D                  92.0    1e-16    
ref|XP_001767931.1|  predicted protein                                90.9    3e-16    
ref|XP_011033469.1|  PREDICTED: uncharacterized protein LOC105131940  89.4    9e-16    
emb|CAA18193.1|  putative calmodulin-binding protein                  89.0    9e-16    
ref|NP_001190876.1|  Calmodulin-binding protein                       89.0    1e-15    
ref|NP_194829.2|  Calmodulin-binding protein                          89.0    1e-15    
ref|XP_010436318.1|  PREDICTED: uncharacterized protein LOC104720044  88.2    2e-15    
ref|XP_002531050.1|  hypothetical protein RCOM_0518120                82.8    2e-15    
ref|XP_002532196.1|  hypothetical protein RCOM_0445820                57.0    3e-15    
ref|XP_001758879.1|  predicted protein                                87.0    5e-15    
gb|KDO62472.1|  hypothetical protein CISIN_1g006542mg                 86.3    6e-15    
ref|XP_010447628.1|  PREDICTED: uncharacterized protein LOC104730192  86.3    8e-15    
ref|XP_002869350.1|  calmodulin-binding protein                       85.9    1e-14    
ref|XP_010438093.1|  PREDICTED: uncharacterized protein LOC104721...  85.5    1e-14    
ref|XP_010438091.1|  PREDICTED: uncharacterized protein LOC104721...  85.5    2e-14    
ref|XP_001766477.1|  predicted protein                                85.1    2e-14    
ref|XP_010927523.1|  PREDICTED: uncharacterized protein LOC105049...  85.1    2e-14    
ref|XP_010103374.1|  hypothetical protein L484_016885                 85.5    2e-14    
ref|XP_010927522.1|  PREDICTED: uncharacterized protein LOC105049...  84.7    2e-14    
ref|XP_007011982.1|  Calmodulin-binding protein isoform 3             82.4    1e-13    
gb|EPS57962.1|  calmodulin-binding protein                            78.2    1e-13    
ref|XP_007011981.1|  Calmodulin-binding protein isoform 2             82.4    2e-13    
ref|XP_008796866.1|  PREDICTED: uncharacterized protein LOC103712...  81.6    3e-13    
ref|XP_008796874.1|  PREDICTED: uncharacterized protein LOC103712...  81.6    3e-13    
ref|XP_010527109.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  73.6    3e-12    
ref|XP_006283459.1|  hypothetical protein CARUB_v10004503mg           78.2    3e-12    
ref|XP_002532197.1|  hypothetical protein RCOM_0445830                70.5    1e-11    
emb|CAN66518.1|  hypothetical protein VITISV_001612                   70.5    1e-11    
ref|XP_001756257.1|  predicted protein                                75.5    3e-11    
gb|KDO75736.1|  hypothetical protein CISIN_1g006875mg                 72.0    3e-10    
gb|AAN65368.1|  calmodulin-binding protein 60-B                       65.1    8e-10    
ref|XP_002530779.1|  conserved hypothetical protein                   56.6    1e-09    
gb|KFK39129.1|  hypothetical protein AALP_AA3G204700                  67.8    3e-09    
gb|ABA27028.1|  TO69-3                                                63.9    4e-09    
ref|XP_002532912.1|  conserved hypothetical protein                   57.8    9e-09    
ref|XP_002531478.1|  conserved hypothetical protein                   60.5    2e-07    
ref|XP_002993171.1|  hypothetical protein SELMODRAFT_187271           63.5    2e-07    
ref|XP_002964136.1|  hypothetical protein SELMODRAFT_166784           63.2    2e-07    
ref|XP_006384007.1|  hypothetical protein POPTR_0004s03500g           58.9    4e-06    
gb|KCW74759.1|  hypothetical protein EUGRSUZ_E03489                   57.4    2e-05    
ref|XP_010070137.1|  PREDICTED: uncharacterized protein LOC104456...  54.7    1e-04    
ref|XP_010070201.1|  PREDICTED: uncharacterized protein LOC104456...  54.3    1e-04    
ref|XP_010070058.1|  PREDICTED: uncharacterized protein LOC104456...  54.3    2e-04    
dbj|BAJ96886.1|  predicted protein                                    53.9    2e-04    



>gb|AAB37246.1| calmodulin-binding protein [Nicotiana tabacum]
Length=551

 Score =   351 bits (901),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 185/272 (68%), Positives = 217/272 (80%), Gaps = 11/272 (4%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFK-NKKA---RNELPMGQVDYSNSLNNQLQQP  1061
             KVYVDSLVKKAY+NW    EYDGK+ L+ K N+KA   RNELP+G VDY N++ NQL Q 
Sbjct  277   KVYVDSLVKKAYDNWNQVVEYDGKSFLNIKQNQKAGSSRNELPVGPVDYPNNMVNQLPQS  336

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
             RLP  VQSE S++DP +LIGGS YN+++ AR  NQS +M+SSSR Q+E+T FAP  Q   
Sbjct  337   RLPVSVQSEQSSMDPNLLIGGSGYNDSIVARMPNQSQMMNSSSRSQFESTPFAPQQQITN  396

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  701
              +  Q      YDNNVGLALGPPQSS F T+ SS+ QTNLN FEDW + RDKGV+E+LSE
Sbjct  397   THQLQS---TSYDNNVGLALGPPQSSSFQTMTSSLPQTNLNPFEDWPHNRDKGVDEFLSE  453

Query  700   EEIRLRSHEMLENEDMQHLLRLFSM-GGHASVNIPEDGFGFTPFM-APSPSFGYDEDRPR  527
             EEIR+RSHE+LEN+DMQHLLRLFSM GGH SVN+ EDG+GF  FM +PSP+FGYDED P+
Sbjct  454   EEIRMRSHEILENDDMQHLLRLFSMGGGHGSVNVSEDGYGFPSFMPSPSPTFGYDED-PK  512

Query  526   P-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             P GKAVVGWLKIKAAMRWGFF+RKKAAERRAQ
Sbjct  513   PSGKAVVGWLKIKAAMRWGFFVRKKAAERRAQ  544



>ref|XP_010323248.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101245373 
[Solanum lycopersicum]
Length=632

 Score =   345 bits (885),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 181/270 (67%), Positives = 214/270 (79%), Gaps = 8/270 (3%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVDSLVKKAY+NW    EYDGK+ L+ K  +    +RNELP+G VDY N+L NQL Q 
Sbjct  359   KVYVDSLVKKAYDNWNQVVEYDGKSFLNIKQNQNPSSSRNELPVGPVDYPNTLVNQLPQS  418

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
             R P PVQSE S++DP +LIGGS YN+NM AR   QS +M+S+SR Q+E+T FAP  Q   
Sbjct  419   RHPVPVQSEQSSMDPNLLIGGSGYNDNMVARMPTQSPMMNSNSRSQFESTPFAPQHQITS  478

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  701
              +  Q     RYDNNVGLALGPPQSS F T+ SS+ QTNLN F+DWS+ RDKGV+E+LSE
Sbjct  479   SHQLQS---TRYDNNVGLALGPPQSSSFQTITSSLPQTNLNPFDDWSHNRDKGVDEFLSE  535

Query  700   EEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFG-FTPFMAPSPSFGYDEDRPRP  524
             EEIR+RS+E+LEN+DMQHLLRLFSMGGH S+N+PEDG+G  +   +PSPSF YDEDR RP
Sbjct  536   EEIRMRSNEILENDDMQHLLRLFSMGGHGSINVPEDGYGFPSFMPSPSPSFSYDEDRTRP  595

Query  523   GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             GKAVVGWLKIKAAMRWGFF+RKKAAERRAQ
Sbjct  596   GKAVVGWLKIKAAMRWGFFVRKKAAERRAQ  625



>gb|KDP22927.1| hypothetical protein JCGZ_01764 [Jatropha curcas]
Length=631

 Score =   328 bits (840),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 172/271 (63%), Positives = 205/271 (76%), Gaps = 14/271 (5%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVD+LVKKAYENW    EYDGK+LL+FK  K     RN+  +GQ+ Y NSL +Q+Q P
Sbjct  362   KVYVDTLVKKAYENWDQVVEYDGKSLLNFKQSKRSNAVRNDFQIGQMGYPNSLEHQMQIP  421

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
             RLPA V  E  ++  G+ +GGSS  +NMG  +S+QS +M+ +SR Q+ +  F P++    
Sbjct  422   RLPASVLIEQPSVHSGLQVGGSS--DNMGTGFSSQSQLMNPNSRTQF-DISFTPHELITN  478

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
              + +      R DN+VGLALGPPQSS   F  VGSS+Q +NLN F+DW+N RDKGV+EY 
Sbjct  479   SHQTS----MRNDNSVGLALGPPQSSMSGFQAVGSSMQPSNLNPFDDWANNRDKGVDEYF  534

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRPR  527
             +EEEIRLRSHEMLENEDMQHLLRLFSMG HASVNIPEDG+GF P+M  SP   YDEDR R
Sbjct  535   AEEEIRLRSHEMLENEDMQHLLRLFSMGAHASVNIPEDGYGFPPYMQ-SPMPNYDEDRTR  593

Query  526   PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  594   PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  624



>ref|XP_012089652.1| PREDICTED: uncharacterized protein LOC105648014 [Jatropha curcas]
 ref|XP_012089653.1| PREDICTED: uncharacterized protein LOC105648014 [Jatropha curcas]
Length=636

 Score =   328 bits (840),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 172/271 (63%), Positives = 205/271 (76%), Gaps = 14/271 (5%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVD+LVKKAYENW    EYDGK+LL+FK  K     RN+  +GQ+ Y NSL +Q+Q P
Sbjct  367   KVYVDTLVKKAYENWDQVVEYDGKSLLNFKQSKRSNAVRNDFQIGQMGYPNSLEHQMQIP  426

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
             RLPA V  E  ++  G+ +GGSS  +NMG  +S+QS +M+ +SR Q+ +  F P++    
Sbjct  427   RLPASVLIEQPSVHSGLQVGGSS--DNMGTGFSSQSQLMNPNSRTQF-DISFTPHELITN  483

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
              + +      R DN+VGLALGPPQSS   F  VGSS+Q +NLN F+DW+N RDKGV+EY 
Sbjct  484   SHQTS----MRNDNSVGLALGPPQSSMSGFQAVGSSMQPSNLNPFDDWANNRDKGVDEYF  539

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRPR  527
             +EEEIRLRSHEMLENEDMQHLLRLFSMG HASVNIPEDG+GF P+M  SP   YDEDR R
Sbjct  540   AEEEIRLRSHEMLENEDMQHLLRLFSMGAHASVNIPEDGYGFPPYMQ-SPMPNYDEDRTR  598

Query  526   PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  599   PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  629



>emb|CDP02958.1| unnamed protein product [Coffea canephora]
Length=631

 Score =   327 bits (839),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 185/272 (68%), Positives = 217/272 (80%), Gaps = 11/272 (4%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFK-NKKA---RNELPMGQVDYSNSLNNQLQQP  1061
             K+YVD LVKKAY+NW    EYDGK+LL+FK NKK+   R+ELP+G VDY N+L+NQL  P
Sbjct  357   KLYVDGLVKKAYDNWNLVIEYDGKSLLNFKQNKKSSASRDELPVGPVDYPNALDNQLSDP  416

Query  1060  -RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  884
              RLP PV SEPS +DP MLIGG  YN+NM  RY+NQS I++SSSR QY +T +      Q
Sbjct  417   PRLPVPVPSEPSPVDPNMLIGG--YNDNMATRYANQSQILNSSSRNQYGSTSYG--LPDQ  472

Query  883   lmnnsqqmqNARYDNNVGLALGPPQSSC-FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
              ++NS Q+QN RYDN   LAL PPQSS  F TVGSSVQ +NLN FEDW+  RDK V+++L
Sbjct  473   QISNSHQIQNTRYDNRAALALAPPQSSSSFQTVGSSVQPSNLNPFEDWTQNRDKSVDDFL  532

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGYDEDRP  530
             SEEEIRLRSHEMLENEDMQHLLRLFSMGGHA+VN+P+D F F  +M +PSP++ Y+EDR 
Sbjct  533   SEEEIRLRSHEMLENEDMQHLLRLFSMGGHAAVNVPDDNFAFQSYMPSPSPNYSYEEDRT  592

Query  529   RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             R GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  593   RSGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  624



>ref|XP_002526232.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF36173.1| calmodulin binding protein, putative [Ricinus communis]
Length=466

 Score =   318 bits (815),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 166/270 (61%), Positives = 207/270 (77%), Gaps = 10/270 (4%)
 Frame = -1

Query  1225  VYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQPR  1058
             VYVD+LVKKAYENW    EYDGK+LL+FK  K     +NE  +GQ+ Y N+ ++Q+Q PR
Sbjct  194   VYVDTLVKKAYENWNEVIEYDGKSLLNFKQSKRSNTYQNEPQIGQIGYPNASDHQMQLPR  253

Query  1057  LPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  878
             LPA V +E ++   G+ +GG  +N++MGA +S QS +++ +SR Q+++T F     + L+
Sbjct  254   LPASVTTEQASGHSGLQVGG--FNDSMGAGFSAQSQLVNPNSRTQFDSTSFT--VHEPLI  309

Query  877   nnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLS  704
             +NS   Q  R DN+VGLALGPPQSS   F  +GSS+Q + LN F+DW+N RDKGV+EY +
Sbjct  310   SNSHHAQGMRNDNSVGLALGPPQSSSSGFQALGSSMQPSGLNPFDDWTNNRDKGVDEYFT  369

Query  703   EEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRPRP  524
             EEEIR+RSHEMLENEDMQHLLRLFSMGGH +VNIPEDGF F P+MA SP   YDE+  RP
Sbjct  370   EEEIRIRSHEMLENEDMQHLLRLFSMGGHGAVNIPEDGFSFPPYMAASPMPNYDENSGRP  429

Query  523   GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  430   GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  459



>ref|XP_011079310.1| PREDICTED: uncharacterized protein LOC105162855 [Sesamum indicum]
Length=643

 Score =   318 bits (816),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 170/269 (63%), Positives = 203/269 (75%), Gaps = 6/269 (2%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             KVYVD+ VKKAY+NW    EYDGK+LL+FK  K  + LP+G V+YS+S+ +QL   RLP 
Sbjct  370   KVYVDAWVKKAYDNWNQVVEYDGKSLLNFKQTKKSSALPLGPVNYSHSVESQLPPQRLPV  429

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  869
              V SEPS++D  MLIGG  YN+NM ARYS QS +++SSSR Q+E   F      Q +N  
Sbjct  430   SVPSEPSSIDQSMLIGGLGYNDNMTARYSTQSQLINSSSRTQFEPASFT--QHDQQVNQP  487

Query  868   qqmqNARYDNNVGLALGPP---QSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEE  698
              Q+ +A YD+ VGLALGPP    SS F    +S+QQ +LN FEDWS  RDKGV+++LSEE
Sbjct  488   NQIDSAPYDSRVGLALGPPQSSSSSSFQASNASLQQASLNPFEDWSTNRDKGVDDFLSEE  547

Query  697   EIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGYDEDRPRPG  521
             EIR+RSHEMLENEDMQHLLRLFSMGGHASVN+PEDG+ F  +M +PSP F Y EDR R G
Sbjct  548   EIRMRSHEMLENEDMQHLLRLFSMGGHASVNVPEDGYNFPSYMPSPSPGFSYGEDRTRSG  607

Query  520   KAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             KAV GWLKIKAAMRWG FIRKKAAERRA+
Sbjct  608   KAVAGWLKIKAAMRWGIFIRKKAAERRAR  636



>ref|XP_006453423.1| hypothetical protein CICLE_v10007720mg [Citrus clementina]
 ref|XP_006453424.1| hypothetical protein CICLE_v10007720mg [Citrus clementina]
 ref|XP_006474152.1| PREDICTED: uncharacterized protein LOC102625149 isoform X1 [Citrus 
sinensis]
 ref|XP_006474153.1| PREDICTED: uncharacterized protein LOC102625149 isoform X2 [Citrus 
sinensis]
 gb|ESR66663.1| hypothetical protein CICLE_v10007720mg [Citrus clementina]
 gb|ESR66664.1| hypothetical protein CICLE_v10007720mg [Citrus clementina]
 gb|KDO62468.1| hypothetical protein CISIN_1g006542mg [Citrus sinensis]
 gb|KDO62469.1| hypothetical protein CISIN_1g006542mg [Citrus sinensis]
Length=641

 Score =   314 bits (805),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 174/272 (64%), Positives = 208/272 (76%), Gaps = 14/272 (5%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVDS VKKAY+NW    EYDGK+LLS K  K    ++NE  +GQ+D+SN+L+NQLQ  
Sbjct  370   KVYVDSQVKKAYDNWNQVVEYDGKSLLSLKQNKRSNASKNEPQIGQIDFSNALDNQLQLS  429

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
             RLPA V +E S+   G  IGGS Y +NM  RY +Q  I++S+SR Q++ T F      QL
Sbjct  430   RLPAAVPTEQSSAHSGHPIGGSGYADNMATRYPSQPQIVNSNSRAQFDGTSFV--SNDQL  487

Query  880   mnnsqqmqNARYDNN-VGLALGPPQSS--CFPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
             ++NS Q+Q+ RY N+ VGLALGPPQSS   F  +GSSVQQ+NLN F+DWS+ RDKGVE++
Sbjct  488   VDNSHQIQSTRYGNSTVGLALGPPQSSNSGFQAIGSSVQQSNLNPFDDWSHNRDKGVEDF  547

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRP  530
              SEEEIR+RS+EMLEN+DMQHLLRLFSMGGHAS    EDG+ F  FM PSP   +DEDR 
Sbjct  548   FSEEEIRMRSNEMLENDDMQHLLRLFSMGGHAS----EDGYSFPSFM-PSPMPNFDEDRT  602

Query  529   RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  603   RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  634



>ref|XP_007014160.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 ref|XP_007014161.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 ref|XP_007014162.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 gb|EOY31779.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 gb|EOY31780.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 gb|EOY31781.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
Length=642

 Score =   311 bits (797),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 170/273 (62%), Positives = 206/273 (75%), Gaps = 15/273 (5%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK---ARNELPMGQVDYSNSLNNQLQQPR  1058
             KVYVD+LVKKAY+NW    EYDGK+LL+F+  +   ARNEL MG +DY N+L+ QLQ PR
Sbjct  369   KVYVDTLVKKAYDNWNKVIEYDGKSLLNFRQNRRSSARNELQMGAIDYPNALDQQLQLPR  428

Query  1057  LPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  878
             LP  V +E   +  G+ + G  YN+N   +YS QS  ++S+S  Q+++TQ+ P+DQ    
Sbjct  429   LPVSVPTE--QVHSGLQVEG--YNDNQSTKYSGQSQHVNSNSHNQFDSTQYLPHDQLINN  484

Query  877   nnsqqmqNARYDNNV-GLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
             +   Q    R DNNV GLALGPPQSS   F  VGSS+Q +NLN F+DW+N RDKGVE+  
Sbjct  485   SQQPQS--LRNDNNVVGLALGPPQSSALGFQNVGSSMQSSNLNPFDDWTNNRDKGVEDLF  542

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPED-GFGFTPFM-APSPSFGYDEDR  533
             SEEEIR+RSHEMLENEDMQHLLRLFSMGGHAS+N+ ED G+GF  +M +P P+F  DEDR
Sbjct  543   SEEEIRIRSHEMLENEDMQHLLRLFSMGGHASINVTEDGGYGFPNYMQSPMPNF-VDEDR  601

Query  532   PRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  602   SRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  634



>ref|XP_007014163.1| Calmodulin-binding protein isoform 4 [Theobroma cacao]
 gb|EOY31782.1| Calmodulin-binding protein isoform 4 [Theobroma cacao]
Length=643

 Score =   309 bits (791),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 169/273 (62%), Positives = 205/273 (75%), Gaps = 14/273 (5%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK---ARNELPMGQVDYSNSLNNQLQQPR  1058
             KVYVD+LVKKAY+NW    EYDGK+LL+F+  +   ARNEL MG +DY N+L+ QLQ PR
Sbjct  369   KVYVDTLVKKAYDNWNKVIEYDGKSLLNFRQNRRSSARNELQMGAIDYPNALDQQLQLPR  428

Query  1057  LPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  878
             LP  V +E   +  G+ +    YN+N   +YS QS  ++S+S  Q+++TQ+ P+DQ    
Sbjct  429   LPVSVPTE--QVHSGLQVE-EGYNDNQSTKYSGQSQHVNSNSHNQFDSTQYLPHDQLINN  485

Query  877   nnsqqmqNARYDNNV-GLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
             +   Q    R DNNV GLALGPPQSS   F  VGSS+Q +NLN F+DW+N RDKGVE+  
Sbjct  486   SQQPQS--LRNDNNVVGLALGPPQSSALGFQNVGSSMQSSNLNPFDDWTNNRDKGVEDLF  543

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPED-GFGFTPFM-APSPSFGYDEDR  533
             SEEEIR+RSHEMLENEDMQHLLRLFSMGGHAS+N+ ED G+GF  +M +P P+F  DEDR
Sbjct  544   SEEEIRIRSHEMLENEDMQHLLRLFSMGGHASINVTEDGGYGFPNYMQSPMPNF-VDEDR  602

Query  532   PRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  603   SRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  635



>gb|KDO62470.1| hypothetical protein CISIN_1g006542mg [Citrus sinensis]
Length=639

 Score =   308 bits (788),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 173/272 (64%), Positives = 207/272 (76%), Gaps = 16/272 (6%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVDS VKKAY+NW    EYDGK+LLS K  K    ++NE  +GQ+D+SN+L+NQLQ  
Sbjct  370   KVYVDSQVKKAYDNWNQVVEYDGKSLLSLKQNKRSNASKNEPQIGQIDFSNALDNQLQLS  429

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
             RLPA V +E S+   G  IGG  Y +NM  RY +Q  I++S+SR Q++ T F      QL
Sbjct  430   RLPAAVPTEQSSAHSGHPIGG--YADNMATRYPSQPQIVNSNSRAQFDGTSFV--SNDQL  485

Query  880   mnnsqqmqNARYDNN-VGLALGPPQSS--CFPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
             ++NS Q+Q+ RY N+ VGLALGPPQSS   F  +GSSVQQ+NLN F+DWS+ RDKGVE++
Sbjct  486   VDNSHQIQSTRYGNSTVGLALGPPQSSNSGFQAIGSSVQQSNLNPFDDWSHNRDKGVEDF  545

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRP  530
              SEEEIR+RS+EMLEN+DMQHLLRLFSMGGHAS    EDG+ F  FM PSP   +DEDR 
Sbjct  546   FSEEEIRMRSNEMLENDDMQHLLRLFSMGGHAS----EDGYSFPSFM-PSPMPNFDEDRT  600

Query  529   RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  601   RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  632



>ref|XP_010047003.1| PREDICTED: uncharacterized protein LOC104435977 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010047005.1| PREDICTED: uncharacterized protein LOC104435977 isoform X1 [Eucalyptus 
grandis]
 gb|KCW78744.1| hypothetical protein EUGRSUZ_C00185 [Eucalyptus grandis]
Length=635

 Score =   305 bits (781),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 157/268 (59%), Positives = 198/268 (74%), Gaps = 11/268 (4%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKN--KKARNELPMGQVDYSNSLNNQLQQPRL  1055
             KVYVD+LVKKAY+NW    EYDGK+LLSFK   + +RNE  M  ++YSN+L++QLQ PRL
Sbjct  370   KVYVDTLVKKAYDNWNQVVEYDGKSLLSFKQVRRSSRNEPQMAALEYSNALDHQLQLPRL  429

Query  1054  PAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmn  875
             P P  SE  + D G+ +GG  YN +M ARYS QS + ++++R Q+ +T + P D      
Sbjct  430   PVPFTSEQPSADSGLTVGG--YNGDMVARYSAQSQLANANARSQFTSTSYMPEDPLANNQ  487

Query  874   nsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVE-EYLSEE  698
                    +R +N+VGLALGPP S+ F   G S+Q   LN F+DWS  RDKG + E+L+EE
Sbjct  488   AQS----SRNNNSVGLALGPPLSAGFSATGPSIQTPGLNPFDDWSGNRDKGGDIEFLTEE  543

Query  697   EIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRPRPGK  518
             EIR+RSHEMLENEDMQ LLRLFSMGGH S+++PED +GFT ++ PSP   +DE+R RPGK
Sbjct  544   EIRMRSHEMLENEDMQQLLRLFSMGGHTSISVPEDAYGFTTYV-PSPQ-PFDEERSRPGK  601

Query  517   AVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             AVVGWLKIKAAMRWGFF+RKKAAERRAQ
Sbjct  602   AVVGWLKIKAAMRWGFFVRKKAAERRAQ  629



>gb|KDO62471.1| hypothetical protein CISIN_1g006542mg [Citrus sinensis]
Length=635

 Score =   303 bits (776),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 168/265 (63%), Positives = 202/265 (76%), Gaps = 14/265 (5%)
 Frame = -1

Query  1207  VKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQPRLPAPVQ  1040
             VKKAY+NW    EYDGK+LLS K  K    ++NE  +GQ+D+SN+L+NQLQ  RLPA V 
Sbjct  371   VKKAYDNWNQVVEYDGKSLLSLKQNKRSNASKNEPQIGQIDFSNALDNQLQLSRLPAAVP  430

Query  1039  SEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnnsqqm  860
             +E S+   G  IGGS Y +NM  RY +Q  I++S+SR Q++ T F      QL++NS Q+
Sbjct  431   TEQSSAHSGHPIGGSGYADNMATRYPSQPQIVNSNSRAQFDGTSFV--SNDQLVDNSHQI  488

Query  859   qNARYDNN-VGLALGPPQSS--CFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEEEIR  689
             Q+ RY N+ VGLALGPPQSS   F  +GSSVQQ+NLN F+DWS+ RDKGVE++ SEEEIR
Sbjct  489   QSTRYGNSTVGLALGPPQSSNSGFQAIGSSVQQSNLNPFDDWSHNRDKGVEDFFSEEEIR  548

Query  688   LRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRPRPGKAVV  509
             +RS+EMLEN+DMQHLLRLFSMGGHAS    EDG+ F  FM PSP   +DEDR RPGKAVV
Sbjct  549   MRSNEMLENDDMQHLLRLFSMGGHAS----EDGYSFPSFM-PSPMPNFDEDRTRPGKAVV  603

Query  508   GWLKIKAAMRWGFFIRKKAAERRAQ  434
             GWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  604   GWLKIKAAMRWGFFIRKKAAERRAQ  628



>gb|KJB83411.1| hypothetical protein B456_013G246400 [Gossypium raimondii]
 gb|KJB83412.1| hypothetical protein B456_013G246400 [Gossypium raimondii]
 gb|KJB83413.1| hypothetical protein B456_013G246400 [Gossypium raimondii]
Length=644

 Score =   299 bits (766),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 164/273 (60%), Positives = 207/273 (76%), Gaps = 15/273 (5%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK---ARNELPMGQVDYSNSLNNQLQQPR  1058
             KVYVDSLVKKAY+NW    EYDGK+LL+FK  +   ARNEL + ++DY++S++NQ+Q PR
Sbjct  369   KVYVDSLVKKAYDNWNQVIEYDGKSLLNFKQNRWSSARNELQIDELDYTSSVDNQMQLPR  428

Query  1057  LPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  878
             +P P+ +E   +  G+ +GG  YN+N  A YS QS IM+ +S  Q+ NTQF P DQ    
Sbjct  429   VPVPIPTE--QVHSGLQVGG--YNDNQSAGYSGQSQIMNPNSHNQFGNTQFVPQDQLIDN  484

Query  877   nnsqqmqNARYDNNV-GLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
             +   Q   ++ D NV GLALGPPQSS   F  +GSS+Q +NLN F DW+N  DKGVE++L
Sbjct  485   SQQPQS--SKNDTNVVGLALGPPQSSIIGFQNIGSSMQPSNLNPFNDWTNNHDKGVEDFL  542

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPED-GFGFTPFM-APSPSFGYDEDR  533
             SEEEIR+RS+EMLENE+MQHLLRLF+MGG+AS+N+ ED G+GF  ++ +P P+F  DEDR
Sbjct  543   SEEEIRVRSNEMLENEEMQHLLRLFNMGGNASINMTEDSGYGFPNYIPSPMPNF-VDEDR  601

Query  532   PRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              R GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  602   SRSGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  634



>ref|XP_002325070.1| calmodulin-binding family protein [Populus trichocarpa]
 gb|EEF03635.1| calmodulin-binding family protein [Populus trichocarpa]
Length=648

 Score =   299 bits (765),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 160/272 (59%), Positives = 197/272 (72%), Gaps = 14/272 (5%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             K+YVD+LVKKAY+NW    EYDGK+LL+F   +    ++NE  + Q+ YSN   +Q+Q P
Sbjct  375   KIYVDTLVKKAYDNWDMVVEYDGKSLLNFNQNRRVSVSQNEHQINQIGYSNPSGHQVQLP  434

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
             RLPA + +E S++   +  GG  YN+N+ + YS QS +++  SR Q  +  FAP+ Q   
Sbjct  435   RLPASIPTEQSSVHSALQAGG--YNDNLVSGYSMQSQLVNPDSRTQLGSNSFAPHQQLIS  492

Query  880   mnnsqqmqNARYDNN-VGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
                       R DN+ VGLALGPPQSS   F T+GSS+Q TNLN F+DW++ RDK  +E+
Sbjct  493   NPQQLLS--TRNDNSAVGLALGPPQSSTSGFQTIGSSMQPTNLNPFDDWTSNRDKSADEF  550

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRP  530
              SEEEIR+RSHEMLENEDMQHLLRLFSMGGHA  N+PEDGF + P+MA SP   YDEDR 
Sbjct  551   FSEEEIRIRSHEMLENEDMQHLLRLFSMGGHA--NVPEDGFSYPPYMA-SPMPNYDEDRS  607

Query  529   RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  608   RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  639



>ref|XP_010103014.1| hypothetical protein L484_022898 [Morus notabilis]
 gb|EXB94581.1| hypothetical protein L484_022898 [Morus notabilis]
Length=641

 Score =   297 bits (761),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 164/273 (60%), Positives = 205/273 (75%), Gaps = 14/273 (5%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             K+YVD+LVKKAY+NW    EYDGK+LLSFK  K    +RNEL MG  +YSN  +NQLQ  
Sbjct  366   KIYVDTLVKKAYDNWDQVVEYDGKSLLSFKQNKRPNASRNELQMGPSNYSNPSDNQLQLS  425

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LP    SE ++L+ G+ I    YN+++  R+SNQ  +++SSSR Q+++  F      Q 
Sbjct  426   HLPVH-PSEQTSLNTGLPIAAPGYNDDVSTRFSNQVPMVNSSSRNQFDSASFV--QNDQF  482

Query  880   mnnsqqmqNARYDNN-VGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
             + NS + Q  R DN+ VGLALGPPQSS   F TV S++QQ+ LN F+DWS  RDKGV+++
Sbjct  483   IGNSHEAQTIRNDNSSVGLALGPPQSSTAGFQTVNSTMQQSTLNPFDDWSQHRDKGVDDF  542

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGYDEDR  533
              SEEEIR++SHEMLENEDMQHLLR+FSMGGH S+N+PEDG+ F+ FM +P+P+F  DEDR
Sbjct  543   FSEEEIRIKSHEMLENEDMQHLLRIFSMGGHPSMNMPEDGYAFSSFMHSPTPNF--DEDR  600

Query  532   PRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              R GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  601   -RSGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  632



>gb|KHG27572.1| Cytochrome P450 [Gossypium arboreum]
Length=643

 Score =   296 bits (759),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 162/273 (59%), Positives = 207/273 (76%), Gaps = 15/273 (5%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK---ARNELPMGQVDYSNSLNNQLQQPR  1058
             KVYVDS VKKAY+NW    EYDGK+LL+FK  +   AR+EL +G++DY++++++Q+Q PR
Sbjct  369   KVYVDSQVKKAYDNWNQVIEYDGKSLLNFKQNRWSSARDELQIGELDYTSAVDHQMQLPR  428

Query  1057  LPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  878
             +P PV +E   +  G+ +GG  YN+N    YS QS IM+ +S  Q+ NTQF P DQ    
Sbjct  429   VPVPVPTE--QVHSGLQVGG--YNDNQSTGYSGQSQIMNPNSHNQFGNTQFVPQDQLIDN  484

Query  877   nnsqqmqNARYDNNV-GLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
             +   Q   ++ D NV GLALGPPQSS   F  +GSS+Q +NLN F DW+N  DKGVE++L
Sbjct  485   SQQPQS--SKNDTNVVGLALGPPQSSIIGFQNIGSSMQPSNLNPFNDWTNNHDKGVEDFL  542

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPED-GFGFTPFM-APSPSFGYDEDR  533
             SEEEIR+RS+EMLENE+MQHLLRLF+MGG+AS+N+ ED G+GF  ++ +P P+F  DEDR
Sbjct  543   SEEEIRVRSNEMLENEEMQHLLRLFNMGGNASINMTEDSGYGFPNYIPSPMPNF-VDEDR  601

Query  532   PRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  602   SRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  634



>ref|XP_011044001.1| PREDICTED: uncharacterized protein LOC105139309 [Populus euphratica]
 ref|XP_011044002.1| PREDICTED: uncharacterized protein LOC105139309 [Populus euphratica]
 ref|XP_011044003.1| PREDICTED: uncharacterized protein LOC105139309 [Populus euphratica]
 ref|XP_011044004.1| PREDICTED: uncharacterized protein LOC105139309 [Populus euphratica]
Length=647

 Score =   296 bits (758),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 159/272 (58%), Positives = 196/272 (72%), Gaps = 14/272 (5%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             K+YVD+LVKKAY+NW    EYDGK+LL+F   +    ++NE  + Q+ YSN   +Q+Q P
Sbjct  374   KIYVDTLVKKAYDNWDMVIEYDGKSLLNFNQNRRVSVSQNEHQINQIGYSNPSGHQVQLP  433

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
             RLP  + +E S++   +  GG  YN+N+ + Y  QS +++  SR Q  +  FAP++Q   
Sbjct  434   RLPGSIPTEQSSVHSALQAGG--YNDNLVSGYPMQSQLVNPDSRTQLGSNSFAPHEQLIS  491

Query  880   mnnsqqmqNARYDNN-VGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
                       R DN+ VGLALGPPQSS   F T+GSS+Q TNLN F+DW+N RDK  +E+
Sbjct  492   NPQQLLS--TRNDNSAVGLALGPPQSSTSGFQTIGSSMQPTNLNPFDDWTNNRDKSADEF  549

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRP  530
              SEEEIR+RSHEMLENEDMQHLLRLFSMGGHA  N+PEDGF + P+MA SP   YDEDR 
Sbjct  550   FSEEEIRVRSHEMLENEDMQHLLRLFSMGGHA--NVPEDGFSYPPYMA-SPMPNYDEDRS  606

Query  529   RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  607   RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  638



>ref|XP_006366189.1| PREDICTED: uncharacterized protein LOC102581064 [Solanum tuberosum]
Length=618

 Score =   295 bits (755),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 167/270 (62%), Positives = 197/270 (73%), Gaps = 29/270 (11%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVDSLVKKAY+NW    EYDGK+ LS K  +    +RNELP+G +DY N+L NQL   
Sbjct  366   KVYVDSLVKKAYDNWNQVVEYDGKSFLSIKQNQNPSSSRNELPVGPMDYPNTLVNQL---  422

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
                           P  LI G  YN+NM  R   QS +M+S+SR Q+E+T +AP  Q   
Sbjct  423   --------------PQSLIDG--YNDNM--RMPTQSPMMNSNSRSQFESTPYAPQHQITS  464

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  701
              +  Q     RYDNNVGLALGPPQSS F T+ SS+ QTNLN F+DWS+ RDKGV+E+LSE
Sbjct  465   SHQLQS---TRYDNNVGLALGPPQSSSFQTITSSLPQTNLNPFDDWSHNRDKGVDEFLSE  521

Query  700   EEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFG-FTPFMAPSPSFGYDEDRPRP  524
             EEIR+RS+E+LEN+DMQ LLRLFSMGGH SVN+PEDG+G  +   +PSPSF YDEDR RP
Sbjct  522   EEIRMRSNEILENDDMQQLLRLFSMGGHGSVNVPEDGYGFPSFMPSPSPSFSYDEDRTRP  581

Query  523   GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             GKAVVGWLKIKAAMRWGFF+RKKAAERRAQ
Sbjct  582   GKAVVGWLKIKAAMRWGFFVRKKAAERRAQ  611



>ref|XP_011018189.1| PREDICTED: uncharacterized protein LOC105121292 [Populus euphratica]
 ref|XP_011018190.1| PREDICTED: uncharacterized protein LOC105121292 [Populus euphratica]
 ref|XP_011018191.1| PREDICTED: uncharacterized protein LOC105121292 [Populus euphratica]
 ref|XP_011018192.1| PREDICTED: uncharacterized protein LOC105121292 [Populus euphratica]
Length=647

 Score =   294 bits (752),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 158/272 (58%), Positives = 195/272 (72%), Gaps = 14/272 (5%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             K+YVD+LVKKAY+NW    EYDGK+LL+F   +    ++NE  + Q+ YSN   +Q+Q P
Sbjct  374   KIYVDTLVKKAYDNWDMVIEYDGKSLLNFNQNRRVSVSQNEHQINQIGYSNPSGHQVQLP  433

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
             RLP  + +E S++   +  GG  YN+N+ + Y  QS +++  SR Q  +  FAP++Q   
Sbjct  434   RLPGSIPTEQSSVHSALQAGG--YNDNLVSGYPMQSQLVNPDSRTQLGSNSFAPHEQLIS  491

Query  880   mnnsqqmqNARYDNN-VGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
                       R DN+ VGLALGPPQSS   F T+GSS+Q  NLN F+DW+N RDK  +E+
Sbjct  492   NPQQLLS--TRNDNSAVGLALGPPQSSTSGFQTIGSSMQPANLNPFDDWTNNRDKSADEF  549

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRP  530
              SEEEIR+RSHEMLENEDMQHLLRLFSMGGHA  N+PEDGF + P+MA SP   YDEDR 
Sbjct  550   FSEEEIRVRSHEMLENEDMQHLLRLFSMGGHA--NVPEDGFSYPPYMA-SPMPNYDEDRS  606

Query  529   RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  607   RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  638



>ref|XP_010259794.1| PREDICTED: uncharacterized protein LOC104599111 [Nelumbo nucifera]
 ref|XP_010259795.1| PREDICTED: uncharacterized protein LOC104599111 [Nelumbo nucifera]
 ref|XP_010259796.1| PREDICTED: uncharacterized protein LOC104599111 [Nelumbo nucifera]
Length=644

 Score =   283 bits (723),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 151/274 (55%), Positives = 202/274 (74%), Gaps = 15/274 (5%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVD+LVKKAY+NW    EYDGK LLS+K  K    +R+ELPMG  +YSNS + Q+  P
Sbjct  371   KVYVDTLVKKAYDNWGHVIEYDGKALLSYKQNKRPSSSRSELPMGP-EYSNSFDQQISVP  429

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
             RLP P  SE  ++D G+ +G S YN+N+  RY  QS + +S+S +Q++   FAP +Q   
Sbjct  430   RLPVP--SEQPSMDSGLNVGVSGYNDNLATRYPAQSQV-NSNSHVQFDGNSFAPQNQMIS  486

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKG-VEEY  710
              ++  Q    R +N VGLALGPPQSS   F  VG S+Q +N++S++DWS++R+ G V+ +
Sbjct  487   TSHQTQF--PRNENIVGLALGPPQSSTPGFQNVGPSIQASNVSSYDDWSHSRENGGVDGF  544

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGYDEDR  533
              SEEEIR+RSHEMLENEDMQHLLR+FSMGG  ++NI E+G+ +  ++ +P+P+ G+DEDR
Sbjct  545   FSEEEIRMRSHEMLENEDMQHLLRIFSMGGQTAINISEEGYSYPSYIPSPTPNLGFDEDR  604

Query  532   PR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              R  GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  605   SRSSGKAVVGWLKLKAALRWGIFIRKQAAERRAQ  638



>ref|XP_008453624.1| PREDICTED: uncharacterized protein LOC103494282 [Cucumis melo]
 ref|XP_008453625.1| PREDICTED: uncharacterized protein LOC103494282 [Cucumis melo]
 ref|XP_008453626.1| PREDICTED: uncharacterized protein LOC103494282 [Cucumis melo]
Length=637

 Score =   279 bits (714),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 158/273 (58%), Positives = 198/273 (73%), Gaps = 18/273 (7%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVD+LV KAYENW    EYDGK+LLS K  K    +RN+   G +D SN+L++     
Sbjct  368   KVYVDTLVNKAYENWNQVVEYDGKSLLSSKQPKKSNASRNDFQGGHLDLSNTLDHG-SLA  426

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
             R+P  VQ +   +DPG+ + G  YN++   RYS Q   ++S+SR Q++N+   P    +L
Sbjct  427   RMPVSVQPQQPVVDPGLSVAG--YNDSTATRYSTQPQFVNSTSRPQFDNS---PYTSNEL  481

Query  880   mnnsqqmqNARYDNN-VGLALGPPQ--SSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
             + NS Q+  AR DN+  GLALGPPQ  SS F  +GSS+Q++NLN F DWSN RDKGV+++
Sbjct  482   VGNSNQVHVARNDNSSFGLALGPPQASSSGFQALGSSMQESNLNPF-DWSNNRDKGVDDF  540

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGYDEDR  533
              SE+EIR+RSHEMLENEDMQ LLR+FSMGGHASVN+ ++GF F  FM +P PSF   +DR
Sbjct  541   FSEDEIRMRSHEMLENEDMQQLLRMFSMGGHASVNVHDEGFSFPSFMPSPMPSF---DDR  597

Query  532   PRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              R GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  598   NRSGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  630



>gb|KJB22129.1| hypothetical protein B456_004G031000 [Gossypium raimondii]
 gb|KJB22130.1| hypothetical protein B456_004G031000 [Gossypium raimondii]
 gb|KJB22131.1| hypothetical protein B456_004G031000 [Gossypium raimondii]
Length=640

 Score =   279 bits (713),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 165/272 (61%), Positives = 198/272 (73%), Gaps = 17/272 (6%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK---ARNELPMGQVDYSNSLNNQLQQPR  1058
             KVYVD+LVKKAY+NW    EYDGK+LL+FK  +   ARNE     + Y N+L++QLQ   
Sbjct  367   KVYVDTLVKKAYDNWHQVIEYDGKSLLNFKQNRRSSARNEAQTDAIGYPNALDHQLQ---  423

Query  1057  LPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  878
             LP  V +E   +  G   GG  +N+N   RY  QS +++S+SR Q+++TQF      QL+
Sbjct  424   LPVAVPTE--QVHSGPQAGG--FNDNQSTRYPGQSELVNSNSRSQFDSTQFL--QYDQLV  477

Query  877   nnsqqmqNARYDNN-VGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
             NNS+Q Q++R +NN VGLALGPPQSS   F    SS+Q +NLN F+DWSN RDKGVE+  
Sbjct  478   NNSEQPQSSRTNNNAVGLALGPPQSSTLGFHNAISSMQPSNLNPFDDWSNNRDKGVEDLF  537

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGY-DEDRP  530
             SEEEIRLRSHEMLENEDMQHLLRLFSMGGH +    + GFGF  +M PSP   + DEDR 
Sbjct  538   SEEEIRLRSHEMLENEDMQHLLRLFSMGGHHATVTEDGGFGFPNYM-PSPMVNFIDEDRS  596

Query  529   RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  597   RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  628



>ref|XP_010265460.1| PREDICTED: uncharacterized protein LOC104603183 isoform X4 [Nelumbo 
nucifera]
Length=592

 Score =   278 bits (710),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 157/274 (57%), Positives = 203/274 (74%), Gaps = 17/274 (6%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK---ARNELPMGQVDYSNSLNNQLQQPR  1058
             KV+VDSLVKKAYENW    EYDGK LLS+K  K   +RNELPM   DY+NS + Q+  PR
Sbjct  321   KVFVDSLVKKAYENWGQVIEYDGKALLSYKQNKRSSSRNELPMAPTDYANSFDQQVSVPR  380

Query  1057  LPAPVQSEPSALDPGMLIGGSSYNEN-MGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
             LP P  SE S++D G+ +GG  YN+N +   Y  QS + +SS+ +Q+++  FA   Q Q+
Sbjct  381   LPVP--SEQSSMDSGLNVGG--YNDNHLVTGYPTQSQV-NSSAHIQFDSNSFA--TQSQM  433

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKG-VEEY  710
             ++ S Q Q  R D+ VGLALGPPQSS   F  VG S+Q +N  +++DW + R+ G VE +
Sbjct  434   ISTSHQAQIPRNDDIVGLALGPPQSSTTGFENVGPSIQASNA-TYDDWPHNRENGGVEGF  492

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPED-GFGFTPFMAPSPSFGYDEDR  533
              SEEEIR+RSHEMLENEDMQHLLR+FSMGGHA+V++P+D G+ ++   +PSP+F +DEDR
Sbjct  493   FSEEEIRMRSHEMLENEDMQHLLRIFSMGGHAAVSVPDDGGYSYSYMPSPSPNFSFDEDR  552

Query  532   PRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              RP GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  553   SRPSGKAVVGWLKLKAALRWGIFIRKQAAERRAQ  586



>ref|XP_010265459.1| PREDICTED: uncharacterized protein LOC104603183 isoform X3 [Nelumbo 
nucifera]
Length=595

 Score =   277 bits (709),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 157/274 (57%), Positives = 203/274 (74%), Gaps = 17/274 (6%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK---ARNELPMGQVDYSNSLNNQLQQPR  1058
             KV+VDSLVKKAYENW    EYDGK LLS+K  K   +RNELPM   DY+NS + Q+  PR
Sbjct  324   KVFVDSLVKKAYENWGQVIEYDGKALLSYKQNKRSSSRNELPMAPTDYANSFDQQVSVPR  383

Query  1057  LPAPVQSEPSALDPGMLIGGSSYNEN-MGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
             LP P  SE S++D G+ +GG  YN+N +   Y  QS + +SS+ +Q+++  FA   Q Q+
Sbjct  384   LPVP--SEQSSMDSGLNVGG--YNDNHLVTGYPTQSQV-NSSAHIQFDSNSFA--TQSQM  436

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKG-VEEY  710
             ++ S Q Q  R D+ VGLALGPPQSS   F  VG S+Q +N  +++DW + R+ G VE +
Sbjct  437   ISTSHQAQIPRNDDIVGLALGPPQSSTTGFENVGPSIQASNA-TYDDWPHNRENGGVEGF  495

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPED-GFGFTPFMAPSPSFGYDEDR  533
              SEEEIR+RSHEMLENEDMQHLLR+FSMGGHA+V++P+D G+ ++   +PSP+F +DEDR
Sbjct  496   FSEEEIRMRSHEMLENEDMQHLLRIFSMGGHAAVSVPDDGGYSYSYMPSPSPNFSFDEDR  555

Query  532   PRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              RP GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  556   SRPSGKAVVGWLKLKAALRWGIFIRKQAAERRAQ  589



>ref|XP_010265458.1| PREDICTED: uncharacterized protein LOC104603183 isoform X2 [Nelumbo 
nucifera]
Length=642

 Score =   278 bits (710),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 157/274 (57%), Positives = 203/274 (74%), Gaps = 17/274 (6%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK---ARNELPMGQVDYSNSLNNQLQQPR  1058
             KV+VDSLVKKAYENW    EYDGK LLS+K  K   +RNELPM   DY+NS + Q+  PR
Sbjct  371   KVFVDSLVKKAYENWGQVIEYDGKALLSYKQNKRSSSRNELPMAPTDYANSFDQQVSVPR  430

Query  1057  LPAPVQSEPSALDPGMLIGGSSYNEN-MGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
             LP P  SE S++D G+ +GG  YN+N +   Y  QS + +SS+ +Q+++  FA   Q Q+
Sbjct  431   LPVP--SEQSSMDSGLNVGG--YNDNHLVTGYPTQSQV-NSSAHIQFDSNSFA--TQSQM  483

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKG-VEEY  710
             ++ S Q Q  R D+ VGLALGPPQSS   F  VG S+Q +N  +++DW + R+ G VE +
Sbjct  484   ISTSHQAQIPRNDDIVGLALGPPQSSTTGFENVGPSIQASNA-TYDDWPHNRENGGVEGF  542

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPED-GFGFTPFMAPSPSFGYDEDR  533
              SEEEIR+RSHEMLENEDMQHLLR+FSMGGHA+V++P+D G+ ++   +PSP+F +DEDR
Sbjct  543   FSEEEIRMRSHEMLENEDMQHLLRIFSMGGHAAVSVPDDGGYSYSYMPSPSPNFSFDEDR  602

Query  532   PRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              RP GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  603   SRPSGKAVVGWLKLKAALRWGIFIRKQAAERRAQ  636



>ref|XP_010265456.1| PREDICTED: uncharacterized protein LOC104603183 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010265457.1| PREDICTED: uncharacterized protein LOC104603183 isoform X1 [Nelumbo 
nucifera]
Length=645

 Score =   278 bits (710),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 157/274 (57%), Positives = 203/274 (74%), Gaps = 17/274 (6%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK---ARNELPMGQVDYSNSLNNQLQQPR  1058
             KV+VDSLVKKAYENW    EYDGK LLS+K  K   +RNELPM   DY+NS + Q+  PR
Sbjct  374   KVFVDSLVKKAYENWGQVIEYDGKALLSYKQNKRSSSRNELPMAPTDYANSFDQQVSVPR  433

Query  1057  LPAPVQSEPSALDPGMLIGGSSYNEN-MGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
             LP P  SE S++D G+ +GG  YN+N +   Y  QS + +SS+ +Q+++  FA   Q Q+
Sbjct  434   LPVP--SEQSSMDSGLNVGG--YNDNHLVTGYPTQSQV-NSSAHIQFDSNSFA--TQSQM  486

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKG-VEEY  710
             ++ S Q Q  R D+ VGLALGPPQSS   F  VG S+Q +N  +++DW + R+ G VE +
Sbjct  487   ISTSHQAQIPRNDDIVGLALGPPQSSTTGFENVGPSIQASNA-TYDDWPHNRENGGVEGF  545

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPED-GFGFTPFMAPSPSFGYDEDR  533
              SEEEIR+RSHEMLENEDMQHLLR+FSMGGHA+V++P+D G+ ++   +PSP+F +DEDR
Sbjct  546   FSEEEIRMRSHEMLENEDMQHLLRIFSMGGHAAVSVPDDGGYSYSYMPSPSPNFSFDEDR  605

Query  532   PRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              RP GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  606   SRPSGKAVVGWLKLKAALRWGIFIRKQAAERRAQ  639



>ref|XP_010656822.1| PREDICTED: uncharacterized protein LOC100264980 isoform X2 [Vitis 
vinifera]
Length=573

 Score =   273 bits (699),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 160/272 (59%), Positives = 197/272 (72%), Gaps = 13/272 (5%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFK----NKKARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVD+LVKKAYENW    EYDGK+L SFK    +  +RNE  +G +DY  +L   L  P
Sbjct  301   KVYVDNLVKKAYENWNQVEEYDGKSL-SFKQIIRSSTSRNEHMIGSMDYPTALEPLLPLP  359

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
             R P    SE S +DPG+ +GGS YN+ +  RY+ Q  +++SSSR Q++   F      QL
Sbjct  360   RPPVAGPSEQSLMDPGISVGGSGYNDGLATRYTAQPQLVNSSSRAQFDGPSFP--SHDQL  417

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
             +NNS Q+Q+ R D++VGLALGPPQSS   F  + SS+Q +NLN F D  N RDKGV++Y 
Sbjct  418   VNNSHQIQSTRNDSSVGLALGPPQSSTMGFQALNSSIQHSNLNPFSDLLNNRDKGVDDYF  477

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMA-PSPSFGYDEDRP  530
             +EEEIRLRSHEMLE++DMQ LLR+FSMGGH    IP+DG+GF P+MA PS     +EDR 
Sbjct  478   TEEEIRLRSHEMLESDDMQQLLRVFSMGGHI---IPDDGYGFPPYMASPSNCLYEEEDRS  534

Query  529   RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             RPGKAVVGWLKIKAAMRWGFFIRKKAAE+RAQ
Sbjct  535   RPGKAVVGWLKIKAAMRWGFFIRKKAAEKRAQ  566



>gb|KHG10046.1| Protein very KIND [Gossypium arboreum]
Length=640

 Score =   275 bits (703),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 164/272 (60%), Positives = 195/272 (72%), Gaps = 17/272 (6%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK---ARNELPMGQVDYSNSLNNQLQQPR  1058
             KVYVD+LVKKAY+NWL   EYDGK+L +FK  +   ARNE     + Y N   +QLQ PR
Sbjct  367   KVYVDTLVKKAYDNWLQVIEYDGKSLSNFKQNRRSSARNEPQTDAICYPN---HQLQLPR  423

Query  1057  LPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  878
             LP  V +E   +  G   GG  +N+N   RYS Q  +++S+SR Q++ TQF      QL+
Sbjct  424   LPVAVPTE--QVHSGPQAGG--FNDNQSMRYSGQPELVNSNSRSQFDGTQFL--QYDQLV  477

Query  877   nnsqqmqNARYDNN-VGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
             +NS+Q Q++R +NN VGLALGPPQSS   F    SS+Q +NLN F+ WSN RDKGVE+  
Sbjct  478   DNSEQPQSSRTNNNAVGLALGPPQSSTLGFHNASSSMQPSNLNPFDYWSNNRDKGVEDMF  537

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGY-DEDRP  530
             SEEEIRLRSHEMLENEDMQHLLRLFSMGGH +    + GFGF  +M PSP   + DEDR 
Sbjct  538   SEEEIRLRSHEMLENEDMQHLLRLFSMGGHHATVTEDGGFGFPNYM-PSPMVNFIDEDRS  596

Query  529   RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  597   RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  628



>emb|CBI17793.3| unnamed protein product [Vitis vinifera]
Length=628

 Score =   275 bits (702),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 160/272 (59%), Positives = 197/272 (72%), Gaps = 13/272 (5%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFK----NKKARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVD+LVKKAYENW    EYDGK+L SFK    +  +RNE  +G +DY  +L   L  P
Sbjct  356   KVYVDNLVKKAYENWNQVEEYDGKSL-SFKQIIRSSTSRNEHMIGSMDYPTALEPLLPLP  414

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
             R P    SE S +DPG+ +GGS YN+ +  RY+ Q  +++SSSR Q++   F      QL
Sbjct  415   RPPVAGPSEQSLMDPGISVGGSGYNDGLATRYTAQPQLVNSSSRAQFDGPSFP--SHDQL  472

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
             +NNS Q+Q+ R D++VGLALGPPQSS   F  + SS+Q +NLN F D  N RDKGV++Y 
Sbjct  473   VNNSHQIQSTRNDSSVGLALGPPQSSTMGFQALNSSIQHSNLNPFSDLLNNRDKGVDDYF  532

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMA-PSPSFGYDEDRP  530
             +EEEIRLRSHEMLE++DMQ LLR+FSMGGH    IP+DG+GF P+MA PS     +EDR 
Sbjct  533   TEEEIRLRSHEMLESDDMQQLLRVFSMGGHI---IPDDGYGFPPYMASPSNCLYEEEDRS  589

Query  529   RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             RPGKAVVGWLKIKAAMRWGFFIRKKAAE+RAQ
Sbjct  590   RPGKAVVGWLKIKAAMRWGFFIRKKAAEKRAQ  621



>ref|XP_002270522.1| PREDICTED: uncharacterized protein LOC100264980 isoform X1 [Vitis 
vinifera]
Length=642

 Score =   275 bits (702),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 160/272 (59%), Positives = 197/272 (72%), Gaps = 13/272 (5%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFK----NKKARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVD+LVKKAYENW    EYDGK+L SFK    +  +RNE  +G +DY  +L   L  P
Sbjct  370   KVYVDNLVKKAYENWNQVEEYDGKSL-SFKQIIRSSTSRNEHMIGSMDYPTALEPLLPLP  428

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
             R P    SE S +DPG+ +GGS YN+ +  RY+ Q  +++SSSR Q++   F      QL
Sbjct  429   RPPVAGPSEQSLMDPGISVGGSGYNDGLATRYTAQPQLVNSSSRAQFDGPSFP--SHDQL  486

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
             +NNS Q+Q+ R D++VGLALGPPQSS   F  + SS+Q +NLN F D  N RDKGV++Y 
Sbjct  487   VNNSHQIQSTRNDSSVGLALGPPQSSTMGFQALNSSIQHSNLNPFSDLLNNRDKGVDDYF  546

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMA-PSPSFGYDEDRP  530
             +EEEIRLRSHEMLE++DMQ LLR+FSMGGH    IP+DG+GF P+MA PS     +EDR 
Sbjct  547   TEEEIRLRSHEMLESDDMQQLLRVFSMGGHI---IPDDGYGFPPYMASPSNCLYEEEDRS  603

Query  529   RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             RPGKAVVGWLKIKAAMRWGFFIRKKAAE+RAQ
Sbjct  604   RPGKAVVGWLKIKAAMRWGFFIRKKAAEKRAQ  635



>ref|XP_004146305.1| PREDICTED: uncharacterized protein LOC101216741 [Cucumis sativus]
 ref|XP_011656751.1| PREDICTED: uncharacterized protein LOC101216741 [Cucumis sativus]
 ref|XP_011656752.1| PREDICTED: uncharacterized protein LOC101216741 [Cucumis sativus]
 gb|KGN65434.1| hypothetical protein Csa_1G422430 [Cucumis sativus]
Length=636

 Score =   271 bits (694),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 157/272 (58%), Positives = 195/272 (72%), Gaps = 16/272 (6%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVD+LV KAYENW    EYDGK+LLS K  K    +RN+   G +D SN+L++     
Sbjct  367   KVYVDTLVNKAYENWNQVVEYDGKSLLSSKQPKKSTASRNDFQGGHLDLSNTLDHG-SLA  425

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
             R+P  VQ +   +D G+ + G  YN++   RYS Q   ++S+SR Q++N+   P    +L
Sbjct  426   RMPVSVQPQQPVVDSGLSVAG--YNDSTATRYSTQPQFVNSTSRPQFDNS---PYTSNEL  480

Query  880   mnnsqqmqNARYDNNV-GLALGPPQ--SSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
             M NS Q+  AR DN+  GLALGPPQ  SS F  +GSS+Q++NLN F DWSN RDKGV+++
Sbjct  481   MGNSNQVHIARNDNSTFGLALGPPQASSSGFQALGSSMQESNLNPF-DWSNNRDKGVDDF  539

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRP  530
              SE+EIR+RSHEMLENEDMQ LLR+FSMGGHASVN  ++GF F  FM PSP   +D DR 
Sbjct  540   FSEDEIRMRSHEMLENEDMQQLLRMFSMGGHASVNGHDEGFSFPSFM-PSPMPNFD-DRN  597

Query  529   RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             R GKAVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  598   RSGKAVVGWLKIKAAMRWGFFIRRKAAERRAQ  629



>ref|XP_007154785.1| hypothetical protein PHAVU_003G147800g [Phaseolus vulgaris]
 gb|ESW26779.1| hypothetical protein PHAVU_003G147800g [Phaseolus vulgaris]
Length=637

 Score =   268 bits (686),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 157/274 (57%), Positives = 199/274 (73%), Gaps = 16/274 (6%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSF----KNKKARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVDSLVKKAYENW    +YDGK+L++     ++  + NEL +  +DY + L++QLQ P
Sbjct  365   KVYVDSLVKKAYENWEQVVDYDGKSLVNGNQNNRSIASENELRVESIDYGSGLDHQLQLP  424

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LP  V SE   ++ GM +GG  YN+++  RY  QS + +S+SR Q++ + +      QL
Sbjct  425   GLPVSVPSE-QQMNSGMSVGG--YNDSVVTRYPTQSLVSNSNSRSQFDGSLYL--SNDQL  479

Query  880   mnnsqqmqNARYDN-NVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
             ++N+ Q  N R D+  VGLALGPPQSS   F    SS+Q + LN F+DWS+ RDKGV+E+
Sbjct  480   ISNTHQTPNTRNDHGTVGLALGPPQSSTSGFHAGSSSIQPSTLNPFDDWSHNRDKGVDEF  539

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGG-HASVNIPEDGFGFTPFMAPSPSF-GYDED  536
              SEEEIRLRSHEMLENEDMQHLLRLFSMGG H S+++ EDG+ F  FM PSP+   YDED
Sbjct  540   FSEEEIRLRSHEMLENEDMQHLLRLFSMGGGHGSMSV-EDGYSFPTFM-PSPNVPNYDED  597

Query  535   RPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             R RPG+AVVGWLKIKAAMRWGFFIRK AAE+RAQ
Sbjct  598   RSRPGRAVVGWLKIKAAMRWGFFIRKIAAEKRAQ  631



>ref|XP_007225676.1| hypothetical protein PRUPE_ppa002789mg [Prunus persica]
 gb|EMJ26875.1| hypothetical protein PRUPE_ppa002789mg [Prunus persica]
Length=633

 Score =   266 bits (681),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 155/270 (57%), Positives = 191/270 (71%), Gaps = 16/270 (6%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK--ARNELPMGQVDYSNSLNNQLQQPRL  1055
             KVYVD+LVKKAYENW    +YDGK+LL+FK  K   R E   G + YS++ ++QLQ PRL
Sbjct  368   KVYVDTLVKKAYENWDQVIQYDGKSLLNFKQNKRSTRTEFQTGPISYSDASDHQLQVPRL  427

Query  1054  PAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmn  875
                V SE   LDP + IGG  YN+N+  RY  Q  +++S+SR Q++ T FA     QL++
Sbjct  428   TNSVPSEQPPLDPALPIGG--YNDNLSTRYLTQP-LVNSNSRTQFDGTGFA--LDDQLIS  482

Query  874   nsqqmqNARYDNN-VGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLS  704
             NS + Q+ R D N VGL L PPQSS   F T+ SS Q + LN  +DW+  RD     + S
Sbjct  483   NSHEAQSTRSDANAVGLVLAPPQSSTSGFQTINSSSQPSTLNPLDDWTTNRD-----FFS  537

Query  703   EEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRPRP  524
             EE+IR+RSHEMLENEDMQHLLR+FSMGGH S+++P+DG+   P   PSP   YDEDR RP
Sbjct  538   EEDIRIRSHEMLENEDMQHLLRIFSMGGHGSIDVPDDGY-SFPPFMPSPMPSYDEDRNRP  596

Query  523   GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             GKAVVGWLKIKAAMRWGFF+RKKAAERRAQ
Sbjct  597   GKAVVGWLKIKAAMRWGFFVRKKAAERRAQ  626



>ref|XP_011457401.1| PREDICTED: uncharacterized protein LOC101314910 [Fragaria vesca 
subsp. vesca]
Length=639

 Score =   265 bits (678),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 152/270 (56%), Positives = 190/270 (70%), Gaps = 15/270 (6%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSF-KNKKA---RNELPMGQVDYSNSLNNQLQQP  1061
             K+YVD+LVKKAYENW    EYDGK+LLS  KNK++    NE  M  + Y +S +   QQP
Sbjct  368   KLYVDTLVKKAYENWDQVIEYDGKSLLSNNKNKRSAADHNEFHMRSISYPSSSD---QQP  424

Query  1060  RLPAPVQSEPSALDPGML-IGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  884
             RL   + SE + L    L IGG  YN+N+  RY  Q  I++S+SR Q+E T FA  D Q 
Sbjct  425   RLTNSIPSEQTLLSNSPLPIGG--YNDNLSTRYLTQQPIVNSNSRAQFEGTSFA-LDGQL  481

Query  883   lmnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
             + ++ Q    A   N VGLALG PQSS   F  + +SVQ + LN  +DW   R+KG +++
Sbjct  482   INSSHQPQNIANDANAVGLALGLPQSSTSGFQAINASVQPSTLNPLDDWGTNREKGGDDF  541

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRP  530
              SEE+IR+RSHEMLENEDMQHLLR+FSMGGH S+++P+DG+ F P+M PSP   +DEDR 
Sbjct  542   FSEEDIRIRSHEMLENEDMQHLLRIFSMGGHGSIDMPDDGYAF-PYM-PSPMPNFDEDRT  599

Query  529   RPGKAVVGWLKIKAAMRWGFFIRKKAAERR  440
             RPGKAVVGWLKIKAAMRWGFF+RKKAAERR
Sbjct  600   RPGKAVVGWLKIKAAMRWGFFVRKKAAERR  629



>ref|XP_003542171.1| PREDICTED: uncharacterized protein LOC100790087 isoform X1 [Glycine 
max]
 ref|XP_006593544.1| PREDICTED: uncharacterized protein LOC100790087 isoform X2 [Glycine 
max]
Length=631

 Score =   265 bits (676),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 153/269 (57%), Positives = 191/269 (71%), Gaps = 11/269 (4%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             KVYVDSLVKKAYENW    +YDGK+L++ K   + NEL +  +DY + L++QLQ P LP 
Sbjct  364   KVYVDSLVKKAYENWDQVVDYDGKSLVNAK-IASENELRVESIDYGSGLDHQLQLPALPV  422

Query  1048  PVQSEPSALDPGMLIGGSSYNEN-MGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnn  872
              V SE   ++ GM +GG  YN+N +  RY  QS I +SSSR Q++++ +  ++ Q + N 
Sbjct  423   SVPSE-QQINSGMPVGG--YNDNNIVIRYPTQSLIPNSSSRTQFDSSLYV-SNDQLISNA  478

Query  871   sqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEE  698
              Q    +     +GLALGPPQSS   F    SS+Q + +N F+DWS+ RDKG +E+ SEE
Sbjct  479   HQTQSTSNDRGPIGLALGPPQSSTSGFHAGSSSIQPSTINPFDDWSHNRDKGADEFFSEE  538

Query  697   EIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSF-GYDEDRPRPG  521
             EIR RSHEMLENEDMQ LLRLFSMGG+ S++  EDG+ F  FM PSPS   YDEDR RPG
Sbjct  539   EIRFRSHEMLENEDMQQLLRLFSMGGNGSMS-AEDGYSFPSFM-PSPSIPNYDEDRSRPG  596

Query  520   KAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +AVVGWLKIKAAMRWGFFIRK AAERRAQ
Sbjct  597   RAVVGWLKIKAAMRWGFFIRKIAAERRAQ  625



>gb|KHN22715.1| hypothetical protein glysoja_027603 [Glycine soja]
Length=631

 Score =   263 bits (672),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 152/269 (57%), Positives = 191/269 (71%), Gaps = 11/269 (4%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             KVYVDSLVKKAYENW    +YDGK+L++ K   + NEL +  +DY + L++QLQ P LP 
Sbjct  364   KVYVDSLVKKAYENWDQVVDYDGKSLVNAK-IASENELRVESIDYGSGLDHQLQLPALPV  422

Query  1048  PVQSEPSALDPGMLIGGSSYNEN-MGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnn  872
              V SE   ++ GM +GG  YN+N +  RY  QS I +SSSR Q++++ +  ++ Q + N 
Sbjct  423   SVPSE-QQINSGMPVGG--YNDNNIVIRYPTQSLIPNSSSRTQFDSSLYV-SNDQLISNA  478

Query  871   sqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEE  698
              Q    +     +GLALGPPQSS   F    SS+Q + +N F+DWS+ RDKG +E+ SEE
Sbjct  479   HQTQSTSNDRGPIGLALGPPQSSTSGFHAGSSSIQPSTINPFDDWSHNRDKGADEFFSEE  538

Query  697   EIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSF-GYDEDRPRPG  521
             EIR RSHEMLENEDMQ LLRLFSMGG+ S++  EDG+ F  FM PSPS   YDEDR RPG
Sbjct  539   EIRFRSHEMLENEDMQQLLRLFSMGGNGSMS-AEDGYSFPSFM-PSPSIPNYDEDRSRPG  596

Query  520   KAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +AVVGWLKIKAA+RWGFFIRK AAERRAQ
Sbjct  597   RAVVGWLKIKAALRWGFFIRKIAAERRAQ  625



>ref|XP_003549493.1| PREDICTED: uncharacterized protein LOC100803029 isoform X1 [Glycine 
max]
 ref|XP_006600498.1| PREDICTED: uncharacterized protein LOC100803029 isoform X2 [Glycine 
max]
Length=627

 Score =   260 bits (665),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 154/268 (57%), Positives = 189/268 (71%), Gaps = 13/268 (5%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             KVYVDSLVKKAYENW    +YDGK+L++ K   + NEL +  +DY + L++QLQ P LP 
Sbjct  364   KVYVDSLVKKAYENWDQVVDYDGKSLVNAK-ISSENELHVESIDYGSGLDHQLQLPVLPV  422

Query  1048  PVQSEPSALDPGMLIGGSSYNEN-MGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnn  872
              V SE   ++ G+ +GG  YN+N +  RY  QS I +SSSR Q++++ +  NDQ     +
Sbjct  423   SVPSE-QQINSGIPVGG--YNDNNIVTRYPTQSLIPNSSSRNQFDSSLYVSNDQLISNAH  479

Query  871   sqqmqNARYDNNVGLALGPPQSSCFP-TVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEEE  695
               Q  +  +   VGLALGPPQSS      GSS   + +N F+DWS+ RDKG +E+ SEEE
Sbjct  480   QTQSTSNDH-GTVGLALGPPQSSTSGFHAGSS---SAINPFDDWSHNRDKGADEFFSEEE  535

Query  694   IRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSF-GYDEDRPRPGK  518
             IR RSHEMLENEDMQ LLRLFSMGGH S++  EDGF F  FM PSPS   YDEDR RPG+
Sbjct  536   IRFRSHEMLENEDMQQLLRLFSMGGHGSMS-AEDGFSFPSFM-PSPSIPNYDEDRSRPGR  593

Query  517   AVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             AVVGWLKIKAAMRWGFFIRK AAE+RAQ
Sbjct  594   AVVGWLKIKAAMRWGFFIRKIAAEKRAQ  621



>gb|EYU20920.1| hypothetical protein MIMGU_mgv1a002870mg [Erythranthe guttata]
Length=629

 Score =   260 bits (664),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 148/273 (54%), Positives = 186/273 (68%), Gaps = 29/273 (11%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFK----NKKARNELPMGQVDYS-NSLNNQLQQ  1064
             K YVDS VKKAYENW    EYDGK+LL+ K    +  +R++  +GQVDYS +S++N L  
Sbjct  371   KGYVDSWVKKAYENWSQVVEYDGKSLLNLKQITNSSTSRSDFTLGQVDYSPHSVDNHLLP  430

Query  1063  PRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  884
              RLP  V SEPS +D  MLIGG  YN+++ ARYS Q  +++S+SR  +E + F  ++ Q 
Sbjct  431   QRLPLSVPSEPSPVDQSMLIGGLGYNDDLTARYSTQPQLINSNSRNHFELSSFT-HNNQP  489

Query  883   lmnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWS-NTRDKGVEEYL  707
             + + +Q      YDN VGLAL P                     EDWS N  +KG++++L
Sbjct  490   IDHTNQIQDPTTYDNKVGLALSP--------------------LEDWSTNHNNKGIDDFL  529

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGGH-ASVNIPEDGFGFTPFM-APSPSFGYDEDR  533
             SE+EIR+RSHEMLENEDMQHLLRLFSMGG+ ASV+ PEDGF F  +M +PSP F + EDR
Sbjct  530   SEDEIRMRSHEMLENEDMQHLLRLFSMGGNNASVSGPEDGFSFPSYMPSPSPGFSFGEDR  589

Query  532   PRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              R GKAV GWLKIKAAMRWG FIRKKAAERRA+
Sbjct  590   ARSGKAVAGWLKIKAAMRWGIFIRKKAAERRAR  622



>gb|KHN17575.1| hypothetical protein glysoja_005772 [Glycine soja]
Length=627

 Score =   260 bits (664),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 154/268 (57%), Positives = 189/268 (71%), Gaps = 13/268 (5%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             KVYVDSLVKKAYENW    +YDGK+L++ K   + NEL +  +DY + L++QLQ P LP 
Sbjct  364   KVYVDSLVKKAYENWDQVVDYDGKSLVNAK-IASENELRVESIDYGSGLDHQLQLPVLPV  422

Query  1048  PVQSEPSALDPGMLIGGSSYNEN-MGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnn  872
              V SE   ++ G+ +GG  YN+N +  RY  QS I +SSSR Q++++ +  NDQ     +
Sbjct  423   SVPSE-QQINSGIPVGG--YNDNNIVTRYPTQSLIPNSSSRNQFDSSLYVSNDQLISNAH  479

Query  871   sqqmqNARYDNNVGLALGPPQSSCFP-TVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEEE  695
               Q  +  +   VGLALGPPQSS      GSS   + +N F+DWS+ RDKG +E+ SEEE
Sbjct  480   QTQSTSNDH-GTVGLALGPPQSSTSGFHAGSS---SAINPFDDWSHNRDKGADEFFSEEE  535

Query  694   IRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSF-GYDEDRPRPGK  518
             IR RSHEMLENEDMQ LLRLFSMGGH S++  EDGF F  FM PSPS   YDEDR RPG+
Sbjct  536   IRFRSHEMLENEDMQQLLRLFSMGGHGSMS-AEDGFSFPSFM-PSPSIPNYDEDRSRPGR  593

Query  517   AVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             AVVGWLKIKAAMRWGFFIRK AAE+RAQ
Sbjct  594   AVVGWLKIKAAMRWGFFIRKIAAEKRAQ  621



>ref|XP_003610155.1| Calmodulin-binding protein [Medicago truncatula]
 gb|AES92352.1| calmodulin-binding protein [Medicago truncatula]
Length=636

 Score =   258 bits (658),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 150/272 (55%), Positives = 192/272 (71%), Gaps = 14/272 (5%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNK----KARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVDSLVKKAY+NW    EYDGK+L+  +      ++ NEL +  +DY   L++QL  P
Sbjct  366   KVYVDSLVKKAYDNWEQVVEYDGKSLVDAEQNNNTVESENELHVESIDYDGGLDHQLLMP  425

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LP  V SE   ++  M +GG  +N +M  RY +Q+ I +SSSR  ++++ +       L
Sbjct  426   SLPMSVASE-QQINSAMPVGG--FNNSMVTRYPSQALIGNSSSRSHFDDSLYL--SNDHL  480

Query  880   mnnsqqmqNARYDNN-VGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
             + N+ Q Q++R D++ VGLALGPPQSS   F    SS+Q    N F+DWSN RDKGV+++
Sbjct  481   LGNAHQSQSSRNDHSTVGLALGPPQSSTSGFHAGSSSMQPPAPNPFDDWSNNRDKGVDDF  540

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRP  530
              SE+EIR+RS+E+LENEDMQHLLRLFSMGGH S+N  EDG+ F  FM PSP   +DEDR 
Sbjct  541   FSEDEIRVRSNEILENEDMQHLLRLFSMGGHPSMNT-EDGYSFPSFM-PSPMPNFDEDRS  598

Query  529   RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             RPGKAVVGWLKIKAAMRWGFFIRK AAE+RAQ
Sbjct  599   RPGKAVVGWLKIKAAMRWGFFIRKIAAEKRAQ  630



>ref|XP_010914125.1| PREDICTED: uncharacterized protein LOC105039615 [Elaeis guineensis]
 ref|XP_010914126.1| PREDICTED: uncharacterized protein LOC105039615 [Elaeis guineensis]
Length=638

 Score =   257 bits (657),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 146/276 (53%), Positives = 186/276 (67%), Gaps = 15/276 (5%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KV+VD+LVKKAY+NW+   EYDGK LLSF+  K     RNE      +Y  S + Q  Q 
Sbjct  361   KVFVDTLVKKAYDNWMHVIEYDGKALLSFRQSKKTIATRNEPSSASTNYPASYDQQSSQQ  420

Query  1060  RLPAPVQSEPSALDPGMLIGGSS-YNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  884
              +   V  E SA+D G+++G S+ YN N   RY   S  + S+  MQYE+  FAP  Q  
Sbjct  421   HMSTAVPMEHSAVDGGVVVGASAGYNGNQVTRYVAHSQHVDSNVHMQYESNSFAPQSQLN  480

Query  883   lmnnsqqmqNARYDNNVGLALGPPQSS--CFPTVGSSVQQTNLNSFEDWSNTRD-KGVEE  713
               +   Q+     +++ GLALGPPQ +   F  +G SV  TNLNS++DWS  RD + VE+
Sbjct  481   GSSQQTQVTR---NDSTGLALGPPQQANLGFQPLGQSVLSTNLNSYDDWSRQRDIQAVED  537

Query  712   Y-LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMA-PSPSFGYDE  539
             + LSEEEIR+RSHE+LENE+MQ LLR+FSMGG AS +IPED +GF  +++ P PSF +DE
Sbjct  538   FNLSEEEIRMRSHEILENEEMQQLLRVFSMGG-ASASIPEDTYGFQSYISSPCPSFNFDE  596

Query  538   DRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             DR R  G+AVVGWLKIKAAMRWG FIRKKAAE+RAQ
Sbjct  597   DRSRSSGRAVVGWLKIKAAMRWGIFIRKKAAEKRAQ  632



>ref|XP_004507834.1| PREDICTED: uncharacterized protein LOC101488801 isoform X4 [Cicer 
arietinum]
Length=625

 Score =   256 bits (655),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 151/272 (56%), Positives = 191/272 (70%), Gaps = 13/272 (5%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSF----KNKKARNELPMGQVDYSNSLNNQLQQP  1061
             K+YVDSLVKKAY+NW    EYDGK+L+      K+ ++ NEL +  +DY   L++QLQ P
Sbjct  354   KIYVDSLVKKAYDNWDQVVEYDGKSLVDAEQVNKSVESENELHVESIDYDVGLDHQLQMP  413

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSN-QSHIMSSSSRMQYENTQFAPndqqq  884
              +P  V S    ++ GM +GG  YN NM  RY N Q+ I +SSSR Q+E + + P DQ  
Sbjct  414   VIPMSVTS-GQQMNSGMPVGG--YNNNMVTRYPNHQALIGNSSSRSQFEGSLYLPTDQLV  470

Query  883   lmnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
                +  Q  +  + + VGLALGPPQSS   F    SS+Q + LN F+DWS+ RDKGV+++
Sbjct  471   SNAHQSQSSSNDH-STVGLALGPPQSSTSGFHAGSSSIQPSALNPFDDWSHNRDKGVDDF  529

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRP  530
              SE+EIR+RS+E+LENEDMQHLLRLFSMGGHAS+N  EDG+   P   PSP   +DEDR 
Sbjct  530   FSEDEIRVRSNEILENEDMQHLLRLFSMGGHASMN-TEDGY-SFPPFMPSPMPNFDEDRT  587

Query  529   RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             RPG+AVVGWLKIKAAMRWGFFIRK AAE+RAQ
Sbjct  588   RPGRAVVGWLKIKAAMRWGFFIRKIAAEKRAQ  619



>ref|XP_004507832.1| PREDICTED: uncharacterized protein LOC101488801 isoform X2 [Cicer 
arietinum]
 ref|XP_004507833.1| PREDICTED: uncharacterized protein LOC101488801 isoform X3 [Cicer 
arietinum]
Length=635

 Score =   256 bits (655),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 151/272 (56%), Positives = 191/272 (70%), Gaps = 13/272 (5%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSF----KNKKARNELPMGQVDYSNSLNNQLQQP  1061
             K+YVDSLVKKAY+NW    EYDGK+L+      K+ ++ NEL +  +DY   L++QLQ P
Sbjct  364   KIYVDSLVKKAYDNWDQVVEYDGKSLVDAEQVNKSVESENELHVESIDYDVGLDHQLQMP  423

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSN-QSHIMSSSSRMQYENTQFAPndqqq  884
              +P  V S    ++ GM +GG  YN NM  RY N Q+ I +SSSR Q+E + + P DQ  
Sbjct  424   VIPMSVTS-GQQMNSGMPVGG--YNNNMVTRYPNHQALIGNSSSRSQFEGSLYLPTDQLV  480

Query  883   lmnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
                +  Q  +  + + VGLALGPPQSS   F    SS+Q + LN F+DWS+ RDKGV+++
Sbjct  481   SNAHQSQSSSNDH-STVGLALGPPQSSTSGFHAGSSSIQPSALNPFDDWSHNRDKGVDDF  539

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRP  530
              SE+EIR+RS+E+LENEDMQHLLRLFSMGGHAS+N  EDG+   P   PSP   +DEDR 
Sbjct  540   FSEDEIRVRSNEILENEDMQHLLRLFSMGGHASMNT-EDGY-SFPPFMPSPMPNFDEDRT  597

Query  529   RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             RPG+AVVGWLKIKAAMRWGFFIRK AAE+RAQ
Sbjct  598   RPGRAVVGWLKIKAAMRWGFFIRKIAAEKRAQ  629



>ref|XP_004507831.1| PREDICTED: uncharacterized protein LOC101488801 isoform X1 [Cicer 
arietinum]
Length=694

 Score =   256 bits (654),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 151/272 (56%), Positives = 191/272 (70%), Gaps = 13/272 (5%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSF----KNKKARNELPMGQVDYSNSLNNQLQQP  1061
             K+YVDSLVKKAY+NW    EYDGK+L+      K+ ++ NEL +  +DY   L++QLQ P
Sbjct  423   KIYVDSLVKKAYDNWDQVVEYDGKSLVDAEQVNKSVESENELHVESIDYDVGLDHQLQMP  482

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSN-QSHIMSSSSRMQYENTQFAPndqqq  884
              +P  V S    ++ GM +GG  YN NM  RY N Q+ I +SSSR Q+E + + P DQ  
Sbjct  483   VIPMSVTS-GQQMNSGMPVGG--YNNNMVTRYPNHQALIGNSSSRSQFEGSLYLPTDQLV  539

Query  883   lmnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
                +  Q  +  + + VGLALGPPQSS   F    SS+Q + LN F+DWS+ RDKGV+++
Sbjct  540   SNAHQSQSSSNDH-STVGLALGPPQSSTSGFHAGSSSIQPSALNPFDDWSHNRDKGVDDF  598

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRP  530
              SE+EIR+RS+E+LENEDMQHLLRLFSMGGHAS+N  EDG+   P   PSP   +DEDR 
Sbjct  599   FSEDEIRVRSNEILENEDMQHLLRLFSMGGHASMNT-EDGY-SFPPFMPSPMPNFDEDRT  656

Query  529   RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             RPG+AVVGWLKIKAAMRWGFFIRK AAE+RAQ
Sbjct  657   RPGRAVVGWLKIKAAMRWGFFIRKIAAEKRAQ  688



>ref|XP_008800271.1| PREDICTED: uncharacterized protein LOC103714689 [Phoenix dactylifera]
Length=641

 Score =   251 bits (642),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 144/276 (52%), Positives = 188/276 (68%), Gaps = 25/276 (9%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFK-NKKARNELPMGQVDYSNSLNNQLQQPRLP  1052
             KV+ D+LVKKAY+NW+   EYDGK LL+ K NKKA         +Y    + Q+ Q  L 
Sbjct  374   KVFADALVKKAYDNWVHVIEYDGKALLNSKQNKKAT------AANYPVLYDQQISQTNLS  427

Query  1051  APVQSEPSALDPGMLIGGSS----YNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  884
              PV  E  ++D  M IGGS+    Y+ N G RYS+    +S+++ +Q+E+T F P +Q  
Sbjct  428   VPVPLEQPSVDAEMAIGGSTISAGYSGNQGTRYSSHPQNVSTNAHIQFESTSFIPENQYV  487

Query  883   lmnnsqqmqNARYDNNVGLALGPPQ--SSCFPTVGSSVQQTNLNSFEDWSNTRD-KGVEE  713
               ++       + ++ VGL LGPPQ  S  F  +GSS+Q +NLNS++DWS  RD + +++
Sbjct  488   GSSHQ-----TQRNDGVGLELGPPQQESIGFQQIGSSIQPSNLNSYDDWSRQRDSRRIDD  542

Query  712   YLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPS--FGYDE  539
             + SEEEIR+RSHEMLENEDMQ LLR+FSMGG  +VN PEDG+GF+ + APSP   F +D+
Sbjct  543   FFSEEEIRMRSHEMLENEDMQQLLRVFSMGG--AVNAPEDGYGFSSY-APSPCQNFNFDD  599

Query  538   DRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             DR R  GKAVVGWLKIKAAMRWG FIRKKAAERRAQ
Sbjct  600   DRSRSSGKAVVGWLKIKAAMRWGIFIRKKAAERRAQ  635



>ref|XP_010536924.1| PREDICTED: uncharacterized protein LOC104811802 [Tarenaya hassleriana]
Length=646

 Score =   249 bits (637),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 140/275 (51%), Positives = 182/275 (66%), Gaps = 14/275 (5%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVD LVKKAYENW    EYDGK+L+SFK  K    +R +L M   +YS ++++ +Q  
Sbjct  364   KVYVDGLVKKAYENWNQVIEYDGKSLMSFKQPKKSGISRTDLAMAPANYSTTIDHSMQFH  423

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LPA V +  +++   + IGG  +N+++  RYS Q+ +++S+ R Q+E    AP DQ   
Sbjct  424   ELPASVPANQASVHSELAIGG--FNQSLATRYSTQNQLLNSNPRTQFEFASSAPQDQFVD  481

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSC---FPTVGSSVQQTNLNSFEDWSNTRDKGV-EE  713
               +  Q          GLALGPP SS    +  + +S Q  NLN FE+WSN R++G  ++
Sbjct  482   SLHQTQSNINDQSAAAGLALGPPHSSTGGGYQNMSTSNQTENLNPFEEWSNHRERGGGDD  541

Query  712   YLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDG--FGFTPFMAPSPSFGYDE  539
             + SEEEIR RSHEMLENEDMQ LLRLFSMGG+   ++ EDG  F F  FM  +P   ++E
Sbjct  542   FFSEEEIRSRSHEMLENEDMQQLLRLFSMGGN--THVAEDGGLFSFPSFMQQTPMQSFEE  599

Query  538   DRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             DR R GKAVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  600   DRGRSGKAVVGWLKIKAAMRWGFFIRRKAAERRAQ  634



>ref|XP_010913644.1| PREDICTED: uncharacterized protein LOC105039256 [Elaeis guineensis]
 ref|XP_010913645.1| PREDICTED: uncharacterized protein LOC105039256 [Elaeis guineensis]
 ref|XP_010913646.1| PREDICTED: uncharacterized protein LOC105039256 [Elaeis guineensis]
Length=651

 Score =   249 bits (636),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 142/285 (50%), Positives = 188/285 (66%), Gaps = 33/285 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFK-NKKARNELPMGQVDYSNSLNNQLQQPRLP  1052
             KV+ D+LVKKAY+NWL   EYDGK LL+FK NKKA         +Y  S + Q+ Q  + 
Sbjct  374   KVFADTLVKKAYDNWLHVLEYDGKALLNFKQNKKAT------AANYPVSYDQQISQTNMS  427

Query  1051  APVQSEPSALDPGMLIGGSS----YNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  884
              PV  E  A+D GM +GGS+    Y+ N   R S+    +SS + + +E+  F P +Q  
Sbjct  428   VPVPLEQPAVDAGMGVGGSTISAGYSVNQVTRCSSHPQNVSSDAHIHFESAPFIPQNQYV  487

Query  883   lmnnsqqmqNARYDNNVGLALGPPQ--SSCFPTVGSSVQQTNLNSFEDWSNTRD-KGVEE  713
               ++       + +++VGL LGPPQ  S  F  +GSS+Q +NLNS++DWS  RD +G+++
Sbjct  488   GSSHQ-----TQRNDSVGLELGPPQQESIGFQQIGSSMQPSNLNSYDDWSRQRDSRGIDD  542

Query  712   YLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGYDED  536
             + SEEEIR RSHEMLENEDMQ LLR+FSMGG  +VN+PEDG+ F+ ++ +P P+F +D+D
Sbjct  543   FFSEEEIRTRSHEMLENEDMQQLLRVFSMGG--TVNLPEDGYSFSSYVPSPCPNFNFDDD  600

Query  535   RPR-----------PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             R R            GKAVVGWLKIKAAMRWG FIRKKAAERRAQ
Sbjct  601   RNRNFNFDEDRNRSSGKAVVGWLKIKAAMRWGIFIRKKAAERRAQ  645



>ref|XP_008805417.1| PREDICTED: uncharacterized protein LOC103718396 [Phoenix dactylifera]
 ref|XP_008805418.1| PREDICTED: uncharacterized protein LOC103718396 [Phoenix dactylifera]
 ref|XP_008805420.1| PREDICTED: uncharacterized protein LOC103718396 [Phoenix dactylifera]
Length=654

 Score =   249 bits (636),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 141/279 (51%), Positives = 185/279 (66%), Gaps = 18/279 (6%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KV+VD+LVKKAY+NW+   EYDGK LLSF+  K     RNE P    +Y    + Q  Q 
Sbjct  374   KVFVDTLVKKAYDNWMHVIEYDGKALLSFRQCKKTTATRNEPPSSSTNYPALYDQQSSQQ  433

Query  1060  RLPAPVQSEPSALDPGMLIGGSS----YNENMGARYSNQSHIMSSSSRMQYENTQFAPnd  893
              +   V +E  A+D G+++GG +    YN N   RY+       S+  M YE+  FAP  
Sbjct  434   HMSTTVPTELPAVDRGVVVGGDAASAGYNGNQVNRYAAHPQHADSNVHMHYESNSFAPQS  493

Query  892   qqqlmnnsqqmqNARYDNNVGLALGPPQSS--CFPTVGSSVQQTNLNSFEDWSNTRD-KG  722
             Q    +   Q+     +++ GLALGPPQ +   F  +G S+  TNL+S++DWS  RD + 
Sbjct  494   QLNGSSQQTQVTR---NDSTGLALGPPQQANLGFQPLGQSILSTNLHSYDDWSRQRDVQA  550

Query  721   VEEY-LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMA-PSPSFG  548
             VE++ LSEEEIR+RSHE+LENE+MQ LLR+FSMGG AS +IPED +GF P+++ P P+F 
Sbjct  551   VEDFNLSEEEIRMRSHEILENEEMQQLLRVFSMGG-ASSSIPEDAYGFPPYISSPCPNFN  609

Query  547   YDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +DEDR R  G+AVVGWLKIKAAMRWG FIRKKAAE+RAQ
Sbjct  610   FDEDRSRSSGRAVVGWLKIKAAMRWGIFIRKKAAEKRAQ  648



>ref|XP_010929241.1| PREDICTED: uncharacterized protein LOC105050786 isoform X2 [Elaeis 
guineensis]
Length=640

 Score =   247 bits (631),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 139/278 (50%), Positives = 186/278 (67%), Gaps = 17/278 (6%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK---ARNELPMGQVDYSNSLNNQLQQPR  1058
             KV+ D+LVKKAY+NW+   EYDG+ LL+F+  K    RNE P    +   S + Q  Q  
Sbjct  361   KVFADALVKKAYDNWMHVIEYDGEALLNFRQSKKTATRNEHPSASKNCPASYDQQACQQH  420

Query  1057  LPAPVQSEPSALDPGMLIGGSS----YNENMGARYSNQSHIMSSSSRMQYENTQFAPndq  890
             +   V  E  A+D G++ GG++    YNEN   RYS     + SS+ MQYE+  FAP  Q
Sbjct  421   MSTTVPGEHPAVDRGVVAGGNAASAGYNENQVNRYSAHPQHVDSSTHMQYESNSFAPQSQ  480

Query  889   qqlmnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRD-KGV  719
                 +   Q+     +++ GLALGPPQ +   F  +G S+   NLN+++DWS  RD + V
Sbjct  481   FNGSSQQMQITR---NDSTGLALGPPQQATLGFQPLGQSILSANLNTYDDWSRQRDVQAV  537

Query  718   EEY-LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGY  545
             E++ LSEEEIR+RSHE+LENE+MQ LLR+FSMGG AS ++PEDG+GF  ++ +P P+F +
Sbjct  538   EDFNLSEEEIRMRSHEILENEEMQQLLRVFSMGG-ASTSVPEDGYGFPSYIPSPCPNFNF  596

Query  544   DEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             DEDR R  G+AVVGWLKIKAAMRWG FIRK+AA+RRAQ
Sbjct  597   DEDRNRSSGRAVVGWLKIKAAMRWGIFIRKRAAQRRAQ  634



>ref|XP_010929240.1| PREDICTED: uncharacterized protein LOC105050786 isoform X1 [Elaeis 
guineensis]
Length=653

 Score =   248 bits (632),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 139/278 (50%), Positives = 186/278 (67%), Gaps = 17/278 (6%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK---ARNELPMGQVDYSNSLNNQLQQPR  1058
             KV+ D+LVKKAY+NW+   EYDG+ LL+F+  K    RNE P    +   S + Q  Q  
Sbjct  374   KVFADALVKKAYDNWMHVIEYDGEALLNFRQSKKTATRNEHPSASKNCPASYDQQACQQH  433

Query  1057  LPAPVQSEPSALDPGMLIGGSS----YNENMGARYSNQSHIMSSSSRMQYENTQFAPndq  890
             +   V  E  A+D G++ GG++    YNEN   RYS     + SS+ MQYE+  FAP  Q
Sbjct  434   MSTTVPGEHPAVDRGVVAGGNAASAGYNENQVNRYSAHPQHVDSSTHMQYESNSFAPQSQ  493

Query  889   qqlmnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRD-KGV  719
                 +   Q+     +++ GLALGPPQ +   F  +G S+   NLN+++DWS  RD + V
Sbjct  494   FNGSSQQMQITR---NDSTGLALGPPQQATLGFQPLGQSILSANLNTYDDWSRQRDVQAV  550

Query  718   EEY-LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGY  545
             E++ LSEEEIR+RSHE+LENE+MQ LLR+FSMGG AS ++PEDG+GF  ++ +P P+F +
Sbjct  551   EDFNLSEEEIRMRSHEILENEEMQQLLRVFSMGG-ASTSVPEDGYGFPSYIPSPCPNFNF  609

Query  544   DEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             DEDR R  G+AVVGWLKIKAAMRWG FIRK+AA+RRAQ
Sbjct  610   DEDRNRSSGRAVVGWLKIKAAMRWGIFIRKRAAQRRAQ  647



>ref|XP_008808337.1| PREDICTED: uncharacterized protein LOC103720426 [Phoenix dactylifera]
Length=641

 Score =   244 bits (624),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 139/279 (50%), Positives = 184/279 (66%), Gaps = 18/279 (6%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNS----LNNQLQQP  1061
             KV+ D+LVKKAY+NW+   EYDGK+LLSF+  K       GQ   S +     + +  Q 
Sbjct  361   KVFADTLVKKAYDNWMHVIEYDGKSLLSFRQSKKTTATRSGQPSASKTHTALYDQEACQQ  420

Query  1060  RLPAPVQSEPSALDPGMLIGGSS----YNENMGARYSNQSHIMSSSSRMQYENTQFAPnd  893
              +   V +E  A+D G++ GG +    YN N   RYS     + S+  MQYE++ FAP  
Sbjct  421   HMSTTVPAEHPAVDRGVVAGGDAASAGYNGNQVNRYSAHPQHVDSNIHMQYESSSFAPQS  480

Query  892   qqqlmnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRD-KG  722
                  +   Q+     +++ GLALGPPQ +   F  +G S+  TNLNS++DWS  RD + 
Sbjct  481   LLNGSSQQTQITR---NDSTGLALGPPQQATLGFQPLGQSILSTNLNSYDDWSRQRDVQA  537

Query  721   VEEY-LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFG  548
             VE++ LSEEEIR+RSHE+LENE+MQ LLR+FSMGG AS ++PEDG+GF  ++ +P P+F 
Sbjct  538   VEDFNLSEEEIRMRSHEILENEEMQQLLRVFSMGG-ASSSVPEDGYGFPSYIPSPCPNFN  596

Query  547   YDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +DEDR R  G+AVVGWLKIKAAMRWG FIRKKAAERRAQ
Sbjct  597   FDEDRNRSSGRAVVGWLKIKAAMRWGIFIRKKAAERRAQ  635



>gb|EYU20919.1| hypothetical protein MIMGU_mgv1a002870mg [Erythranthe guttata]
Length=611

 Score =   239 bits (611),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 136/272 (50%), Positives = 173/272 (64%), Gaps = 45/272 (17%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFK----NKKARNELPMGQVDYS-NSLNNQLQQ  1064
             K YVDS VKKAYENW    EYDGK+LL+ K    +  +R++  +GQVDYS +S++N L  
Sbjct  371   KGYVDSWVKKAYENWSQVVEYDGKSLLNLKQITNSSTSRSDFTLGQVDYSPHSVDNHLLP  430

Query  1063  PRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  884
              RLP  V SEPS +D  MLIGG  YN+++ ARYS Q  +++S+SR  +E + F       
Sbjct  431   QRLPLSVPSEPSPVDQSMLIGGLGYNDDLTARYSTQPQLINSNSRNHFELSSFT------  484

Query  883   lmnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLS  704
                           NN  +                    + N  +D +   +KG++++LS
Sbjct  485   -------------HNNQPI-------------------DHTNQIQDPTTYDNKGIDDFLS  512

Query  703   EEEIRLRSHEMLENEDMQHLLRLFSMGGH-ASVNIPEDGFGFTPFM-APSPSFGYDEDRP  530
             E+EIR+RSHEMLENEDMQHLLRLFSMGG+ ASV+ PEDGF F  +M +PSP F + EDR 
Sbjct  513   EDEIRMRSHEMLENEDMQHLLRLFSMGGNNASVSGPEDGFSFPSYMPSPSPGFSFGEDRA  572

Query  529   RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             R GKAV GWLKIKAAMRWG FIRKKAAERRA+
Sbjct  573   RSGKAVAGWLKIKAAMRWGIFIRKKAAERRAR  604



>ref|XP_010688497.1| PREDICTED: uncharacterized protein LOC104902420 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010688498.1| PREDICTED: uncharacterized protein LOC104902420 [Beta vulgaris 
subsp. vulgaris]
Length=645

 Score =   238 bits (608),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 136/275 (49%), Positives = 181/275 (66%), Gaps = 24/275 (9%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFK----NKKARNELPMGQVDYSNSLN-NQLQQ  1064
             KVY+D+LVKKAY+NW    EYDGK L++ K     + ++N+L M  + YSN ++ NQL  
Sbjct  379   KVYIDTLVKKAYDNWHQVIEYDGKALMNSKQTRRTRSSQNDLSMNTISYSNHIDDNQLAL  438

Query  1063  PRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  884
             PRLP  V +E + ++  +   G  YN N+  R+ NQS +MSS+S  Q+E+T ++ +    
Sbjct  439   PRLPVAVPTEQALVENSVAAPG--YNNNLANRFPNQSQLMSSNSHNQFESTSYSQHGLIS  496

Query  883   lmnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
               +    +     DN  GLALGPPQS+   F  +  S Q  N+N F+DWS+ +       
Sbjct  497   SSSEQTHIIGN--DNRAGLALGPPQSAVPGFQVMQQS-QPPNINPFDDWSHNQ-------  546

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSF---GYDE  539
             +SE+EIR RSHE+LE++DMQ LLRLFSMGGH  VN+P++ F   P   P+PS     ++E
Sbjct  547   ISEDEIRNRSHELLESDDMQQLLRLFSMGGH--VNMPDETFSSFPSFMPTPSNYNNSFEE  604

Query  538   DRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             DR RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  605   DRSRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  639



>ref|XP_006401191.1| hypothetical protein EUTSA_v10012939mg [Eutrema salsugineum]
 gb|ESQ42644.1| hypothetical protein EUTSA_v10012939mg [Eutrema salsugineum]
Length=642

 Score =   234 bits (596),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 143/278 (51%), Positives = 175/278 (63%), Gaps = 22/278 (8%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQP-RLP  1052
             KV+VD LVKKAYENW    EYDGK+LL  K  K    L + Q + +N     +  P ++ 
Sbjct  364   KVFVDGLVKKAYENWNLVIEYDGKSLLDLKQPK---RLAITQTEPANYSTVAIDHPMQMA  420

Query  1051  APVQSEPSALDPGML---IGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
                 S P+   P +    IGG  Y++ M  RY+ Q  +++S++R Q+E    AP    Q 
Sbjct  421   GHSSSVPANQCPVLSDYPIGG--YDQAMVTRYTPQPQLLNSNARAQFE---VAPGTTTQD  475

Query  880   mnnsqqmqNARYDNNVG----LALGPPQSSC--FPTV-GSSVQQTNLNSFEDWSNTRDKG  722
                    Q     NN      LALGPPQSS   F  +  SSV Q NLN FEDWSN R++G
Sbjct  476   QLMGNLHQTQSIINNQNVTGLLALGPPQSSTSGFQDINSSSVHQANLNPFEDWSNHRERG  535

Query  721   VEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFTPFMAPSPSFG  548
              EE+ SEEEIRLRSHEMLENEDMQ  LRLFSMGG   ++ ++PEDG+ F  F+  +P  G
Sbjct  536   AEEFFSEEEIRLRSHEMLENEDMQQFLRLFSMGGGNGSATHLPEDGYTFPSFLH-TPMQG  594

Query  547   YDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             YDEDR R G+AVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  595   YDEDRGRSGRAVVGWLKIKAAMRWGFFIRRKAAERRAQ  632



>ref|XP_002866219.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42478.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
Length=646

 Score =   231 bits (588),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 136/275 (49%), Positives = 170/275 (62%), Gaps = 16/275 (6%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             KVYVD LVKKAYE+W    EYDGK+LL  K  +    L +   D  N     +  P   A
Sbjct  365   KVYVDGLVKKAYESWNLVIEYDGKSLLDLKQPQ---RLSITHTDLENYSTAAIDHPMQMA  421

Query  1048  PVQSEPSALDPGML----IGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
                S   A  P +L    IGG  Y++ +  RY +Q  +++S+ R Q+E    +    Q +
Sbjct  422   GHSSSMPANQPPVLSDFAIGG--YDQTLATRYHSQPQLLNSNPRAQFEVASCSTAQDQFM  479

Query  880   mnnsqqmqNARYDNNVGLALGPPQ--SSCFPTVGSS-VQQTNLNSFEDWSNTRDKGVEEY  710
              N           N  GLALGPPQ  +S +  + SS V Q NLN  EDWSN R++G E++
Sbjct  480   GNLHHTQSTIHNQNMNGLALGPPQPSTSGYQNINSSTVHQANLNHLEDWSNPRERGPEDF  539

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGG---HASVNIPEDGFGFTPFMAPSPSFGYDE  539
              SEEEIRLRSHEMLE+EDMQ  LRLFSMGG    ++ ++PEDG+ F  F+  +P  GYDE
Sbjct  540   FSEEEIRLRSHEMLESEDMQQFLRLFSMGGGGNGSATHLPEDGYTFPSFLH-TPMQGYDE  598

Query  538   DRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             DR R G+AVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  599   DRGRSGRAVVGWLKIKAAMRWGFFIRRKAAERRAQ  633



>ref|XP_006281432.1| hypothetical protein CARUB_v10027506mg [Capsella rubella]
 gb|EOA14330.1| hypothetical protein CARUB_v10027506mg [Capsella rubella]
Length=651

 Score =   227 bits (578),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 134/282 (48%), Positives = 175/282 (62%), Gaps = 24/282 (9%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSN----SLNNQLQQP  1061
             KVYVD LVKKAYENW    EYDGK+L+  K     N L + Q D +N    ++++ +Q  
Sbjct  365   KVYVDGLVKKAYENWNLVIEYDGKSLIELKQP---NRLSITQNDLANYSTAAIDHPMQMT  421

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYE-------NTQFA  902
                + + +  S +     I G  Y++ +  RY +Q  +++S+ R Q+E         QF 
Sbjct  422   GHSSSIPANQSPVLSDFAIAG--YDQPLATRYHSQPQLLNSNPRAQFEVASCSNPRAQFD  479

Query  901   PndqqqlmnnsqqmqNARYDNNVGLALGPPQSSC--FPTV-GSSVQQTNLNSFEDWSNTR  731
                     +      +   + N GLALGPPQSS   +  +  SSV Q NLN  EDWSN R
Sbjct  480   VASCSTTQDQLMGNLHQTQNMN-GLALGPPQSSTSGYQNINSSSVHQANLNHLEDWSNHR  538

Query  730   DKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG---HASVNIPEDGFGFTPFMAPS  560
             ++G E++ SEEEIRLRSHEMLE+EDMQ  LRLFSMGG    ++ ++PEDG+ F  F+  +
Sbjct  539   ERGPEDFFSEEEIRLRSHEMLESEDMQQFLRLFSMGGGGNGSATHLPEDGYTFPSFLH-T  597

Query  559   PSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             P  GYDEDR R G+AVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  598   PMQGYDEDRGRSGRAVVGWLKIKAAMRWGFFIRRKAAERRAQ  639



>ref|XP_009388351.1| PREDICTED: uncharacterized protein LOC103975166 [Musa acuminata 
subsp. malaccensis]
Length=327

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 126/269 (47%), Positives = 168/269 (62%), Gaps = 17/269 (6%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             KV+ D LVKKAY+NW+   EYDGK LL+F  KK          D SN  +++  Q  L A
Sbjct  63    KVFADVLVKKAYDNWMHVIEYDGKALLNFTKKKK------ALSDSSN--DHEESQVNLQA  114

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  869
                 E   +D G     + Y+ N G  YS+    + S + MQYE+  F P ++       
Sbjct  115   SFPLEHPLVDMGGSTITAVYSGNEGVTYSSSLPNVVSDTNMQYESACFTPQNEAIGSAQQ  174

Query  868   qqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRD-KGVEEYLSEE  698
               +     +++  LAL  PQ +   F     S++ + LN ++DWS  +D + ++++ SEE
Sbjct  175   SLITR---NDSTSLALALPQQTSIGFQPSSHSMEHSGLNIYDDWSGQQDSRCMDDFFSEE  231

Query  697   EIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGYDEDRPRP-  524
             EIRLRSHEMLENEDMQHLLR F+MGG ASV +PEDG+GF P+M +P P+F +D++R R  
Sbjct  232   EIRLRSHEMLENEDMQHLLRTFTMGG-ASVGLPEDGYGFPPYMPSPCPNFNFDDERNRSS  290

Query  523   GKAVVGWLKIKAAMRWGFFIRKKAAERRA  437
             GKAVVGWLKIKAAMRWG F+RKKAAERRA
Sbjct  291   GKAVVGWLKIKAAMRWGIFVRKKAAERRA  319



>ref|XP_010452498.1| PREDICTED: uncharacterized protein LOC104734591 [Camelina sativa]
 ref|XP_010452506.1| PREDICTED: uncharacterized protein LOC104734591 [Camelina sativa]
Length=659

 Score =   224 bits (570),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 140/288 (49%), Positives = 177/288 (61%), Gaps = 29/288 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQP-RLP  1052
             KVYV+ LVKKAYENW    EY GK+LL  K     N L + Q D +N     L  P ++ 
Sbjct  366   KVYVEGLVKKAYENWTQVIEYGGKSLLDLKQP---NRLSITQTDLANYSTAALDHPIQMT  422

Query  1051  APVQSEPSALDPGM---LIGGSSYNENMGARYSNQSHIMSSSSRMQYE-------NTQF-  905
                 S P+   P +    IGG  Y++++  RY +Q  +++S+ R Q++         QF 
Sbjct  423   GHSSSMPANQSPVLSDFAIGG--YDQSLATRYHSQPQLLNSNPRAQFDIASCSNPRAQFD  480

Query  904   ----APndqqqlmnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGS-SVQQTNLNSFED  746
                 +    Q L N  Q        N  GLALGPPQSS   +  + S SV Q NLN  ED
Sbjct  481   VASCSTTQDQLLGNLHQTQSTINSQNMNGLALGPPQSSTNGYQNINSASVHQANLNHLED  540

Query  745   WSNTRDK-GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH---ASVNIPEDGFGFT  578
             WSN+R++ G E++ SEEEIRLRSHEMLE+EDMQ  LRLFSMGG    ++ ++PEDG+ F 
Sbjct  541   WSNSRERVGPEDFFSEEEIRLRSHEMLESEDMQQFLRLFSMGGGGNGSATHLPEDGYTFP  600

Query  577   PFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              F+  +P  GYDEDR R G+AVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  601   SFLH-TPMQGYDEDRGRSGRAVVGWLKIKAAMRWGFFIRRKAAERRAQ  647



>emb|CAB71126.1| calmodulin-binding protein [Cicer arietinum]
Length=282

 Score =   213 bits (541),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 127/278 (46%), Positives = 178/278 (64%), Gaps = 32/278 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYS--NSLNNQLQ  1067
             KVYVD+LVKKAYENW+   EYDGK+LL++   +    ++ ++P+G  DYS  NSL+ Q+ 
Sbjct  17    KVYVDTLVKKAYENWMHVIEYDGKSLLNYNQNRNLGMSQPQVPVGSHDYSISNSLDQQIS  76

Query  1066  QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqq  887
              P LP PV +   ++DP   +GG  Y+      +S Q H  + +S +Q+ NT F   +  
Sbjct  77    IPSLPVPVPTGQPSMDPSATVGG--YHHGTTTGFSIQPHNSNLNSSIQFGNTAFPLQNLL  134

Query  886   qlmnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEE  713
                ++  Q+      N+  L+LGPPQS+   F TVG              S+   +G E+
Sbjct  135   TSASHQSQLPT----NDNELSLGPPQSATPGFQTVG-------------ISDPTYRGFED  177

Query  712   YLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGF-TPFM-APSPSFGY  545
             +  EE+IR+RSHEMLENEDMQHLLR+F+MGG  H+S N PEDG+ + +P+M A S ++  
Sbjct  178   FFPEEDIRMRSHEMLENEDMQHLLRIFNMGGQSHSSFNAPEDGYPYSSPYMPATSINYNM  237

Query  544   DEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             D++R R  GKAVVGWLK+KAA+RWG F+RKKAAERRA+
Sbjct  238   DDERNRSSGKAVVGWLKLKAALRWGIFVRKKAAERRAR  275



>ref|XP_010646160.1| PREDICTED: uncharacterized protein LOC100256775 [Vitis vinifera]
Length=631

 Score =   221 bits (564),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 132/276 (48%), Positives = 180/276 (65%), Gaps = 31/276 (11%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQP  1061
             KV+VD+LVKKAY+NW+S  EYDGK+LL+F   K+    + E+ MG  DY NS ++QL  P
Sbjct  369   KVFVDTLVKKAYDNWISVVEYDGKSLLNFNQSKSSGSSQTEVAMGPQDYPNSFDHQLTLP  428

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LP  V  +  ++ P + +GG  YN+NM  RY  QS  ++ ++ MQ++ T F P   Q +
Sbjct  429   SLPVSVPPQQPSVGPSITVGG--YNDNMPTRYPIQSQNVNLNAPMQFDGTSF-PLQNQLI  485

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
              N  Q    +   N   LALGPP ++   F +VG+S    NLN            V+++ 
Sbjct  486   GNPHQVQLPS---NESMLALGPPPATTPGFQSVGTS----NLN----------YRVDDFF  528

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMG--GHASVNIPEDGFGFTPFMAPSPS--FGYDE  539
              E+EIR+RSHEMLEN+DMQHLLR+F+MG  GHAS N+ +DG+ ++    P+ S  +G+DE
Sbjct  529   PEDEIRMRSHEMLENDDMQHLLRIFNMGNHGHASANVTDDGYPYSSAYMPTSSTGYGFDE  588

Query  538   DRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             DR R  GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  589   DRSRSSGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  624



>ref|XP_010483282.1| PREDICTED: uncharacterized protein LOC104761843 [Camelina sativa]
 ref|XP_010483283.1| PREDICTED: uncharacterized protein LOC104761843 [Camelina sativa]
 ref|XP_010483284.1| PREDICTED: uncharacterized protein LOC104761843 [Camelina sativa]
 ref|XP_010483285.1| PREDICTED: uncharacterized protein LOC104761843 [Camelina sativa]
 ref|XP_010483286.1| PREDICTED: uncharacterized protein LOC104761843 [Camelina sativa]
 ref|XP_010483287.1| PREDICTED: uncharacterized protein LOC104761843 [Camelina sativa]
Length=659

 Score =   222 bits (565),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 137/288 (48%), Positives = 174/288 (60%), Gaps = 29/288 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQP-RLP  1052
             KVYVD LVK+AYENW    EYDGK++L  K     N L + Q D +N     +  P ++ 
Sbjct  366   KVYVDGLVKRAYENWTQVIEYDGKSILDLKQP---NRLSITQTDLANYSTAPIDHPIQMV  422

Query  1051  APVQSEPSALDPGM---LIGGSSYNENMGARYSNQSHIM------------SSSSRMQYE  917
                 S P+   P +    IGG  Y++++  RY +Q  ++             S+ R Q++
Sbjct  423   GHSSSMPANQSPVLSDFAIGG--YDQSLATRYHSQPQLLNSNPRAHFDVAACSNPRAQFD  480

Query  916   NTQFAPndqqqlmnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGS-SVQQTNLNSFED  746
                 +    Q L N  Q        N  GLALGPPQSS   +  + S SV Q NLN  ED
Sbjct  481   VASCSTTQDQLLGNLHQSQSTINSQNMNGLALGPPQSSTNGYQNINSASVHQANLNHLED  540

Query  745   WSNTRDKGV-EEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH---ASVNIPEDGFGFT  578
             WSN R++G  E++ SEEEIRLRSHEMLE+EDMQ  LRLFSMGG    ++ ++PEDG+ F 
Sbjct  541   WSNPRERGGPEDFFSEEEIRLRSHEMLESEDMQQFLRLFSMGGGGNGSATHLPEDGYTFP  600

Query  577   PFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              F+  +P  GYDEDR R G+AVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  601   SFLH-TPMQGYDEDRGRSGRAVVGWLKIKAAMRWGFFIRRKAAERRAQ  647



>emb|CAN66517.1| hypothetical protein VITISV_001611 [Vitis vinifera]
Length=637

 Score =   221 bits (564),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 132/276 (48%), Positives = 180/276 (65%), Gaps = 31/276 (11%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQP  1061
             KV+VD+LVKKAY+NW+S  EYDGK+LL+F   K+    + E+ MG  DY NS ++QL  P
Sbjct  369   KVFVDTLVKKAYDNWISVVEYDGKSLLNFNQSKSSGSSQTEVAMGPQDYPNSFDHQLTLP  428

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LP  V  +  ++ P + +GG  YN+NM  RY  QS  ++ ++ MQ++ T F P   Q +
Sbjct  429   SLPVSVPPQQPSVGPSITVGG--YNDNMPTRYPIQSQNVNLNAPMQFDGTSF-PLQNQLI  485

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
              N  Q    +   N   LALGPP ++   F +VG+S    NLN            V+++ 
Sbjct  486   GNPHQVQLPS---NESMLALGPPPATTPGFQSVGTS----NLN----------YRVDDFF  528

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMG--GHASVNIPEDGFGFTPFMAPSPS--FGYDE  539
              E+EIR+RSHEMLEN+DMQHLLR+F+MG  GHAS N+ +DG+ ++    P+ S  +G+DE
Sbjct  529   PEDEIRMRSHEMLENDDMQHLLRIFNMGNHGHASANVTDDGYPYSSAYMPTSSTGYGFDE  588

Query  538   DRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             DR R  GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  589   DRSRSSGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  624



>emb|CBI23322.3| unnamed protein product [Vitis vinifera]
Length=636

 Score =   221 bits (564),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 132/276 (48%), Positives = 180/276 (65%), Gaps = 31/276 (11%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQP  1061
             KV+VD+LVKKAY+NW+S  EYDGK+LL+F   K+    + E+ MG  DY NS ++QL  P
Sbjct  369   KVFVDTLVKKAYDNWISVVEYDGKSLLNFNQSKSSGSSQTEVAMGPQDYPNSFDHQLTLP  428

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LP  V  +  ++ P + +GG  YN+NM  RY  QS  ++ ++ MQ++ T F P   Q +
Sbjct  429   SLPVSVPPQQPSVGPSITVGG--YNDNMPTRYPIQSQNVNLNAPMQFDGTSF-PLQNQLI  485

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
              N  Q    +   N   LALGPP ++   F +VG+S    NLN            V+++ 
Sbjct  486   GNPHQVQLPS---NESMLALGPPPATTPGFQSVGTS----NLNY----------RVDDFF  528

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMG--GHASVNIPEDGFGFTPFMAPSPS--FGYDE  539
              E+EIR+RSHEMLEN+DMQHLLR+F+MG  GHAS N+ +DG+ ++    P+ S  +G+DE
Sbjct  529   PEDEIRMRSHEMLENDDMQHLLRIFNMGNHGHASANVTDDGYPYSSAYMPTSSTGYGFDE  588

Query  538   DRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             DR R  GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  589   DRSRSSGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  624



>emb|CDY69506.1| BnaCnng63910D [Brassica napus]
Length=654

 Score =   221 bits (562),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 135/276 (49%), Positives = 171/276 (62%), Gaps = 14/276 (5%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNS-LNNQLQQPRLP  1052
             KVYVD LVKKAY+NW    EYDGK+L+  K  +        + +YS + +N+ +Q     
Sbjct  372   KVYVDGLVKKAYDNWNLVIEYDGKSLIDMKQPQRSGITQADEANYSTAAINHPMQMAGHS  431

Query  1051  APVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnn  872
             + V +    +     IGG  Y++ M  RY     ++ S+ R Q+E    A    Q + N 
Sbjct  432   SSVPANQPPVLSDFAIGG--YDQTMATRYPLHPQLVVSNPRAQFEVASGATTQDQLMGNL  489

Query  871   sqqmqNARYDNNVG-LALGPPQSSC--FPTV-GSSVQQTNLNSFEDWSNTRDKGVEEYLS  704
              Q   +    N  G LALGPPQ+S   +  +  SSVQQ NLN FEDWSN R++G EE+ S
Sbjct  490   HQGQSSMNNQNMNGMLALGPPQASTSGYQNINSSSVQQANLNPFEDWSNHRERGAEEFFS  549

Query  703   EEEIRLRSHEMLENEDMQHLLRLFSM------GGHASVNIPEDGFGFTPFMAPSPSFGYD  542
             EEEIRLRSHEMLENEDMQ  LRLFSM      G  ++ ++ EDG+ F  F+  +P  GYD
Sbjct  550   EEEIRLRSHEMLENEDMQQFLRLFSMGGGGGGGNGSASHLQEDGYTFPSFLH-TPMQGYD  608

Query  541   EDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             EDR R G+AVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  609   EDRGRSGRAVVGWLKIKAAMRWGFFIRRKAAERRAQ  644



>ref|XP_009589610.1| PREDICTED: uncharacterized protein LOC104086953 [Nicotiana tomentosiformis]
Length=619

 Score =   219 bits (559),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 128/273 (47%), Positives = 174/273 (64%), Gaps = 29/273 (11%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVD+LVKKAYENW+   EYDGK+LLS    K    ++N+L +G  ++S S + Q+  P
Sbjct  361   KVYVDTLVKKAYENWMHVVEYDGKSLLSLGQNKPSVTSQNDLTIGSQNHSTSFDQQINLP  420

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LPA + SE  A++ G+ +GG  YN+++ +RY+ Q H+   +  MQ     F P +    
Sbjct  421   SLPASISSEQPAMNTGLNMGG--YNDSLSSRYTMQPHL---NGNMQVNGASFPPQNHLLG  475

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  701
              +   Q     + +   LAL PPQ    P++ S    +  N +        +G E++L+E
Sbjct  476   TSQQAQP----HGSESMLALRPPQ----PSMSSYFAASTPNPY--------RGAEDFLTE  519

Query  700   EEIRLRSHEMLENEDMQHLLRLFSMG-GHASVNIPEDGFGFTPFMAP--SPSFGYDEDRP  530
             EEIR+RSHEMLENEDMQHLLR+FSMG GHAS ++ E+ + +     P  S +FG+DEDR 
Sbjct  520   EEIRMRSHEMLENEDMQHLLRIFSMGQGHASSSVGEENYQYGSSYMPNMSSTFGFDEDRT  579

Query  529   R-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  580   RSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  612



>ref|XP_010443447.1| PREDICTED: uncharacterized protein LOC104726314 [Camelina sativa]
 ref|XP_010443448.1| PREDICTED: uncharacterized protein LOC104726314 [Camelina sativa]
 ref|XP_010443449.1| PREDICTED: uncharacterized protein LOC104726314 [Camelina sativa]
Length=659

 Score =   220 bits (561),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 136/288 (47%), Positives = 174/288 (60%), Gaps = 29/288 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQP-RLP  1052
             KVYVD LVK+AYENW    EYDGK++L  K     N L + Q D +N     +  P ++ 
Sbjct  366   KVYVDGLVKRAYENWTQVIEYDGKSILDLKQP---NRLSITQTDLANYSTAPIDHPIQMV  422

Query  1051  APVQSEPSALDPGM---LIGGSSYNENMGARYSNQSHIM------------SSSSRMQYE  917
                 S P+   P +    IGG  Y++++  RY +Q  ++             S+ R Q++
Sbjct  423   GHSSSMPANQSPVLSDFAIGG--YDQSLATRYHSQPQLLNSNPRAHFDVAACSNPRAQFD  480

Query  916   NTQFAPndqqqlmnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGS-SVQQTNLNSFED  746
                 +    Q L N  Q        N  GLALGPPQSS   +  + S SV Q NLN  ED
Sbjct  481   VASCSTTQDQLLGNLHQTQSTINSQNMNGLALGPPQSSTNGYQNINSASVHQANLNHLED  540

Query  745   WSNTRDKGV-EEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH---ASVNIPEDGFGFT  578
             WSN R++G  E++ SEEEIRLRSHEMLE+EDMQ  LRLFSMGG    ++ ++PEDG+ F 
Sbjct  541   WSNPRERGGPEDFFSEEEIRLRSHEMLESEDMQQFLRLFSMGGGGNGSATHLPEDGYTFP  600

Query  577   PFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              F+  +P  GYDE+R R G+AVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  601   SFLH-TPMQGYDEERGRSGRAVVGWLKIKAAMRWGFFIRRKAAERRAQ  647



>ref|XP_009120276.1| PREDICTED: uncharacterized protein LOC103845193 [Brassica rapa]
Length=654

 Score =   220 bits (560),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 139/279 (50%), Positives = 170/279 (61%), Gaps = 20/279 (7%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             KVYVD LVKKAY+NW    EYDGK+L+  K  +    L + Q D +N     +  P   A
Sbjct  372   KVYVDGLVKKAYDNWNLVIEYDGKSLIDMKQPQ---RLGITQADEANYSTAAINHPMQMA  428

Query  1048  PVQSEPSALDPGML----IGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
                S   A  P +L    IGG  Y++ M  RY     ++ S+ R Q+E         Q +
Sbjct  429   GQSSSVPANQPPVLSDFAIGG--YDQTMATRYPPYPQLLVSNPRAQFEVASGGTAQDQLM  486

Query  880   mnnsqqmqNARYDNNVG-LALGPPQSSC--FPTV-GSSVQQTNLNSFEDWSNTRDKGVEE  713
              N  Q   +    N  G LALGPPQ+S   +  +  SSVQQ NLN FEDWSN R++G EE
Sbjct  487   GNLHQGQSSMNNQNMNGMLALGPPQASTSGYQNINSSSVQQANLNPFEDWSNHRERGAEE  546

Query  712   YLSEEEIRLRSHEMLENEDMQHLLRLFSM------GGHASVNIPEDGFGFTPFMAPSPSF  551
             + SEEEIRLRSHEMLENEDMQ  LRLFSM      G  ++ ++ EDG+ F  F+  +P  
Sbjct  547   FFSEEEIRLRSHEMLENEDMQQFLRLFSMGGGGGGGNGSASHLQEDGYTFPSFLH-TPMQ  605

Query  550   GYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             GYDEDR R G+AVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  606   GYDEDRGRSGRAVVGWLKIKAAMRWGFFIRRKAAERRAQ  644



>ref|XP_004952753.1| PREDICTED: uncharacterized protein LOC101756263 isoform X1 [Setaria 
italica]
 ref|XP_004952754.1| PREDICTED: uncharacterized protein LOC101756263 isoform X2 [Setaria 
italica]
Length=649

 Score =   219 bits (559),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 134/280 (48%), Positives = 178/280 (64%), Gaps = 21/280 (8%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVY D+LVKKAYE+W+   EYDGK LLSFK KK     R++          S      Q 
Sbjct  370   KVYADALVKKAYEDWMHAVEYDGKALLSFKQKKKSITTRSDTAAASTSNPASYGLASSQK  429

Query  1060  RLPAPVQS-EPSALDPGMLIGG--SSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndq  890
             +LP P +S +PS+        G  S+YN N  ARY++ +  + ++  MQ++ +  +P  Q
Sbjct  430   QLPLPTKSGQPSSAGTTNEADGTRSAYNGNQSARYTSNTQNIPANITMQFDRSALSPESQ  489

Query  889   qqlmnnsqqmqNARYDNNVGLALGPPQ----SSCFPTVGSSVQQTNLNSFEDWSNTRDK-  725
                 +   Q   A   +N+ LALGPPQ    S  FP +G S+Q T +N F++WS  ++  
Sbjct  490   FNGSSLQAQ---ASRGSNM-LALGPPQQQQQSFEFPALGQSMQPTGMNPFDEWSQPQENR  545

Query  724   -GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSF  551
              GV++YL EE IR+RSHE+LENE+MQ +LR+ SMGG A  N+ EDGF F  +M APSP+ 
Sbjct  546   GGVDDYLMEE-IRMRSHEILENEEMQQMLRILSMGG-AGTNLTEDGFNFPSYMPAPSPNL  603

Query  550   GYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              +++DR R PGKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  604   NFEDDRTRTPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  643



>emb|CDY49721.1| BnaA10g11510D [Brassica napus]
Length=654

 Score =   219 bits (559),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 139/279 (50%), Positives = 170/279 (61%), Gaps = 20/279 (7%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             KVYVD LVKKAY+NW    EYDGK+L+  K  +    L + Q D +N     +  P   A
Sbjct  372   KVYVDGLVKKAYDNWNLVIEYDGKSLIDMKQPQ---RLGITQADEANYSTAAINHPMQMA  428

Query  1048  PVQSEPSALDPGML----IGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
                S   A  P +L    IGG  Y++ M  RY     ++ S+ R Q+E         Q +
Sbjct  429   GQSSSVPANQPPVLSDFAIGG--YDQTMATRYPPYPQLLVSNPRAQFEVASGGTAQDQLM  486

Query  880   mnnsqqmqNARYDNNVG-LALGPPQSSC--FPTV-GSSVQQTNLNSFEDWSNTRDKGVEE  713
              N  Q   +    N  G LALGPPQ+S   +  +  SSVQQ NLN FEDWSN R++G EE
Sbjct  487   GNLHQGQSSMNNQNMNGMLALGPPQASTSGYQNINSSSVQQANLNPFEDWSNHRERGAEE  546

Query  712   YLSEEEIRLRSHEMLENEDMQHLLRLFSM------GGHASVNIPEDGFGFTPFMAPSPSF  551
             + SEEEIRLRSHEMLENEDMQ  LRLFSM      G  ++ ++ EDG+ F  F+  +P  
Sbjct  547   FFSEEEIRLRSHEMLENEDMQQFLRLFSMGGGGGGGNGSASHLQEDGYTFPSFLH-TPLQ  605

Query  550   GYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             GYDEDR R G+AVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  606   GYDEDRGRSGRAVVGWLKIKAAMRWGFFIRRKAAERRAQ  644



>ref|XP_004952755.1| PREDICTED: uncharacterized protein LOC101756263 isoform X3 [Setaria 
italica]
Length=648

 Score =   219 bits (558),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 134/279 (48%), Positives = 178/279 (64%), Gaps = 20/279 (7%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVY D+LVKKAYE+W+   EYDGK LLSFK KK     R++          S      Q 
Sbjct  370   KVYADALVKKAYEDWMHAVEYDGKALLSFKQKKKSITTRSDTAAASTSNPASYGLASSQK  429

Query  1060  RLPAPVQS-EPSALDPGMLIGG-SSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqq  887
             +LP P +S +PS+       G  S+YN N  ARY++ +  + ++  MQ++ +  +P  Q 
Sbjct  430   QLPLPTKSGQPSSAGTTNEDGTRSAYNGNQSARYTSNTQNIPANITMQFDRSALSPESQF  489

Query  886   qlmnnsqqmqNARYDNNVGLALGPPQ----SSCFPTVGSSVQQTNLNSFEDWSNTRDK--  725
                +   Q   A   +N+ LALGPPQ    S  FP +G S+Q T +N F++WS  ++   
Sbjct  490   NGSSLQAQ---ASRGSNM-LALGPPQQQQQSFEFPALGQSMQPTGMNPFDEWSQPQENRG  545

Query  724   GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFG  548
             GV++YL EE IR+RSHE+LENE+MQ +LR+ SMGG A  N+ EDGF F  +M APSP+  
Sbjct  546   GVDDYLMEE-IRMRSHEILENEEMQQMLRILSMGG-AGTNLTEDGFNFPSYMPAPSPNLN  603

Query  547   YDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +++DR R PGKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  604   FEDDRTRTPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  642



>gb|ABK95891.1| unknown [Populus trichocarpa]
Length=326

 Score =   211 bits (537),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 131/275 (48%), Positives = 176/275 (64%), Gaps = 28/275 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVDSLVKKAY+NW+   EYDGK+LL FK  +    ++N++P  Q ++ NS ++Q+  P
Sbjct  63    KVYVDSLVKKAYDNWMHVIEYDGKSLLDFKQNQGIVASQNDVPSSQQEFLNSYDHQVTLP  122

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              +  PV SE   +D G ++ G  YN +M AR+S  S   + ++  Q++    A    Q  
Sbjct  123   IMSVPVPSEQPVMDSGPIVAG--YNNDMAARFSIHSQNGNLNTPFQFDA---ASITLQNP  177

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
             M N+ Q       +N+ LAL PPQSS   F + G+     NLNS+         G E+Y 
Sbjct  178   MVNTSQQIQVPGTDNL-LALAPPQSSMSGFQSFGT----LNLNSY--------GGTEDYF  224

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGGH--ASVNIPEDGFGFTPFM-APSPSFGYDED  536
             SEEEIR RSHEMLENEDMQ+LLR F MGG   +S N+ EDG+ ++ +M  PSPS+ +++D
Sbjct  225   SEEEIRTRSHEMLENEDMQNLLRGFHMGGQGPSSFNVTEDGYPYSSYMPCPSPSYCFEDD  284

Query  535   RPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
               R  GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  285   PSRSSGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  319



>ref|XP_009794879.1| PREDICTED: uncharacterized protein LOC104241635 [Nicotiana sylvestris]
Length=621

 Score =   218 bits (556),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 131/274 (48%), Positives = 173/274 (63%), Gaps = 29/274 (11%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVD+LVKKAY+NW+   EYDGK+LLS    K    ++N+L +G  ++S S + Q+  P
Sbjct  361   KVYVDTLVKKAYDNWMHVVEYDGKSLLSLGQNKTSVASQNDLTIGSQNHSTSFDQQINLP  420

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LPA + SE  A++ G+ +GG  YNE++ +RY+ Q   M+ +  MQ     F P +    
Sbjct  421   SLPASISSEQPAMNTGLNMGG--YNESLSSRYTMQPQHMNLNGSMQLNGASFPPQNHLLG  478

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  701
              +   Q     + +   LAL PPQ    P++ S    +  N +        KG E++L+E
Sbjct  479   TSQQAQP----HGSESMLALRPPQ----PSMSSYFAASTPNPY--------KGAEDFLTE  522

Query  700   EEIRLRSHEMLENEDMQHLLRLFSMG-GHASVNIPED---GFGFTPFMAPSPSFGYDEDR  533
             EEIR+RSHEMLENEDMQHLLR+FSMG GHAS    E+   G  + P M  S +FG+DEDR
Sbjct  523   EEIRMRSHEMLENEDMQHLLRIFSMGQGHASSRGEENYQYGSSYMPNM--SSTFGFDEDR  580

Query  532   PR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  581   TRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  614



>ref|XP_010092630.1| hypothetical protein L484_006392 [Morus notabilis]
 gb|EXB51819.1| hypothetical protein L484_006392 [Morus notabilis]
Length=650

 Score =   218 bits (556),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 132/274 (48%), Positives = 175/274 (64%), Gaps = 29/274 (11%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFK--NKKARNEL--PMGQVDYSNSLNNQLQQP  1061
             KVYVD+LVKKAY+NW+   EYDGK+LLS +  N    +E+  P+   DYSNS + Q   P
Sbjct  390   KVYVDTLVKKAYDNWMHVIEYDGKSLLSSQSHNSSCASEMITPIASQDYSNSFDQQFTLP  449

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LP  V SE   +DPG+    + YN+ M   +S  S   + ++ + +  + FA  +Q   
Sbjct  450   ALPVAVPSEQPTIDPGL----TGYNDGMATSFSIPSQNANLNAPVSFVGSSFALQNQLPS  505

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
              +N  Q+Q +    NV L LGPPQSS   F  VG+S    NL SF        +GV+++ 
Sbjct  506   TSNQTQLQRSE---NV-LTLGPPQSSTSGFQNVGAS----NLTSF--------RGVDDFF  549

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGGHASV-NIPEDGFGFTPFMAPSPSFGY--DED  536
             SEEEIR+RSHEMLENEDMQHLL +F+MGGH  V N+ EDG+ ++    P+ S  Y  ++D
Sbjct  550   SEEEIRMRSHEMLENEDMQHLLHIFNMGGHGHVPNVVEDGYPYSSGYMPNTSLNYNLNDD  609

Query  535   RPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             R R GKAVVGWLK+KAA+RWG F+RK+AAERRAQ
Sbjct  610   RTRSGKAVVGWLKLKAALRWGIFVRKRAAERRAQ  643



>ref|NP_200566.1| Calmodulin-binding protein [Arabidopsis thaliana]
 dbj|BAB08793.1| calmodulin-binding protein [Arabidopsis thaliana]
 gb|AAL07138.1| putative calmodulin-binding protein [Arabidopsis thaliana]
 gb|AAM14373.1| putative calmodulin-binding protein [Arabidopsis thaliana]
 gb|AED96923.1| Calmodulin-binding protein [Arabidopsis thaliana]
Length=647

 Score =   216 bits (551),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 130/278 (47%), Positives = 169/278 (61%), Gaps = 21/278 (8%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             KVYV+ LVKKAYENW    EYDGK+LL  K  +    L +   +  N     +  P    
Sbjct  366   KVYVEGLVKKAYENWNLVIEYDGKSLLDLKQPQ---RLSITHTNLENYSTAAIDHPM--Q  420

Query  1048  PVQSEPSALDPG-------MLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndq  890
              V    S++ P          IGG  Y++ +  RY +   +++S+ R Q+E    + +  
Sbjct  421   MVAGHSSSMPPNQSPVLSDFAIGG--YDQTLATRYHSHPQLLNSNPRAQFEVASCSTSQD  478

Query  889   qqlmnnsqqmqNARYDNNVGLALGPPQSSC--FPTVG-SSVQQTNLNSFEDWSNTRDKGV  719
             Q + N  Q        +  GLALGP QSS   +  +  SSV Q +LN  EDWSN R++G 
Sbjct  479   QFMGNLHQTQSTINNQHMNGLALGPSQSSTSGYQNINPSSVHQADLNHLEDWSNPRERGP  538

Query  718   EEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG---HASVNIPEDGFGFTPFMAPSPSFG  548
             +++ SEEEIRLRSHEMLE+EDMQ  LRLFSMGG    ++ ++PEDG+ F  F+  +P  G
Sbjct  539   DDFFSEEEIRLRSHEMLESEDMQQFLRLFSMGGGGNGSATHLPEDGYTFPSFLH-TPMQG  597

Query  547   YDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             YDEDR R G+AVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  598   YDEDRGRSGRAVVGWLKIKAAMRWGFFIRRKAAERRAQ  635



>ref|XP_011043288.1| PREDICTED: uncharacterized protein LOC105138780 isoform X1 [Populus 
euphratica]
Length=637

 Score =   216 bits (549),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 131/274 (48%), Positives = 175/274 (64%), Gaps = 27/274 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVDSLVKKAY+NW+   EYDGK+LL FK+ +    ++N++P  Q ++ NS ++Q+  P
Sbjct  375   KVYVDSLVKKAYDNWMHVVEYDGKSLLDFKHNQGIVASQNDVPSSQQEFLNSYDHQVTLP  434

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              +  PV SE   +D G + GG  YN +M AR+S  S   + ++  Q++ T     +    
Sbjct  435   IMSVPVPSEQPVMDSGPIAGG--YNNDMAARFSIHSQNGNLNTPFQFDATSITLQNPMVS  492

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
              +   Q+     DN   LALGPPQSS   F + G+     NLNS+         G E+Y 
Sbjct  493   TSQQIQVPGT--DNL--LALGPPQSSMSGFQSFGT----LNLNSY--------GGTEDYF  536

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGGHA-SVNIPEDGFGFTPFM-APSPSFGYDEDR  533
             SEEEIR RSHEMLENEDMQ+LLR F+MGG   S N+ EDG+ ++ +M  PSPS+ + +D 
Sbjct  537   SEEEIRTRSHEMLENEDMQNLLRGFNMGGQGPSFNVTEDGYPYSSYMPCPSPSYCFGDDP  596

Query  532   PRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              R  GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  597   SRSSGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  630



>ref|XP_009398635.1| PREDICTED: uncharacterized protein LOC103983171 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009398636.1| PREDICTED: uncharacterized protein LOC103983171 [Musa acuminata 
subsp. malaccensis]
Length=655

 Score =   214 bits (545),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 175/277 (63%), Gaps = 17/277 (6%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSF-KNKKA---RNELPMGQVDYSNSLNNQLQQP  1061
             KV+ D+LVKKAY+NW+   EYDG+ LL+F KNKKA   + E  +   +Y +S + Q+ Q 
Sbjct  375   KVFADALVKKAYDNWMQVIEYDGRALLNFTKNKKAPAAQKESLLASSNYPSSYDQQVSQM  434

Query  1060  RLPAPVQSEPSALDPGMLIGGSS----YNENMGARYSNQSHIMSSSSRMQYENTQFAPnd  893
                A   S   + + G   GG +    Y+    ARY N +  + S + +  E+T   P +
Sbjct  435   HSQASASSTELSAEMGNTTGGGTISAGYSGTQSARYPNLTQHVDSDAHISTESTSSTPQN  494

Query  892   qqqlmnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRD-KG  722
             Q     +  Q       +   LA  PPQ +     ++G +VQQ +L++++DWS  RD +G
Sbjct  495   QLVGSTHQTQFTRT---DGTSLAPAPPQQASMELQSLGHTVQQPDLSTYDDWSRQRDSRG  551

Query  721   VEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGY  545
             ++++ SE+EIRLRSHE+LE++DMQHLLR+F+MGG A   + +DG+ F  +M +P P+F +
Sbjct  552   IDDFFSEDEIRLRSHELLEHDDMQHLLRVFTMGG-APTGLHDDGYAFPSYMPSPCPAFNF  610

Query  544   DEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRA  437
             D+DR R  GKAVVGWLKIKAAMRWG F+RKKAAERRA
Sbjct  611   DDDRSRTSGKAVVGWLKIKAAMRWGIFVRKKAAERRA  647



>ref|XP_002316655.1| calmodulin-binding protein 60-C [Populus trichocarpa]
 gb|EEE97267.1| calmodulin-binding protein 60-C [Populus trichocarpa]
Length=637

 Score =   213 bits (542),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 129/275 (47%), Positives = 174/275 (63%), Gaps = 28/275 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVDSLVKKAY+NW+   EYDGK+LL FK  +    ++N++P  Q ++ NS ++Q+  P
Sbjct  374   KVYVDSLVKKAYDNWMHVIEYDGKSLLDFKQNQGIVASQNDVPSSQQEFLNSYDHQVTLP  433

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              +  PV SE   +D G ++GG  YN +M AR+S  S   + ++  Q++       +    
Sbjct  434   IMSVPVPSEQPVMDSGPIVGG--YNNDMAARFSIHSQNGNLNTPFQFDAASITLQNPMVN  491

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
              +   Q+     DN   LAL PPQSS   F + G+     NLNS+         G E+Y 
Sbjct  492   TSQQIQVPGT--DNL--LALAPPQSSMSGFQSFGT----LNLNSY--------GGTEDYF  535

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGGH--ASVNIPEDGFGFTPFM-APSPSFGYDED  536
             SEEEIR RSHEMLENEDMQ+LLR F MGG   +S N+ EDG+ ++ +M  PSPS+ +++D
Sbjct  536   SEEEIRTRSHEMLENEDMQNLLRGFHMGGQGPSSFNVTEDGYPYSSYMPCPSPSYCFEDD  595

Query  535   RPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
               R  GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  596   PSRSSGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  630



>ref|XP_006384008.1| hypothetical protein POPTR_0004s03510g [Populus trichocarpa]
 gb|ERP61805.1| hypothetical protein POPTR_0004s03510g [Populus trichocarpa]
Length=640

 Score =   213 bits (541),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 130/277 (47%), Positives = 174/277 (63%), Gaps = 31/277 (11%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQP  1061
             KVYVDSLVKKAY+NW+   EYDGK+LL FK  +     +NE+P  Q ++ NS ++Q+  P
Sbjct  376   KVYVDSLVKKAYDNWMHAIEYDGKSLLDFKMNQGIDALQNEVPSVQQEFLNSYDHQVTLP  435

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              +  PV SE   +D G+ +GG  YN++M  R+S      + ++  Q++ T     +    
Sbjct  436   TISVPVPSEQPVMDSGLAVGG--YNDDMATRFSMHPQNGNFNTSFQFDATSLPSQNPLVH  493

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
              +   Q+  +   +N+ LALG PQ+S   F + GSS    NLNS+        KG E++ 
Sbjct  494   TSQQIQVPGS---DNL-LALGRPQTSTPGFQSFGSS----NLNSY--------KGTEDFF  537

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGGH--ASVNIPEDGFGFT----PFMAPSPSFGY  545
             SEEEIR RSHEMLEN+DMQHLLR+F+MGG   +S N  EDG+ F+    P   P+ SFG 
Sbjct  538   SEEEIRTRSHEMLENDDMQHLLRIFNMGGQGLSSFNATEDGYPFSSTNMPTAPPNYSFGD  597

Query  544   DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             D  R   GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  598   DPSRS-SGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  633



>ref|XP_004485707.1| PREDICTED: uncharacterized protein LOC101498971 [Cicer arietinum]
Length=634

 Score =   212 bits (540),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 127/278 (46%), Positives = 178/278 (64%), Gaps = 32/278 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYS--NSLNNQLQ  1067
             KVYVD+LVKKAYENW+   EYDGK+LL++   +    ++ ++P+G  DYS  NSL+ Q+ 
Sbjct  369   KVYVDTLVKKAYENWMHVIEYDGKSLLNYNQNRNLGMSQPQVPVGSHDYSISNSLDQQIS  428

Query  1066  QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqq  887
              P LP PV +   ++DP   +GG  +    G  +S Q H  + +S +Q+ NT F   +  
Sbjct  429   IPSLPVPVPTGQPSMDPSATVGGYHHGTTTG--FSIQPHNSNLNSSIQFGNTAFPLQNLL  486

Query  886   qlmnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEE  713
                ++  Q+      N+  L+LGPPQS+   F TVG              S+   +G E+
Sbjct  487   TSASHQSQLPT----NDNELSLGPPQSATPGFQTVG-------------ISDPTYRGFED  529

Query  712   YLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGF-TPFM-APSPSFGY  545
             +  EE+IR+RSHEMLENEDMQHLLR+F+MGG  H+S N PEDG+ + +P+M A S ++  
Sbjct  530   FFPEEDIRMRSHEMLENEDMQHLLRIFNMGGQSHSSFNAPEDGYPYSSPYMPATSINYNM  589

Query  544   DEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             D++R R  GKAVVGWLK+KAA+RWG F+RKKAAERRA+
Sbjct  590   DDERNRSSGKAVVGWLKLKAALRWGIFVRKKAAERRAR  627



>ref|XP_008645829.1| PREDICTED: uncharacterized protein LOC103627307 isoform X2 [Zea 
mays]
Length=650

 Score =   212 bits (540),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 133/281 (47%), Positives = 173/281 (62%), Gaps = 22/281 (8%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVY D+LVKKAYE+W+   EYDGK LLSFK KK     R+++         S  +   Q 
Sbjct  370   KVYADALVKKAYEDWMQVVEYDGKALLSFKQKKKTVTTRSDVASASTSNPASYGSANSQK  429

Query  1060  RLPAPVQSEPSALDPGMLIGGS----SYNENMGARYSNQSHIMSSSSRMQYENTQFAPnd  893
             +L  P ++  ++    M   G+    + N N  ARY+  +  + ++  MQY+ +  +P  
Sbjct  430   QLSLPAKAGQTSSAGTMNEDGTRNAYNANGNQSARYAANTQSIPANVGMQYDGSAVSPEI  489

Query  892   qqqlmnnsqqmqNARYDNNVGLALGPPQ---SSCFPTVGSSVQQTNLNSFEDW---SNTR  731
             Q    +   Q       +N+ LALGPPQ   S  FP +G  VQ T LN FE+W      R
Sbjct  490   QFSGSSLQSQSSRG---SNM-LALGPPQQHQSFEFPALGQPVQPTGLNPFEEWPQQQENR  545

Query  730   DKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPS  554
               GV++YL EE IR+RSHE+LENE+MQ +LRL SMGG A  ++ EDGF F P+M APSP+
Sbjct  546   GGGVDDYLMEE-IRMRSHEILENEEMQQMLRLLSMGG-AGTSLAEDGFNFPPYMPAPSPN  603

Query  553   FGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
               Y++DR R PGKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  604   VSYEDDRTRAPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  644



>ref|XP_008678706.1| PREDICTED: uncharacterized protein LOC103653644 [Zea mays]
 gb|AFW62646.1| hypothetical protein ZEAMMB73_771415 [Zea mays]
Length=652

 Score =   212 bits (540),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 130/280 (46%), Positives = 174/280 (62%), Gaps = 21/280 (8%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             K Y D+LVKKAYE+W+   EYDGK LLSFK KK     R++  +   ++  S  + + Q 
Sbjct  373   KGYADALVKKAYEDWMQVVEYDGKALLSFKQKKKSVMTRSDAAVASTNHPASNGSAISQK  432

Query  1060  RLPAPVQSEPSALDPGMLIGGS----SYNENMGARYSNQSHIMSSSSRMQYENTQFAPnd  893
             +L  P ++  ++    M   G+    + N N  ARY+  +  + ++  MQY+ +  +P  
Sbjct  433   QLSLPAKAGQTSSAGIMNEDGTRNAYNANGNQSARYAATTQNIPANVAMQYDRSAVSPES  492

Query  892   qqqlmnnsqqmqNARYDNNVGLALGPPQ---SSCFPTVGSSVQQTNLNSFEDWSNTRDK-  725
             Q    +   Q   +R  N   LALGPPQ   S  FP +G S++ T LN FE+W   ++  
Sbjct  493   QFSGSSLQSQA--SRGSNT--LALGPPQQHQSFAFPALGQSMRPTGLNPFEEWPQQQENC  548

Query  724   -GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSF  551
              GV++YL EE IR+RSHE+LENE+MQ +LRL S GG A  N+ EDGF F  +M APSP  
Sbjct  549   GGVDDYLMEE-IRMRSHEILENEEMQQMLRLLSTGG-AGTNLTEDGFSFPSYMPAPSPKL  606

Query  550   GYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              Y++DR R PGKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  607   SYEDDRTRAPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  646



>gb|KDP20890.1| hypothetical protein JCGZ_21361 [Jatropha curcas]
Length=623

 Score =   211 bits (538),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 134/275 (49%), Positives = 172/275 (63%), Gaps = 27/275 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KV+VD LVKKAYENW+   EYDGKTLL FK  +    ++ ++P  Q DY NS ++Q+  P
Sbjct  359   KVHVDELVKKAYENWMHVIEYDGKTLLDFKENENIAASQIDIPTSQQDYLNSYDHQVTLP  418

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              +  PV  E  A+D G  +GG  YNE+M AR+S Q H  + +   Q++        Q  L
Sbjct  419   TISVPVPPEQPAMDSGPTVGG--YNESMAARFSMQPHTGNQNMPFQFDAASLP--LQNPL  474

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  701
              + SQQ Q  R DN    ALGPPQSS     G  V   NL S+        +G E++L E
Sbjct  475   GSTSQQAQLPRSDNIP--ALGPPQSSTSSFQG--VCAPNLTSY--------RGAEDFLQE  522

Query  700   EEIRLRSHEMLENEDMQHLLRLFSMGGHA--SVNIPEDGF----GFTPFMAPSPSFGYDE  539
             E+IR+RSHEMLE+EDMQHLLR+F+MGG    S N  EDG+     + P ++P+ S G D+
Sbjct  523   EDIRMRSHEMLESEDMQHLLRIFNMGGQGLNSFNTTEDGYPYSSAYMPALSPNYSVGDDQ  582

Query  538   DRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              R   GKAV+GWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  583   SR-SSGKAVLGWLKLKAALRWGIFIRKKAAERRAQ  616



>gb|AGT16661.1| hypothetical protein SHCRBa_107_F16_R_30 [Saccharum hybrid cultivar 
R570]
Length=649

 Score =   212 bits (539),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 134/281 (48%), Positives = 175/281 (62%), Gaps = 23/281 (8%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLN-------NQL  1070
             KVY D+LVKKAYE+W+   EYDGK LLSFK KK ++ +       +++ N       N  
Sbjct  370   KVYADALVKKAYEDWMQVVEYDGKALLSFKQKK-KSVMTRSDAAAASTSNPAPYGSANSQ  428

Query  1069  QQPRLPAPVQSEPSA--LDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPn  896
             +Q  LPA      SA  ++        + N N  ARY+  +  + ++  MQY+ +  +P 
Sbjct  429   KQLSLPAKAGQTSSAGTMNEDGTRNAYNGNGNQSARYAANTQNIPANVTMQYDRSAVSPE  488

Query  895   dqqqlmnnsqqmqNARYDNNVGLALGPPQ---SSCFPTVGSSVQQTNLNSFEDWSNTRDK  725
              Q    +   Q   A   +N+ LALGPPQ   S  FP +G S+Q T LN FE+W   ++ 
Sbjct  489   SQFSGSSLQSQ---ASRGSNM-LALGPPQQHQSFEFPALGQSMQPTGLNPFEEWPQQQEN  544

Query  724   --GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPS  554
               GV++YL EE IR+RSHE+LENE+MQ +LRL SMGG A  N+ EDGF F  +M APSP+
Sbjct  545   RGGVDDYLMEE-IRMRSHEILENEEMQQMLRLLSMGG-AGTNLTEDGFNFPSYMPAPSPN  602

Query  553   FGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
               Y++DR R PGKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  603   LSYEDDRTRAPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  643



>dbj|BAJ94992.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=653

 Score =   212 bits (539),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 129/277 (47%), Positives = 172/277 (62%), Gaps = 20/277 (7%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKAR-----NELPMGQVDYSNSLNNQLQQ  1064
             KVY D+LVKKAYE+W+   EYDGK LL FK KK       + +     + SN   N   Q
Sbjct  379   KVYADTLVKKAYEDWMHAVEYDGKALLGFKQKKRSVMTRSDTVSASTSNASNGFANT--Q  436

Query  1063  PRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  884
              +L +    + S   P      S+YN N  ARY+      +++  MQY+ +  +P  Q  
Sbjct  437   KQLLSGKAGQTSTGTPSEAGARSAYNGNQTARYTVSPQNNAANITMQYDRSALSPESQFS  496

Query  883   lmnnsqqmqNARYDNNVGLALGPPQSSC----FPTVGSSVQQTNLNSFEDWSNTRD-KGV  719
               +   Q       +N+ LAL PPQ       F  VG S+Q  NLN F+ WS+ ++ +GV
Sbjct  497   GSSLQTQTSGG---SNI-LALEPPQQQQQGFEFSAVGQSMQPANLNHFDQWSHPQENRGV  552

Query  718   EEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGYD  542
             ++YL EE IRLRSHE+LEN++MQ +LR+ +MGG AS N+ +DGF F P+M +PSP+F ++
Sbjct  553   DDYLMEE-IRLRSHEILENDEMQQMLRILNMGG-ASTNMTDDGFTFPPYMESPSPNFNFE  610

Query  541   EDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +DR R PGKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  611   DDRTRPPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  647



>ref|XP_012091499.1| PREDICTED: uncharacterized protein LOC105649465 isoform X2 [Jatropha 
curcas]
 ref|XP_012091500.1| PREDICTED: uncharacterized protein LOC105649465 isoform X2 [Jatropha 
curcas]
 ref|XP_012091501.1| PREDICTED: uncharacterized protein LOC105649465 isoform X2 [Jatropha 
curcas]
Length=634

 Score =   211 bits (538),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 134/275 (49%), Positives = 172/275 (63%), Gaps = 27/275 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KV+VD LVKKAYENW+   EYDGKTLL FK  +    ++ ++P  Q DY NS ++Q+  P
Sbjct  370   KVHVDELVKKAYENWMHVIEYDGKTLLDFKENENIAASQIDIPTSQQDYLNSYDHQVTLP  429

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              +  PV  E  A+D G  +GG  YNE+M AR+S Q H  + +   Q++        Q  L
Sbjct  430   TISVPVPPEQPAMDSGPTVGG--YNESMAARFSMQPHTGNQNMPFQFDAASLP--LQNPL  485

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  701
              + SQQ Q  R DN    ALGPPQSS     G  V   NL S+        +G E++L E
Sbjct  486   GSTSQQAQLPRSDNIP--ALGPPQSSTSSFQG--VCAPNLTSY--------RGAEDFLQE  533

Query  700   EEIRLRSHEMLENEDMQHLLRLFSMGGHA--SVNIPEDGF----GFTPFMAPSPSFGYDE  539
             E+IR+RSHEMLE+EDMQHLLR+F+MGG    S N  EDG+     + P ++P+ S G D+
Sbjct  534   EDIRMRSHEMLESEDMQHLLRIFNMGGQGLNSFNTTEDGYPYSSAYMPALSPNYSVGDDQ  593

Query  538   DRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              R   GKAV+GWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  594   SR-SSGKAVLGWLKLKAALRWGIFIRKKAAERRAQ  627



>ref|XP_011001128.1| PREDICTED: uncharacterized protein LOC105108501 [Populus euphratica]
Length=637

 Score =   211 bits (536),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 130/277 (47%), Positives = 171/277 (62%), Gaps = 31/277 (11%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQP  1061
             KVYVDSLVKKAY+NW+   EYDGK+LL FK  +     +NE+P  Q ++ NS ++Q+  P
Sbjct  373   KVYVDSLVKKAYDNWMHVIEYDGKSLLDFKMNQGIDALKNEVPSVQQEFLNSYDHQVTLP  432

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              +P PV SE   +D G+ +GG  YN++M  R+S      + ++  Q++ T     +    
Sbjct  433   TIPVPVPSEQPVMDSGLTVGG--YNDDMATRFSMHPQNGNLNTPFQFDATSLPSQNPMVH  490

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
              +   Q+  +  DN   LALGP Q+S   F + GSS     LN +        KG E++ 
Sbjct  491   TSQQIQVPGS--DNL--LALGPGQTSIPGFQSFGSST----LNPY--------KGTEDFF  534

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGGH--ASVNIPEDGFGF----TPFMAPSPSFGY  545
             SEEEIR RSHEMLEN+DMQHLLR+F+MGG   +S N  EDG+ F     P   P+ SFG 
Sbjct  535   SEEEIRTRSHEMLENDDMQHLLRIFNMGGQGLSSFNATEDGYPFLSTNMPTAPPNYSFGD  594

Query  544   DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             D  R   GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  595   DPSRS-SGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  630



>ref|XP_008224946.1| PREDICTED: uncharacterized protein LOC103324639 isoform X2 [Prunus 
mume]
 ref|XP_008224947.1| PREDICTED: uncharacterized protein LOC103324639 isoform X2 [Prunus 
mume]
Length=638

 Score =   210 bits (535),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 132/285 (46%), Positives = 172/285 (60%), Gaps = 42/285 (15%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  1061
             KVYVD LVKKAY+NW+   EYDGK+LL+FK +K+      E+P+   DY NS + Q   P
Sbjct  369   KVYVDGLVKKAYDNWMHVMEYDGKSLLNFKQQKSPEASLPEVPLATQDYPNSFD-QFTLP  427

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LP  V +E   +D G+ +GG  YN++M  R+S Q+  ++ S+ +Q +   F        
Sbjct  428   SLPVSVSAERPTMDSGLSVGG--YNDDMATRFSTQN--VNLSAPIQLDGLAFP-----LQ  478

Query  880   mnnsqqmqNARYDNNVG-LALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
                      A +  N   LALGPPQSS   F  +G+S    NL S+        +GVE+ 
Sbjct  479   NQLPSTSNQAHFQRNENMLALGPPQSSTSGFQNIGTS----NLTSY--------RGVEDL  526

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSM----------GGHASVNIPEDGFGFTPFMAPS  560
               EEEIR+RSHEMLENEDMQHLLR+F+M           GHAS+N+ ED + ++    P+
Sbjct  527   FPEEEIRMRSHEMLENEDMQHLLRIFNMGGQGHGHGHGYGHASMNVTEDNYPYSTAYIPT  586

Query  559   PSFGY--DEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             P   Y  D+DR R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  587   PPVNYNIDDDRSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  631



>ref|XP_008645828.1| PREDICTED: uncharacterized protein LOC103627307 isoform X1 [Zea 
mays]
 gb|AFW71857.1| hypothetical protein ZEAMMB73_193945 [Zea mays]
Length=651

 Score =   211 bits (536),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 137/282 (49%), Positives = 172/282 (61%), Gaps = 23/282 (8%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLN--NQLQ  1067
             KVY D+LVKKAYE+W+   EYDGK LLSFK KK     R+++         S    N  +
Sbjct  370   KVYADALVKKAYEDWMQVVEYDGKALLSFKQKKKTVTTRSDVASASTSNPASYGSANSQK  429

Query  1066  QPRLPAPVQSEPSALDPGMLIGG-SSYNEN--MGARYSNQSHIMSSSSRMQYENTQFAPn  896
             Q  LPA      SA       G  ++YN N    ARY+  +  + ++  MQY+ +  +P 
Sbjct  430   QLSLPAKAGQTSSAGTMNEADGTRNAYNANGNQSARYAANTQSIPANVGMQYDGSAVSPE  489

Query  895   dqqqlmnnsqqmqNARYDNNVGLALGPPQ---SSCFPTVGSSVQQTNLNSFEDW---SNT  734
              Q    +   Q       +N+ LALGPPQ   S  FP +G  VQ T LN FE+W      
Sbjct  490   IQFSGSSLQSQSSRG---SNM-LALGPPQQHQSFEFPALGQPVQPTGLNPFEEWPQQQEN  545

Query  733   RDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSP  557
             R  GV++YL EE IR+RSHE+LENE+MQ +LRL SMGG A  ++ EDGF F P+M APSP
Sbjct  546   RGGGVDDYLMEE-IRMRSHEILENEEMQQMLRLLSMGG-AGTSLAEDGFNFPPYMPAPSP  603

Query  556   SFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +  Y++DR R PGKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  604   NVSYEDDRTRAPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  645



>ref|XP_008224944.1| PREDICTED: uncharacterized protein LOC103324639 isoform X1 [Prunus 
mume]
 ref|XP_008224945.1| PREDICTED: uncharacterized protein LOC103324639 isoform X1 [Prunus 
mume]
Length=639

 Score =   210 bits (535),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 132/285 (46%), Positives = 172/285 (60%), Gaps = 42/285 (15%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  1061
             KVYVD LVKKAY+NW+   EYDGK+LL+FK +K+      E+P+   DY NS + Q   P
Sbjct  370   KVYVDGLVKKAYDNWMHVMEYDGKSLLNFKQQKSPEASLPEVPLATQDYPNSFD-QFTLP  428

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LP  V +E   +D G+ +GG  YN++M  R+S Q+  ++ S+ +Q +   F        
Sbjct  429   SLPVSVSAERPTMDSGLSVGG--YNDDMATRFSTQN--VNLSAPIQLDGLAFP-----LQ  479

Query  880   mnnsqqmqNARYDNNVG-LALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
                      A +  N   LALGPPQSS   F  +G+S    NL S+        +GVE+ 
Sbjct  480   NQLPSTSNQAHFQRNENMLALGPPQSSTSGFQNIGTS----NLTSY--------RGVEDL  527

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSM----------GGHASVNIPEDGFGFTPFMAPS  560
               EEEIR+RSHEMLENEDMQHLLR+F+M           GHAS+N+ ED + ++    P+
Sbjct  528   FPEEEIRMRSHEMLENEDMQHLLRIFNMGGQGHGHGHGYGHASMNVTEDNYPYSTAYIPT  587

Query  559   PSFGY--DEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             P   Y  D+DR R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  588   PPVNYNIDDDRSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  632



>ref|XP_012091498.1| PREDICTED: uncharacterized protein LOC105649465 isoform X1 [Jatropha 
curcas]
Length=687

 Score =   211 bits (536),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 134/275 (49%), Positives = 172/275 (63%), Gaps = 27/275 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KV+VD LVKKAYENW+   EYDGKTLL FK  +    ++ ++P  Q DY NS ++Q+  P
Sbjct  423   KVHVDELVKKAYENWMHVIEYDGKTLLDFKENENIAASQIDIPTSQQDYLNSYDHQVTLP  482

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              +  PV  E  A+D G  +GG  YNE+M AR+S Q H  + +   Q++        Q  L
Sbjct  483   TISVPVPPEQPAMDSGPTVGG--YNESMAARFSMQPHTGNQNMPFQFDAASLP--LQNPL  538

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  701
              + SQQ Q  R DN    ALGPPQSS     G  V   NL S+        +G E++L E
Sbjct  539   GSTSQQAQLPRSDNIP--ALGPPQSSTSSFQG--VCAPNLTSY--------RGAEDFLQE  586

Query  700   EEIRLRSHEMLENEDMQHLLRLFSMGGHA--SVNIPEDGF----GFTPFMAPSPSFGYDE  539
             E+IR+RSHEMLE+EDMQHLLR+F+MGG    S N  EDG+     + P ++P+ S G D+
Sbjct  587   EDIRMRSHEMLESEDMQHLLRIFNMGGQGLNSFNTTEDGYPYSSAYMPALSPNYSVGDDQ  646

Query  538   DRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              R   GKAV+GWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  647   SR-SSGKAVLGWLKLKAALRWGIFIRKKAAERRAQ  680



>gb|KEH36516.1| calmodulin-binding protein [Medicago truncatula]
Length=634

 Score =   209 bits (532),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 128/278 (46%), Positives = 172/278 (62%), Gaps = 32/278 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYS--NSLNNQLQ  1067
             KV+VD+LVKKAYENW+   EYDGK+LL++   +    +++++P+   DYS  NSL+ Q+ 
Sbjct  369   KVHVDTLVKKAYENWMHVIEYDGKSLLNYNQNRTLGMSQHQVPVSSHDYSISNSLDQQIS  428

Query  1066  QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqq  887
              P LP  V +   ++DPG  +GG  Y+     R+S Q      +S +Q+ NT F    Q 
Sbjct  429   TPSLPVHVPTGQHSMDPGATVGG--YHHGTATRFSMQPQNADVNSALQFGNTAFP--LQN  484

Query  886   qlmnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEE  713
              L + S Q Q  R +N   L+LGPPQS+   F TVG              S+   +G E+
Sbjct  485   LLTSVSHQSQLPRNENE--LSLGPPQSATPGFQTVG-------------LSDPTYRGFED  529

Query  712   YLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFTPFMAPSPSFGYDE  539
             +  E++IR+RSHEMLENEDMQHLLR+F+MGG  H S N PED + ++    P+ S  Y+ 
Sbjct  530   FFPEDDIRIRSHEMLENEDMQHLLRIFNMGGQPHTSFNAPEDEYPYSSAYMPATSTNYNV  589

Query  538   DRPR---PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             D  R    GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  590   DDERNRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  627



>ref|XP_004232807.1| PREDICTED: uncharacterized protein LOC101255950 [Solanum lycopersicum]
Length=621

 Score =   209 bits (531),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 124/273 (45%), Positives = 171/273 (63%), Gaps = 27/273 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQP  1061
             K+YVD+LVKKAY+NW+   EYDGK+LLS    KA    +N+  +G  +++ S + Q   P
Sbjct  361   KIYVDTLVKKAYDNWMQVVEYDGKSLLSLGQNKAAVSSQNDPTIGSQNHTISFDQQTNLP  420

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LPA + SE  +++ G+ +GG  YN+++  RY+ Q   M+ +  MQ     F  N     
Sbjct  421   SLPASISSEQPSMNSGLNMGG--YNDSLSGRYTMQPQNMNLNGNMQLNGASFPQNHLLGT  478

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  701
                +Q      + ++  LAL PPQ    P++ S    +  N +        KG E++L+E
Sbjct  479   SQQAQP-----HGSDSMLALRPPQ----PSMSSYFAASTPNPY--------KGAEDFLTE  521

Query  700   EEIRLRSHEMLENEDMQHLLRLFSMG-GHASVNIPEDGFGFTPFMAPSPS--FGYDEDRP  530
             EEIR++SHEMLENEDMQHLLR+FSMG GHAS ++ E+ + +     PS S  FG+DE+R 
Sbjct  522   EEIRMKSHEMLENEDMQHLLRMFSMGQGHASSSVAEENYQYGSAYMPSMSSNFGFDEERT  581

Query  529   R-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  582   RSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  614



>ref|XP_008383819.1| PREDICTED: uncharacterized protein LOC103446473 [Malus domestica]
 ref|XP_008358694.1| PREDICTED: uncharacterized protein LOC103422407 [Malus domestica]
Length=636

 Score =   208 bits (529),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 129/279 (46%), Positives = 171/279 (61%), Gaps = 32/279 (11%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKAR-NELPMGQVDYSNSLNNQLQQPRLP  1052
             KV VD LVKKAY+NW+   EYDGK+LLS KN      E+PM   DY NS + Q   P LP
Sbjct  369   KVCVDGLVKKAYDNWMHVMEYDGKSLLSXKNPDVSLPEVPMASQDYPNSCDQQFTLPSLP  428

Query  1051  APVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnn  872
             A V S+P  +D G+ +GG  Y + M AR+S QS   + +  +Q +   F   +Q   ++ 
Sbjct  429   ASVSSQPPPMDSGLNVGG--YXDGMAARFSIQSQNGNLNXPIQLDGLSFPQQNQLPSISX  486

Query  871   sqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEE  698
                 Q     N   L+LGP QSS   F  +G+S    NL+S+        +GVE+   EE
Sbjct  487   QXHFQR----NENMLSLGPLQSSTSGFQNIGTS----NLSSY--------RGVEDLFPEE  530

Query  697   EIRLRSHEMLENEDMQHLLRLFSMGG--------HASVNIPEDGFGFTPFMAPSPSFGY-  545
             EIR+RS+E+LENEDMQHLLR+ +MGG        H+S+N+ ED + ++    P+P   Y 
Sbjct  531   EIRMRSNEILENEDMQHLLRVINMGGQGQGHSYGHSSMNVTEDNYPYSSPYIPTPQANYS  590

Query  544   -DEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              D+D+ R PGKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  591   IDDDQSRSPGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  629



>ref|XP_007213593.1| hypothetical protein PRUPE_ppa002740mg [Prunus persica]
 gb|EMJ14792.1| hypothetical protein PRUPE_ppa002740mg [Prunus persica]
Length=638

 Score =   208 bits (529),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 132/285 (46%), Positives = 170/285 (60%), Gaps = 42/285 (15%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  1061
             KVYVD LVKKAY+NW+   EYDGK+LL+FK +K+      E+P+   DY NS + Q   P
Sbjct  369   KVYVDGLVKKAYDNWMHVMEYDGKSLLNFKQQKSPEASLPEVPLATQDYPNSFD-QFTLP  427

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LP  V +E   +D G+ +GG  YN+ M  R+S Q+  ++ S+ +Q +   F        
Sbjct  428   SLPISVSAEQPTMDSGLSVGG--YNDGMATRFSTQN--VNLSAPIQLDGLAFP-----LQ  478

Query  880   mnnsqqmqNARYDNNVG-LALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
                      A +  N   LALGPPQSS   F  +G+S    NL S+        +GVE+ 
Sbjct  479   NQLPSTSNQAHFQRNENMLALGPPQSSTSGFQNIGTS----NLTSY--------RGVEDL  526

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSM----------GGHASVNIPEDGFGFTPFMAPS  560
               EEEIR+RSHEMLENEDMQHLLR+F+M           GHAS+NI ED + ++    P+
Sbjct  527   FPEEEIRMRSHEMLENEDMQHLLRIFNMGGQGHGHGHGYGHASMNITEDNYPYSTAYIPT  586

Query  559   PSFGY--DEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             P   Y  D+D  R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  587   PPVNYSTDDDHSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  631



>ref|XP_009606926.1| PREDICTED: uncharacterized protein LOC104101191 isoform X1 [Nicotiana 
tomentosiformis]
Length=581

 Score =   206 bits (525),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 126/275 (46%), Positives = 165/275 (60%), Gaps = 28/275 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQP  1061
             K YVD+LVKKAY+NW++  EYDG++LLS    K     +N+L  G   +S+S ++QL  P
Sbjct  318   KEYVDTLVKKAYDNWMNVVEYDGESLLSLNQNKTSDGPQNDLTTGSQSHSSSFDHQLNLP  377

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
               PA + SE   +DPG+ IGG  YN++    Y+ QS  M+ S   Q     F P +   +
Sbjct  378   SFPASISSEQPTMDPGLNIGG--YNDSRTGSYTIQSQKMNLSVNEQLNVASFPPQNHHFV  435

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWS--NTRDKGVEEYL  707
               + Q             AL PP+SS              +SF   S  N   KG +++ 
Sbjct  436   GTSQQTQPPGSESIQ---ALRPPESS-------------FSSFYVASTPNPSYKGTDDFF  479

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFTPFMAPSPS--FGYDE  539
             +EEEIR+RSHEMLENEDMQHLLR+F+MGG  HAS +  ED + + P   PS S  +G+ E
Sbjct  480   AEEEIRMRSHEMLENEDMQHLLRIFNMGGQNHASSSNTEDNYPYGPSYMPSMSSTYGFQE  539

Query  538   DRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             DR R GKAVVGWLK+KAA+RWG FIRKKAAE+RAQ
Sbjct  540   DRTRSGKAVVGWLKLKAALRWGIFIRKKAAEKRAQ  574



>ref|XP_009606927.1| PREDICTED: uncharacterized protein LOC104101191 isoform X2 [Nicotiana 
tomentosiformis]
Length=626

 Score =   206 bits (525),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 126/275 (46%), Positives = 165/275 (60%), Gaps = 28/275 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQP  1061
             K YVD+LVKKAY+NW++  EYDG++LLS    K     +N+L  G   +S+S ++QL  P
Sbjct  363   KEYVDTLVKKAYDNWMNVVEYDGESLLSLNQNKTSDGPQNDLTTGSQSHSSSFDHQLNLP  422

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
               PA + SE   +DPG+ IGG  YN++    Y+ QS  M+ S   Q     F P +   +
Sbjct  423   SFPASISSEQPTMDPGLNIGG--YNDSRTGSYTIQSQKMNLSVNEQLNVASFPPQNHHFV  480

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWS--NTRDKGVEEYL  707
               + Q             AL PP+SS              +SF   S  N   KG +++ 
Sbjct  481   GTSQQTQPPGSESIQ---ALRPPESS-------------FSSFYVASTPNPSYKGTDDFF  524

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFTPFMAPSPS--FGYDE  539
             +EEEIR+RSHEMLENEDMQHLLR+F+MGG  HAS +  ED + + P   PS S  +G+ E
Sbjct  525   AEEEIRMRSHEMLENEDMQHLLRIFNMGGQNHASSSNTEDNYPYGPSYMPSMSSTYGFQE  584

Query  538   DRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             DR R GKAVVGWLK+KAA+RWG FIRKKAAE+RAQ
Sbjct  585   DRTRSGKAVVGWLKLKAALRWGIFIRKKAAEKRAQ  619



>ref|XP_007025783.1| Calmodulin-binding protein isoform 2 [Theobroma cacao]
 gb|EOY28405.1| Calmodulin-binding protein isoform 2 [Theobroma cacao]
Length=632

 Score =   206 bits (523),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 129/276 (47%), Positives = 170/276 (62%), Gaps = 29/276 (11%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVD+LVKKAYENW+   EYDGK+LL  K       ++  +PM    Y NS+N Q   P
Sbjct  368   KVYVDALVKKAYENWMHVVEYDGKSLLGSKEDDNAGASQANVPMDLQGYPNSINQQQTLP  427

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              L  PV SE   +D G+ +GG  Y+++M AR S QS  +  +++ Q     F   +    
Sbjct  428   SLSVPVPSEQPPMDSGLNVGG--YDDSMAARLSLQSQNVHLNAQTQLNGASFTLQNHLVS  485

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
              +   Q+      N+  LALG  QSS   F  VG+S    N+ ++        +GVE++ 
Sbjct  486   ASQQVQLPG----NDNELALGSSQSSMPDFHGVGTS----NIPTY--------RGVEDFF  529

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMG--GHASVNIPEDGFGF-TPFMA-PSPSFGYDE  539
             SEEEIR+RSHEMLENEDMQHLLR+F+MG  GH S N  EDG+   + +M+ PS ++G+D 
Sbjct  530   SEEEIRMRSHEMLENEDMQHLLRIFNMGSHGHTSFNATEDGYPHSSAYMSTPSLNYGFDN  589

Query  538   DRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +  R  GKAVVGWLK+KAA+RWG FIRKKAAERRA 
Sbjct  590   EASRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAH  625



>ref|XP_007025782.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 gb|EOY28404.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
Length=635

 Score =   206 bits (523),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 129/276 (47%), Positives = 170/276 (62%), Gaps = 29/276 (11%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVD+LVKKAYENW+   EYDGK+LL  K       ++  +PM    Y NS+N Q   P
Sbjct  371   KVYVDALVKKAYENWMHVVEYDGKSLLGSKEDDNAGASQANVPMDLQGYPNSINQQQTLP  430

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              L  PV SE   +D G+ +GG  Y+++M AR S QS  +  +++ Q     F   +    
Sbjct  431   SLSVPVPSEQPPMDSGLNVGG--YDDSMAARLSLQSQNVHLNAQTQLNGASFTLQNHLVS  488

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
              +   Q+      N+  LALG  QSS   F  VG+S    N+ ++        +GVE++ 
Sbjct  489   ASQQVQLPG----NDNELALGSSQSSMPDFHGVGTS----NIPTY--------RGVEDFF  532

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMG--GHASVNIPEDGFGF-TPFMA-PSPSFGYDE  539
             SEEEIR+RSHEMLENEDMQHLLR+F+MG  GH S N  EDG+   + +M+ PS ++G+D 
Sbjct  533   SEEEIRMRSHEMLENEDMQHLLRIFNMGSHGHTSFNATEDGYPHSSAYMSTPSLNYGFDN  592

Query  538   DRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +  R  GKAVVGWLK+KAA+RWG FIRKKAAERRA 
Sbjct  593   EASRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAH  628



>ref|NP_001047151.1| Os02g0562300 [Oryza sativa Japonica Group]
 dbj|BAD16554.1| putative calmodulin-binding protein [Oryza sativa Japonica Group]
 dbj|BAF09065.1| Os02g0562300 [Oryza sativa Japonica Group]
 dbj|BAG93360.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57202.1| hypothetical protein OsJ_07158 [Oryza sativa Japonica Group]
Length=652

 Score =   206 bits (523),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 131/284 (46%), Positives = 170/284 (60%), Gaps = 29/284 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQ----VDY-SNSLNN  1076
             K+Y D LVKKAYE+W+   EYDGK LLSFK KK     R++         V Y S++ + 
Sbjct  373   KIYADGLVKKAYEDWMHVVEYDGKALLSFKQKKKSVTTRSDTAAAATNSPVSYGSSNTHK  432

Query  1075  QLQQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPn  896
             QL QP       +  ++ D       S+YN N   RY+  S  + ++   QYE +   P 
Sbjct  433   QLSQPAKAGQTSTGTTSEDGST----SAYNGNQAGRYAVNSQSIPANVTTQYERSSLTPE  488

Query  895   dqqqlmnnsqqmqNARYDNNVGLALGPPQSSC-----FPTVGS-SVQQTNLNSFEDWSNT  734
              Q        Q+      +N+ LALGPPQ        F  +G  S+Q T LN F+DWS  
Sbjct  489   SQFNGSALQNQVSRG---SNI-LALGPPQQQHQQNFEFSALGGQSMQPTGLNPFDDWSQP  544

Query  733   RD--KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPS  560
             ++   GV++YL EE IR+RSHE+LENE+MQ +LR+ SMGG AS N+ EDGF F  +M  +
Sbjct  545   QENRSGVDDYLMEE-IRMRSHEILENEEMQQMLRILSMGG-ASTNLTEDGFAFPNYMPST  602

Query  559   P-SFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             P +F + +DR RP GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  603   PPNFNFGDDRARPPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  646



>ref|XP_002452291.1| hypothetical protein SORBIDRAFT_04g023100 [Sorghum bicolor]
 gb|EES05267.1| hypothetical protein SORBIDRAFT_04g023100 [Sorghum bicolor]
Length=650

 Score =   205 bits (522),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 130/281 (46%), Positives = 173/281 (62%), Gaps = 22/281 (8%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVY D+LVKKAYE+W+   EYDGK LLSFK KK     R++          S  +   Q 
Sbjct  370   KVYADALVKKAYEDWMQVVEYDGKALLSFKQKKKSVTTRSDAAAASTSNPASYGSTNSQK  429

Query  1060  RLPAPVQS-EPSALDPGMLIGGS----SYNENMGARYSNQSHIMSSSSRMQYENTQFAPn  896
             ++  P ++ + S++       G+    + N N  ARY+  +  + ++  MQY+ +  +P 
Sbjct  430   QMSLPAKAGQTSSVGTMNEADGTRNAYNANGNQSARYAANTQNIPANITMQYDRSAVSPE  489

Query  895   dqqqlmnnsqqmqNARYDNNVGLALGPPQ---SSCFPTVGSSVQQTNLNSFEDWSNTRDK  725
              Q    +   Q   A   +N+ LALGP Q   S  FP +G S+Q T LN FE+W   ++ 
Sbjct  490   SQFSGSSLQSQ---ASRGSNM-LALGPSQQHQSFEFPALGQSLQPTGLNPFEEWPQQQEN  545

Query  724   --GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPS  554
               GV++YL EE IR+RSHE+LENE+MQ +LRL SMGG A  N+ ED F F  +M APSP+
Sbjct  546   RGGVDDYLMEE-IRMRSHEILENEEMQQMLRLLSMGG-AGTNLTEDAFNFPSYMPAPSPN  603

Query  553   FGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
               Y++DR R PGKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  604   LSYEDDRTRAPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  644



>ref|XP_002524676.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF37695.1| calmodulin binding protein, putative [Ricinus communis]
Length=458

 Score =   201 bits (511),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 127/275 (46%), Positives = 176/275 (64%), Gaps = 29/275 (11%)
 Frame = -1

Query  1225  VYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQPR  1058
             VYVD LVKKAYENW+   EYDGKTLL FK  +    ++ + P+ Q D+ NS ++Q+  P 
Sbjct  195   VYVDGLVKKAYENWMHVIEYDGKTLLDFKQNENIVASQTDNPICQEDFLNSYDHQVTLPT  254

Query  1057  LPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  878
             L  PV  E  A+D G  +GG  YN NM AR+S Q+   + ++  Q++        Q  L 
Sbjct  255   LSVPVPPEQPAMDSGPTVGG--YNNNMAARFSMQAQNENINTPFQFDAASMP--LQNPLP  310

Query  877   nnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEE  698
             + SQQ Q +R D+   LAL PPQSS     G  V   N+ S+        +G E++  EE
Sbjct  311   STSQQNQFSRSDSL--LALAPPQSSTSSFQG--VCTPNVTSY--------RGSEDFFPEE  358

Query  697   EIRLRSHEMLENEDMQHLLRLFSMGGH--ASVNIPEDGF----GFTPFMAPSPSFGYDED  536
             ++R+RS+EMLEN+DMQHLLR+F+MGG   +S+N+ EDG+     + P  APSP++ + +D
Sbjct  359   DLRVRSNEMLENDDMQHLLRIFNMGGQGLSSLNMGEDGYPYPSSYVP--APSPNYSFGDD  416

Query  535   RPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             + R  GKAV+GWLK+KAA+RWG F+RK+AAERRAQ
Sbjct  417   QSRSSGKAVIGWLKLKAALRWGIFVRKRAAERRAQ  451



>ref|XP_010696621.1| PREDICTED: uncharacterized protein LOC104909117 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=634

 Score =   204 bits (519),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 134/278 (48%), Positives = 172/278 (62%), Gaps = 32/278 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVY D+L+KKAYENW    EYDGK+LLS K  K    +R E P+ Q +  N   ++L  P
Sbjct  369   KVYADTLIKKAYENWTHVVEYDGKSLLSLKQNKIEDSSRTESPVSQPN-PNFYTHELSLP  427

Query  1060  RLP-APVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  884
              LP AP   +PS +DPG+ IGG   ++ MG RYS QS  M+ +   QY  T   P +Q  
Sbjct  428   SLPVAPPMEQPS-VDPGLKIGG--LHDAMGTRYSAQSQTMNFNGSAQYA-TSLLPQNQFI  483

Query  883   lmnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLS  704
               +   Q       NN  L+LGP Q S      S +Q    ++F D+     +G E  LS
Sbjct  484   GTSGLSQPSR----NNDALSLGPAQPSL-----SGLQPVGTSNFVDY-----RGNENLLS  529

Query  703   EEEIRLRSHEMLENEDMQHLLRLFSMG--GHAS---VNIPEDGFGFTPFMAPSPS--FGY  545
             EE+IR+RSH+MLE+EDMQHLLR+F MG  GH +   V++ ED + ++   APSP+  F +
Sbjct  530   EEDIRMRSHQMLEHEDMQHLLRIFGMGNGGHQAQNPVSVSEDPYPYSAGYAPSPAINFNF  589

Query  544   DEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             DEDR R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  590   DEDRSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  627



>ref|XP_010696620.1| PREDICTED: uncharacterized protein LOC104909117 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=639

 Score =   204 bits (520),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 134/278 (48%), Positives = 172/278 (62%), Gaps = 32/278 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVY D+L+KKAYENW    EYDGK+LLS K  K    +R E P+ Q +  N   ++L  P
Sbjct  374   KVYADTLIKKAYENWTHVVEYDGKSLLSLKQNKIEDSSRTESPVSQPN-PNFYTHELSLP  432

Query  1060  RLP-APVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  884
              LP AP   +PS +DPG+ IGG   ++ MG RYS QS  M+ +   QY  T   P +Q  
Sbjct  433   SLPVAPPMEQPS-VDPGLKIGG--LHDAMGTRYSAQSQTMNFNGSAQYA-TSLLPQNQFI  488

Query  883   lmnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLS  704
               +   Q       NN  L+LGP Q S      S +Q    ++F D+     +G E  LS
Sbjct  489   GTSGLSQPSR----NNDALSLGPAQPSL-----SGLQPVGTSNFVDY-----RGNENLLS  534

Query  703   EEEIRLRSHEMLENEDMQHLLRLFSMG--GHAS---VNIPEDGFGFTPFMAPSPS--FGY  545
             EE+IR+RSH+MLE+EDMQHLLR+F MG  GH +   V++ ED + ++   APSP+  F +
Sbjct  535   EEDIRMRSHQMLEHEDMQHLLRIFGMGNGGHQAQNPVSVSEDPYPYSAGYAPSPAINFNF  594

Query  544   DEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             DEDR R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  595   DEDRSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  632



>ref|XP_004293506.1| PREDICTED: uncharacterized protein LOC101308261 [Fragaria vesca 
subsp. vesca]
 ref|XP_011460292.1| PREDICTED: uncharacterized protein LOC101308261 [Fragaria vesca 
subsp. vesca]
Length=636

 Score =   204 bits (518),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 132/283 (47%), Positives = 179/283 (63%), Gaps = 41/283 (14%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVDSLVKKAYENW+   EYDGK+LL+FK +K    ++ E+PM   +Y+NS N Q   P
Sbjct  370   KVYVDSLVKKAYENWMHVMEYDGKSLLNFKQQKDPVTSQLEVPMASQEYTNSFNQQFTVP  429

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LP P  SE   +DPG + GG  YN+ M  ++S   ++ + +  +Q++ + F P +Q   
Sbjct  430   SLPVP--SEQHIMDPGFIAGG--YNDGMATQFSIPQNV-NLNPPIQFDGSSFPPPNQLPN  484

Query  880   mnnsqqmqNARYDNNVGLALGPPQ--SSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
              ++  ++Q  R +N   LALGP Q  +S F  V +S    NL S+        +G++ + 
Sbjct  485   TSHPHEIQ--RSENM--LALGPSQLSTSGFQNVDTS----NLASY--------RGLD-FF  527

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGGHA---------SVNIPEDGFGFTPFMAPSPS  554
              EEEIR RSHE+LENEDMQHLLR+F+MGGH          S+N  ED + ++    PSP+
Sbjct  528   PEEEIRTRSHEILENEDMQHLLRMFNMGGHGQVHGQSVHPSINATED-YSYSSAYMPSPA  586

Query  553   FGY--DEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
               Y  D+DR R  GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  587   INYNFDDDRSRSSGKAVVGWLKLKAALRWGIFIRKRAAERRAQ  629



>ref|XP_006347126.1| PREDICTED: uncharacterized protein LOC102591443 [Solanum tuberosum]
Length=621

 Score =   204 bits (518),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 121/273 (44%), Positives = 169/273 (62%), Gaps = 27/273 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQP  1061
             K+YVD+LVKKAY+NW+   EYDGK+LLS    KA    +N+  +G  +++ S + Q    
Sbjct  361   KIYVDTLVKKAYDNWMQVVEYDGKSLLSLGQNKAAVSSQNDPTIGSQNHTISFDQQTNLA  420

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LPA + SE  +++ G+ +GG  YN+++  RY+ Q   M+ +  M      F  N     
Sbjct  421   SLPASISSEQPSMNSGLNMGG--YNDSLSGRYTMQPQNMNLNGNMHLNGASFPQNHLLGT  478

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  701
                +Q      + ++  LAL PPQ    P++ S    +  N +        KG E++L+E
Sbjct  479   SQQAQP-----HGSDSMLALRPPQ----PSMSSYFTASTPNPY--------KGAEDFLTE  521

Query  700   EEIRLRSHEMLENEDMQHLLRLFSMG-GHASVNIPEDGFGFTPFMAP--SPSFGYDEDRP  530
             EEIR++SHEMLENEDMQHLLR+FSMG GHAS ++ E+ + +     P  S +FG+DE+R 
Sbjct  522   EEIRMKSHEMLENEDMQHLLRMFSMGQGHASSSVAEENYQYGSAYMPNMSSNFGFDEERT  581

Query  529   R-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  582   RSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  614



>gb|EEC73417.1| hypothetical protein OsI_07682 [Oryza sativa Indica Group]
Length=652

 Score =   204 bits (518),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 130/284 (46%), Positives = 170/284 (60%), Gaps = 29/284 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQ----VDY-SNSLNN  1076
             K+Y D LVKKAYE+W+   EYDGK LLSFK KK     R++         V Y S++ + 
Sbjct  373   KIYADGLVKKAYEDWMHVVEYDGKALLSFKQKKKSVTTRSDTAAAATNSPVSYGSSNTHK  432

Query  1075  QLQQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPn  896
             QL QP       +  ++ D       S+YN N   RY+  S  + ++   QYE +   P 
Sbjct  433   QLSQPAKAGQTSTGTTSEDGST----SAYNGNQAGRYAVNSQSIPANVTTQYERSSLTPE  488

Query  895   dqqqlmnnsqqmqNARYDNNVGLALGPPQSSC-----FPTVGS-SVQQTNLNSFEDWSNT  734
              Q        Q+      +N+ LALGPPQ        F  +G  S+Q T LN F+DWS  
Sbjct  489   SQFNGSALQNQVSRG---SNI-LALGPPQQQHQQNFEFSALGGQSMQPTGLNPFDDWSQP  544

Query  733   RD--KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPS  560
             ++   GV++YL EE IR++SHE+LENE+MQ +LR+ SMGG AS N+ EDGF F  +M  +
Sbjct  545   QENRSGVDDYLMEE-IRMQSHEILENEEMQQMLRILSMGG-ASTNLTEDGFAFPNYMPST  602

Query  559   P-SFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             P +F + +DR RP GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  603   PPNFNFGDDRARPPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  646



>ref|XP_010539448.1| PREDICTED: uncharacterized protein LOC104813528 [Tarenaya hassleriana]
Length=632

 Score =   203 bits (517),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 129/272 (47%), Positives = 173/272 (64%), Gaps = 16/272 (6%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVD L+KKAYENW    EYDGK+L++FK  K    ++ +L +   +YS +++N +Q  
Sbjct  358   KVYVDGLMKKAYENWNQVIEYDGKSLMNFKQPKNSVISQTDLEVAPANYSTAIDNPMQLL  417

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LP+ + +  S++   + I G  ++++  + YS Q  +++S+ + Q+E     P   Q +
Sbjct  418   GLPSSLSANQSSVHSEIAIKG--FHQSPPSTYSTQHQLLNSNPQAQFEAGLCTPQQDQFM  475

Query  880   mnnsqqmqNARYDNNVG-LALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLS  704
              N  Q         N G LALGPP    +    SS Q  +L ++E+WSN R+KG EE+ S
Sbjct  476   GNLHQTQS-----TNAGRLALGPPGGYQYQNSSSSAQPASLPTYENWSNHREKGPEEFFS  530

Query  703   EEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGY-DEDRP  530
             EEEIRLRS+EMLENEDMQ LLRLFSM      +  EDG+GF  FM  P     Y +E+R 
Sbjct  531   EEEIRLRSNEMLENEDMQQLLRLFSM--GGGGHAGEDGYGFPSFMQTPQMMQSYEEEERG  588

Query  529   RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             R GKAVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  589   RSGKAVVGWLKIKAAMRWGFFIRRKAAERRAQ  620



>ref|XP_010235560.1| PREDICTED: uncharacterized protein LOC100846328 isoform X1 [Brachypodium 
distachyon]
Length=650

 Score =   203 bits (517),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 130/279 (47%), Positives = 167/279 (60%), Gaps = 22/279 (8%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYS---NSLNNQL  1070
             KVY D+LVKKAYE+W+   EYDGK LLSFK KK     R++             S+N Q 
Sbjct  374   KVYADTLVKKAYEDWMHAVEYDGKALLSFKQKKKTVTTRSDTAAASSSNLASYGSVNAQK  433

Query  1069  QQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndq  890
             Q   LP       +          S+YN N  ARY+     + ++  MQYE +   P  Q
Sbjct  434   QI--LPGKAGQSSAGTTSEADGARSTYNGNQTARYTASPQSIPANITMQYERSALLPESQ  491

Query  889   qqlmnnsqqmqNARYDNNVGLALGPPQSSC----FPTVGSSVQQTNLNSFEDWSNTRD-K  725
                 +   Q   A   +N+ LALGPPQ       F  +G S+Q   LN+F+ WS  ++ +
Sbjct  492   LNGSSLQTQ---ASGGSNM-LALGPPQQQPQGFEFQALGQSMQPAGLNTFDQWSQPQENR  547

Query  724   GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFG  548
             GV++YL EE IRLRSHE+LEN++MQ +LR+ +MGG    N+PEDGF F   M +P PSF 
Sbjct  548   GVDDYLMEE-IRLRSHEILENDEMQQMLRILNMGG-VPTNLPEDGFSFPYNMQSPLPSFN  605

Query  547   YDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +++DR RP GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  606   FEDDRTRPPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  644



>ref|XP_003575160.1| PREDICTED: uncharacterized protein LOC100846328 isoform X2 [Brachypodium 
distachyon]
Length=649

 Score =   202 bits (515),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 131/279 (47%), Positives = 169/279 (61%), Gaps = 23/279 (8%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYS---NSLNNQL  1070
             KVY D+LVKKAYE+W+   EYDGK LLSFK KK     R++             S+N Q 
Sbjct  374   KVYADTLVKKAYEDWMHAVEYDGKALLSFKQKKKTVTTRSDTAAASSSNLASYGSVNAQK  433

Query  1069  QQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndq  890
             Q     A   S  +  + G     S+YN N  ARY+     + ++  MQYE +   P  Q
Sbjct  434   QILPGKAGQSSAGTTSEDG---ARSTYNGNQTARYTASPQSIPANITMQYERSALLPESQ  490

Query  889   qqlmnnsqqmqNARYDNNVGLALGPPQSSC----FPTVGSSVQQTNLNSFEDWSNTRD-K  725
                 +   Q   A   +N+ LALGPPQ       F  +G S+Q   LN+F+ WS  ++ +
Sbjct  491   LNGSSLQTQ---ASGGSNM-LALGPPQQQPQGFEFQALGQSMQPAGLNTFDQWSQPQENR  546

Query  724   GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFG  548
             GV++YL EE IRLRSHE+LEN++MQ +LR+ +MGG    N+PEDGF F   M +P PSF 
Sbjct  547   GVDDYLMEE-IRLRSHEILENDEMQQMLRILNMGG-VPTNLPEDGFSFPYNMQSPLPSFN  604

Query  547   YDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +++DR RP GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  605   FEDDRTRPPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  643



>ref|XP_006449222.1| hypothetical protein CICLE_v10014600mg [Citrus clementina]
 gb|ESR62462.1| hypothetical protein CICLE_v10014600mg [Citrus clementina]
Length=628

 Score =   202 bits (513),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 132/275 (48%), Positives = 180/275 (65%), Gaps = 28/275 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPM----GQVDYSNSLNNQLQQP  1061
             KV+VD+LVKKAY+NW+   EYDGK+LL F   K+ +  P     G  +Y+N  + QL  P
Sbjct  365   KVHVDTLVKKAYDNWMHVIEYDGKSLLGFTQNKSVDAPPTDFQTGPPNYTNPFSQQLALP  424

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              L  PV  E  ++D G+ +GG  YN+ + +R+S QS  ++ +S  Q++ T F    Q  L
Sbjct  425   TLSVPVPPEQPSMDSGLTVGG--YNDGIPSRFSLQSQNVNINS--QFDGTSFP--QQNPL  478

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  701
             ++  Q+    R +N   LALGPPQSS    V  ++  +N   +        +G+E++ SE
Sbjct  479   VSVPQEAHIPRSENV--LALGPPQSSSL--VSQTIGTSNPAPY--------RGIEDFFSE  526

Query  700   EEIRLRSHEMLENEDMQ-HLLRLFSMGG--HASVNIPEDGFGFT-PFMA-PSPSFGYDED  536
             EEIR+RSHEMLENEDMQ HLLR+F+MGG  H S N+ ED + ++ PFMA PSP++ +D+D
Sbjct  527   EEIRMRSHEMLENEDMQQHLLRIFNMGGQGHPSFNVAEDAYPYSSPFMANPSPNYSFDDD  586

Query  535   RPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
               R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  587   SSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  621



>gb|KDO75730.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
Length=627

 Score =   202 bits (513),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 131/275 (48%), Positives = 179/275 (65%), Gaps = 28/275 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPM----GQVDYSNSLNNQLQQP  1061
             KV+VD+LVKKAY+NW+   EYDGK+LL F   K+ +  P     G  +Y+N  + QL  P
Sbjct  364   KVHVDTLVKKAYDNWMHVIEYDGKSLLGFTQNKSVDAPPTDFQTGPPNYTNPFSQQLALP  423

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              L  PV  E  ++D G+ +GG  YN+ + +R+S QS  ++ +S  Q++ T F    Q  L
Sbjct  424   TLSVPVPPEQPSMDSGLTVGG--YNDGIPSRFSLQSQNVNINS--QFDGTSFP--QQNPL  477

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  701
             ++   +    R +N   LALGPPQSS    V  ++  +N   +        +G+E++ SE
Sbjct  478   VSVPHEAHIPRSENV--LALGPPQSSSL--VSQTIGTSNPAPY--------RGIEDFFSE  525

Query  700   EEIRLRSHEMLENEDMQ-HLLRLFSMGG--HASVNIPEDGFGFT-PFMA-PSPSFGYDED  536
             EEIR+RSHEMLENEDMQ HLLR+F+MGG  H S N+ ED + ++ PFMA PSP++ +D+D
Sbjct  526   EEIRMRSHEMLENEDMQQHLLRIFNMGGQGHPSFNVAEDAYPYSSPFMANPSPNYSFDDD  585

Query  535   RPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
               R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  586   SSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  620



>ref|XP_006467892.1| PREDICTED: uncharacterized protein LOC102626942 [Citrus sinensis]
 gb|KDO75732.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
 gb|KDO75733.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
Length=628

 Score =   202 bits (513),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 131/275 (48%), Positives = 179/275 (65%), Gaps = 28/275 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPM----GQVDYSNSLNNQLQQP  1061
             KV+VD+LVKKAY+NW+   EYDGK+LL F   K+ +  P     G  +Y+N  + QL  P
Sbjct  365   KVHVDTLVKKAYDNWMHVIEYDGKSLLGFTQNKSVDAPPTDFQTGPPNYTNPFSQQLALP  424

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              L  PV  E  ++D G+ +GG  YN+ + +R+S QS  ++ +S  Q++ T F    Q  L
Sbjct  425   TLSVPVPPEQPSMDSGLTVGG--YNDGIPSRFSLQSQNVNINS--QFDGTSFP--QQNPL  478

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  701
             ++   +    R +N   LALGPPQSS    V  ++  +N   +        +G+E++ SE
Sbjct  479   VSVPHEAHIPRSENV--LALGPPQSSSL--VSQTIGTSNPAPY--------RGIEDFFSE  526

Query  700   EEIRLRSHEMLENEDMQ-HLLRLFSMGG--HASVNIPEDGFGFT-PFMA-PSPSFGYDED  536
             EEIR+RSHEMLENEDMQ HLLR+F+MGG  H S N+ ED + ++ PFMA PSP++ +D+D
Sbjct  527   EEIRMRSHEMLENEDMQQHLLRIFNMGGQGHPSFNVAEDAYPYSSPFMANPSPNYSFDDD  586

Query  535   RPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
               R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  587   SSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  621



>gb|KDO75734.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
 gb|KDO75735.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
Length=588

 Score =   201 bits (511),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 131/275 (48%), Positives = 179/275 (65%), Gaps = 28/275 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPM----GQVDYSNSLNNQLQQP  1061
             KV+VD+LVKKAY+NW+   EYDGK+LL F   K+ +  P     G  +Y+N  + QL  P
Sbjct  325   KVHVDTLVKKAYDNWMHVIEYDGKSLLGFTQNKSVDAPPTDFQTGPPNYTNPFSQQLALP  384

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              L  PV  E  ++D G+ +GG  YN+ + +R+S QS  ++ +S  Q++ T F    Q  L
Sbjct  385   TLSVPVPPEQPSMDSGLTVGG--YNDGIPSRFSLQSQNVNINS--QFDGTSFP--QQNPL  438

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  701
             ++   +    R +N   LALGPPQSS    V  ++  +N   +        +G+E++ SE
Sbjct  439   VSVPHEAHIPRSENV--LALGPPQSSSL--VSQTIGTSNPAPY--------RGIEDFFSE  486

Query  700   EEIRLRSHEMLENEDMQ-HLLRLFSMGG--HASVNIPEDGFGFT-PFMA-PSPSFGYDED  536
             EEIR+RSHEMLENEDMQ HLLR+F+MGG  H S N+ ED + ++ PFMA PSP++ +D+D
Sbjct  487   EEIRMRSHEMLENEDMQQHLLRIFNMGGQGHPSFNVAEDAYPYSSPFMANPSPNYSFDDD  546

Query  535   RPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
               R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  547   SSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  581



>ref|XP_006449221.1| hypothetical protein CICLE_v10014600mg [Citrus clementina]
 gb|ESR62461.1| hypothetical protein CICLE_v10014600mg [Citrus clementina]
Length=588

 Score =   201 bits (511),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 132/275 (48%), Positives = 180/275 (65%), Gaps = 28/275 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPM----GQVDYSNSLNNQLQQP  1061
             KV+VD+LVKKAY+NW+   EYDGK+LL F   K+ +  P     G  +Y+N  + QL  P
Sbjct  325   KVHVDTLVKKAYDNWMHVIEYDGKSLLGFTQNKSVDAPPTDFQTGPPNYTNPFSQQLALP  384

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              L  PV  E  ++D G+ +GG  YN+ + +R+S QS  ++ +S  Q++ T F    Q  L
Sbjct  385   TLSVPVPPEQPSMDSGLTVGG--YNDGIPSRFSLQSQNVNINS--QFDGTSFP--QQNPL  438

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  701
             ++  Q+    R +N   LALGPPQSS    V  ++  +N   +        +G+E++ SE
Sbjct  439   VSVPQEAHIPRSENV--LALGPPQSSSL--VSQTIGTSNPAPY--------RGIEDFFSE  486

Query  700   EEIRLRSHEMLENEDMQ-HLLRLFSMGG--HASVNIPEDGFGFT-PFMA-PSPSFGYDED  536
             EEIR+RSHEMLENEDMQ HLLR+F+MGG  H S N+ ED + ++ PFMA PSP++ +D+D
Sbjct  487   EEIRMRSHEMLENEDMQQHLLRIFNMGGQGHPSFNVAEDAYPYSSPFMANPSPNYSFDDD  546

Query  535   RPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
               R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  547   SSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  581



>ref|XP_006647388.1| PREDICTED: uncharacterized protein LOC102720488 isoform X1 [Oryza 
brachyantha]
Length=655

 Score =   202 bits (513),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 128/281 (46%), Positives = 167/281 (59%), Gaps = 22/281 (8%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             K+Y D LVKKAYE+W+   EYDGK LLSFK KK     R++      +   S  +   Q 
Sbjct  375   KIYADGLVKKAYEDWMHVVEYDGKALLSFKQKKKSVTTRSDTAAAATNNPASYGSPSTQK  434

Query  1060  RLPAPVQSEPSALDPGMLIGGS--SYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqq  887
             +L  P ++  ++        GS  SYN N    Y+  S  + ++   QYE +   P  Q 
Sbjct  435   QLSQPAKAGQTSTGTTSEADGSTISYNGNQAGHYTANSQSIPANVTTQYERSSLTPESQL  494

Query  886   qlmnnsqqmqNARYDNNVGLALGPPQSSC-----FPTVGS-SVQQTNLNSFEDWSNTRD-  728
                    Q   A   +N+ LALGPPQ        F  +G  S+Q T +N F+DWS  ++ 
Sbjct  495   NGSALQNQ---ASRGSNM-LALGPPQQHQQQNFEFSALGGQSMQPTGMNPFDDWSQPQEN  550

Query  727   -KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSP-S  554
               GV++YL EE IR+RSHE+LENE+MQ +LR+ SMGG AS N+ EDGF F  +M  +P +
Sbjct  551   RSGVDDYLMEE-IRMRSHEILENEEMQQMLRILSMGG-ASTNLTEDGFSFPNYMPSTPPN  608

Query  553   FGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             F Y +DR RP G+AVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  609   FNYADDRARPSGRAVVGWLKIKAAMRWGIFVRKKAAERRAQ  649



>ref|XP_010525739.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104803505 
[Tarenaya hassleriana]
Length=636

 Score =   201 bits (511),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 121/268 (45%), Positives = 164/268 (61%), Gaps = 28/268 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSF-KNKKA----RNELPMGQVDYSNSLNNQLQQ  1064
             KVYVD LVKKAYENW    EYDG++L+ F + +KA      +L +G  +Y          
Sbjct  366   KVYVDGLVKKAYENWDQVIEYDGQSLMDFNQARKAGSSKSQQLLLGNENYP---------  416

Query  1063  PRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  884
               +P  +  + S+    + +  S Y+ N  A Y +QS + +SSS   + N  FA      
Sbjct  417   --MPMAIPGQQSSSHSDITVEASVYDGNPAAGYQSQSQLDNSSSYSHFGNVSFA-TQDHL  473

Query  883   lmnnsqqmqNARYDNNVGLALGPPQSS-----CFPTVGSSV--QQTNLNSFEDWSNTRDK  725
             + N ++       +  V LALGPPQ S       P   S++  Q +N+NSF+DWSNT ++
Sbjct  474   ISNPNESQSMMNSNGAVRLALGPPQLSPTGFQTTPVSSSTMRAQPSNINSFDDWSNTHER  533

Query  724   GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFG  548
             G EE+LSEEEIR RS+E+LEN+DMQ LLRLFSMG   + N+P+DG+GF  F+ +P P+F 
Sbjct  534   GAEEFLSEEEIRARSNEILENDDMQQLLRLFSMGDQQASNVPDDGYGFHSFIHSPMPNF-  592

Query  547   YDEDRPRPGKAVVGWLKIKAAMRWGFFI  464
               EDR + GKAVVGWLKIKAAMRWGFF+
Sbjct  593   --EDRTQSGKAVVGWLKIKAAMRWGFFV  618



>ref|XP_006647389.1| PREDICTED: uncharacterized protein LOC102720488 isoform X2 [Oryza 
brachyantha]
Length=654

 Score =   201 bits (511),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 127/280 (45%), Positives = 167/280 (60%), Gaps = 21/280 (8%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             K+Y D LVKKAYE+W+   EYDGK LLSFK KK     R++      +   S  +   Q 
Sbjct  375   KIYADGLVKKAYEDWMHVVEYDGKALLSFKQKKKSVTTRSDTAAAATNNPASYGSPSTQK  434

Query  1060  RLPAPVQSEPSALDPGMLIGGS-SYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  884
             +L  P ++  ++       G + SYN N    Y+  S  + ++   QYE +   P  Q  
Sbjct  435   QLSQPAKAGQTSTGTTSEDGSTISYNGNQAGHYTANSQSIPANVTTQYERSSLTPESQLN  494

Query  883   lmnnsqqmqNARYDNNVGLALGPPQSSC-----FPTVGS-SVQQTNLNSFEDWSNTRD--  728
                   Q   A   +N+ LALGPPQ        F  +G  S+Q T +N F+DWS  ++  
Sbjct  495   GSALQNQ---ASRGSNM-LALGPPQQHQQQNFEFSALGGQSMQPTGMNPFDDWSQPQENR  550

Query  727   KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSP-SF  551
              GV++YL EE IR+RSHE+LENE+MQ +LR+ SMGG AS N+ EDGF F  +M  +P +F
Sbjct  551   SGVDDYLMEE-IRMRSHEILENEEMQQMLRILSMGG-ASTNLTEDGFSFPNYMPSTPPNF  608

Query  550   GYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              Y +DR RP G+AVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  609   NYADDRARPSGRAVVGWLKIKAAMRWGIFVRKKAAERRAQ  648



>ref|XP_009375849.1| PREDICTED: uncharacterized protein LOC103964603 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009375923.1| PREDICTED: uncharacterized protein LOC103964603 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009375988.1| PREDICTED: uncharacterized protein LOC103964603 isoform X1 [Pyrus 
x bretschneideri]
Length=638

 Score =   200 bits (509),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 127/284 (45%), Positives = 163/284 (57%), Gaps = 41/284 (14%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  1061
             KVYVD LV KAYENW+   EYDGK+LL  K +K+ +    E+P    DY NS + Q   P
Sbjct  370   KVYVDGLVTKAYENWMHVMEYDGKSLL--KQQKSPDVSLPEVPTASQDYPNSFDQQFTLP  427

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LPA V SEP  +D G+ +GG  Y ++M  R+S +S  ++ S+  Q +   F        
Sbjct  428   SLPASVSSEPPTMDSGLNVGG--YTDSMANRFSVESQNINLSAPSQLDGLSFP-----LQ  480

Query  880   mnnsqqmqNARYDNNVG-LALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
                      A++  N   LALGPPQSS   F  +G+S             N   +G E+ 
Sbjct  481   NQQPITSHQAQFQGNENMLALGPPQSSTSGFQNIGTS-------------NPSYRGAEDL  527

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGH----------ASVNIPEDGFGFTPFMAPS  560
               EEEIR+RSHE+LENEDMQHLLR+F+MGG           AS+NI ED + ++    P+
Sbjct  528   FPEEEIRMRSHEILENEDMQHLLRIFNMGGQGQGQGHGYGHASMNITEDNYPYSSPYMPT  587

Query  559   PSFGY--DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             P   Y  D+     GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  588   PQVNYSVDDQSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  631



>ref|XP_009376054.1| PREDICTED: uncharacterized protein LOC103964603 isoform X2 [Pyrus 
x bretschneideri]
Length=637

 Score =   200 bits (508),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 127/284 (45%), Positives = 163/284 (57%), Gaps = 41/284 (14%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  1061
             KVYVD LV KAYENW+   EYDGK+LL  K +K+ +    E+P    DY NS + Q   P
Sbjct  369   KVYVDGLVTKAYENWMHVMEYDGKSLL--KQQKSPDVSLPEVPTASQDYPNSFDQQFTLP  426

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LPA V SEP  +D G+ +GG  Y ++M  R+S +S  ++ S+  Q +   F        
Sbjct  427   SLPASVSSEPPTMDSGLNVGG--YTDSMANRFSVESQNINLSAPSQLDGLSFP-----LQ  479

Query  880   mnnsqqmqNARYDNNVG-LALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
                      A++  N   LALGPPQSS   F  +G+S             N   +G E+ 
Sbjct  480   NQQPITSHQAQFQGNENMLALGPPQSSTSGFQNIGTS-------------NPSYRGAEDL  526

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGH----------ASVNIPEDGFGFTPFMAPS  560
               EEEIR+RSHE+LENEDMQHLLR+F+MGG           AS+NI ED + ++    P+
Sbjct  527   FPEEEIRMRSHEILENEDMQHLLRIFNMGGQGQGQGHGYGHASMNITEDNYPYSSPYMPT  586

Query  559   PSFGY--DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             P   Y  D+     GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  587   PQVNYSVDDQSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  630



>ref|XP_010467708.1| PREDICTED: uncharacterized protein LOC104747723 [Camelina sativa]
 ref|XP_010467709.1| PREDICTED: uncharacterized protein LOC104747723 [Camelina sativa]
Length=629

 Score =   199 bits (507),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 125/274 (46%), Positives = 162/274 (59%), Gaps = 34/274 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             K YVD LV+KAYENW    EYD K+L++F N+  + +     +DYS           +P 
Sbjct  371   KDYVDGLVRKAYENWDQVIEYDSKSLMNF-NQVGKTD----AIDYS-----------MPV  414

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  869
                S+PS     + +  S YN++  + +  QS I  +++ M + N+ FAP DQ     + 
Sbjct  415   SGPSQPSTSYSDVTVEASVYNQSPASSFPGQSQIADTTTYMHFGNSSFAPQDQLINNTHE  474

Query  868   qqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQT------NLNSFEDWSNTRDKGVEEYL  707
              Q      +  V LALGP         GS  QQ        +NS+ DWSNT ++GV+ +L
Sbjct  475   SQTM-INSNGGVRLALGP-------ATGSQNQQLVQPPPPEINSYNDWSNTCNRGVDGFL  526

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGG---HASVNIPEDGFGFTPFMAPSPSFGYDED  536
             SEEEIR RS+EMLEN+DMQ LLRLFSM G      +N+ EDGFGF  F   S +  Y+ED
Sbjct  527   SEEEIRARSNEMLENDDMQQLLRLFSMNGGDQQTQMNMGEDGFGFHSFGETSMA-DYEED  585

Query  535   RPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             R   GKAVVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  586   RSNSGKAVVGWLKIKAAMRWGFFIRRKAAQRRAQ  619



>ref|XP_010414641.1| PREDICTED: uncharacterized protein LOC104700762 [Camelina sativa]
 ref|XP_010414649.1| PREDICTED: uncharacterized protein LOC104700762 [Camelina sativa]
Length=624

 Score =   199 bits (507),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 124/274 (45%), Positives = 163/274 (59%), Gaps = 34/274 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             K YVD LV+KAYENW    EYD K+L++F N+  + +     +DYS           +P 
Sbjct  366   KGYVDGLVRKAYENWDQVIEYDSKSLMNF-NQVGKTD----AIDYS-----------MPV  409

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  869
              V S+PS     + +  S YN++  + +  QS +  +++ M + N+ +AP DQ     + 
Sbjct  410   SVPSQPSTSYSDVTVEASVYNQSPASSFPGQSQLADTTTYMHFGNSSYAPQDQLINNTHE  469

Query  868   qqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQT------NLNSFEDWSNTRDKGVEEYL  707
              Q      +  V LALGP         GS  QQ        +NS+ DWSNT ++GV+ +L
Sbjct  470   SQSM-INSNGGVRLALGP-------ATGSQNQQLVQPPPPEINSYNDWSNTCNRGVDGFL  521

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGG---HASVNIPEDGFGFTPFMAPSPSFGYDED  536
             SEEEIR RS+EMLEN+DMQ LLRLFSM G      +N+ EDGFGF  F   S +  Y+ED
Sbjct  522   SEEEIRARSNEMLENDDMQQLLRLFSMNGGEQQTPMNMGEDGFGFHSFGETSMA-DYEED  580

Query  535   RPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             R   GKAVVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  581   RSNSGKAVVGWLKIKAAMRWGFFIRRKAAQRRAQ  614



>ref|XP_006297211.1| hypothetical protein CARUB_v10013220mg [Capsella rubella]
 gb|EOA30109.1| hypothetical protein CARUB_v10013220mg [Capsella rubella]
Length=624

 Score =   199 bits (507),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 123/274 (45%), Positives = 162/274 (59%), Gaps = 34/274 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             K YVD LV+KAYENW    EYD K+L++F          +G+ D ++          +P 
Sbjct  366   KGYVDGLVRKAYENWDQVIEYDSKSLMNFDQ--------VGKTDATDY--------SMPV  409

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  869
              V S+PS     + +  S YN++  + +  QS +  +++ MQ+ N+ +AP DQ     + 
Sbjct  410   SVPSQPSTSYSDVTVEASVYNQSPASSFPGQSQLADTTTYMQFGNSSYAPQDQLINNTHE  469

Query  868   qqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQT------NLNSFEDWSNTRDKGVEEYL  707
              Q      +  V LALGP         GS  QQ        +NS+ DWSNT ++GV+ +L
Sbjct  470   SQSM-INSNGGVRLALGP-------ATGSQNQQQLVQPPPEINSYNDWSNTCNRGVDGFL  521

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGG---HASVNIPEDGFGFTPFMAPSPSFGYDED  536
             SEEEIR RS+EMLEN+DMQ LLRLFSM G      +N+ EDGFGF  F   S +  Y+ED
Sbjct  522   SEEEIRARSNEMLENDDMQQLLRLFSMNGGDQQTPMNMGEDGFGFHSFGQTSMA-DYEED  580

Query  535   RPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             R   GKAVVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  581   RSNSGKAVVGWLKIKAAMRWGFFIRRKAAQRRAQ  614



>ref|XP_007148242.1| hypothetical protein PHAVU_006G191900g [Phaseolus vulgaris]
 gb|ESW20236.1| hypothetical protein PHAVU_006G191900g [Phaseolus vulgaris]
Length=638

 Score =   199 bits (506),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 127/280 (45%), Positives = 166/280 (59%), Gaps = 33/280 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNE-----LPMGQVDYS--NSLNNQL  1070
             KVYVD+LVKKAYENW+   EYDGK+LL+    K          P+G  DYS  NSL+ Q 
Sbjct  370   KVYVDTLVKKAYENWMHVIEYDGKSLLNANQNKTLGASQPLLAPVGSHDYSISNSLDQQT  429

Query  1069  QQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndq  890
               P LP PV +   ++DP + +GG  Y+     R S Q       S +Q++NT F   +Q
Sbjct  430   SMPNLPDPVTTGQPSMDPAITVGG--YHNATTIRSSMQPQNDDLHSSIQFDNTAFPLQNQ  487

Query  889   qqlmnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRD--KGVE  716
                 ++  Q+      N   L LG            S QQ   + F++ SN+    +G+E
Sbjct  488   LLNASHQSQLPI----NENELTLG------------SRQQPATHGFQNVSNSNPCYRGLE  531

Query  715   EYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG---HASVNIPEDGFGFTPFMAPSPSFGY  545
             +Y  EEEIR RSHEMLENEDMQ+LLR+F+MGG   HAS N PED + ++    P+ S GY
Sbjct  532   DYFPEEEIRTRSHEMLENEDMQNLLRIFNMGGGQSHASFNTPEDAYPYSSTYMPATSMGY  591

Query  544   --DEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
               D++R R  GKAVVGWLK+KAA+RWG FIRK+AAE+RAQ
Sbjct  592   HLDDERNRSSGKAVVGWLKLKAALRWGIFIRKRAAEKRAQ  631



>ref|XP_010489590.1| PREDICTED: uncharacterized protein LOC104767243 [Camelina sativa]
 ref|XP_010489591.1| PREDICTED: uncharacterized protein LOC104767243 [Camelina sativa]
 ref|XP_010489592.1| PREDICTED: uncharacterized protein LOC104767243 [Camelina sativa]
Length=624

 Score =   198 bits (504),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 124/274 (45%), Positives = 165/274 (60%), Gaps = 34/274 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             K YVD LV+KAYENW    EYD K+L++F N+  + +     +DYS           +P 
Sbjct  366   KGYVDGLVRKAYENWDQVIEYDSKSLMNF-NQVGKTD----AIDYS-----------MPV  409

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  869
              V S+PS     + +  S YN++  + +  QS +  +++ M + N+ FAP DQ     N 
Sbjct  410   SVPSQPSTSYSDVTVEASVYNQSPASSFPGQSQLADTTTYMHFGNSSFAPQDQLINNTNE  469

Query  868   qqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQT------NLNSFEDWSNTRDKGVEEYL  707
              Q   +  +NN G+ L    ++     GS  QQ        +NS+ DWSNT ++GV+ +L
Sbjct  470   SQ---SMINNNGGVRLAFGAAT-----GSQNQQLVQPPPPEINSYNDWSNTCNRGVDGFL  521

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGG---HASVNIPEDGFGFTPFMAPSPSFGYDED  536
             SEEEIR RS+EMLEN+DMQ LLRLFSM G      +N+ EDGFGF  F   S +  Y+ED
Sbjct  522   SEEEIRARSNEMLENDDMQQLLRLFSMNGGDQQTQMNMGEDGFGFHTFGETSMA-DYEED  580

Query  535   RPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             R   GKAVVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  581   RSNSGKAVVGWLKIKAAMRWGFFIRRKAAQRRAQ  614



>ref|XP_006845603.1| PREDICTED: uncharacterized protein LOC18435496 [Amborella trichopoda]
 gb|ERN07278.1| hypothetical protein AMTR_s00019p00206980 [Amborella trichopoda]
Length=630

 Score =   198 bits (504),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 121/272 (44%), Positives = 173/272 (64%), Gaps = 28/272 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFK-NKKARNELPMGQVDYSNSLNNQLQQPRLP  1052
             K++VD+LVK+AY+NW+   EYDGK LL++K ++KA +       +YS +L+ Q    R P
Sbjct  374   KLHVDTLVKRAYDNWMHVVEYDGKALLNYKQSRKASSS------NYSIALDQQPSITRAP  427

Query  1051  APVQSEPSALDPGMLIGG---SSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
               V  E S+++    +GG   SSY EN   RYS+Q   +++++++Q+ N  FA     Q 
Sbjct  428   VQVPMEQSSVNAMSAVGGASISSYGENPATRYSSQPDQLTANNQVQFNNNHFA----TQQ  483

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRD-KGVEEYLS  704
                     +A     VGLALGPP S+ F T+  +V QT     +DW+  RD +G+++Y +
Sbjct  484   NQLVSTSHHAPQGPQVGLALGPPLSTGFQTM--NVGQT---PADDWARHRDARGLDDYFT  538

Query  703   EEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGYDEDRPR  527
             EEEIR+RS EMLENEDMQHLLRLFSMGG+       D + +  ++ +P+ ++ Y+    R
Sbjct  539   EEEIRMRSSEMLENEDMQHLLRLFSMGGNT------DAYSYPSYIPSPATNYTYEMCPGR  592

Query  526   P-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             P GKA VGWLKIKAA+RWG F+RK AAE+RAQ
Sbjct  593   PSGKAAVGWLKIKAALRWGIFVRKIAAEKRAQ  624



>ref|XP_004504984.1| PREDICTED: uncharacterized protein LOC101509425 [Cicer arietinum]
Length=627

 Score =   196 bits (499),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 121/274 (44%), Positives = 169/274 (62%), Gaps = 27/274 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNEL----PMGQVDYSNSLNNQLQQP  1061
             K+YVD+LVKKAY+NW+   EYDGK+LLS+   K  + L    PMG  +YSNS+  Q+  P
Sbjct  365   KIYVDTLVKKAYDNWMHVIEYDGKSLLSYNQDKNLDTLHPQDPMGSHEYSNSIQ-QISIP  423

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LP PV +   +++ G ++G   Y++    R+   S   + +S +Q+++  F+   Q   
Sbjct  424   SLPQPVHTGQPSMETGAIVG--VYHDGTTTRFPLPSQNANLNSSIQFDDNAFSLQSQLMS  481

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  701
             + +  Q+Q     N  GL  G PQ++      +S+           SN+  +GVE+   E
Sbjct  482   VPHQAQLQR----NENGLTHGLPQTATHGFQTASI-----------SNSTYRGVEDLFPE  526

Query  700   EEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFTPFMAPS--PSFGYDEDR  533
             EEIR+RSHEMLENEDMQHLLR+F+MGG  HAS N  E+G+  T    PS   S+ +D++ 
Sbjct  527   EEIRIRSHEMLENEDMQHLLRIFNMGGHAHASFNAHEEGYPNTSTYMPSNHTSYNFDDEP  586

Query  532   PR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              R  GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  587   NRSSGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  620



>ref|XP_008364142.1| PREDICTED: uncharacterized protein LOC103427840 isoform X1 [Malus 
domestica]
 ref|XP_008364143.1| PREDICTED: uncharacterized protein LOC103427840 isoform X1 [Malus 
domestica]
Length=638

 Score =   196 bits (499),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 128/283 (45%), Positives = 165/283 (58%), Gaps = 39/283 (14%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  1061
             KVYVD LV KAYENW+   EYDGK+LL  K +K+ +    E+P    DY NS + Q   P
Sbjct  370   KVYVDGLVTKAYENWMHVMEYDGKSLL--KQEKSPDVSLSEVPTASQDYPNSFDQQFTLP  427

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LPA V SEP  +D G+ +GG  Y + M  R+S +S  ++ S+  Q +   F        
Sbjct  428   SLPASVSSEPPTMDSGLNVGG--YTDGMANRFSVESQNLNLSAPSQLDGLPFP-----LQ  480

Query  880   mnnsqqmqNARYDNNVG-LALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
                      A++  N   LALGPPQSS   F  +G+S    N +S+        +G E+ 
Sbjct  481   NQQPITSHQAQFQRNENMLALGPPQSSTSGFQNIGTS----NPSSY--------RGAEDL  528

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGH--------ASVNIPEDGFGFTPFMAPSPS  554
               EEEIR+RSHE+LENEDMQ LL +F+MGG         AS+NI ED + ++    P+P 
Sbjct  529   FPEEEIRMRSHEILENEDMQRLLHIFNMGGQGQGHGYGHASMNITEDNYPYSSPYVPTPQ  588

Query  553   FGY--DEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
               Y  D+D  R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  589   VNYSVDDDHSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  631



>ref|XP_008364144.1| PREDICTED: uncharacterized protein LOC103427840 isoform X2 [Malus 
domestica]
Length=637

 Score =   196 bits (499),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 128/283 (45%), Positives = 165/283 (58%), Gaps = 39/283 (14%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  1061
             KVYVD LV KAYENW+   EYDGK+LL  K +K+ +    E+P    DY NS + Q   P
Sbjct  369   KVYVDGLVTKAYENWMHVMEYDGKSLL--KQEKSPDVSLSEVPTASQDYPNSFDQQFTLP  426

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LPA V SEP  +D G+ +GG  Y + M  R+S +S  ++ S+  Q +   F        
Sbjct  427   SLPASVSSEPPTMDSGLNVGG--YTDGMANRFSVESQNLNLSAPSQLDGLPFP-----LQ  479

Query  880   mnnsqqmqNARYDNNVG-LALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
                      A++  N   LALGPPQSS   F  +G+S    N +S+        +G E+ 
Sbjct  480   NQQPITSHQAQFQRNENMLALGPPQSSTSGFQNIGTS----NPSSY--------RGAEDL  527

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGH--------ASVNIPEDGFGFTPFMAPSPS  554
               EEEIR+RSHE+LENEDMQ LL +F+MGG         AS+NI ED + ++    P+P 
Sbjct  528   FPEEEIRMRSHEILENEDMQRLLHIFNMGGQGQGHGYGHASMNITEDNYPYSSPYVPTPQ  587

Query  553   FGY--DEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
               Y  D+D  R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  588   VNYSVDDDHSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  630



>gb|AAL11615.1|AF424622_1 At2g18750/MSF3.13 [Arabidopsis thaliana]
 gb|AAN28789.1| At2g18750/MSF3.13 [Arabidopsis thaliana]
Length=315

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 121/274 (44%), Positives = 160/274 (58%), Gaps = 37/274 (14%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             K YVD LV+KAYENW    EYD K+L++F      ++     +DYS           +P 
Sbjct  61    KGYVDGLVRKAYENWEQVIEYDSKSLMNFNQVSKTDD-----IDYS-----------MPV  104

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  869
              V S+PS     + +   +YN++  + +  QS  ++ ++ M + N+ FAP DQ     + 
Sbjct  105   SVPSQPSTSYSDVTV--EAYNQSPASSFPGQSQ-LADTTYMHFGNSSFAPQDQLVNNTHE  161

Query  868   qqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQT------NLNSFEDWSNTRDKGVEEYL  707
              Q      +  V LALGP         GS  Q+        +NS+ DWSNT ++GV+ +L
Sbjct  162   SQSM-INSNGGVRLALGP-------ATGSQNQEQLVHPPPEINSYNDWSNTCNRGVDGFL  213

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGG---HASVNIPEDGFGFTPFMAPSPSFGYDED  536
             SEEEIR RS+EMLEN+DMQ LLRLFSM G      +N+ ED FGF  F   S +  Y+ED
Sbjct  214   SEEEIRARSNEMLENDDMQQLLRLFSMNGGDQQTPLNMGEDSFGFHSFGQTSMA-DYEED  272

Query  535   RPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             R   GKAVVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  273   RSNSGKAVVGWLKIKAAMRWGFFIRRKAAQRRAQ  306



>emb|CDO99627.1| unnamed protein product [Coffea canephora]
Length=633

 Score =   194 bits (494),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 125/276 (45%), Positives = 169/276 (61%), Gaps = 30/276 (11%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQP  1061
             K+YVD+LVKKAYENW+   EYDGK LLSF   K+    ++++  G  + SNS + Q+  P
Sbjct  370   KLYVDTLVKKAYENWMHVIEYDGKALLSFAENKSSSAPQSDIATGSQNDSNSFDYQVNLP  429

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LP  + SE  ++ P   IG   Y+EN G+R+  QS  M+ +  +    +    ++Q   
Sbjct  430   SLPPLIPSEQPSISPVQTIG---YDENGGSRFQMQSQSMNLNPTIHIHGSSLPLHNQMIT  486

Query  880   mnnsqqmqNARYDNNVGLALGPPQSS--CFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
              ++          N   LALGP QSS   F   G S    NL+++        +G ++  
Sbjct  487   TSSQVHSPT----NTNLLALGPLQSSMSSFHAPGPS----NLSNY--------RGFDDVF  530

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGF-TPFMAPSPS-FGYDE  539
             SEE+IRLRSHEMLENEDMQ+LLR+F+MGG  H  VN  E+ + +   +MA + S + +DE
Sbjct  531   SEEDIRLRSHEMLENEDMQNLLRIFNMGGYGHTPVNGTENNYQYPLGYMAGTSSGYAFDE  590

Query  538   DRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             DR RP GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  591   DRTRPSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  626



>ref|XP_009394895.1| PREDICTED: uncharacterized protein LOC103980282 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394896.1| PREDICTED: uncharacterized protein LOC103980282 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394897.1| PREDICTED: uncharacterized protein LOC103980282 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394898.1| PREDICTED: uncharacterized protein LOC103980282 [Musa acuminata 
subsp. malaccensis]
Length=633

 Score =   194 bits (494),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 124/274 (45%), Positives = 169/274 (62%), Gaps = 18/274 (7%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KV+ D+LVKKAY+NW    EYDGK LLS  + K     R+E      ++S+S +    Q 
Sbjct  358   KVFADTLVKKAYDNWACVIEYDGKALLSLTSNKKTITTRSE-SRALANFSDSYDCPPSQQ  416

Query  1060  RLPAPVQSEPSALDPGMLI-GGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqq  884
             +L  P  +  S  D GM+  G S Y +N   R S+   ++ S++++ YE+T   P +Q  
Sbjct  417   QLSVPALTVQSLTDTGMVSEGDSGYGDNQMTRCSSHPQLVISNAQLHYEDTSLTPQNQFC  476

Query  883   lmnnsqqmqNARYDNNVGLALGPPQ--SSCFPTVGSSVQQTNLNSFEDWSNTRDK-GVEE  713
               +   Q+     +++ GLALGP Q  SS F  VG  +  +NLNS+ DWSN R   GV++
Sbjct  477   ESSGLAQVSR---NDSFGLALGPSQHSSSEFQLVGQPMLSSNLNSYYDWSNQRQSHGVDD  533

Query  712   YLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGF---GFTPFMAPSPSFGYD  542
             YL+EEEIR+RSHE+LENE+MQ LLR F +G  +S N+P +GF    F    +P  +F  D
Sbjct  534   YLTEEEIRMRSHEILENEEMQQLLRHFMVG--SSSNVPGNGFESPSFVSPPSPPFNFDVD  591

Query  541   EDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERR  440
             ++R   GKAVVGWLKIKAAMRWG FIRKK A+RR
Sbjct  592   QNRS-SGKAVVGWLKIKAAMRWGIFIRKKVAQRR  624



>gb|EYU42432.1| hypothetical protein MIMGU_mgv1a025463mg [Erythranthe guttata]
Length=648

 Score =   194 bits (493),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 140/291 (48%), Positives = 170/291 (58%), Gaps = 47/291 (16%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKN-KKARNELPMG-QVDYSNSLNNQLQQPRL  1055
             KVYVD LVK AY+NW    EYDGK+LL+ K  KK+R ++P+G  ++Y NSL+ Q+   RL
Sbjct  372   KVYVDKLVKTAYDNWNQVVEYDGKSLLNSKQIKKSREDIPVGPTINYPNSLDIQIPH-RL  430

Query  1054  PAPVQSEPSALDPGMLIGGSS-YNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  878
                + SEPS +D  +L G S  Y +N+ A Y  QSH  S    + + + +  P++Q Q  
Sbjct  431   SVSIPSEPS-MDQSVLSGDSGGYTDNISASYLTQSH--SQFDTVSFTHHEVNPHNQFQSQ  487

Query  877   nnsqqmqNARYDNNVGLALGPPQSSCFPTVGSS-----------VQQTNLNSF--EDWSN  737
                       Y   V LAL PPQSS   +                Q  N+N F  E+W  
Sbjct  488   T---------YSEKVNLALAPPQSSPQSSFQHGNSSSSSVSSLHHQSNNVNPFLSEEWPT  538

Query  736   TRD---KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIP--EDGFGFTP-  575
              RD   KG  ++LSEE+IRLRSHE+LENEDMQHLLRLFSMGG    N+P  ED F F   
Sbjct  539   NRDDNNKGGIDFLSEEDIRLRSHEILENEDMQHLLRLFSMGG----NVPPVEDSFSFPSS  594

Query  574   ----FMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
                   APSP    D    R GKAVVGWLKIKAAMRWG FIRKKAAERRAQ
Sbjct  595   SSSYMTAPSP----DYRGARSGKAVVGWLKIKAAMRWGIFIRKKAAERRAQ  641



>gb|KDO75731.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
Length=623

 Score =   193 bits (491),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 129/275 (47%), Positives = 175/275 (64%), Gaps = 33/275 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPM----GQVDYSNSLNNQLQQP  1061
             KV+VD+LVKKAY+NW+   EYDGK+LL F   K+ +  P     G  +Y+N  + QL  P
Sbjct  365   KVHVDTLVKKAYDNWMHVIEYDGKSLLGFTQNKSVDAPPTDFQTGPPNYTNPFSQQLALP  424

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              L  PV  E  ++D G       YN+ + +R+S QS  ++ +S  Q++ T F    Q  L
Sbjct  425   TLSVPVPPEQPSMDSG-------YNDGIPSRFSLQSQNVNINS--QFDGTSFP--QQNPL  473

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  701
             ++   +    R +N   LALGPPQSS    V  ++  +N   +        +G+E++ SE
Sbjct  474   VSVPHEAHIPRSENV--LALGPPQSSSL--VSQTIGTSNPAPY--------RGIEDFFSE  521

Query  700   EEIRLRSHEMLENEDMQ-HLLRLFSMGG--HASVNIPEDGFGFT-PFMA-PSPSFGYDED  536
             EEIR+RSHEMLENEDMQ HLLR+F+MGG  H S N+ ED + ++ PFMA PSP++ +D+D
Sbjct  522   EEIRMRSHEMLENEDMQQHLLRIFNMGGQGHPSFNVAEDAYPYSSPFMANPSPNYSFDDD  581

Query  535   RPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
               R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  582   SSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  616



>ref|XP_011096210.1| PREDICTED: uncharacterized protein LOC105175464 [Sesamum indicum]
Length=636

 Score =   194 bits (492),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 133/281 (47%), Positives = 174/281 (62%), Gaps = 37/281 (13%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNE----LPMGQVDYSNSLNNQLQQP  1061
             KV+VD+LVKKAYENW+   EYDGK+LL +   K+ N     L +   D  NS + QL  P
Sbjct  370   KVFVDTLVKKAYENWMHVIEYDGKSLLGYDQSKSSNSSQNDLRIHIQDQPNSFD-QLSLP  428

Query  1060  RLPAP--VQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqq  887
              LP P  + +EP   +PG+ IGG  YN+N+ +RY  Q   M+ +  +Q +   F P +Q 
Sbjct  429   NLPIPSSIPAEPPT-NPGLTIGG--YNDNIVSRYPTQPQNMNLNVSIQLDGASFPPQNQL  485

Query  886   qlmnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEE  713
                    Q   +    NV LALG P S+   FPT G+S    NL S+        +G E+
Sbjct  486   INSVQQAQPSGSE---NV-LALGLPHSTTLSFPTGGTS----NLTSY--------RGFED  529

Query  712   YLSEEEIRLRSHEMLENEDMQHLLRLFSM------GGHASVNIPEDGFGFTPFMAPSPS-  554
              + E+EIR+RSHEMLENEDMQHLLR+FSM       GHAS N+ E+ + ++ +   +PS 
Sbjct  530   -IPEDEIRIRSHEMLENEDMQHLLRVFSMGGHGHGHGHASFNVNENNYAYSAYTPMTPST  588

Query  553   FGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             FG+D DR RP GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  589   FGFDVDRTRPSGKAVVGWLKLKAALRWGIFIRKRAAERRAQ  629



>ref|XP_002886266.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62525.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
Length=621

 Score =   193 bits (491),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 163/273 (60%), Gaps = 36/273 (13%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             K YVD LV+KAYENW    EYD K+L++F N+ ++ +     +DYS           +P 
Sbjct  368   KGYVDGLVRKAYENWDQVIEYDSKSLMNF-NQVSKTD----AIDYS-----------MPV  411

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  869
              V S+PS     + +   +YNE+  + +  QS  ++ ++ M + N+ FAP D      + 
Sbjct  412   SVPSQPSTSYSDVTV--EAYNESPASSFPGQSQ-LADTTYMHFGNSSFAPQDHLVNNTHE  468

Query  868   qqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQT-----NLNSFEDWSNTRDKGVEEYLS  704
              Q      ++ V LALGP         GS  QQ       +NS+ DWSNT ++GV+ +LS
Sbjct  469   SQSM-INSNSGVRLALGP-------ATGSQNQQLVQPPPEINSYNDWSNTCNRGVDGFLS  520

Query  703   EEEIRLRSHEMLENEDMQHLLRLFSMGG---HASVNIPEDGFGFTPFMAPSPSFGYDEDR  533
             EEEIR RS+EMLEN+DMQ LLRLFSM G      +N+ EDGFGF  F   +    Y+EDR
Sbjct  521   EEEIRARSNEMLENDDMQQLLRLFSMNGGDQQTPMNMGEDGFGFHSF-GQTAIADYEEDR  579

Query  532   PRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
                GKAVVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  580   SNSGKAVVGWLKIKAAMRWGFFIRRKAAQRRAQ  612



>ref|XP_003529298.1| PREDICTED: uncharacterized protein LOC100812605 [Glycine max]
Length=623

 Score =   193 bits (490),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 129/276 (47%), Positives = 169/276 (61%), Gaps = 32/276 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  1061
             KVYVD+LVKKAY+NW+   EYDGK+L++    KA +    + PM   +YSNSL  Q+  P
Sbjct  362   KVYVDTLVKKAYDNWMHVIEYDGKSLINDNEDKALDTTHPQAPMTSHEYSNSLQ-QISIP  420

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LP PV     ++D G+ +GG  Y++   +R+S Q H   +SS +Q+++  F    Q QL
Sbjct  421   ALPLPVHPGQPSMDSGVTVGG--YHDGTASRFSLQPHPNLNSS-IQFDDNAFP--LQNQL  475

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFE--DWSNTRDKGVEEYL  707
             M+ S   Q  R +N  G  +GPPQSS              + FE    SN   +GVEEY 
Sbjct  476   MSASHHAQLPRNEN--GQTIGPPQSST-------------HGFEPVSISNPTYRGVEEYF  520

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFTPFMAPSPSFGY---D  542
              EEEIR+RS+EMLENEDMQHLLR+F+MGG  H + N  +DG+  +     +   GY   D
Sbjct  521   PEEEIRIRSNEMLENEDMQHLLRIFNMGGQPHPTFNAQDDGYPSSSTYISANPMGYNFDD  580

Query  541   EDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             E     GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  581   EPNRSSGKAVVGWLKLKAALRWGIFIRKQAAERRAQ  616



>gb|KHN07315.1| hypothetical protein glysoja_027405 [Glycine soja]
Length=623

 Score =   192 bits (487),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 128/276 (46%), Positives = 168/276 (61%), Gaps = 32/276 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  1061
             KVYVD+LVKKAY+NW+   EYDGK+L++    K  +    + PM   +YSNSL  Q+  P
Sbjct  362   KVYVDTLVKKAYDNWMHVIEYDGKSLINDNEDKTLDTTHPQAPMTSHEYSNSLQ-QISIP  420

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LP PV     ++D G+ +GG  Y++   +R+S Q H   +SS +Q+++  F    Q QL
Sbjct  421   ALPLPVHPGQPSMDSGVTVGG--YHDGTASRFSLQPHPNLNSS-IQFDDNAFP--LQNQL  475

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFE--DWSNTRDKGVEEYL  707
             M+ S   Q  R +N  G  +GPPQSS              + FE    SN   +GVEEY 
Sbjct  476   MSASHHAQLPRNEN--GQTIGPPQSST-------------HGFEPVSISNPTYRGVEEYF  520

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFTPFMAPSPSFGY---D  542
              EEEIR+RS+EMLENEDMQHLLR+F+MGG  H + N  +DG+  +     +   GY   D
Sbjct  521   PEEEIRIRSNEMLENEDMQHLLRIFNMGGQPHPTFNAQDDGYPSSSTYISANPMGYNFDD  580

Query  541   EDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             E     GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  581   EPNRSSGKAVVGWLKLKAALRWGIFIRKQAAERRAQ  616



>ref|XP_006361013.1| PREDICTED: uncharacterized protein LOC102605248 [Solanum tuberosum]
Length=625

 Score =   191 bits (484),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 120/274 (44%), Positives = 158/274 (58%), Gaps = 25/274 (9%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  1061
             K YVDSLVKKAY+NW+   EYDGK+LLS    K  +    +   G  ++ NS ++QL  P
Sbjct  361   KEYVDSLVKKAYDNWMHVVEYDGKSLLSLNQNKTSDAPQYDPSTGSQNHPNSFDHQLNLP  420

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LPA   SE   ++ G+ +G   YN+++   Y+ +S   + S   Q     F+ N    +
Sbjct  421   SLPASTSSEQPPMNSGLNMGLEGYNDSLMGTYTTESQNTNVSVNEQLSGASFSQNHFVGM  480

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  701
                +QQ  +        LAL PPQ S      +S             N+  KG +++ +E
Sbjct  481   SQQAQQPGSESR-----LALHPPQPSFSSFFAAST-----------PNSSYKGTDDFFTE  524

Query  700   EEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDG---FGFTPFMAPSPSFGYDED  536
             EEIR RSHEMLEN+DMQHLL +F+MGG  HAS +  ED    +G     + S SFG DED
Sbjct  525   EEIRTRSHEMLENDDMQHLLHIFNMGGQHHASSSTSEDNNYPYGSPYMPSMSSSFGIDED  584

Query  535   RPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             R R GKAVVGWLK+KAA+RWG FIRKKAAE+RAQ
Sbjct  585   RTRSGKAVVGWLKLKAALRWGIFIRKKAAEKRAQ  618



>ref|XP_003545838.1| PREDICTED: uncharacterized protein LOC100802994 isoform X1 [Glycine 
max]
 ref|XP_006597397.1| PREDICTED: uncharacterized protein LOC100802994 isoform X2 [Glycine 
max]
Length=635

 Score =   190 bits (482),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 159/277 (57%), Gaps = 29/277 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNE----LPMGQVDYS--NSLNNQLQ  1067
             KVYVD+LVKKAYENW+   EYDG++LL++   K         P+G  DYS  NSL+ Q  
Sbjct  369   KVYVDTLVKKAYENWMHVIEYDGESLLNYNQNKTLGTSQPLAPVGSHDYSISNSLDQQTS  428

Query  1066  QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqq  887
              P LP P+ +   +++P + +GG  Y+     R S Q    +  S +Q++NT F    Q 
Sbjct  429   IPSLPVPLTTGQPSMNPAVTVGG--YHNVTTTRCSMQPQNDNLHSSIQFDNTAFP--LQN  484

Query  886   qlmnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
             QLM+ S   Q  R +N + L    P +  F  V               SN   +G+E+Y 
Sbjct  485   QLMSASHHSQFPRNENGLTLGTRQPATPGFQNVS-------------ISNPNYRGLEDYF  531

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGG---HASVNIPEDGFGFTPFMAPSPSFGY---  545
              E+EIR RSHEMLENEDMQHLLR+F+MGG   HA  N  ED + ++    P+ S      
Sbjct  532   PEDEIRTRSHEMLENEDMQHLLRIFNMGGGQSHAPFNTQEDAYPYSSAYMPAASMSSNLD  591

Query  544   DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             DE     GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  592   DEQNRSSGKAVVGWLKLKAALRWGIFIRKRAAERRAQ  628



>ref|NP_565441.2| Calmodulin-binding protein [Arabidopsis thaliana]
 ref|NP_001031372.1| Calmodulin-binding protein [Arabidopsis thaliana]
 ref|NP_001189550.1| Calmodulin-binding protein [Arabidopsis thaliana]
 dbj|BAH30392.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC06802.1| Calmodulin-binding protein [Arabidopsis thaliana]
 gb|AEC06803.1| Calmodulin-binding protein [Arabidopsis thaliana]
 gb|AEC06804.1| Calmodulin-binding protein [Arabidopsis thaliana]
Length=622

 Score =   189 bits (479),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 122/274 (45%), Positives = 163/274 (59%), Gaps = 37/274 (14%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             K YVD LV+KAYENW    EYD K+L++F N+ ++ +     +DYS           +P 
Sbjct  368   KGYVDGLVRKAYENWEQVIEYDSKSLMNF-NQVSKTD----DIDYS-----------MPV  411

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  869
              V S+PS     + +   +YN++  + +  QS  ++ ++ M + N+ FAP DQ     + 
Sbjct  412   SVPSQPSTSYSDVTV--EAYNQSPASSFPGQSQ-LADTTYMHFGNSSFAPQDQLVNNTHE  468

Query  868   qqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQT------NLNSFEDWSNTRDKGVEEYL  707
              Q      +  V LALGP         GS  Q+        +NS+ DWSNT ++GV+ +L
Sbjct  469   SQSM-INSNGGVRLALGP-------ATGSQNQEQLVHPPPEINSYNDWSNTCNRGVDGFL  520

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGG---HASVNIPEDGFGFTPFMAPSPSFGYDED  536
             SEEEIR RS+EMLEN+DMQ LLRLFSM G      +N+ ED FGF  F   S +  Y+ED
Sbjct  521   SEEEIRARSNEMLENDDMQQLLRLFSMNGGDQQTPLNMGEDSFGFHSFGQTSMA-DYEED  579

Query  535   RPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             R   GKAVVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  580   RSNSGKAVVGWLKIKAAMRWGFFIRRKAAQRRAQ  613



>ref|XP_009761692.1| PREDICTED: uncharacterized protein LOC104213840 isoform X2 [Nicotiana 
sylvestris]
Length=583

 Score =   188 bits (477),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 113/278 (41%), Positives = 157/278 (56%), Gaps = 29/278 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNE---------LPMGQVDYSNSLNN  1076
             K YVD+LVKKAY+NW++  EYDG++LLS    +  ++         L  G  ++S+S ++
Sbjct  315   KEYVDTLVKKAYDNWMNVVEYDGESLLSLNQNQTSDDPQNHSNSFDLTTGSQNHSSSFDH  374

Query  1075  QLQQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPn  896
             QL  P  PA + SE  A+DPG  IGG  YN++    Y+ QS   + S   Q     F P 
Sbjct  375   QLNLPNFPASISSEQPAMDPGRNIGG--YNDSRTGSYTIQSQNANLSVNEQLNGAPFPPQ  432

Query  895   dqqqlmnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVE  716
             +   +  + Q                P  S    T+       +        N   KG +
Sbjct  433   NHHFVGTSQQTQ--------------PSGSGSMQTLRPPESSFSSFFAASIPNPSYKGAD  478

Query  715   EYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFTPFMAPSPS--FG  548
             ++ +E+EIR+RSHEMLENEDMQHLLR+F+MGG  HAS +  +D + +     PS S  +G
Sbjct  479   DFFTEQEIRMRSHEMLENEDMQHLLRIFNMGGQNHASSSSTQDNYQYGSSYMPSISSTYG  538

Query  547   YDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             + EDR R GKAVVGWLK+KAA+RWG FIRK+AA++RAQ
Sbjct  539   FQEDRTRSGKAVVGWLKLKAALRWGIFIRKEAADKRAQ  576



>ref|XP_009761691.1| PREDICTED: uncharacterized protein LOC104213840 isoform X1 [Nicotiana 
sylvestris]
Length=628

 Score =   188 bits (478),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 113/278 (41%), Positives = 157/278 (56%), Gaps = 29/278 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNE---------LPMGQVDYSNSLNN  1076
             K YVD+LVKKAY+NW++  EYDG++LLS    +  ++         L  G  ++S+S ++
Sbjct  360   KEYVDTLVKKAYDNWMNVVEYDGESLLSLNQNQTSDDPQNHSNSFDLTTGSQNHSSSFDH  419

Query  1075  QLQQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPn  896
             QL  P  PA + SE  A+DPG  IGG  YN++    Y+ QS   + S   Q     F P 
Sbjct  420   QLNLPNFPASISSEQPAMDPGRNIGG--YNDSRTGSYTIQSQNANLSVNEQLNGAPFPPQ  477

Query  895   dqqqlmnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVE  716
             +   +  + Q                P  S    T+       +        N   KG +
Sbjct  478   NHHFVGTSQQTQ--------------PSGSGSMQTLRPPESSFSSFFAASIPNPSYKGAD  523

Query  715   EYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFTPFMAPSPS--FG  548
             ++ +E+EIR+RSHEMLENEDMQHLLR+F+MGG  HAS +  +D + +     PS S  +G
Sbjct  524   DFFTEQEIRMRSHEMLENEDMQHLLRIFNMGGQNHASSSSTQDNYQYGSSYMPSISSTYG  583

Query  547   YDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             + EDR R GKAVVGWLK+KAA+RWG FIRK+AA++RAQ
Sbjct  584   FQEDRTRSGKAVVGWLKLKAALRWGIFIRKEAADKRAQ  621



>ref|XP_011043290.1| PREDICTED: uncharacterized protein LOC105138780 isoform X3 [Populus 
euphratica]
Length=623

 Score =   188 bits (477),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 117/275 (43%), Positives = 161/275 (59%), Gaps = 40/275 (15%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             K+YVDSLV KAY+NW+   EYDG +LL FK  +    ++N++P GQ D+ N  ++Q   P
Sbjct  372   KIYVDSLVNKAYDNWMHVMEYDGNSLLDFKQHQGVAASQNDVPSGQQDFLNPYDHQDSLP  431

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              +  PV SE   +  G  IGG  Y +   AR+S      S ++  Q++  Q         
Sbjct  432   TISVPVPSEQPVVHSGPAIGG--YTDGAIARFSIDPQNGSLNTPFQFDAIQ---------  480

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  701
                     N    NN+ LALGPPQSS   + G      NL+          +G E++ SE
Sbjct  481   --------NPLGTNNL-LALGPPQSSTPGSQGFCTSNLNLH----------RGKEDFFSE  521

Query  700   EEIRLRSHEMLENEDMQHLLRLFSMGGH--ASVNIPEDGFGFTPFM---APSPSFGYDED  536
             EEIR RSH+MLENEDMQ LLR+F+MGG   +S ++ E G+ ++ +M   +P P++   ++
Sbjct  522   EEIRTRSHDMLENEDMQQLLRIFNMGGQGLSSNSVTEYGYPYSSYMPSPSPCPNYSLSDN  581

Query  535   RPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
               R  GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  582   PSRSSGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  616



>emb|CDY02746.1| BnaC02g11430D [Brassica napus]
Length=624

 Score =   187 bits (476),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 126/276 (46%), Positives = 164/276 (59%), Gaps = 34/276 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             KVYVD LVKKAY+NW    EYDGK+L+  K  +   E      +YS +  +       P 
Sbjct  362   KVYVDGLVKKAYDNWNLVIEYDGKSLIDMKQPQNPPE------NYSTAAFDH------PM  409

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  869
              +     +LD    IGG  Y++ M   Y     ++ S++R  +E         Q + +  
Sbjct  410   QMAGANQSLD--FTIGG--YDQTMVTSYPPHPQLLDSNTRAHFE-----VASDQLMGSVH  460

Query  868   qqmqNARYDNNVG--LALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKG---VEEYLS  704
              Q Q++ Y+ N+   LA+GPPQSS   +   ++ Q NLN FEDWSN  ++G    E++ S
Sbjct  461   PQAQSSTYNQNMNGLLAIGPPQSST--SHYQNINQANLNPFEDWSNHGERGGGGAEDFFS  518

Query  703   EEEIRLRSHEMLENEDMQHLLRLFSMGGHAS-----VNIPEDGFGFTPFMAPSPSFGYD-  542
             EEEIRLRSHEMLENEDMQ  LRLFSMGG  +      + PEDG+   P    +P  GYD 
Sbjct  519   EEEIRLRSHEMLENEDMQKFLRLFSMGGGGAGNGSPAHFPEDGYASFPSFLNTPMQGYDD  578

Query  541   EDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             EDR + G++VVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  579   EDRGQSGRSVVGWLKIKAAMRWGFFIRRKAAERRAQ  614



>ref|XP_011043289.1| PREDICTED: uncharacterized protein LOC105138780 isoform X2 [Populus 
euphratica]
Length=626

 Score =   187 bits (476),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 117/275 (43%), Positives = 161/275 (59%), Gaps = 40/275 (15%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             K+YVDSLV KAY+NW+   EYDG +LL FK  +    ++N++P GQ D+ N  ++Q   P
Sbjct  375   KIYVDSLVNKAYDNWMHVMEYDGNSLLDFKQHQGVAASQNDVPSGQQDFLNPYDHQDSLP  434

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              +  PV SE   +  G  IGG  Y +   AR+S      S ++  Q++  Q         
Sbjct  435   TISVPVPSEQPVVHSGPAIGG--YTDGAIARFSIDPQNGSLNTPFQFDAIQ---------  483

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  701
                     N    NN+ LALGPPQSS   + G      NL+          +G E++ SE
Sbjct  484   --------NPLGTNNL-LALGPPQSSTPGSQGFCTSNLNLH----------RGKEDFFSE  524

Query  700   EEIRLRSHEMLENEDMQHLLRLFSMGGH--ASVNIPEDGFGFTPFM---APSPSFGYDED  536
             EEIR RSH+MLENEDMQ LLR+F+MGG   +S ++ E G+ ++ +M   +P P++   ++
Sbjct  525   EEIRTRSHDMLENEDMQQLLRIFNMGGQGLSSNSVTEYGYPYSSYMPSPSPCPNYSLSDN  584

Query  535   RPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
               R  GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  585   PSRSSGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  619



>gb|EAY94271.1| hypothetical protein OsI_16040 [Oryza sativa Indica Group]
Length=652

 Score =   188 bits (477),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 125/278 (45%), Positives = 173/278 (62%), Gaps = 20/278 (7%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             +++ D+LVK+AY++W++  EYDGK LL FK KK     R++       Y +S  +     
Sbjct  376   RLFADTLVKQAYDDWINVVEYDGKELLRFKQKKKSVTTRSDTAKASTSYPSSYGSTHSHK  435

Query  1060  RLPA-PVQSEPSALDPGMLIGGSSY-NENMGARYSNQSHIMSSSSRMQYENTQFAPndqq  887
             +L   PV  E S++      G  +  N ++ ARY+     +S S  M Y+ +   P +Q 
Sbjct  436   QLTGGPVNIEQSSMSSMSEDGTRNMSNGSLAARYAANPQDISQSITMPYDMSSLRPEEQF  495

Query  886   qlmnnsqqmqNARYDNNVGLALGPPQSSCF--PTVGSSVQQTNLNSFEDWSNTRDK--GV  719
                +   Q   A   +N+ LALGP Q   F    +G S+Q + LN F+DWS  ++   GV
Sbjct  496   AGSSIQTQ---ASRSSNM-LALGPTQQQNFEFSALGQSMQPSPLNPFDDWSRLQENRGGV  551

Query  718   EEYLSEEEIRLRSHEMLENE-DMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGY  545
             ++YL EE IR+RSHE+LENE DMQ +LR+ SMGG +S N+   G GF+PFM +P+P+F Y
Sbjct  552   DDYLMEE-IRVRSHEILENEEDMQQMLRILSMGG-SSANM-NHGDGFSPFMPSPAPAFNY  608

Query  544   DEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             ++DR RP GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  609   EDDRARPSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  646



>ref|NP_001052891.1| Os04g0444200 [Oryza sativa Japonica Group]
 emb|CAE02429.1| OSJNBa0058G03.4 [Oryza sativa Japonica Group]
 dbj|BAF14805.1| Os04g0444200 [Oryza sativa Japonica Group]
Length=652

 Score =   187 bits (474),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 125/278 (45%), Positives = 172/278 (62%), Gaps = 20/278 (7%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             +++ D+LVK+AY++W++  EYDGK LL FK KK     R++       Y +S  +     
Sbjct  376   RLFADTLVKQAYDDWINVVEYDGKELLRFKQKKKSVTTRSDTAKASTSYPSSYGSTHSHK  435

Query  1060  RLPA-PVQSEPSALDPGMLIGGSSY-NENMGARYSNQSHIMSSSSRMQYENTQFAPndqq  887
             +L   PV  E S++      G  +  N +  ARY+     +S S  M Y+ +   P +Q 
Sbjct  436   QLTGGPVNIEQSSMSSMSEDGTRNMSNGSQAARYAANPQDISQSITMPYDMSSLRPEEQF  495

Query  886   qlmnnsqqmqNARYDNNVGLALGPPQSSCF--PTVGSSVQQTNLNSFEDWSNTRDK--GV  719
                +   Q   A   +N+ LALGP Q   F    +G S+Q + LN F+DWS  ++   GV
Sbjct  496   AGSSIQTQ---ASRSSNM-LALGPTQQQNFEFSALGQSMQPSPLNPFDDWSRLQENRGGV  551

Query  718   EEYLSEEEIRLRSHEMLENE-DMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGY  545
             ++YL EE IR+RSHE+LENE DMQ +LR+ SMGG +S N+   G GF+PFM +P+P+F Y
Sbjct  552   DDYLMEE-IRVRSHEILENEEDMQQMLRILSMGG-SSANM-NHGDGFSPFMPSPAPAFNY  608

Query  544   DEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             ++DR RP GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  609   EDDRARPSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  646



>emb|CDY29246.1| BnaA06g25110D [Brassica napus]
Length=625

 Score =   187 bits (474),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 124/278 (45%), Positives = 156/278 (56%), Gaps = 40/278 (14%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             KVYVD LV+KAYENW    EYD K+L++F      + L     DYS           +P 
Sbjct  367   KVYVDGLVRKAYENWDQVIEYDSKSLMNFNQVNKVDAL-----DYS-----------MPV  410

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  869
              V S+PS    G     S Y+++ G  +  QS +  ++S M + N+ +AP   Q + N  
Sbjct  411   SVPSQPSTSYSGE---ASVYSQSQGTSFPAQSQLADTTSYMHFGNSSYAPPQDQLINNTH  467

Query  868   qqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQT-----NLNSFEDWSNTRDKGVEE-YL  707
             +       +    LALG        T GS  Q        +N F DWSNT ++G  + +L
Sbjct  468   ESQIMINSNGGERLALGQ-------TTGSQNQHLVQPPPEVNPFNDWSNTGNRGGGDGFL  520

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGG-------HASVNIPEDGFGFTPFMAPSPSFG  548
             SEEEIR RS+EMLEN+DMQ LLRLFSM G          +N+ EDGFGF  F   S   G
Sbjct  521   SEEEIRARSNEMLENDDMQQLLRLFSMSGGGGGGGPQTPMNMGEDGFGFQSF-GQSSMDG  579

Query  547   YDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             Y EDR +PGK VVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  580   YGEDRSQPGKPVVGWLKIKAAMRWGFFIRRKAAQRRAQ  617



>ref|XP_010057559.1| PREDICTED: uncharacterized protein LOC104445366 [Eucalyptus grandis]
 gb|KCW74752.1| hypothetical protein EUGRSUZ_E03474 [Eucalyptus grandis]
Length=621

 Score =   186 bits (473),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 119/275 (43%), Positives = 164/275 (60%), Gaps = 39/275 (14%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA---RNELPMGQVDYSNSLNNQLQQPR  1058
             KV+VD+LVKKAY+NW+   EYDGK+L+ F N+ A    +E PMGQ +YSN  + Q+  P 
Sbjct  369   KVHVDTLVKKAYDNWMHVIEYDGKSLVDFNNEDAGASCSEFPMGQQEYSNIYDQQITPPS  428

Query  1057  LPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  878
             L  P+  +    D G       YN+++  RY  Q   ++ S  +Q + + F   D     
Sbjct  429   LSVPISMDQPPADSG-------YNDSISTRYQMQPPSVNVSIPLQVDGSSFPLQDPLISS  481

Query  877   nnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLS  704
             ++  Q+          L++GP Q+S   F + G S     L  +        +G EE   
Sbjct  482   SHQTQL----------LSIGPSQASASGFHSAGPS----GLPPY--------RGAEELFP  519

Query  703   EEEIRLRSHEMLENEDMQHLLRLFSMGGH--ASVNIPEDGF-GFTPFMAP-SPSFGYDED  536
             EEEIR+RS  MLENEDMQHLLR+F+MGGH  +S +  EDG+   +P+M   S +FG++ED
Sbjct  520   EEEIRMRSLAMLENEDMQHLLRIFNMGGHTESSFHATEDGYPCSSPYMPNLSQNFGFNED  579

Query  535   RPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             R R  GKAV+GWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  580   RSRSSGKAVIGWLKLKAALRWGIFVRKKAAERRAQ  614



>ref|XP_003532556.1| PREDICTED: uncharacterized protein LOC100806393 [Glycine max]
Length=624

 Score =   186 bits (473),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 125/276 (45%), Positives = 167/276 (61%), Gaps = 32/276 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  1061
             KVYVD+LVKKAY+NW+   EYDGK+L++    K  +    + PM   +YSNSL  Q+  P
Sbjct  363   KVYVDTLVKKAYDNWMHVIEYDGKSLINDNEDKTLDTTHPQAPMTSHEYSNSLQ-QISIP  421

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LP P+     ++D G+ +GG  Y++   +R+S Q H   +SS +Q+++  F    Q QL
Sbjct  422   ALPLPLHPGQPSVDSGVAVGG--YHDGTASRFSLQPHPNLNSS-IQFDDNAFP--LQNQL  476

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFE--DWSNTRDKGVEEYL  707
             M+ S   Q  R +N  G  +GPPQSS              + FE    SN   +G EEY 
Sbjct  477   MSVSHHTQLPRNEN--GRTVGPPQSST-------------HGFEPLTISNPTYRGAEEYF  521

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFTPFMAPSPSFGY---D  542
              EEEIR+RS+EMLEN DMQHLLR+F+MGG  H ++N  +DG+  +     +   GY   D
Sbjct  522   PEEEIRIRSNEMLENNDMQHLLRIFNMGGQSHPTLNAQDDGYPSSSTYISANPMGYNFDD  581

Query  541   EDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             E     GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  582   EPNRSSGKAVVGWLKLKAALRWGIFIRKQAAERRAQ  617



>gb|KHN00110.1| hypothetical protein glysoja_028638 [Glycine soja]
Length=624

 Score =   186 bits (472),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 125/276 (45%), Positives = 167/276 (61%), Gaps = 32/276 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  1061
             KVYVD+LVKKAY+NW+   EYDGK+L++    K  +    + PM   +YSNSL  Q+  P
Sbjct  363   KVYVDTLVKKAYDNWMHVIEYDGKSLINDNEDKTLDTTHPQAPMTSHEYSNSLQ-QISIP  421

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LP P+     ++D G+ +GG  Y++   +R+S Q H   +SS +Q+++  F    Q QL
Sbjct  422   ALPLPLHPGQPSVDSGVAVGG--YHDGTASRFSLQPHPNLNSS-IQFDDNAFP--LQNQL  476

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFE--DWSNTRDKGVEEYL  707
             M+ S   Q  R +N  G  +GPPQSS              + FE    SN   +G EEY 
Sbjct  477   MSVSHHTQLPRNEN--GRTVGPPQSST-------------HGFEPLTISNPTYRGAEEYF  521

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFTPFMAPSPSFGY---D  542
              EEEIR+RS+EMLEN DMQHLLR+F+MGG  H ++N  +DG+  +     +   GY   D
Sbjct  522   PEEEIRIRSNEMLENNDMQHLLRIFNMGGQSHPTLNAQDDGYPSSSTYISANPMGYNFDD  581

Query  541   EDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             E     GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  582   EPNRSSGKAVVGWLKLKAALRWGIFIRKQAAERRAQ  617



>ref|XP_002869655.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45914.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
Length=600

 Score =   185 bits (469),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 127/269 (47%), Positives = 152/269 (57%), Gaps = 35/269 (13%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             KVYVD LVKKAYENW    EY+GK+LL+F N+  R  L + Q D   +L          A
Sbjct  355   KVYVDGLVKKAYENWNQVVEYEGKSLLNF-NQPER--LDISQTDPVTAL----------A  401

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  869
                + P +  P   I G  YN+ +    ++Q H   +      +  QF        +   
Sbjct  402   SYSTVPLSQFPEFAIEG--YNQTLA---TSQPHNPQAQFDFVSQQDQFM------GIQQP  450

Query  868   qqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEEE  695
             Q       +N  GL LGPP SS   +  + SSV Q NLN FEDW N  +    +  +EEE
Sbjct  451   QSQPTIENENVTGLVLGPPYSSTGGYQDIKSSVDQENLNPFEDWINPNEN---DLFAEEE  507

Query  694   IRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSF-GY-DEDRPRPG  521
             IR RSH+ML NEDMQ LL+LFSMGG       EDGF F  FM  +P   GY DEDR R G
Sbjct  508   IRQRSHDMLANEDMQQLLQLFSMGGGNG----EDGFAFPSFMHNTPMMQGYNDEDRGRSG  563

Query  520   KAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             KAVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  564   KAVVGWLKIKAAMRWGFFIRRKAAERRAQ  592



>ref|XP_009126828.1| PREDICTED: uncharacterized protein LOC103851701 [Brassica rapa]
 ref|XP_009126829.1| PREDICTED: uncharacterized protein LOC103851701 [Brassica rapa]
Length=625

 Score =   184 bits (468),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 126/276 (46%), Positives = 156/276 (57%), Gaps = 33/276 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             KVYVD LVKKAY+NW    EYDGK+L+  K  +   E      +YS +  +       P 
Sbjct  362   KVYVDGLVKKAYDNWNLVIEYDGKSLIDMKQPQNPPE------NYSTTAFDH------PM  409

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  869
              +     +LD    IGG  Y++ M   Y     ++ S+   QYE      +DQ     + 
Sbjct  410   QMAGANQSLD--FTIGG--YDQTMVTSYPQHPQLLDSNPGAQYE----VASDQLMGSVHQ  461

Query  868   qqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKG-----VEEYLS  704
              Q      + N  LALGPPQSS   +    + Q NLN FEDWSN  ++G      E++ S
Sbjct  462   AQSSTNNQNMNGLLALGPPQSST--SHYQHINQANLNPFEDWSNHGERGGGGGGAEDFFS  519

Query  703   EEEIRLRSHEMLENEDMQHLLRLFSMGGHASVN-----IPEDGFGFTPFMAPSPSFGYD-  542
             EEEIRLRSHEMLENEDMQ  +RLFSMGG  + N      PEDG+   P    +P  GYD 
Sbjct  520   EEEIRLRSHEMLENEDMQKFVRLFSMGGGGTGNDSVAHFPEDGYTSFPSFLNTPMQGYDD  579

Query  541   EDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             ED  R G++VVGWLKIKAAMRWGF IR+KAAERRAQ
Sbjct  580   EDSGRSGRSVVGWLKIKAAMRWGFSIRRKAAERRAQ  615



>gb|KJB57646.1| hypothetical protein B456_009G173400 [Gossypium raimondii]
Length=631

 Score =   184 bits (468),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 125/281 (44%), Positives = 164/281 (58%), Gaps = 34/281 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQP  1061
             KVYVD+LVKKAYENW+   EYD K+LL  K   +    +  +PM    Y  S+N Q   P
Sbjct  362   KVYVDALVKKAYENWMHVIEYDSKSLLGSKEDDSAGPSQANVPMDPQGYPISINQQHTLP  421

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              L  PV SE   +D  + +GG  Y+++M AR S QS  +   ++ Q+  + F    Q  L
Sbjct  422   TLSVPVPSEQPPIDSSLNVGG--YDDSMAARMSMQSQNVHLHAQNQFSGSSFT--LQNPL  477

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
             ++ S Q+Q   +DN  G ALGP QSS   F   G+S   T             KG++++ 
Sbjct  478   VSGSHQVQVPGHDN--GPALGPCQSSMPGFHEGGTSHIPTY------------KGIDDFF  523

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIP-------EDGFGFTPFMAPSPS--  554
             SEEEI++RS+EML+NEDMQHLLR+F+MG H     P       ED   +     P+PS  
Sbjct  524   SEEEIKMRSNEMLDNEDMQHLLRIFNMGSHCHATPPPPPFNAIEDTHPYPSTYMPTPSLA  583

Query  553   FGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +G+D D  R  GKAVVGWLK+KAA+RWG FIRKKAAERRA 
Sbjct  584   YGFDNDASRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAH  624



>ref|XP_010327019.1| PREDICTED: uncharacterized protein LOC101268806 isoform X3 [Solanum 
lycopersicum]
Length=588

 Score =   183 bits (465),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 117/277 (42%), Positives = 157/277 (57%), Gaps = 31/277 (11%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  1061
             K YVD+LVKKAY+NW+   EYDGK+LLS    K  +    +L  G  ++ NS ++QL  P
Sbjct  324   KEYVDTLVKKAYDNWMHVVEYDGKSLLSLDQNKTSDAPQYDLSTGSQNHPNSFDHQLNLP  383

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LPA   SE   ++ G+ +G   YN+++   Y+ +S   + S   Q     F+ N    +
Sbjct  384   SLPASTSSEQPPMNSGLNMGLEGYNDSLMGTYTTESQNTNLSVNEQLSGASFSQNHFVGM  443

Query  880   mnnsqqmqNARYDNNVGLALGPPQ---SSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
                +Q   +         AL PPQ   SS F                +  N+  KG +++
Sbjct  444   SQQAQPTGSESRP-----ALHPPQPPFSSFFAA--------------NTPNSSYKGTDDF  484

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDG---FGFTPFMAPSPSFGY  545
              +EEEIR RS EMLEN+DMQHLL +F+MGG  HAS +  ED    +G     + S SFG 
Sbjct  485   YTEEEIRTRSQEMLENDDMQHLLHIFNMGGQHHASSSTSEDNNYPYGSPYMPSMSSSFGI  544

Query  544   DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             DEDR R GKAVVGWLK+KAA+RWG FI+KKAAE+RAQ
Sbjct  545   DEDRTRSGKAVVGWLKLKAALRWGIFIKKKAAEKRAQ  581



>ref|XP_010327020.1| PREDICTED: uncharacterized protein LOC101268806 isoform X4 [Solanum 
lycopersicum]
Length=570

 Score =   183 bits (464),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 117/277 (42%), Positives = 157/277 (57%), Gaps = 31/277 (11%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  1061
             K YVD+LVKKAY+NW+   EYDGK+LLS    K  +    +L  G  ++ NS ++QL  P
Sbjct  306   KEYVDTLVKKAYDNWMHVVEYDGKSLLSLDQNKTSDAPQYDLSTGSQNHPNSFDHQLNLP  365

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LPA   SE   ++ G+ +G   YN+++   Y+ +S   + S   Q     F+ N    +
Sbjct  366   SLPASTSSEQPPMNSGLNMGLEGYNDSLMGTYTTESQNTNLSVNEQLSGASFSQNHFVGM  425

Query  880   mnnsqqmqNARYDNNVGLALGPPQ---SSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
                +Q   +         AL PPQ   SS F                +  N+  KG +++
Sbjct  426   SQQAQPTGSESRP-----ALHPPQPPFSSFFAA--------------NTPNSSYKGTDDF  466

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDG---FGFTPFMAPSPSFGY  545
              +EEEIR RS EMLEN+DMQHLL +F+MGG  HAS +  ED    +G     + S SFG 
Sbjct  467   YTEEEIRTRSQEMLENDDMQHLLHIFNMGGQHHASSSTSEDNNYPYGSPYMPSMSSSFGI  526

Query  544   DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             DEDR R GKAVVGWLK+KAA+RWG FI+KKAAE+RAQ
Sbjct  527   DEDRTRSGKAVVGWLKLKAALRWGIFIKKKAAEKRAQ  563



>ref|XP_009150716.1| PREDICTED: uncharacterized protein LOC103874061 [Brassica rapa]
 ref|XP_009150718.1| PREDICTED: uncharacterized protein LOC103874061 [Brassica rapa]
 ref|XP_009150719.1| PREDICTED: uncharacterized protein LOC103874061 [Brassica rapa]
 ref|XP_009150720.1| PREDICTED: uncharacterized protein LOC103874061 [Brassica rapa]
Length=626

 Score =   184 bits (466),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 122/279 (44%), Positives = 154/279 (55%), Gaps = 41/279 (15%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             KVYVD LV+KAYENW    EYD K+L++F      + L     DYS           +P 
Sbjct  367   KVYVDGLVRKAYENWDQVIEYDSKSLMNFNQVNKVDAL-----DYS-----------MPV  410

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  869
              V S+PS    G     S Y+++ G  +  QS +  ++S M + N+ +AP   Q + N  
Sbjct  411   SVPSQPSTSYSGE---ASVYSQSQGTSFPAQSQLADTTSYMHFGNSSYAPPQDQLINNTH  467

Query  868   qqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQT-----NLNSFEDWSNTRDKGVEE-YL  707
             +       +    LALG        T GS  Q        +N F DWSNT ++G  + +L
Sbjct  468   ESQIMINSNGGERLALGQ-------TTGSQNQHLVQPPPEINHFNDWSNTGNRGGGDGFL  520

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGG--------HASVNIPEDGFGFTPFMAPSPSF  551
             SEEEIR RS+EMLEN+DMQ LLRLF M G           +N+ EDG GF  F   S   
Sbjct  521   SEEEIRARSNEMLENDDMQQLLRLFCMSGGGGGGGGPQTPMNMGEDGLGFQSF-GQSSMD  579

Query  550   GYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             GY EDR +PGK VVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  580   GYGEDRSQPGKPVVGWLKIKAAMRWGFFIRRKAAQRRAQ  618



>ref|XP_004248099.1| PREDICTED: uncharacterized protein LOC101268806 isoform X2 [Solanum 
lycopersicum]
Length=594

 Score =   183 bits (464),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 117/277 (42%), Positives = 157/277 (57%), Gaps = 31/277 (11%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  1061
             K YVD+LVKKAY+NW+   EYDGK+LLS    K  +    +L  G  ++ NS ++QL  P
Sbjct  330   KEYVDTLVKKAYDNWMHVVEYDGKSLLSLDQNKTSDAPQYDLSTGSQNHPNSFDHQLNLP  389

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LPA   SE   ++ G+ +G   YN+++   Y+ +S   + S   Q     F+ N    +
Sbjct  390   SLPASTSSEQPPMNSGLNMGLEGYNDSLMGTYTTESQNTNLSVNEQLSGASFSQNHFVGM  449

Query  880   mnnsqqmqNARYDNNVGLALGPPQ---SSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
                +Q   +         AL PPQ   SS F                +  N+  KG +++
Sbjct  450   SQQAQPTGSESRP-----ALHPPQPPFSSFFAA--------------NTPNSSYKGTDDF  490

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDG---FGFTPFMAPSPSFGY  545
              +EEEIR RS EMLEN+DMQHLL +F+MGG  HAS +  ED    +G     + S SFG 
Sbjct  491   YTEEEIRTRSQEMLENDDMQHLLHIFNMGGQHHASSSTSEDNNYPYGSPYMPSMSSSFGI  550

Query  544   DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             DEDR R GKAVVGWLK+KAA+RWG FI+KKAAE+RAQ
Sbjct  551   DEDRTRSGKAVVGWLKLKAALRWGIFIKKKAAEKRAQ  587



>gb|EYU27904.1| hypothetical protein MIMGU_mgv1a0037712mg, partial [Erythranthe 
guttata]
Length=526

 Score =   182 bits (461),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 118/272 (43%), Positives = 158/272 (58%), Gaps = 45/272 (17%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA---RNELPMGQVDYSNSLNNQLQQPR  1058
             K +VD+LVKKAY+NW++  EYD K+LL F   K+    N+L +   D  NS + QL  P 
Sbjct  286   KGFVDTLVKKAYDNWMNVLEYDSKSLLGFDQNKSSPFENDLRIHTQDQLNSFD-QLSVPI  344

Query  1057  LPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  878
             L A +  +  +++PG+ IGG  Y++N+G RY  Q    +    +Q + T F         
Sbjct  345   LSASIPPQNPSVNPGLTIGG--YHDNLGGRYPIQPQNPNLHVALQLDGTSFP--------  394

Query  877   nnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLS  704
                       +D    LALG P S+   FPT  +S   T+   FED            + 
Sbjct  395   ----------HDQ---LALGQPISTTASFPTASTS-NVTSYRGFED------------IP  428

Query  703   EEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPS-FGYDEDRPR  527
             E+EIR+RSHEMLE+EDMQHLLR+FSMGGH   +  E  + ++ +   +PS FG+ E R R
Sbjct  429   EDEIRVRSHEMLEHEDMQHLLRMFSMGGHTPFSGNEHNY-YSAYTPATPSTFGFGEGRTR  487

Query  526   -PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
               GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  488   SSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  519



>ref|XP_004248098.1| PREDICTED: uncharacterized protein LOC101268806 isoform X1 [Solanum 
lycopersicum]
Length=625

 Score =   183 bits (464),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 117/277 (42%), Positives = 157/277 (57%), Gaps = 31/277 (11%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN----ELPMGQVDYSNSLNNQLQQP  1061
             K YVD+LVKKAY+NW+   EYDGK+LLS    K  +    +L  G  ++ NS ++QL  P
Sbjct  361   KEYVDTLVKKAYDNWMHVVEYDGKSLLSLDQNKTSDAPQYDLSTGSQNHPNSFDHQLNLP  420

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LPA   SE   ++ G+ +G   YN+++   Y+ +S   + S   Q     F+ N    +
Sbjct  421   SLPASTSSEQPPMNSGLNMGLEGYNDSLMGTYTTESQNTNLSVNEQLSGASFSQNHFVGM  480

Query  880   mnnsqqmqNARYDNNVGLALGPPQ---SSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
                +Q   +         AL PPQ   SS F                +  N+  KG +++
Sbjct  481   SQQAQPTGSESRP-----ALHPPQPPFSSFFAA--------------NTPNSSYKGTDDF  521

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDG---FGFTPFMAPSPSFGY  545
              +EEEIR RS EMLEN+DMQHLL +F+MGG  HAS +  ED    +G     + S SFG 
Sbjct  522   YTEEEIRTRSQEMLENDDMQHLLHIFNMGGQHHASSSTSEDNNYPYGSPYMPSMSSSFGI  581

Query  544   DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             DEDR R GKAVVGWLK+KAA+RWG FI+KKAAE+RAQ
Sbjct  582   DEDRTRSGKAVVGWLKLKAALRWGIFIKKKAAEKRAQ  618



>gb|ACN34699.1| unknown [Zea mays]
Length=304

 Score =   176 bits (447),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 161/287 (56%), Gaps = 35/287 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDY--SNSLNNQLQ  1067
             +V+ D+LVK+AY +W++  EYDGK LL F  KK     R+E       Y  SN L N   
Sbjct  25    EVFADTLVKQAYADWINVLEYDGKALLKFNQKKKYVTTRSETAKASASYPASNGLVNS--  82

Query  1066  QPRLPA-PVQSEPSALD----------PGMLIGGSSYNENMGARYSNQSHIMSSSSRMQY  920
             Q  LP  PV +E S+L+          P M +G     E     Y+     M+ S  MQ 
Sbjct  83    QKELPGGPVNAEQSSLNNASQADRTRIPSMSMGNQVARE-----YAGNPQHMTPSITMQC  137

Query  919   ENTQFAPndqqqlmnnsqqmqNARYDNNVGLALGP---PQSSCFPTVGSSVQQTNLNSFE  749
             +     P  Q    ++ Q    +R  N   LAL P   PQ+  F  +G S Q +  N F 
Sbjct  138   DTRSLIPGGQFSGGSSVQTQT-SRSSNM--LALRPTQQPQNLDFSGLGQSTQPSGTNPFA  194

Query  748   DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  569
             DWS  ++  V+EYL +E IR RSHE+LEN++MQH+LR  S+GG  +     DGF   P  
Sbjct  195   DWSRLQESSVDEYLMDE-IRARSHELLENDEMQHMLRFLSVGGAPTGLNNVDGFLSYP--  251

Query  568   APSPSFGYDED-RPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +P+P+FG+DED R R  GKAVVGWLKIKAAMRWG F+R+KAAERRAQ
Sbjct  252   SPAPAFGFDEDDRARSSGKAVVGWLKIKAAMRWGIFVRRKAAERRAQ  298



>gb|KHG24590.1| eukaryotic translation initiation factor 3 subunit m [Gossypium 
arboreum]
Length=631

 Score =   182 bits (462),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 123/281 (44%), Positives = 163/281 (58%), Gaps = 34/281 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA----RNELPMGQVDYSNSLNNQLQQP  1061
             KVYVD+LVKKAYENW+   EYD K+LL  K   +    +  +PM    Y  S+N Q   P
Sbjct  362   KVYVDALVKKAYENWMHVIEYDSKSLLGSKEDDSAGPSQANVPMDPQGYPISINQQHTLP  421

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              L  PV SE   +D  + +GG  Y+++M AR S QS  +   ++ Q+  + F    Q  L
Sbjct  422   TLSVPVPSEQPPIDSSLNVGG--YDDSMAARMSMQSQNVHLHAQNQFSGSSFT--LQNPL  477

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
             ++ + Q+Q   +DN    ALGP QSS   F   G+S   T             KG++++ 
Sbjct  478   VSGTHQVQVPGHDNEP--ALGPCQSSMPGFHEGGTSHIPTY------------KGIDDFF  523

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIP-------EDGFGFTPFMAPSPS--  554
             SEEEI++RS+EML+NEDMQHLLR+F+MG H     P       ED   +     P+PS  
Sbjct  524   SEEEIKMRSNEMLDNEDMQHLLRIFNMGSHCHATPPPPPFNAIEDTHPYPSTYMPTPSLA  583

Query  553   FGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +G+D D  R  GKAVVGWLK+KAA+RWG FIRKKAAERRA 
Sbjct  584   YGFDNDASRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAH  624



>ref|XP_003608224.1| Calmodulin-binding protein [Medicago truncatula]
 gb|AES90421.1| calmodulin-binding protein [Medicago truncatula]
Length=629

 Score =   182 bits (461),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 123/274 (45%), Positives = 165/274 (60%), Gaps = 28/274 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVD+LVKKAY+NW+   EYDGK+LL++   K    A  +  MG  +YSN L  Q    
Sbjct  368   KVYVDTLVKKAYDNWMHVIEYDGKSLLNYNQDKNLEPAHPQALMGSHEYSN-LIQQTSIH  426

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LP PV +   ++D G  +GG  Y++     +S QS   + +S +Q+++  F+   Q QL
Sbjct  427   SLPHPVNTGQPSMDTGATVGG--YHDGTTTSFSMQSQNTNLNSSIQFDDNAFS--LQSQL  482

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  701
             M+   Q Q  R +N  G+ LG PQ     TV    Q  ++++    S  R   VE++  E
Sbjct  483   MSVPHQAQLQRSEN--GMMLGMPQ-----TVTHGFQTASISN----STYR---VEDFFPE  528

Query  700   EEIRLRSHEMLENEDMQHLLRLFSMG--GHASVNIPEDGFGFTPFMAPSPSFGY---DED  536
             EEIR+RSHEMLENEDMQ LLR+F+MG   HAS N  EDG+       P+ +  Y   DE 
Sbjct  529   EEIRIRSHEMLENEDMQQLLRMFNMGSHAHASFNAHEDGYPNPSAYMPANNMSYNFDDEP  588

Query  535   RPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +   GKAVVGWLK+KAA+RWG F+RKKAA+RRAQ
Sbjct  589   KSSSGKAVVGWLKLKAALRWGIFVRKKAADRRAQ  622



>ref|XP_010433589.1| PREDICTED: uncharacterized protein LOC104717678 [Camelina sativa]
 ref|XP_010433590.1| PREDICTED: uncharacterized protein LOC104717678 [Camelina sativa]
Length=620

 Score =   181 bits (460),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 124/278 (45%), Positives = 155/278 (56%), Gaps = 34/278 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSL---------NN  1076
             KVYVD LV+KAYENW    EY+GK+LL+F N+  R  L   Q D + +L         +N
Sbjct  355   KVYVDELVRKAYENWNQVVEYEGKSLLNF-NQPER--LDTFQTDPAATLANYSTTAAADN  411

Query  1075  QLQQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPn  896
              +    +P+ V    S+L     IGG  YN+ +    + Q H          +  QF   
Sbjct  412   PIHVTVIPSAVPPNHSSLLSEFSIGG--YNQTLA---TAQPHNPQEQFDNGLQQDQFMGI  466

Query  895   dqqqlmnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKG  722
              Q Q     +       +N  G   GPPQS+   +  + SS+ Q NLN FEDWS   +  
Sbjct  467   RQHQTQTTIEN------ENVTGFVFGPPQSATGGYQDIESSIDQENLNPFEDWSKHHEG-  519

Query  721   VEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSF-GY  545
               ++ SEEEIR RSHE+L NEDMQ LL+LF+MG        EDGF    FM  +P+  GY
Sbjct  520   --DFFSEEEIRQRSHELLANEDMQELLQLFNMGDGNE----EDGFALPSFMHNTPTMQGY  573

Query  544   DE-DRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             DE DR R GKAVVGWLKIKAAMRWGFFIR+KAAERRA 
Sbjct  574   DEEDRGRSGKAVVGWLKIKAAMRWGFFIRRKAAERRAH  611



>gb|ACJ85726.1| unknown [Medicago truncatula]
Length=119

 Score =   169 bits (427),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 94/109 (86%), Gaps = 2/109 (2%)
 Frame = -1

Query  760  NSFEDWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGF  581
            N F+DWSN RDKGV+++ SE+EIR+RS+E+LENEDMQHLLRLFSMGGH S+N  EDG+ F
Sbjct  7    NPFDDWSNNRDKGVDDFFSEDEIRVRSNEILENEDMQHLLRLFSMGGHPSMNT-EDGYSF  65

Query  580  TPFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              FM PSP   +DEDR RPGKAVVGWLKIKAAMRWGFFIRK AAE+RAQ
Sbjct  66   PSFM-PSPMPNFDEDRSRPGKAVVGWLKIKAAMRWGFFIRKIAAEKRAQ  113



>ref|XP_010438831.1| PREDICTED: uncharacterized protein LOC104722380 [Camelina sativa]
Length=630

 Score =   181 bits (459),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 125/278 (45%), Positives = 158/278 (57%), Gaps = 33/278 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSL---------NN  1076
             KVYVD LVKKA ENW    EY+GK+LL+F N+  R  L M Q D + +L         +N
Sbjct  356   KVYVDELVKKANENWNQVVEYEGKSLLNF-NQPER--LDMSQTDPAATLANYSTTAAADN  412

Query  1075  QLQQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPn  896
              +    +P+ V    S++     IGG  YN+ +    + Q H    + + Q++N      
Sbjct  413   PIHVTVIPSAVPPNQSSVLTEFSIGG--YNQTLA---TAQPH----NPQEQFDNGLQRDQ  463

Query  895   dqqqlmnnsqqmqNARYDNNVGLALGPPQS--SCFPTVGSSVQQTNLNSFEDWSNTRDKG  722
                   +  Q       +N  GL  GPPQS  S +    SSV Q NLN FEDWSN  +  
Sbjct  464   FMGIHQHQHQTRTTIENENVTGLVFGPPQSASSGYQDTESSVDQENLNPFEDWSNHHEG-  522

Query  721   VEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSF-GY  545
               ++ SEEEIR RS+E+L NEDMQ LL+LF   G+      EDGF F  FM  +P+  GY
Sbjct  523   --DFFSEEEIRQRSNELLANEDMQELLQLFMGDGN-----EEDGFAFPSFMHNTPTMQGY  575

Query  544   DE-DRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +E DR R GKAVVGWLKIKAAMRWGFFIR+KAAERRA 
Sbjct  576   EEEDRGRSGKAVVGWLKIKAAMRWGFFIRRKAAERRAH  613



>ref|XP_007159256.1| hypothetical protein PHAVU_002G222600g [Phaseolus vulgaris]
 gb|ESW31250.1| hypothetical protein PHAVU_002G222600g [Phaseolus vulgaris]
Length=628

 Score =   180 bits (457),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 122/274 (45%), Positives = 163/274 (59%), Gaps = 30/274 (11%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             +VYVD+LVKKAY+NW+   EYDGK+L++    K    A  + PM   +YSNSL    QQ 
Sbjct  369   RVYVDTLVKKAYDNWMHVIEYDGKSLINDIEDKTLDTAHPQAPMTPHEYSNSL----QQI  424

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              +P PV +   ++D G+ +GG  Y++   +R+S Q    S +S +Q++   F+   Q QL
Sbjct  425   PIPLPVHAGQPSMDSGVTVGG--YHDGTTSRFSLQPQNPSFNSSIQFDENAFS--LQNQL  480

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  701
             M+     Q  R +N  GL  GP QSS       S+           SN   +GVEEY  E
Sbjct  481   MSVPHHTQLPRSEN--GLTHGPAQSSTHGFEPVSI-----------SNPTYRGVEEYFPE  527

Query  700   EEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFTPFMAPSPSFGY---DED  536
             EEIR+RSHEMLENEDMQ LLR+F++GG  H + N  +DG+  +     +   GY   DE 
Sbjct  528   EEIRIRSHEMLENEDMQQLLRMFNVGGQPHPTFNGLDDGYPSSSTYISANPMGYNFDDEP  587

Query  535   RPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
                 GKAVVGWLK+KAA+RWG FIRK+AAE+RAQ
Sbjct  588   NRSSGKAVVGWLKLKAALRWGIFIRKQAAEKRAQ  621



>gb|AFW62647.1| hypothetical protein ZEAMMB73_771415 [Zea mays]
Length=222

 Score =   171 bits (433),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 127/192 (66%), Gaps = 13/192 (7%)
 Frame = -1

Query  988  NENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnnsqqmqNARYDNNVGLALGPPQ  809
            N N  ARY+  +  + ++  MQY+ +  +P  Q    +   Q   +R  N   LALGPPQ
Sbjct  31   NGNQSARYAATTQNIPANVAMQYDRSAVSPESQFSGSSLQSQA--SRGSNT--LALGPPQ  86

Query  808  ---SSCFPTVGSSVQQTNLNSFEDWSNTRDK--GVEEYLSEEEIRLRSHEMLENEDMQHL  644
               S  FP +G S++ T LN FE+W   ++   GV++YL EE IR+RSHE+LENE+MQ +
Sbjct  87   QHQSFAFPALGQSMRPTGLNPFEEWPQQQENCGGVDDYLMEE-IRMRSHEILENEEMQQM  145

Query  643  LRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGYDEDRPR-PGKAVVGWLKIKAAMRWGF  470
            LRL S GG A  N+ EDGF F  +M APSP   Y++DR R PGKAVVGWLKIKAAMRWG 
Sbjct  146  LRLLSTGG-AGTNLTEDGFSFPSYMPAPSPKLSYEDDRTRAPGKAVVGWLKIKAAMRWGI  204

Query  469  FIRKKAAERRAQ  434
            F+RKKAAERRAQ
Sbjct  205  FVRKKAAERRAQ  216



>ref|NP_001130446.1| uncharacterized protein LOC100191543 [Zea mays]
 gb|ACF78658.1| unknown [Zea mays]
Length=471

 Score =   177 bits (449),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 124/286 (43%), Positives = 161/286 (56%), Gaps = 34/286 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDY--SNSLNNQLQ  1067
             +V+ D+LVK+AY +W++  EYDGK LL F  KK     R+E       Y  SN L N   
Sbjct  193   QVFADTLVKQAYADWINVLEYDGKALLKFNQKKKYVTTRSETAKASASYPASNGLVNS--  250

Query  1066  QPRLPA-PVQSEPSALD---------PGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYE  917
             Q  LP  PV +E S+L+         P M +G     E     Y+     M+ S  MQ +
Sbjct  251   QKELPGGPVNAEQSSLNNASQDRTRIPSMSMGNQVARE-----YAGNPQHMTPSITMQCD  305

Query  916   NTQFAPndqqqlmnnsqqmqNARYDNNVGLALGP---PQSSCFPTVGSSVQQTNLNSFED  746
                  P  Q    ++ Q    +R  N   LAL P   PQ+  F  +G S Q +  N F D
Sbjct  306   TRSLIPGGQFSGGSSVQTQT-SRSSNM--LALRPTQQPQNLDFSGLGQSTQPSGTNPFAD  362

Query  745   WSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMA  566
             WS  ++  V+EYL +E IR RSHE+LEN++MQH+LR  S+GG  +     DGF   P  +
Sbjct  363   WSRLQESSVDEYLMDE-IRARSHELLENDEMQHMLRFLSVGGAPTGLNNVDGFLSYP--S  419

Query  565   PSPSFGYDED-RPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             P+P+FG+DED R R  GKAVVGWLKIKAAMRWG F+R+KAAERRAQ
Sbjct  420   PAPAFGFDEDDRARSSGKAVVGWLKIKAAMRWGIFVRRKAAERRAQ  465



>emb|CDY59992.1| BnaA02g35270D [Brassica napus]
Length=629

 Score =   179 bits (454),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 125/275 (45%), Positives = 157/275 (57%), Gaps = 27/275 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNS-LNNQLQQPRLP  1052
             KVYVD LVKKAYENW    EYDGK+L+  K  +   E      +YS + ++N +Q   + 
Sbjct  362   KVYVDGLVKKAYENWNLVIEYDGKSLIDMKQPQNPPE------NYSTAAVDNPMQ---MA  412

Query  1051  APVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnn  872
                 S P+        GG  Y++ M A Y     ++ S+ R  +E      +DQ     +
Sbjct  413   GHSSSLPANQFSDFTTGG--YDQTMVASYPLHPQLLDSNPRAHFE----VASDQLMGSVH  466

Query  871   sqqmqNARYDNNVGLALGPPQSSCFPTV-GSSVQQTNLNSFED-WSNTRDKGVEEYLSEE  698
               Q      + N  LALGPPQ+  +  +  SS  Q NLN FED WSN R    E++ SEE
Sbjct  467   QAQSSTNNQNMNGLLALGPPQA--YQNINSSSAHQENLNPFEDCWSNHRGGAEEDFFSEE  524

Query  697   EIRLRSHEMLENEDMQHLLRLFSM------GGHASVNIPEDGFGFTPFMAPSPSFGY-DE  539
             EIRLRSHEMLENEDM+  LRLFSM      G  +  + PEDG+   P    +P  GY DE
Sbjct  525   EIRLRSHEMLENEDMKQFLRLFSMGGGGGTGNDSVAHFPEDGYSSFPSFLNTPMQGYDDE  584

Query  538   DRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             D  R G++VVGWLKIKAAMRWGF IR+KAAERRAQ
Sbjct  585   DSGRSGRSVVGWLKIKAAMRWGFSIRRKAAERRAQ  619



>ref|XP_009112562.1| PREDICTED: uncharacterized protein LOC103837921 [Brassica rapa]
Length=624

 Score =   179 bits (454),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 128/277 (46%), Positives = 159/277 (57%), Gaps = 43/277 (16%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFK--NKKARNELPMGQVDYSNSLNNQLQQPRL  1055
             K YVD+LVKKAYENW    EYD K+L++F   NK A       ++DYS           +
Sbjct  371   KGYVDALVKKAYENWDQVVEYDSKSLMNFNQVNKTA-------EIDYS-----------M  412

Query  1054  PAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmn  875
             P  V S+PS     +    S YN+   + +  QS    ++S M Y N  FAP DQ     
Sbjct  413   PVSVPSQPSTSYSDITGEASVYNQIPASSFQAQS---DTTSYMHYGNASFAPQDQLVSNT  469

Query  874   nsqqmqNARYDNNVG--LALGPPQSSCFPTVGSSVQ-QTNLNSFEDWSNTRDKGVEEYLS  704
             +  Q      ++N G  LALGPP  S    +   VQ  T +N F DWSN   +G + +LS
Sbjct  470   HESQ---GMMNSNGGGRLALGPPSGSQNNHL---VQPHTEMNPFNDWSN---RGGDGFLS  520

Query  703   EEEIRLRSHEMLENEDMQHLLRLFSMGG-------HASVNIPEDGFGFTPFMAPSPSFGY  545
             EEEIR RS+EMLEN+DMQ LLRLFSM G          +N+ EDGFGF  F   S    Y
Sbjct  521   EEEIRARSNEMLENDDMQQLLRLFSMNGGGGGGGPQTPMNMGEDGFGFHSF-GQSSLGDY  579

Query  544   DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +E+R + GK VVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  580   EEERSQSGKPVVGWLKIKAAMRWGFFIRRKAAQRRAQ  616



>emb|CDY30302.1| BnaA09g09750D [Brassica napus]
Length=624

 Score =   179 bits (454),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 128/277 (46%), Positives = 159/277 (57%), Gaps = 43/277 (16%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFK--NKKARNELPMGQVDYSNSLNNQLQQPRL  1055
             K YVD+LVKKAYENW    EYD K+L++F   NK A       ++DYS           +
Sbjct  371   KGYVDALVKKAYENWDQVVEYDSKSLMNFNQVNKTA-------EIDYS-----------M  412

Query  1054  PAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmn  875
             P  V S+PS     +    S YN+   + +  QS    ++S M Y N  FAP DQ     
Sbjct  413   PVSVPSQPSTSYSDITGEASVYNQIPASSFQAQS---DTTSYMHYGNASFAPQDQLVSNT  469

Query  874   nsqqmqNARYDNNVG--LALGPPQSSCFPTVGSSVQ-QTNLNSFEDWSNTRDKGVEEYLS  704
             +  Q      ++N G  LALGPP  S    +   VQ  T +N F DWSN   +G + +LS
Sbjct  470   HESQ---GMMNSNGGGRLALGPPSGSQNNHL---VQPHTEMNPFNDWSN---RGGDGFLS  520

Query  703   EEEIRLRSHEMLENEDMQHLLRLFSMGG-------HASVNIPEDGFGFTPFMAPSPSFGY  545
             EEEIR RS+EMLEN+DMQ LLRLFSM G          +N+ EDGFGF  F   S    Y
Sbjct  521   EEEIRARSNEMLENDDMQQLLRLFSMNGGGGGGGPQTPMNMGEDGFGFHSF-GQSSLGDY  579

Query  544   DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +E+R + GK VVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  580   EEERSQSGKPVVGWLKIKAAMRWGFFIRRKAAQRRAQ  616



>ref|XP_002446536.1| hypothetical protein SORBIDRAFT_06g017740 [Sorghum bicolor]
 gb|EES10864.1| hypothetical protein SORBIDRAFT_06g017740 [Sorghum bicolor]
Length=652

 Score =   179 bits (453),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 120/281 (43%), Positives = 162/281 (58%), Gaps = 24/281 (9%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDY--SNSLNNQLQ  1067
             +V+ D+LVK+AY++W++  EYDGK LLSFK  K     R+E       Y  SN L N  Q
Sbjct  374   RVFADTLVKQAYDDWINAVEYDGKALLSFKQTKKTVTTRSETAKASASYPASNDLMNS-Q  432

Query  1066  QPRLPAPVQSEPSALDPGMLIGGS---SYNENMGARYSNQSHIMSSSSRMQYENTQFAPn  896
             +     PV +E S+L      GG+   S    +   Y+     ++ S  MQY+ +   P 
Sbjct  433   KQLAGGPVNTEQSSLKNTREAGGTGIPSMGNQVAREYAGNPQHVAPSITMQYDMSSLVPG  492

Query  895   dqqqlmnnsqqmqNARYDNNVGLALGP---PQSSCFPTVGSSVQQTNLNSFEDWS---NT  734
              Q    +   Q   +R  N   LAL P   PQ+  F  +G S Q + LN F+DWS     
Sbjct  493   GQFSGSSVQTQT--SRSSNM--LALRPMQQPQNFEFSGLGQSTQPSGLNPFDDWSRLQEN  548

Query  733   RDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPS  554
             R  G ++YL +E IR RSHE+LEN++MQ +LRL SMGG  +     DGF   P  +P+P+
Sbjct  549   RGGGADDYLMDE-IRARSHEILENDEMQQMLRLLSMGGAPTGLNNVDGFPSYP--SPAPA  605

Query  553   FGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             F ++++R R  GKAVVGWLKIKAAMRWG F+R+KAAERRAQ
Sbjct  606   FSFEDNRARSSGKAVVGWLKIKAAMRWGIFVRRKAAERRAQ  646



>ref|XP_008667039.1| PREDICTED: uncharacterized protein LOC100191543 isoform X1 [Zea 
mays]
Length=652

 Score =   177 bits (450),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 126/286 (44%), Positives = 162/286 (57%), Gaps = 34/286 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDY--SNSLNNQLQ  1067
             +V+ D+LVK+AY +W++  EYDGK LL F  KK     R+E       Y  SN L N   
Sbjct  374   RVFADTLVKQAYADWINVLEYDGKALLKFNQKKKYVTTRSETAKASASYPASNGLVNS--  431

Query  1066  QPRLPA-PVQSEPSALD---------PGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYE  917
             Q  LP  PV +E S+L+         P M +G     E  G    N  H M+ S  MQ +
Sbjct  432   QKELPGGPVNAEQSSLNNASQDRTRIPSMSMGNQVAREYAG----NPQH-MTPSITMQCD  486

Query  916   NTQFAPndqqqlmnnsqqmqNARYDNNVGLALGP---PQSSCFPTVGSSVQQTNLNSFED  746
                  P  Q    ++ Q    +R  N   LAL P   PQ+  F  +G S Q +  N F D
Sbjct  487   TRSLIPGGQFSGGSSVQTQT-SRSSNM--LALRPTQQPQNLDFSGLGQSTQPSGTNPFAD  543

Query  745   WSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMA  566
             WS  ++  V+EYL +E IR RSHE+LEN++MQH+LR  S+GG  +     DGF   P  +
Sbjct  544   WSRLQESSVDEYLMDE-IRARSHELLENDEMQHMLRFLSVGGAPTGLNNVDGFLSYP--S  600

Query  565   PSPSFGYDED-RPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             P+P+FG+DED R R  GKAVVGWLKIKAAMRWG F+R+KAAERRAQ
Sbjct  601   PAPAFGFDEDDRARSSGKAVVGWLKIKAAMRWGIFVRRKAAERRAQ  646



>ref|XP_008667040.1| PREDICTED: uncharacterized protein LOC100191543 isoform X2 [Zea 
mays]
Length=653

 Score =   177 bits (449),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 161/287 (56%), Gaps = 35/287 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDY--SNSLNNQLQ  1067
             +V+ D+LVK+AY +W++  EYDGK LL F  KK     R+E       Y  SN L N   
Sbjct  374   RVFADTLVKQAYADWINVLEYDGKALLKFNQKKKYVTTRSETAKASASYPASNGLVNS--  431

Query  1066  QPRLPA-PVQSEPSALD----------PGMLIGGSSYNENMGARYSNQSHIMSSSSRMQY  920
             Q  LP  PV +E S+L+          P M +G     E     Y+     M+ S  MQ 
Sbjct  432   QKELPGGPVNAEQSSLNNASQADRTRIPSMSMGNQVARE-----YAGNPQHMTPSITMQC  486

Query  919   ENTQFAPndqqqlmnnsqqmqNARYDNNVGLALGP---PQSSCFPTVGSSVQQTNLNSFE  749
             +     P  Q    ++ Q    +R  N   LAL P   PQ+  F  +G S Q +  N F 
Sbjct  487   DTRSLIPGGQFSGGSSVQTQT-SRSSNM--LALRPTQQPQNLDFSGLGQSTQPSGTNPFA  543

Query  748   DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  569
             DWS  ++  V+EYL +E IR RSHE+LEN++MQH+LR  S+GG  +     DGF   P  
Sbjct  544   DWSRLQESSVDEYLMDE-IRARSHELLENDEMQHMLRFLSVGGAPTGLNNVDGFLSYP--  600

Query  568   APSPSFGYDED-RPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +P+P+FG+DED R R  GKAVVGWLKIKAAMRWG F+R+KAAERRAQ
Sbjct  601   SPAPAFGFDEDDRARSSGKAVVGWLKIKAAMRWGIFVRRKAAERRAQ  647



>tpg|DAA37640.1| TPA: hypothetical protein ZEAMMB73_428755 [Zea mays]
Length=450

 Score =   174 bits (441),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 124/285 (44%), Positives = 160/285 (56%), Gaps = 34/285 (12%)
 Frame = -1

Query  1225  VYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDY--SNSLNNQLQQ  1064
             V+ D+LVK+AY +W++  EYDGK LL F  KK     R+E       Y  SN L N   Q
Sbjct  173   VFADTLVKQAYADWINVLEYDGKALLKFNQKKKYVTTRSETAKASASYPASNGLVNS--Q  230

Query  1063  PRLPA-PVQSEPSALD---------PGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYEN  914
               LP  PV +E S+L+         P M +G     E     Y+     M+ S  MQ + 
Sbjct  231   KELPGGPVNAEQSSLNNASQDRTRIPSMSMGNQVARE-----YAGNPQHMTPSITMQCDT  285

Query  913   TQFAPndqqqlmnnsqqmqNARYDNNVGLALGP---PQSSCFPTVGSSVQQTNLNSFEDW  743
                 P  Q    ++ Q    +R  N   LAL P   PQ+  F  +G S Q +  N F DW
Sbjct  286   RSLIPGGQFSGGSSVQTQT-SRSSNM--LALRPTQQPQNLDFSGLGQSTQPSGTNPFADW  342

Query  742   SNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAP  563
             S  ++  V+EYL +E IR RSHE+LEN++MQH+LR  S+GG  +     DGF   P  +P
Sbjct  343   SRLQESSVDEYLMDE-IRARSHELLENDEMQHMLRFLSVGGAPTGLNNVDGFLSYP--SP  399

Query  562   SPSFGYDED-RPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +P+FG+DED R R  GKAVVGWLKIKAAMRWG F+R+KAAERRAQ
Sbjct  400   APAFGFDEDDRARSSGKAVVGWLKIKAAMRWGIFVRRKAAERRAQ  444



>gb|AFW71858.1| hypothetical protein ZEAMMB73_193945 [Zea mays]
Length=173

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 105/140 (75%), Gaps = 10/140 (7%)
 Frame = -1

Query  829  LALGPPQ---SSCFPTVGSSVQQTNLNSFEDW---SNTRDKGVEEYLSEEEIRLRSHEML  668
            LALGPPQ   S  FP +G  VQ T LN FE+W      R  GV++YL EE IR+RSHE+L
Sbjct  30   LALGPPQQHQSFEFPALGQPVQPTGLNPFEEWPQQQENRGGGVDDYLMEE-IRMRSHEIL  88

Query  667  ENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGYDEDRPR-PGKAVVGWLKI  494
            ENE+MQ +LRL SMGG A  ++ EDGF F P+M APSP+  Y++DR R PGKAVVGWLKI
Sbjct  89   ENEEMQQMLRLLSMGG-AGTSLAEDGFNFPPYMPAPSPNVSYEDDRTRAPGKAVVGWLKI  147

Query  493  KAAMRWGFFIRKKAAERRAQ  434
            KAAMRWG F+RKKAAERRAQ
Sbjct  148  KAAMRWGIFVRKKAAERRAQ  167



>ref|XP_009414724.1| PREDICTED: uncharacterized protein LOC103995757 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414730.1| PREDICTED: uncharacterized protein LOC103995757 [Musa acuminata 
subsp. malaccensis]
Length=634

 Score =   176 bits (446),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 124/275 (45%), Positives = 164/275 (60%), Gaps = 32/275 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLL-SFKNKKARNEL----PMGQVDYSNSLNNQ-LQ  1067
             KV+ D+LVKKAY+NW+    YD  TLL + K+KKA   L    P+       SL++Q + 
Sbjct  373   KVFADTLVKKAYDNWMHAIAYDSHTLLDNTKSKKATASLLQESPLVSSLNHPSLHDQHIS  432

Query  1066  Q--PRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPnd  893
             Q  P+   P+Q +P A+          YN +   RYSN       +++M  ++T FA   
Sbjct  433   QFHPQSSVPLQHQPVAIADT----AEGYNGSRATRYSNLPQDADLNAQMPIQSTSFA---  485

Query  892   qqqlmnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEE  713
              Q   ++S    + R D+  GLAL PP     P++           +EDWS  +D    +
Sbjct  486   FQNQSSSSSHQSHFRRDDRAGLALAPPLHQ--PSM-------EFQPYEDWSCQQD----D  532

Query  712   YLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPS-FGYDED  536
             +LSEEEIRLRSHEMLENEDMQHLLR  S+ G AS+++ EDG+GF P++    S F  D+D
Sbjct  533   FLSEEEIRLRSHEMLENEDMQHLLRNLSVVG-ASMSLHEDGYGFPPYVPLLCSNFNDDDD  591

Query  535   -RPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRA  437
              R RP G+AVVGWLKIKAAMRWG F+RKKAAERRA
Sbjct  592   ERSRPSGRAVVGWLKIKAAMRWGIFVRKKAAERRA  626



>ref|XP_010448369.1| PREDICTED: uncharacterized protein LOC104730838 isoform X2 [Camelina 
sativa]
 ref|XP_010448370.1| PREDICTED: uncharacterized protein LOC104730838 isoform X2 [Camelina 
sativa]
Length=614

 Score =   173 bits (439),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 117/278 (42%), Positives = 157/278 (56%), Gaps = 32/278 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQ--------  1073
             KVYVD LV+KAYENW    EY+GK+LL+F N+  R++  M Q D + +  N         
Sbjct  346   KVYVDELVRKAYENWNQVVEYEGKSLLNF-NQPGRSD--MSQTDPAATFANYSSTAAAGH  402

Query  1072  -LQQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPn  896
              +    +P+ V    S+L     +GG  YN+ +    + Q H    + + Q++N      
Sbjct  403   PINVTVIPSTVPPNQSSLLSEFSVGG--YNQTLA---TAQPH----NPQEQFDNGLQQDQ  453

Query  895   dqqqlmnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKG  722
                   +  Q       +N  G   GP +S+   +  + SS+ Q NLN FEDWS   +  
Sbjct  454   FMGIHQHQHQTRTTIENENVTGFVFGPLRSATGGYQDIESSLDQENLNPFEDWSKHNEG-  512

Query  721   VEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSF-GY  545
               ++ SEEEIR RS+E+L NED+Q LL+LF+MG        EDGF F  FM  +P+  GY
Sbjct  513   --DFFSEEEIRQRSNELLANEDLQELLQLFNMGDGNE----EDGFAFPSFMDNTPTMQGY  566

Query  544   DE-DRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +E DR R GKAVVGWLKIKAAMRWGFFIR+KAAERRA 
Sbjct  567   EEEDRGRSGKAVVGWLKIKAAMRWGFFIRRKAAERRAH  604



>ref|XP_010448367.1| PREDICTED: uncharacterized protein LOC104730838 isoform X1 [Camelina 
sativa]
 ref|XP_010448368.1| PREDICTED: uncharacterized protein LOC104730838 isoform X1 [Camelina 
sativa]
Length=624

 Score =   173 bits (438),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 117/278 (42%), Positives = 157/278 (56%), Gaps = 32/278 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQ--------  1073
             KVYVD LV+KAYENW    EY+GK+LL+F N+  R++  M Q D + +  N         
Sbjct  356   KVYVDELVRKAYENWNQVVEYEGKSLLNF-NQPGRSD--MSQTDPAATFANYSSTAAAGH  412

Query  1072  -LQQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPn  896
              +    +P+ V    S+L     +GG  YN+ +    + Q H    + + Q++N      
Sbjct  413   PINVTVIPSTVPPNQSSLLSEFSVGG--YNQTLA---TAQPH----NPQEQFDNGLQQDQ  463

Query  895   dqqqlmnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKG  722
                   +  Q       +N  G   GP +S+   +  + SS+ Q NLN FEDWS   +  
Sbjct  464   FMGIHQHQHQTRTTIENENVTGFVFGPLRSATGGYQDIESSLDQENLNPFEDWSKHNEG-  522

Query  721   VEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSF-GY  545
               ++ SEEEIR RS+E+L NED+Q LL+LF+MG        EDGF F  FM  +P+  GY
Sbjct  523   --DFFSEEEIRQRSNELLANEDLQELLQLFNMGDGNE----EDGFAFPSFMDNTPTMQGY  576

Query  544   DE-DRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +E DR R GKAVVGWLKIKAAMRWGFFIR+KAAERRA 
Sbjct  577   EEEDRGRSGKAVVGWLKIKAAMRWGFFIRRKAAERRAH  614



>ref|XP_008349259.1| PREDICTED: uncharacterized protein LOC103412486 [Malus domestica]
Length=228

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 109/239 (46%), Positives = 146/239 (61%), Gaps = 31/239 (13%)
 Frame = -1

Query  1111  MGQVDYSNSLNNQLQQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSS  932
             M   DY NS + Q   P LPA V S+P  +D G+ +GG  Y + M AR+S QS   + + 
Sbjct  1     MASQDYPNSCDQQFTLPSLPASVSSQPPPMDSGLNVGG--YXDGMAARFSIQSQNGNLNX  58

Query  931   RMQYENTQFAPndqqqlmnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLN  758
              +Q +   F    Q QL + S Q    R +N   L+LGP QSS   F  +G+S    NL+
Sbjct  59    PIQLDGLSFP--QQNQLPSISXQXHFQRNENM--LSLGPLQSSTSGFQNIGTS----NLS  110

Query  757   SFEDWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--------HASVNI  602
             S+        +GVE+   EEEIR+RS+E+LENEDMQHLLR+ +MGG        H+S+N+
Sbjct  111   SY--------RGVEDLFPEEEIRMRSNEILENEDMQHLLRVINMGGQGQGHSYGHSSMNV  162

Query  601   PEDGFGFTPFMAPSPSFGY--DEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              ED + ++    P+P   Y  D+D+ R PGKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  163   TEDNYPYSSPYIPTPQANYSIDDDQSRSPGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  221



>ref|XP_002316656.1| calmodulin-binding protein 60-C [Populus trichocarpa]
 gb|EEE97268.1| calmodulin-binding protein 60-C [Populus trichocarpa]
Length=625

 Score =   172 bits (435),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 115/277 (42%), Positives = 155/277 (56%), Gaps = 42/277 (15%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             K+YVDSLVKKAY+NW+   EYDG +LL FK  +    ++N++P G  D+ N  ++Q   P
Sbjct  372   KIYVDSLVKKAYDNWMHVIEYDGNSLLDFKQHQGVAASQNDVPSGHQDFLNPYDHQDSLP  431

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              +  PV SE   +     IGG  Y +   AR+S      S ++  Q++  Q  P      
Sbjct  432   TISVPVPSEQPVVHSSPAIGG--YTDGTVARFSIDPQNGSLNTPFQFDAIQ-NPLGT---  485

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  701
                          NN+ LALGPPQSS   + G      NL+          +G +++ SE
Sbjct  486   -------------NNL-LALGPPQSSTPGSQGFCASNLNLH----------RGKDDFFSE  521

Query  700   EEIRLRSHEMLENEDMQHLLRLFSMGGH--ASVNIPEDGFGFTPFMAPSPSFGYDE----  539
             EEIR RSH+MLENEDMQ LLR+F+MGG   +S ++ EDG+ ++ +M              
Sbjct  522   EEIRTRSHDMLENEDMQQLLRIFNMGGQGLSSNSVTEDGYPYSSYMPSPSPSPSPNYSLS  581

Query  538   DRPR--PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             D P    GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  582   DNPSRSSGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  618



>emb|CAB39601.1| putative calmodulin-binding protein [Arabidopsis thaliana]
 emb|CAB79435.1| putative calmodulin-binding protein [Arabidopsis thaliana]
Length=536

 Score =   169 bits (428),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 122/270 (45%), Positives = 151/270 (56%), Gaps = 23/270 (9%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             KVYVD LVKKAYENW    EY+G++LL+  N+  R  L + Q D   +L +         
Sbjct  274   KVYVDGLVKKAYENWNQVVEYEGESLLNL-NQPER--LDISQTDPVTALAS-----YSTV  325

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  869
             P+   P     G  I    Y+ ++     NQ+   +     Q +   F P   Q +    
Sbjct  326   PLSQFPEFAIEGWQISPFLYSTSIFTAGYNQTLTTALPHNPQAQ-FDFVPQQDQFIGIQQ  384

Query  868   qqmqNARYDNNVG-LALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEE  698
              Q Q    + NV  L LGPPQSS   +  + SS  Q NLN FEDW+N  +    ++ SEE
Sbjct  385   PQTQTNIENENVTRLVLGPPQSSTGGYQDIKSSADQENLNPFEDWTNLSEN---DFFSEE  441

Query  697   EIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSF-GYDED-RPRP  524
             EIR  SH++L NEDMQ LL  FSMGG       EDGF F  FM  +P   GYDE+ R R 
Sbjct  442   EIRQTSHDLLANEDMQQLL--FSMGGGKG----EDGFTFPSFMQNTPMMQGYDEEGRGRS  495

Query  523   GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             GKAVVGWLK+KAAMRWGFFIR+KAAERRAQ
Sbjct  496   GKAVVGWLKVKAAMRWGFFIRRKAAERRAQ  525



>ref|NP_194310.3| Calmodulin-binding protein [Arabidopsis thaliana]
 ref|NP_001078448.1| Calmodulin-binding protein [Arabidopsis thaliana]
 dbj|BAE98742.1| putative calmodulin-binding protein [Arabidopsis thaliana]
 gb|AEE85115.1| Calmodulin-binding protein [Arabidopsis thaliana]
 gb|AEE85116.1| Calmodulin-binding protein [Arabidopsis thaliana]
Length=601

 Score =   170 bits (430),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 122/270 (45%), Positives = 153/270 (57%), Gaps = 39/270 (14%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             KVYVD LVKKAYENW    EY+G++LL+  N+  R  L + Q D   +L          A
Sbjct  355   KVYVDGLVKKAYENWNQVVEYEGESLLNL-NQPER--LDISQTDPVTAL----------A  401

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  869
                + P +  P   I G  YN+ +       +  +  + + Q++   F P   Q +    
Sbjct  402   SYSTVPLSQFPEFAIEG--YNQTL-------TTALPHNPQAQFD---FVPQQDQFIGIQQ  449

Query  868   qqmqNARYDNNVG-LALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEE  698
              Q Q    + NV  L LGPPQSS   +  + SS  Q NLN FEDW+N  +    ++ SEE
Sbjct  450   PQTQTNIENENVTRLVLGPPQSSTGGYQDIKSSADQENLNPFEDWTNLSEN---DFFSEE  506

Query  697   EIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSF-GYDED-RPRP  524
             EIR  SH++L NEDMQ LL  FSMGG       EDGF F  FM  +P   GYDE+ R R 
Sbjct  507   EIRQTSHDLLANEDMQQLL--FSMGGGKG----EDGFTFPSFMQNTPMMQGYDEEGRGRS  560

Query  523   GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             GKAVVGWLK+KAAMRWGFFIR+KAAERRAQ
Sbjct  561   GKAVVGWLKVKAAMRWGFFIRRKAAERRAQ  590



>gb|EMS55488.1| hypothetical protein TRIUR3_12862 [Triticum urartu]
Length=657

 Score =   170 bits (430),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 119/284 (42%), Positives = 166/284 (58%), Gaps = 31/284 (11%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYS--NSLNNQLQ  1067
             +V+ D+LVK+AY++W++  EYDGK LL FK KK     R++       Y+  +S ++Q Q
Sbjct  380   RVFADTLVKQAYDDWINVVEYDGKGLLKFKQKKKSVTTRSDAANVSTSYTSYDSAHSQKQ  439

Query  1066  ----QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAP  899
                  P +   + S  S  +   +    + N N  A Y+     +S S  MQY  +   P
Sbjct  440   LARGHPNIERSLMSSTSKAEETRV----ASNGNQVAIYATNPQDISPSITMQYGMSSLIP  495

Query  898   ndqqqlmnnsqqmqNARYDNNVGLALGPP----QSSCFPTVGSSVQQTNLNSFEDW---S  740
               Q    +   Q   A   +N+ LA GPP    Q+  F T+G S+Q   LN F+DW   S
Sbjct  496   EGQFNGSSIQTQ---APRSSNM-LAFGPPPQQQQNFEFSTLGLSMQSPALNPFDDWPGRS  551

Query  739   NTRDKGVEEYLSEEEIRLRSHEMLENED-MQHLLRLFSMGGHASVNIPEDGFGFTPFMAP  563
                  GV+++L EE IR+RSH++LENE+ MQH+LR+ S G  A++N   DGF + P  +P
Sbjct  552   QENRGGVDDFLMEE-IRVRSHDILENEEEMQHMLRILSGGAAANMN-NVDGFPYIP--SP  607

Query  562   SPSFGYDEDR-PRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              P+F +++DR P  GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  608   VPTFNFEDDRAPSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  651



>ref|XP_006409114.1| hypothetical protein EUTSA_v10022604mg [Eutrema salsugineum]
 ref|XP_006409115.1| hypothetical protein EUTSA_v10022604mg [Eutrema salsugineum]
 gb|ESQ50567.1| hypothetical protein EUTSA_v10022604mg [Eutrema salsugineum]
 gb|ESQ50568.1| hypothetical protein EUTSA_v10022604mg [Eutrema salsugineum]
Length=608

 Score =   169 bits (427),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 126/280 (45%), Positives = 151/280 (54%), Gaps = 59/280 (21%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             K YVD LV+KAYENW    EYD K+L++F      + L     DYS           +P 
Sbjct  365   KGYVDGLVRKAYENWDQVIEYDSKSLMNFNQVNKTDAL-----DYS-----------IPV  408

Query  1048  PVQSEPSALDPGMLIGGSSYNENMG-ARYSNQSHI-MSSSSRMQYENTQFAPndqqqlmn  875
              V S+ S          +SY++  G A   NQS +   +SS M + N  FA  +Q     
Sbjct  409   SVPSQAS----------TSYSDLTGEASVYNQSQLGADTSSYMHFGNNSFATQEQLINNA  458

Query  874   nsqqmqNARYDNNVG--LALGPPQSSCFPTVGSSVQQT-----NLNSF-EDWSNTRDKGV  719
             +  Q       N VG  LAL PP        GS  QQ       +NSF  DWSNT +   
Sbjct  459   HGSQS------NGVGARLALCPP-------TGSQSQQMVQPPPEMNSFNSDWSNTGNG--  503

Query  718   EEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG-----HASVNIPEDGFGFTPFMAPSPS  554
               +LSEEEIR RS+EMLEN+DMQ LLRLFSM G        +N+ EDGFGF  F   S  
Sbjct  504   --FLSEEEIRARSNEMLENDDMQQLLRLFSMSGGEQQQTTPMNLSEDGFGFHSF-GQSSM  560

Query  553   FGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
               Y+EDR   GK VVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  561   ADYEEDRSNSGKPVVGWLKIKAAMRWGFFIRRKAAQRRAQ  600



>gb|EEC72606.1| hypothetical protein OsI_06079 [Oryza sativa Indica Group]
Length=669

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 162/270 (60%), Gaps = 17/270 (6%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQ-QPRLP  1052
             K++ D+LVKKAY+NW+   EYDGK LL+ K KK     P GQV+    L+     + R+ 
Sbjct  406   KLFADALVKKAYDNWMYAIEYDGKALLNSKPKK--KAAPTGQVETHPPLSQPASYEQRIS  463

Query  1051  APVQSEPS-ALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENT-QFAPndqqqlm  878
             +   + PS A   G       Y+ N  A   +Q    S++  + Y++T  F P       
Sbjct  464   SASMTGPSPAGGSGTGTDSIGYDGNQAATQPSQLQSTSANVPVPYDDTFSFLPPSMLMGS  523

Query  877   nnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEE  698
             +N +       ++ +GL LG  Q +   +   S+Q  N+  ++DW+ +++    +  +E+
Sbjct  524   DNQETG-----NDGMGLELGQLQQAI--SQSQSIQPANVG-YDDWTRSQNGQFADDFTED  575

Query  697   EIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGYDEDRPRP-  524
              IR++SH+MLE+EDMQ LLR+FSMGG AS ++ ED FGF  +M +P P+ G++ +R R  
Sbjct  576   -IRMKSHQMLESEDMQQLLRVFSMGG-ASTSLQEDAFGFPTYMPSPLPNLGFEGERTRSS  633

Query  523   GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  634   GKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  663



>ref|XP_004975724.1| PREDICTED: uncharacterized protein LOC101760764 isoform X1 [Setaria 
italica]
Length=660

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 121/286 (42%), Positives = 163/286 (57%), Gaps = 28/286 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             +V+ D+LVK+AY++W++  EYDGK LL FK KK     R+E       Y  S      Q 
Sbjct  376   RVFADTLVKQAYDDWINVVEYDGKALLRFKQKKKSVTTRSETAKASASYPASNGLVHSQK  435

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNE--NMGAR-YSNQSHIM--SSSSRMQYENTQFAPn  896
             +L +PV +E S+L       G+      N GAR Y+     M  +SS  MQY+ +  AP 
Sbjct  436   QLASPVNAEQSSLSNISEADGTRVVSIGNQGARGYAANPQDMAPTSSITMQYDMSSLAPE  495

Query  895   dqqqlmnnsqqmqNARYDNNVGLALGPPQSSCFPTV---------GSSVQQTNLNSFEDW  743
              Q    +   Q   +R  N   LAL P Q    P +         G S Q ++LN F+DW
Sbjct  496   GQFSGSSIQPQA--SRSSNT--LALRPMQQQQQPLLQNFEFSGLGGQSTQPSSLNPFDDW  551

Query  742   SNTRDK--GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  569
             S  ++    V++YL EE IR RSHE+LEN++MQ +LR+ SMGG  +     D F   P  
Sbjct  552   SRLQENRGSVDDYLMEE-IRARSHEILENDEMQQMLRILSMGGAPTGLNNVDSFPSYP--  608

Query  568   APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +P+P+F +++DR R  GKAVVGWLKIKAAMRWG F+R+KAAERRAQ
Sbjct  609   SPAPAFSFEDDRSRSSGKAVVGWLKIKAAMRWGIFVRRKAAERRAQ  654



>ref|XP_006282572.1| hypothetical protein CARUB_v10004387mg [Capsella rubella]
 gb|EOA15470.1| hypothetical protein CARUB_v10004387mg [Capsella rubella]
Length=619

 Score =   167 bits (422),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 116/275 (42%), Positives = 149/275 (54%), Gaps = 28/275 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN------ELPMGQVDYSNSLNNQLQ  1067
             KVYVD LV+KAYENW    EY+GK+L +F   +  N         +     +++ +N + 
Sbjct  355   KVYVDELVRKAYENWNQVVEYEGKSLSNFNQPERLNISQNNPAATLANYSTTSAADNPIH  414

Query  1066  QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqq  887
                +P+ V    S +     +G   YN+ +    + Q H       +  +  QF    Q 
Sbjct  415   VTVVPSAVPPNQSPVHSEFSMG--EYNQTL---TTAQPHNPQELFDIGLQQDQFMGIRQH  469

Query  886   qlmnnsqqmqNARYDNNVGLALGPPQS-SC-FPTVGSSVQQTNLNSFEDWSNTRDKGVEE  713
             Q +   +        N  G  LGPPQS +C +  + SSV Q NLN F+DWS        +
Sbjct  470   QTLATIENA------NVTGFVLGPPQSATCGYQDIESSVDQGNLNLFDDWSKHHGN---D  520

Query  712   YLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSP-SFGYDED  536
               SEEEIR  SHE+L NEDMQ LL+LFSMGG       EDGF F  FM  +P + G DE+
Sbjct  521   LFSEEEIRKISHELLANEDMQELLQLFSMGGGNG----EDGFAFPSFMHNTPRTQGSDEE  576

Query  535   -RPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
                R GKAVVGWLKIKAAMRWGFFIR+KAAERRA 
Sbjct  577   GHGRSGKAVVGWLKIKAAMRWGFFIRRKAAERRAH  611



>ref|XP_004975725.1| PREDICTED: uncharacterized protein LOC101760764 isoform X2 [Setaria 
italica]
Length=659

 Score =   167 bits (422),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 121/285 (42%), Positives = 163/285 (57%), Gaps = 27/285 (9%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             +V+ D+LVK+AY++W++  EYDGK LL FK KK     R+E       Y  S      Q 
Sbjct  376   RVFADTLVKQAYDDWINVVEYDGKALLRFKQKKKSVTTRSETAKASASYPASNGLVHSQK  435

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYN-ENMGAR-YSNQSHIM--SSSSRMQYENTQFAPnd  893
             +L +PV +E S+L      G    +  N GAR Y+     M  +SS  MQY+ +  AP  
Sbjct  436   QLASPVNAEQSSLSNISEDGTRVVSIGNQGARGYAANPQDMAPTSSITMQYDMSSLAPEG  495

Query  892   qqqlmnnsqqmqNARYDNNVGLALGPPQSSCFPTV---------GSSVQQTNLNSFEDWS  740
             Q    +   Q   +R  N   LAL P Q    P +         G S Q ++LN F+DWS
Sbjct  496   QFSGSSIQPQA--SRSSNT--LALRPMQQQQQPLLQNFEFSGLGGQSTQPSSLNPFDDWS  551

Query  739   NTRDK--GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMA  566
               ++    V++YL EE IR RSHE+LEN++MQ +LR+ SMGG  +     D F   P  +
Sbjct  552   RLQENRGSVDDYLMEE-IRARSHEILENDEMQQMLRILSMGGAPTGLNNVDSFPSYP--S  608

Query  565   PSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             P+P+F +++DR R  GKAVVGWLKIKAAMRWG F+R+KAAERRAQ
Sbjct  609   PAPAFSFEDDRSRSSGKAVVGWLKIKAAMRWGIFVRRKAAERRAQ  653



>emb|CDY59605.1| BnaC03g74590D [Brassica napus]
Length=627

 Score =   167 bits (422),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 112/263 (43%), Positives = 144/263 (55%), Gaps = 30/263 (11%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             KVYVD LV+KAYENW    EYD K+L++F      + L     DYS           +P 
Sbjct  369   KVYVDGLVRKAYENWDQVIEYDSKSLMNFNQVNKVDAL-----DYS-----------IPV  412

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  869
                S+PS    G     S Y+++ G  +  +S +  ++S M + N+ +AP   Q + N  
Sbjct  413   SGPSQPSTSYSGE---ASVYSQSQGTSFPARSQLADTTSYMHFGNSSYAPPQDQLINNTH  469

Query  868   qqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEE-YLSEEEI  692
             +       +    LALG P  S    +     + NL  F DWSNT ++G  + +LSEEEI
Sbjct  470   ESQSMINSNGGGSLALGAPTGSQSQHLVQPPPEVNL--FNDWSNTGNRGGGDGFLSEEEI  527

Query  691   RLRSHEMLENEDMQHLLRLFSMGG-------HASVNIPEDGFGFTPFMAPSPSFGYDEDR  533
             R RS+EMLEN+DMQ LLRLFSM G          +N+ EDGFGF  F   S   GY EDR
Sbjct  528   RARSNEMLENDDMQQLLRLFSMSGGGGGGGPQTPINMGEDGFGFNSF-GQSSMGGYGEDR  586

Query  532   PRPGKAVVGWLKIKAAMRWGFFI  464
              + GK VVGWLKIKAAMRWGFFI
Sbjct  587   SQSGKPVVGWLKIKAAMRWGFFI  609



>ref|NP_001046071.1| Os02g0177800 [Oryza sativa Japonica Group]
 dbj|BAD27989.1| putative calmodulin-binding protein [Oryza sativa Japonica Group]
 dbj|BAF07985.1| Os02g0177800 [Oryza sativa Japonica Group]
Length=624

 Score =   166 bits (421),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 110/270 (41%), Positives = 161/270 (60%), Gaps = 17/270 (6%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQ-QPRLP  1052
             K++ D+LVKKAY+NW+   EYDGK LL+ K KK     P G V+    L+     + R+ 
Sbjct  361   KLFADALVKKAYDNWMYAIEYDGKALLNSKPKK--KAAPTGHVETHPPLSQPASYEQRIS  418

Query  1051  APVQSEPS-ALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENT-QFAPndqqqlm  878
             +   + PS A   G       Y+ N  A   +Q    S++  + Y++T  F P       
Sbjct  419   SASMTGPSPAGGSGTGTDSIGYDGNQAATQPSQLQSTSANVPVPYDDTFSFLPPSMLMGS  478

Query  877   nnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEE  698
             +N +       ++ +GL LG  Q +   +   S+Q  N+  ++DW+ +++    +  +E+
Sbjct  479   DNQETG-----NDGMGLELGQLQQAI--SQSQSIQPANVG-YDDWTRSQNGQFADDFTED  530

Query  697   EIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGYDEDRPRP-  524
              IR++SH+MLE+EDMQ LLR+FSMGG AS ++ ED FGF  +M +P P+ G++ +R R  
Sbjct  531   -IRMKSHQMLESEDMQQLLRVFSMGG-ASTSLQEDAFGFPTYMPSPLPNLGFEGERTRSS  588

Query  523   GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  589   GKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  618



>emb|CDY52577.1| BnaCnng22620D [Brassica napus]
Length=623

 Score =   166 bits (420),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 118/273 (43%), Positives = 147/273 (54%), Gaps = 36/273 (13%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFK--NKKARNELPMGQVDYSNSLNNQLQQPRL  1055
             K YVD+LVKKAYENW    EYD K+L++F   NK A       ++DYS           +
Sbjct  371   KGYVDALVKKAYENWDQVVEYDSKSLMNFNQVNKTA-------EIDYS-----------M  412

Query  1054  PAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmn  875
             P  V S+PS     +    S YN+   + +  QS    ++S M Y N  FAP DQ     
Sbjct  413   PVSVPSQPSTSYSDITGEASVYNQIPASSFPAQS---DTTSYMHYGNASFAPQDQLVSNT  469

Query  874   nsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEEE  695
             +  Q               P  S     V      + +N F DWS    +G + +LSEEE
Sbjct  470   HESQGMMNGNGGGRLGLGPPSGSQNNHLVQP---HSEMNPFNDWST---RGGDGFLSEEE  523

Query  694   IRLRSHEMLENEDMQHLLRLFSMGG------HASVNIPEDGFGFTPFMAPSPSFGYDEDR  533
             IR RS+EMLEN+DMQ LLRLFSM G         +N+ EDGFGF  F   S    Y+E+R
Sbjct  524   IRARSNEMLENDDMQQLLRLFSMNGGGGGGPQTPMNMGEDGFGFHSF-GQSSMGDYEEER  582

Query  532   PRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              + GK VVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  583   SQSGKPVVGWLKIKAAMRWGFFIRRKAAQRRAQ  615



>gb|EEE56432.1| hypothetical protein OsJ_05602 [Oryza sativa Japonica Group]
Length=789

 Score =   165 bits (418),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 110/270 (41%), Positives = 161/270 (60%), Gaps = 17/270 (6%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQ-QPRLP  1052
             K++ D+LVKKAY+NW+   EYDGK LL+ K KK     P G V+    L+     + R+ 
Sbjct  526   KLFADALVKKAYDNWMYAIEYDGKALLNSKPKK--KAAPTGHVETHPPLSQPASYEQRIS  583

Query  1051  APVQSEPS-ALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENT-QFAPndqqqlm  878
             +   + PS A   G       Y+ N  A   +Q    S++  + Y++T  F P       
Sbjct  584   SASMTGPSPAGGSGTGTDSIGYDGNQAATQPSQLQSTSANVPVPYDDTFSFLPPSMLMGS  643

Query  877   nnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEE  698
             +N +       ++ +GL LG  Q +   +   S+Q  N+  ++DW+ +++    +  +E+
Sbjct  644   DNQETG-----NDGMGLELGQLQQAI--SQSQSIQPANVG-YDDWTRSQNGQFADDFTED  695

Query  697   EIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGYDEDRPRP-  524
              IR++SH+MLE+EDMQ LLR+FSMGG AS ++ ED FGF  +M +P P+ G++ +R R  
Sbjct  696   -IRMKSHQMLESEDMQQLLRVFSMGG-ASTSLQEDAFGFPTYMPSPLPNLGFEGERTRSS  753

Query  523   GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  754   GKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  783



>ref|XP_003570530.1| PREDICTED: uncharacterized protein LOC100822237 [Brachypodium 
distachyon]
 ref|XP_010233903.1| PREDICTED: uncharacterized protein LOC100822237 [Brachypodium 
distachyon]
Length=614

 Score =   163 bits (413),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 110/270 (41%), Positives = 155/270 (57%), Gaps = 23/270 (9%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             K++ D+LVKKAY+NW+   EYDGK LL+ + KK            S +    L +    A
Sbjct  357   KLFADALVKKAYDNWMYVIEYDGKALLNPEPKKK-------AASTSQAEARPLPERYPTA  409

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQ--YENT-QFAPndqqqlm  878
               Q   S   PG    G + +   G R + QS + S+S  +   Y++T  F P      +
Sbjct  410   YAQRGSSTTLPGPSPAGITDSIGHGNRSATQSALQSTSVNLPVPYDDTFSFLPPTMFMGV  469

Query  877   nnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEE  698
             +           + +GL LG  Q     + G S+Q  N+  ++DW+ TRD    +  +E+
Sbjct  470   DQGTAS------DAMGLELGQLQQVV--SHGQSIQPANIG-YDDWTRTRDGQYADDFTED  520

Query  697   EIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGYDEDRPRP-  524
              IR++SH+MLE EDMQ LLR+FSMGG AS ++P++ F F  +M +P P+ G++ +  RP 
Sbjct  521   -IRMKSHQMLEGEDMQQLLRVFSMGG-ASTSLPDETFAFQSYMPSPLPNLGFEGEPSRPS  578

Query  523   GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  579   GKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  608



>gb|EMS66476.1| hypothetical protein TRIUR3_28909 [Triticum urartu]
Length=774

 Score =   164 bits (415),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 115/265 (43%), Positives = 155/265 (58%), Gaps = 25/265 (9%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNS-------LNNQL  1070
             KVY D+LVKKAYE+W+   EYDGK LL FK KK            S S       +N Q 
Sbjct  408   KVYADTLVKKAYEDWMHAVEYDGKALLGFKQKKKSVTTRSDTASASTSNPALYGFVNAQK  467

Query  1069  QQPRLPAPVQSEPSALDPGMLIG-GSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPnd  893
             Q   LP     + S   P    G  S+YN N+ AR ++  +  +++  MQYE +  +P  
Sbjct  468   QL--LPGKA-GQTSTGTPSEAAGVRSTYNGNLAARNTSPQN-NAANITMQYERSALSPES  523

Query  892   qqqlmnnsqqmqNARYDNNVGLALGPPQSSC----FPTVGSSVQQTNLNSFEDWSNTRD-  728
             Q    +   Q       +N+ LAL P Q       F  VG S+Q  +LN F+ WS  ++ 
Sbjct  524   QFSGPSLQTQTSGG---SNI-LALEPAQQQQQGFEFSAVGQSMQPADLNPFDQWSQPQEN  579

Query  727   KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSF  551
             + V++YL EE IRLRSHE+LEN++MQ +LR+ +MGG AS N+ +DGF F P+M +PSP+ 
Sbjct  580   RAVDDYLMEE-IRLRSHEILENDEMQQMLRILNMGG-ASTNMNDDGFTFPPYMQSPSPNL  637

Query  550   GYDEDRPR-PGKAVVGWLKIKAAMR  479
              +++DR R PGKAVVGWLKIKAAMR
Sbjct  638   NFEDDRTRPPGKAVVGWLKIKAAMR  662



>gb|EMT06125.1| hypothetical protein F775_27254 [Aegilops tauschii]
Length=699

 Score =   161 bits (408),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 114/265 (43%), Positives = 156/265 (59%), Gaps = 26/265 (10%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNS-------LNNQL  1070
             KVY D+LVKKAYE+W+   EYDGK LL FK KK            S S       +N Q 
Sbjct  374   KVYADTLVKKAYEDWMHAVEYDGKALLGFKQKKKSVTTRSDTASASTSNPALYGFVNAQK  433

Query  1069  QQPRLPAPV-QSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPnd  893
             Q   LP    QS  +  +   + G  +YN N+ AR ++  +  ++ + MQYE +  +P  
Sbjct  434   QL--LPGKAGQSTGTPSEAAGVRG--TYNGNLAARNTSPQNNAANIT-MQYERSALSPES  488

Query  892   qqqlmnnsqqmqNARYDNNVGLALGPPQSSC----FPTVGSSVQQTNLNSFEDWSNTRD-  728
             Q    +   Q       +N+ LAL P Q       F  VG S+Q  +LN F+ WS  ++ 
Sbjct  489   QFSGPSLQTQTSGG---SNI-LALEPAQQQQQSFEFSAVGQSMQPADLNPFDQWSQPQEN  544

Query  727   KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSF  551
             + V++YL EE IRLRSHE+LEN++MQ +LR+ +MGG AS N+ +DGF F P+M +PSP+ 
Sbjct  545   RAVDDYLMEE-IRLRSHEILENDEMQQMLRILNMGG-ASTNMNDDGFTFPPYMQSPSPNL  602

Query  550   GYDEDRPR-PGKAVVGWLKIKAAMR  479
              +++DR R PGKAVVGWLKIKAAMR
Sbjct  603   NFEDDRTRPPGKAVVGWLKIKAAMR  627



>gb|AFW66308.1| hypothetical protein ZEAMMB73_910550 [Zea mays]
Length=317

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 110/276 (40%), Positives = 153/276 (55%), Gaps = 38/276 (14%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYS------NSLNNQLQ  1067
             K++ D+LVKKAY+NW+   EYDGK LL+ K KK       GQV+         S    L 
Sbjct  63    KLFADALVKKAYDNWMYVIEYDGKGLLNPKPKK--KSASTGQVETHAPAGGPTSYQQYLS  120

Query  1066  QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQ--YENT-QFAPn  896
                +P P    PS        G  S    +    ++ S + SSS+ +Q  Y++T  F P 
Sbjct  121   SMSMPGP---SPSG-------GTDSAGYGVDQSATHPSQLQSSSANVQAPYDDTFSFLPP  170

Query  895   dqqqlmnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVE  716
             +                ++ +GL LG  Q     + G ++Q  N+  + DW   RD    
Sbjct  171   NMLTGSA----------NDAMGLELGQLQQ--VTSQGQTIQPANVG-YGDWPRNRDSQYP  217

Query  715   EYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGYDE  539
             +  +E+ IR++SH++LE EDMQ LLR+FSMGG AS ++P+D F F  +M +P P+ G++ 
Sbjct  218   DDFTED-IRVKSHQLLEGEDMQQLLRVFSMGG-ASGSLPDDTFNFQSYMPSPLPNLGFET  275

Query  538   DRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +R    GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  276   ERSHSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  311



>emb|CAD40976.1| OSJNBa0027P08.1 [Oryza sativa Japonica Group]
Length=143

 Score =   150 bits (380),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 106/139 (76%), Gaps = 10/139 (7%)
 Frame = -1

Query  829  LALGPPQSSCF--PTVGSSVQQTNLNSFEDWSNTRDK--GVEEYLSEEEIRLRSHEMLEN  662
            LALGP Q   F    +G S+Q + LN F+DWS  ++   GV++YL EE IR+RSHE+LEN
Sbjct  2    LALGPTQQQNFEFSALGQSMQPSPLNPFDDWSRLQENRGGVDDYLMEE-IRVRSHEILEN  60

Query  661  E-DMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGYDEDRPRP-GKAVVGWLKIK  491
            E DMQ +LR+ SMGG +S N+   G GF+PFM +P+P+F Y++DR RP GKAVVGWLKIK
Sbjct  61   EEDMQQMLRILSMGG-SSANM-NHGDGFSPFMPSPAPAFNYEDDRARPSGKAVVGWLKIK  118

Query  490  AAMRWGFFIRKKAAERRAQ  434
            AAMRWG F+RKKAAERRAQ
Sbjct  119  AAMRWGIFVRKKAAERRAQ  137



>gb|EMT33137.1| hypothetical protein F775_28653 [Aegilops tauschii]
Length=959

 Score =   163 bits (412),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 115/283 (41%), Positives = 162/283 (57%), Gaps = 35/283 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYS-NSLNNQLQ-  1067
             +V+ D+LVK+AY++W++  EYDGK LL FK KK     R++       Y+ +S ++Q Q 
Sbjct  688   RVFADTLVKQAYDDWINVVEYDGKGLLKFKQKKKSVTTRSDAANVSTSYTYDSAHSQKQL  747

Query  1066  ---QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPn  896
                 P +   + S  S  +   +    + N N  A Y+     +S S  MQY  +   P 
Sbjct  748   ARGHPNIERSLMSSTSKAEETRI----ASNGNQVAIYAANPQDISPSITMQYGMSSLIPE  803

Query  895   dqqqlmnnsqqmqNARYDNNVGLALGPP----QSSCFPTVGSSVQQTNLNSFEDW---SN  737
              Q    +   Q   A   +N+ LA GPP    Q+  F T+G S+Q   LN F+DW   S 
Sbjct  804   GQFNGSSIQTQ---ASRSSNM-LAFGPPPQQQQNFEFSTLGLSMQSPALNPFDDWPGRSQ  859

Query  736   TRDKGVEEYLSEEEIRLRSHEMLENED-MQHLLRLFSMGGHASVNIPEDGFGFTPFMAPS  560
                 GV+++L EE IR+RSH++LENE+ MQH+LR+ S G  A++N        T   +P 
Sbjct  860   ENRGGVDDFLMEE-IRVRSHDILENEEEMQHMLRILSGGAAANMN--------TYIPSPI  910

Query  559   PSFGYDEDR-PRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             P++ +++DR P  GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  911   PTYNFEDDRAPSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  953



>gb|AFW70388.1| calmodulin binding protein [Zea mays]
Length=616

 Score =   157 bits (397),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 111/276 (40%), Positives = 153/276 (55%), Gaps = 38/276 (14%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDY------SNSLNNQLQ  1067
             K++ D+LVKKAY+NW+   EYDGK LL+ K KK       GQ +       S S    L 
Sbjct  362   KLFADALVKKAYDNWMYVIEYDGKGLLNLKPKK--KAASTGQAETHASAGGSTSYQQHLS  419

Query  1066  QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQ--YENT-QFAPn  896
                +P    S PS        G  S    +    ++ S + SSS+ +Q  Y++T  F P 
Sbjct  420   STSMPG---SSPSG-------GTDSVGYGVDQSATHLSQLQSSSTNLQTPYDDTFSFLPP  469

Query  895   dqqqlmnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVE  716
             +                ++ +GL LG  Q     + G  +Q  N+  + DW   RD    
Sbjct  470   NLLTGSA----------NDAMGLELG--QLHQVISQGQPIQPANVG-YVDWPRNRDSQYA  516

Query  715   EYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGYDE  539
             +  +E+ IR++SH+MLE+EDMQ LLR+FSMGG AS ++ +D F F P+M +P P+ G++ 
Sbjct  517   DDFTED-IRVKSHQMLESEDMQQLLRVFSMGG-ASGSLSDDTFNFQPYMPSPLPNPGFES  574

Query  538   DRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +R    GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  575   ERSHSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  610



>ref|XP_006646962.1| PREDICTED: uncharacterized protein LOC102709708 [Oryza brachyantha]
Length=606

 Score =   157 bits (397),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 111/278 (40%), Positives = 151/278 (54%), Gaps = 50/278 (18%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             K++ D+LVKKAY+NW+   EYDGK LL+ K KK     P GQ +          QP L  
Sbjct  360   KLFADALVKKAYDNWMYAIEYDGKALLNSKPKK--KAAPTGQAE---------TQPTLSQ  408

Query  1048  PVQSEPSALDPGML----IGGS---SYNENMGAR-----YSNQSHIMSSSSRMQYENTQF  905
             P   E      GM      GG+    Y+ N  A      Y +    +  S  M  +N + 
Sbjct  409   PASYEQRISSAGMTGPSPAGGTDSIGYDGNQAAANVPVPYDDTFSFLPPSMLMGSDNQET  468

Query  904   APndqqqlmnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDK  725
                                 ++ +GL LG  Q +   +   S+Q  N+  ++DW+ +++ 
Sbjct  469   G-------------------NDAMGLELGELQQAI--SQSHSIQPANVG-YDDWTRSQNG  506

Query  724   GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGY  545
                +  +E+ IR++SH+MLE+EDMQ LLR+FSMGG AS ++ ED FGF  +M PSP   Y
Sbjct  507   QFADDFTED-IRMKSHQMLESEDMQQLLRVFSMGG-ASTSLQEDAFGFPSYM-PSP-LPY  562

Query  544   DEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             + +R R  GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  563   EGERTRSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  600



>dbj|BAJ96828.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score =   157 bits (396),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 159/287 (55%), Gaps = 38/287 (13%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYS--NSLNNQLQ  1067
             +V+ D+LVK+AY++W++  EYDGK LL FK KK     R+++      Y+  +S ++Q Q
Sbjct  378   RVFADTLVKQAYDDWINVVEYDGKGLLKFKQKKKSVTTRSDVANVSTSYTSYDSAHSQKQ  437

Query  1066  QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHI-------MSSSSRMQYENTQ  908
               R  A ++          L+  +S +E   A   NQ  I       +S S  MQY  + 
Sbjct  438   LARGHANIERS--------LMSSTSKDETRIASNGNQVAIYEANPQDISPSITMQYGMSS  489

Query  907   FAPndqqqlmnnsqqmqNARYDNNVGLALGPP----QSSCFPTVGSSVQQTNLNSFEDWS  740
               P  Q    +   Q   A   +N+ LA GPP     +  F   G S+Q    N F+DW 
Sbjct  490   LIPESQFNGSSIQTQ---ASRSSNM-LAFGPPPQQPHNFEFSAFGLSMQSPAPNPFDDWP  545

Query  739   NTRDK---GVEEYLSEEEIRLRSHEMLENED-MQHLLRLFSMGGHASVNIPEDGFGFTPF  572
                 +   GV++ L EE IR RSH+MLENE+ MQH+LR+ S G  A++N   +  GF  +
Sbjct  546   GRLQENRGGVDDCLMEE-IRGRSHDMLENEEEMQHMLRILSGGAAANMN---NVGGFPSY  601

Query  571   MAPSPSFGYDEDR-PRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              +P P F + +DR P  GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  602   PSPVPDFNFVDDRAPSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  648



>gb|AAN65367.1| calmodulin-binding protein 60-A [Phaseolus vulgaris]
Length=101

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 84/97 (87%), Gaps = 4/97 (4%)
 Frame = -1

Query  718  EEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG-HASVNIPEDGFGFTPFMAPSPSF-GY  545
            +E+ SEEEIRLRSHEMLENEDMQHLLRLFSMGG H S+++ EDG+ F  FM PSP+   Y
Sbjct  1    DEFFSEEEIRLRSHEMLENEDMQHLLRLFSMGGGHGSMSV-EDGYSFPTFM-PSPNVPNY  58

Query  544  DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
            DEDR RPG+AVVGWLKIKAAMRWGFFIRK AAE+RAQ
Sbjct  59   DEDRSRPGRAVVGWLKIKAAMRWGFFIRKIAAEKRAQ  95



>dbj|BAK04468.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=655

 Score =   156 bits (395),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 116/284 (41%), Positives = 158/284 (56%), Gaps = 31/284 (11%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYS--NSLNNQLQ  1067
             +V+ D+LVK+AY++W++  EYDGK LL FK KK     R+++      Y+  +S ++Q Q
Sbjct  378   RVFADTLVKQAYDDWINVVEYDGKGLLKFKQKKKSVTTRSDVANVSTSYTSYDSAHSQKQ  437

Query  1066  QPRLPAPVQ----SEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAP  899
               R  A ++    S  S  D   +    + N N  A Y      +S S  MQY  +   P
Sbjct  438   LARGHANIERSLMSSTSKADETRI----ASNGNQVAIYEANPQDISPSITMQYGMSSLIP  493

Query  898   ndqqqlmnnsqqmqNARYDNNVGLALGPP----QSSCFPTVGSSVQQTNLNSFEDWSNTR  731
               Q    +   Q   A   +N+ LA GPP     +  F   G S+Q    N F+DW    
Sbjct  494   EGQFNGSSIQTQ---ASRSSNM-LAFGPPPQQPHNFEFSAFGLSMQSPAPNPFDDWPGRL  549

Query  730   DK---GVEEYLSEEEIRLRSHEMLENED-MQHLLRLFSMGGHASVNIPEDGFGFTPFMAP  563
              +   GV++ L EE IR RSH+MLENE+ MQH+LR+ S G  A++N   +  GF  + +P
Sbjct  550   QENRGGVDDCLMEE-IRGRSHDMLENEEEMQHMLRILSGGAAANMN---NVGGFPSYPSP  605

Query  562   SPSFGYDEDR-PRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              P F + +DR P  GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  606   VPDFNFVDDRAPSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  649



>ref|NP_001152440.1| LOC100286080 [Zea mays]
 gb|ACN34355.1| unknown [Zea mays]
 gb|AFW66305.1| calmodulin binding protein [Zea mays]
Length=612

 Score =   156 bits (394),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 110/276 (40%), Positives = 153/276 (55%), Gaps = 38/276 (14%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYS------NSLNNQLQ  1067
             K++ D+LVKKAY+NW+   EYDGK LL+ K KK       GQV+         S    L 
Sbjct  358   KLFADALVKKAYDNWMYVIEYDGKGLLNPKPKK--KSASTGQVETHAPAGGPTSYQQYLS  415

Query  1066  QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQ--YENT-QFAPn  896
                +P P    PS        G  S    +    ++ S + SSS+ +Q  Y++T  F P 
Sbjct  416   SMSMPGP---SPSG-------GTDSAGYGVDQSATHPSQLQSSSANVQAPYDDTFSFLPP  465

Query  895   dqqqlmnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVE  716
             +                ++ +GL LG  Q     + G ++Q  N+  + DW   RD    
Sbjct  466   NMLT----------GSANDAMGLELGQLQQ--VTSQGQTIQPANVG-YGDWPRNRDSQYP  512

Query  715   EYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGYDE  539
             +  +E+ IR++SH++LE EDMQ LLR+FSMGG AS ++P+D F F  +M +P P+ G++ 
Sbjct  513   DDFTED-IRVKSHQLLEGEDMQQLLRVFSMGG-ASGSLPDDTFNFQSYMPSPLPNLGFET  570

Query  538   DRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +R    GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  571   ERSHSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  606



>gb|ACG47634.1| calmodulin binding protein [Zea mays]
Length=612

 Score =   156 bits (394),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 110/276 (40%), Positives = 153/276 (55%), Gaps = 38/276 (14%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYS------NSLNNQLQ  1067
             K++ D+LVKKAY+NW+   EYDGK LL+ K KK       GQV+         S    L 
Sbjct  358   KLFADALVKKAYDNWMYVIEYDGKGLLNPKPKK--KSASTGQVETHAPAGGPTSYQQYLS  415

Query  1066  QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQ--YENT-QFAPn  896
                +P P    PS        G  S    +    ++ S + SSS+ +Q  Y++T  F P 
Sbjct  416   SMSMPGP---SPSG-------GTDSAGYGVDQSATHPSQLQSSSANVQAPYDDTFSFLPP  465

Query  895   dqqqlmnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVE  716
             +                ++ +GL LG  Q     + G ++Q  N+  + DW   RD    
Sbjct  466   NMLTGSA----------NDAMGLELGQLQQ--VTSQGQTIQPANVG-YGDWPRNRDSQYP  512

Query  715   EYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGYDE  539
             +  +E+ IR++SH++LE EDMQ LLR+FSMGG AS ++P+D F F  +M +P P+ G++ 
Sbjct  513   DDFTED-IRVKSHQLLEGEDMQQLLRVFSMGG-ASGSLPDDTFNFQSYMPSPLPNLGFET  570

Query  538   DRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +R    GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  571   ERSHSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  606



>ref|NP_001150045.1| calmodulin binding protein [Zea mays]
 gb|ACG37616.1| calmodulin binding protein [Zea mays]
Length=616

 Score =   156 bits (394),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 111/276 (40%), Positives = 152/276 (55%), Gaps = 38/276 (14%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDY------SNSLNNQLQ  1067
             K++ D+LVKKAY+NW+   EYDGK LL+ K KK       GQ +       S S    L 
Sbjct  362   KLFADALVKKAYDNWMYVIEYDGKGLLNLKPKK--KAASTGQAETHASAGGSTSYQQHLS  419

Query  1066  QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQ--YENT-QFAPn  896
                +P    S PS        G  S    +    ++ S + SSS+ +Q  Y+ T  F P 
Sbjct  420   STSMPG---SSPSG-------GTDSVGYGVDQSATHLSQLQSSSTNLQTPYDYTFSFLPP  469

Query  895   dqqqlmnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVE  716
             +                ++ +GL LG  Q     + G  +Q  N+  + DW   RD    
Sbjct  470   NLLTGSA----------NDAMGLELG--QLHQVISQGQPIQPANVG-YVDWPRNRDSQYA  516

Query  715   EYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGYDE  539
             +  +E+ IR++SH+MLE+EDMQ LLR+FSMGG AS ++ +D F F P+M +P P+ G++ 
Sbjct  517   DDFTED-IRVKSHQMLESEDMQQLLRVFSMGG-ASGSLSDDTFNFQPYMPSPLPNPGFES  574

Query  538   DRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +R    GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  575   ERSHSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  610



>ref|XP_004951715.1| PREDICTED: uncharacterized protein LOC101768423 [Setaria italica]
Length=617

 Score =   151 bits (382),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 105/274 (38%), Positives = 149/274 (54%), Gaps = 34/274 (12%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYS------NSLNNQLQ  1067
             K++ D+LVKKAY+NW+   EYDGK L + K KK       GQV+ +       S    L 
Sbjct  363   KLFADALVKKAYDNWMYVIEYDGKGLFNPKPKK--KAASTGQVETNLPAVGPASYQQHLS  420

Query  1066  QPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENT-QFAPndq  890
                +P P         P        Y+ +  A +  Q    SS+ +  +++T  F P + 
Sbjct  421   STSMPGP--------SPAGRSDSVGYDGDQSATHPAQLQSSSSNVQSPFDDTFSFLPPNM  472

Query  889   qqlmnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEY  710
                            ++ +GL LG  Q     +   S+Q  N+  + DW   R+    + 
Sbjct  473   LTGSA----------NDAMGLELGQLQQVI--SQSQSIQPANVG-YTDWPRNRESQYGDD  519

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGYDEDR  533
              +E+ IR++SH+MLE+EDMQ LLR+FSMGG AS ++P+D F F  +M +P P+ G++ +R
Sbjct  520   FTED-IRIKSHQMLESEDMQQLLRVFSMGG-ASGSLPDDTFNFQSYMPSPLPNLGFEGER  577

Query  532   PRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
                 GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  578   SHSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  611



>gb|EMT26442.1| hypothetical protein F775_27587 [Aegilops tauschii]
Length=613

 Score =   150 bits (380),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 149/271 (55%), Gaps = 29/271 (11%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             K + D LVKKAY+NW+   EYDGK LL+ K KK              +L NQ +     A
Sbjct  360   KHFADGLVKKAYDNWMYVIEYDGKALLNPKPKK------------KAALTNQAEARAPAA  407

Query  1048  PVQSEPSALDPGMLIGGSS----YNENMGARYSNQSHIMSSSSRMQYENT-QFAPndqqq  884
              VQ   S   PG    G++    Y+ N  A  S Q    S++  + Y++   F P+    
Sbjct  408   YVQRISSTSMPGPSTTGTNGSIGYDGNQTATQSVQLQSSSANMPVPYDDAFPFLPHTMLM  467

Query  883   lmnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLS  704
               N           + +GL LG    +   + G  +Q  N+  +++W + RD    +  +
Sbjct  468   GSNQGTAS------DGMGLELGQLHHTI--SQGHPIQPANVG-YDNWHHNRDGQYADDFT  518

Query  703   EEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRPRP  524
             E+ IRL+SH++LE +DMQ LLR+F+MGG AS  +P++ F F    +P P+ G++ +  RP
Sbjct  519   ED-IRLKSHQLLEGDDMQQLLRVFNMGG-ASTGLPDETFSFPYMQSPLPNPGFEGEPSRP  576

Query  523   -GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  577   SGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  607



>ref|XP_002453396.1| hypothetical protein SORBIDRAFT_04g005240 [Sorghum bicolor]
 gb|EES06372.1| hypothetical protein SORBIDRAFT_04g005240 [Sorghum bicolor]
Length=622

 Score =   150 bits (378),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 106/266 (40%), Positives = 144/266 (54%), Gaps = 15/266 (6%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQ-QPRLP  1052
             K++ D LVKK+Y+NW+   EYDGK LL+ K KK       GQ +    +   +  Q  L 
Sbjct  365   KLFADGLVKKSYDNWMYVIEYDGKGLLNPKPKK--KAASTGQAETHAPVGGPISYQQHLS  422

Query  1051  APVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnn  872
             +   S PS   P      + Y  +  A + +Q  + SSS+ +Q    Q  P         
Sbjct  423   STSMSGPS---PSGGTNSAGYGVDQSATHPSQ--LQSSSTNVQSAIVQ--PPYDDTFSFL  475

Query  871   sqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEEEI  692
                M     ++ +GL LG  Q     + G ++Q  N+    DW   RD    +  +E+ I
Sbjct  476   PPNMLTGSANDAMGLELGQLQQVI--SQGQAIQPANVGYGSDWPRNRDNQYADDFTED-I  532

Query  691   RLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRPRPGKAV  512
              ++SH+MLE+EDMQ LLR+FSMGG AS ++P+D F F  +M PSP     E     GKAV
Sbjct  533   HVKSHQMLESEDMQQLLRVFSMGG-ASGSLPDDTFNFQSYM-PSPLPNQTERSHSSGKAV  590

Query  511   VGWLKIKAAMRWGFFIRKKAAERRAQ  434
             VGWLKIKAA+RWG F+RKKAAERRAQ
Sbjct  591   VGWLKIKAAIRWGIFVRKKAAERRAQ  616



>gb|KJB68601.1| hypothetical protein B456_010G254300 [Gossypium raimondii]
Length=621

 Score =   149 bits (376),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 104/279 (37%), Positives = 148/279 (53%), Gaps = 46/279 (16%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNK----KARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVD LVKKAYENW+   EYDGK+LL           R +LPM    +++S + Q   P
Sbjct  368   KVYVDILVKKAYENWIHVIEYDGKSLLGCNEDDSLDTCRAKLPMDL--HTSSTSQQQILP  425

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              L  PV +   ++D  +++ G  Y+++M  R +N+S  +  ++ +      F   +    
Sbjct  426   TLSVPVPTGQPSMDSYLVVRG--YDDSMAGRLANESQNVHLNATILLNGASFPLQNPLV-  482

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYL  707
                          N+  L  GP QS+   F  VG+S                 +GVE++ 
Sbjct  483   -------------NDNELVHGPSQSTVRGFNNVGTS--------------NIPEGVEDFF  515

Query  706   SE-EEIRLRSH-EMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFT-PFMAPSPSFGY-  545
             SE EE+R+RS+ EML NEDMQHL+R+F+ G   H   N  +D   ++  +M P+ +  Y 
Sbjct  516   SEDEEMRMRSNNEMLANEDMQHLIRIFNKGNQDHIPFNASDDSHPYSSTYMTPTLALNYG  575

Query  544   --DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
               +E  P  GKAVVGWLK+KAA+RWG F RKKAAER A 
Sbjct  576   FDNETSPSSGKAVVGWLKLKAALRWGIFTRKKAAERHAH  614



>gb|AAA33446.1| calmodulin-binding protein, partial [Zea mays]
Length=129

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 89/125 (71%), Gaps = 6/125 (5%)
 Frame = -1

Query  796  PTVGSSVQQTNLNSFEDW---SNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSM  626
            P +G  VQ T LN FE+W      R  GV++YL EE IR+RSHE+LENE+MQ +LRL SM
Sbjct  1    PALGQPVQPTGLNPFEEWPQQQENRGGGVDDYLMEE-IRMRSHEILENEEMQQMLRLLSM  59

Query  625  GGHASVNIPEDGFGFTPFMAPSPSFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAA  449
            GG A  + P+     +    PSP+  Y++DR R PGKAVVGWLKIKAAMRWG F+RKKAA
Sbjct  60   GG-AEPSEPKTLQFPSVHACPSPNVSYEDDRTRAPGKAVVGWLKIKAAMRWGIFVRKKAA  118

Query  448  ERRAQ  434
            ERRAQ
Sbjct  119  ERRAQ  123



>gb|EMS66803.1| hypothetical protein TRIUR3_04882 [Triticum urartu]
Length=591

 Score =   142 bits (359),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 103/271 (38%), Positives = 145/271 (54%), Gaps = 29/271 (11%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             K + D LVKKAY+NW+   EYDGK LL+ K KK              +L NQ +     A
Sbjct  338   KHFADGLVKKAYDNWMYVIEYDGKALLNPKPKK------------KAALTNQAEARAPAA  385

Query  1048  PVQSEPSALDPGMLIGGSS----YNENMGARYSNQSHIMSSSSRMQYENT-QFAPndqqq  884
              VQ   S   PG    G++    Y+ N  A  S Q    S++  + Y++   F P     
Sbjct  386   YVQCISSTSMPGPSTTGTNGSIGYDGNQTATQSVQLQSSSANVPVPYDDAFSFLPPTMLM  445

Query  883   lmnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLS  704
               N           + +GL LG    +   +    +Q  N+  +++W + RD    +  +
Sbjct  446   GSNQGTAS------DGMGLELGQLHHTI--SQRQPIQPANVG-YDNWHHNRDGQYADDFT  496

Query  703   EEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRPRP  524
             E+ IR++SH++LE +DMQ LLR+F+MGG AS  +P++ F F    +P P+   + +  RP
Sbjct  497   ED-IRMKSHQLLEGDDMQQLLRIFNMGG-ASTGLPDETFSFPDIPSPFPNPDSEGEPSRP  554

Query  523   -GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  555   SGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  585



>gb|AAA33447.1| calmodulin-binding protein, partial [Zea mays]
Length=282

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 100/280 (36%), Positives = 143/280 (51%), Gaps = 45/280 (16%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKA--------RNELPMGQVDYSN----S  1085
             K++ D+LVKKAY+NW+   EYDGK LL+ K KK          + L +G +DYSN    S
Sbjct  27    KLFADALVKKAYDNWMYVIEYDGKGLLNPKPKKKSASTGQVETHALRVGPLDYSNNTMSS  86

Query  1084  LNNQLQQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQF  905
             +  Q    +L   +Q   S     + +    +     +R+   +H  S     + +  Q 
Sbjct  87    MACQGHHHQLELILQGMASTKSQHIHLSCRVHPPM--SRHHMMTHFRSYHVPCR-QGLQM  143

Query  904   APndqqqlmnnsqqmqNARYDNNV-GLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRD  728
              P      +  S  ++  ++      + +GP       TV  S+  T+L +F        
Sbjct  144   MPWVWNWAVAASNFLKARQFSQQTWDMVIGPG------TVTVSILMTSLKTFG-------  190

Query  727   KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSF  551
                          LR+  +LE EDMQ LLR+FSMGG AS ++P+D F F  +M +P P+ 
Sbjct  191   -------------LRATSLLEGEDMQQLLRVFSMGG-ASGSLPDDTFNFQSYMPSPMPNL  236

Query  550   GYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             G++ +R    GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  237   GFETERTHSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  276



>ref|XP_002535531.1| hypothetical protein RCOM_2098470 [Ricinus communis]
 gb|EEF26852.1| hypothetical protein RCOM_2098470 [Ricinus communis]
Length=196

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/216 (38%), Positives = 110/216 (51%), Gaps = 30/216 (14%)
 Frame = -1

Query  1072  LQQPRLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPnd  893
             +Q  RLPA + +E +++  G+ +GG+  N++MGA +S QS +++ +SRM           
Sbjct  1     MQLSRLPASITTEQASVHSGLQVGGN--NDSMGAGFSAQSQLVNPNSRM-----------  47

Query  892   qqqlmnnsqqmqNARYDNNVGLALGPPQSSC---FPTVGSSVQQTNLNSFEDWSNTRDKG  722
                           R DN+VGLALG PQS     F  +  +              T  + 
Sbjct  48    --------------RNDNSVGLALGTPQSYLAQGFKLLALTCSHLVSILLMTGPTTGTRE  93

Query  721   VEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYD  542
             +   L  +         L  +           GG A+VNIPE GF F P++A SP   YD
Sbjct  94    LMNTLLRKRFASEVMRCLRMKICNTCFDSLPWGGIAAVNIPEGGFSFPPYIAASPMPNYD  153

Query  541   EDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             E+  RP KAVVGWLKIKAAMRWGFFIRKKAAER+ Q
Sbjct  154   ENGVRPNKAVVGWLKIKAAMRWGFFIRKKAAERQEQ  189


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  765  ISILLRTGLTPVTRGLRNICLRRRFVSEAMKC*RMKICSTCFGSSAW  625
            +SILL TG T  TR L N  LR+RF SE M+C RMKIC+TCF S  W
Sbjct  79   VSILLMTGPTTGTRELMNTLLRKRFASEVMRCLRMKICNTCFDSLPW  125



>gb|ABR25523.1| calmodulin binding protein cellular communication/signal transduction 
mechanism [Oryza sativa Indica Group]
Length=98

 Score =   124 bits (312),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 78/92 (85%), Gaps = 5/92 (5%)
 Frame = -1

Query  700  EEIRLRSHEMLENE-DMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGYDEDRPR  527
            EEIR+RSHE+LENE DMQ +LR+ SMGG +S N+   G GF+PFM +P+P+F Y++DR R
Sbjct  3    EEIRVRSHEILENEEDMQQMLRILSMGG-SSANM-NHGDGFSPFMPSPAPAFNYEDDRAR  60

Query  526  P-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
            P GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  61   PSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  92



>emb|CDX89394.1| BnaA01g14990D [Brassica napus]
Length=575

 Score =   129 bits (325),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 111/269 (41%), Positives = 139/269 (52%), Gaps = 56/269 (21%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             KVYVD LVKKAY+NW    EY+GKT L+  N+  R E+    V  + S+      P  P+
Sbjct  354   KVYVDGLVKKAYDNWNQVIEYEGKTPLNL-NQPERVEIESVTVPANYSV-----LP--PS  405

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  869
             P+   P +  PG    G  YN     ++    H   + ++   EN               
Sbjct  406   PI---PPSQFPGFSFEG--YNVLQQDQFMG-IHQHQTQTQTNLEN---------------  444

Query  868   qqmqNARYDNNVGLALGPP-QSSC-FPTVGSS-VQQTNLNSFEDWSNTRDKGVEEYLSEE  698
                      N  G+ALG   QS+C +  +GSS V Q NL+ FE+WS+           E 
Sbjct  445   --------QNVTGMALGTTLQSTCGYQDMGSSSVHQANLDPFEEWSHQH---------EN  487

Query  697   EIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRPRPGK  518
             ++  RSHEMLE+EDMQ LL+L SMGG    N       F  FM  +P     EDR R GK
Sbjct  488   DLLSRSHEMLESEDMQQLLQLCSMGGGNGENGYG----FPSFMQNTPMV--HEDRERSGK  541

Query  517   AVVGWLKIKAAMRWGFFIRKKAAE-RRAQ  434
             AVVGWLKIKAAM+WG FIRKKAAE RRAQ
Sbjct  542   AVVGWLKIKAAMKWGIFIRKKAAEKRRAQ  570



>ref|XP_009139545.1| PREDICTED: uncharacterized protein LOC103863555 [Brassica rapa]
Length=575

 Score =   129 bits (324),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 110/269 (41%), Positives = 138/269 (51%), Gaps = 56/269 (21%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             KVYVD LVKKAY+NW    EY+GKT L+  N+  R E+    V  + S+         P+
Sbjct  354   KVYVDGLVKKAYDNWNQVIEYEGKTPLNL-NQPERVEIEPVTVPANYSVLP-------PS  405

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  869
             P+   P +  PG    G  YN     ++    H   + ++   EN               
Sbjct  406   PI---PPSQFPGFSFEG--YNVLQQDQFMG-IHQHQTQTQTNLEN---------------  444

Query  868   qqmqNARYDNNVGLALGPP-QSSC-FPTVGSS-VQQTNLNSFEDWSNTRDKGVEEYLSEE  698
                      N  G+ALG   QS+C +  +GSS V Q NL+ FE+WS+           E 
Sbjct  445   --------QNVTGMALGTTLQSTCGYQDMGSSSVHQANLDPFEEWSHQH---------EN  487

Query  697   EIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRPRPGK  518
             ++  RSHEMLE+EDMQ LL+L SMGG    N       F  FM  +P     EDR R GK
Sbjct  488   DLLSRSHEMLESEDMQQLLQLCSMGGGNGENGYG----FPSFMQNTPMV--HEDRARSGK  541

Query  517   AVVGWLKIKAAMRWGFFIRKKAAE-RRAQ  434
             AVVGWLKIKAAM+WG FIRKKAAE RRAQ
Sbjct  542   AVVGWLKIKAAMKWGIFIRKKAAEKRRAQ  570



>gb|KHG17962.1| Insulin-like receptor [Gossypium arboreum]
Length=538

 Score =   128 bits (322),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 100/273 (37%), Positives = 139/273 (51%), Gaps = 45/273 (16%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVD LVKKAYENW+   EYD K+            ++  +PM    Y +         
Sbjct  295   KVYVDGLVKKAYENWMHVIEYDAKSSPGSNEDDNTGCSKANVPMDLQAYPS------HHQ  348

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LP+ +  E   +D G+ +G     + M A   +Q  + S ++R+  + TQ         
Sbjct  349   VLPSLLVPEQPPMDSGLNVG-----DPMAA---SQLPMQSQNARLNAQTTQL--------  392

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  701
                      A  ++N      P  SS  P     V  +N+ SF+          +++LSE
Sbjct  393   ----NGALFAELNDNELTHHCPSHSSSKPGF-HGVAASNIPSFK-------AEADDFLSE  440

Query  700   EEIRLRSHEMLENEDMQHLLRLFSMG--GHASVNIPEDGFGFTPFMAPSPSFGY--DEDR  533
             EEIR+RS+E+LENEDMQHLLR+F+MG  GH + N     +  T   APS + G+  +E  
Sbjct  441   EEIRMRSNEVLENEDMQHLLRVFNMGSHGHGASNPCSSKYMPT---APSLNCGFNNEEAL  497

Query  532   PRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
                GKAVVGWLK+KAA+RWG F RKK AER A+
Sbjct  498   SSSGKAVVGWLKLKAALRWGVFTRKKVAERLAR  530



>gb|AFK38635.1| unknown [Medicago truncatula]
Length=128

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 74/101 (73%), Gaps = 5/101 (5%)
 Frame = -1

Query  721  VEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMG--GHASVNIPEDGFGFTPFMAPSPSFG  548
            VE++  EEEIR+RSHEMLENEDMQ LLR+F+MG   HAS N  EDG+       P+ +  
Sbjct  21   VEDFSPEEEIRIRSHEMLENEDMQQLLRMFNMGSHAHASFNAHEDGYPNPSAYMPANNMS  80

Query  547  Y---DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
            Y   DE +   GKAVVGWLK+KAA+RWG F+RKKAA+RRAQ
Sbjct  81   YNFDDEPKSSSGKAVVGWLKLKAALRWGIFVRKKAADRRAQ  121



>gb|AAN65369.1| calmodulin-binding protein 60-C [Phaseolus vulgaris]
Length=129

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 83/120 (69%), Gaps = 7/120 (6%)
 Frame = -1

Query  772  QTNLNSFE--DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVN  605
            Q++ + FE    SN   +GVEEY  EEEIR+RSHEMLENEDMQ LLR+F++GG  H + N
Sbjct  3    QSSTHGFEPVSISNPTYRGVEEYFPEEEIRIRSHEMLENEDMQQLLRMFNVGGQPHPTFN  62

Query  604  IPEDGFGFTPFMAPSPSFGY---DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              +DG+  +     +   GY   DE     GKAVVGWLK+KAA+RWG FIRK+AAE+RAQ
Sbjct  63   GLDDGYPSSSTYISANPMGYNFDDEPNRSSGKAVVGWLKLKAALRWGIFIRKQAAEKRAQ  122



>emb|CDX94414.1| BnaC01g17700D [Brassica napus]
Length=576

 Score =   127 bits (320),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 137/273 (50%), Gaps = 63/273 (23%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             KVYVD LVKKAY+NW    EY+GKT L+F N+  R E+    V  + S+         P+
Sbjct  354   KVYVDGLVKKAYDNWNQVIEYEGKTPLNF-NQPKRVEIEPVTVPANYSVLP-------PS  405

Query  1048  PVQSEPSALDPGMLIGGSSY---NENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  878
             P+   P +  PG    G S    ++ MG       H   + ++   EN            
Sbjct  406   PI---PPSQFPGFSFEGYSVLQQDQFMGI------HQHQTQTQTNLEN------------  444

Query  877   nnsqqmqNARYDNNVGLALG--PPQSSC-FPTVGSS-VQQTNLNSFEDWSNTRDKGVEEY  710
                         N  G+ LG  P QS+  +P +GSS V Q NL+  E+WS          
Sbjct  445   -----------QNVTGMTLGTTPLQSTGGYPDMGSSSVHQANLDPLEEWSRQH-------  486

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRP  530
               E ++  RSHEMLE+EDMQ LL+L SMGG            F  FM  +P     EDR 
Sbjct  487   --ENDLLSRSHEMLESEDMQQLLQLCSMGGGDGEAGYG----FPSFMQNTPMV--HEDRV  538

Query  529   RPGKAVVGWLKIKAAMRWGFFIRKKAAE-RRAQ  434
             R GKAVVGWLKIKAAM+WG FIRKKAAE RRAQ
Sbjct  539   RSGKAVVGWLKIKAAMKWGIFIRKKAAEKRRAQ  571



>ref|XP_002532915.1| hypothetical protein RCOM_1318360 [Ricinus communis]
 gb|EEF29472.1| hypothetical protein RCOM_1318360 [Ricinus communis]
Length=195

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 108/199 (54%), Gaps = 7/199 (4%)
 Frame = -1

Query  1024  LDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnnsqqmqNARY  845
             +  G+ +GG  YN +MGA +S QS +++ +S  ++++T F     + L++NS   Q  R 
Sbjct  1     MHSGLQVGG--YNNSMGAGFSAQSQLVNPNSSTRFDSTSFT--VHEPLISNSHHAQGMRN  56

Query  844   DNNVGLALGPPQSSC---FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEEEIRLRSHE  674
             DN+VGLALGPPQS        +G                TR + +   L  +        
Sbjct  57    DNSVGLALGPPQSYLAQGLKLLGLPCSHLVSILLMTGPTTRTRELMNTLLRKRFASEVMR  116

Query  673   MLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRPRPGKAVVGWLKI  494
              L  +         + G + +VNI EDGF F P+MA SP   YDE+  RPGKAVVGWLKI
Sbjct  117   CLRMKICNSCFESLAWGENGAVNIHEDGFQFPPYMAASPMPNYDENGVRPGKAVVGWLKI  176

Query  493   KAAMRWGFFIRKKAAERRA  437
             K AMR GFF+RKKA ERRA
Sbjct  177   KVAMRLGFFVRKKATERRA  195



>gb|KDO59439.1| hypothetical protein CISIN_1g007350mg [Citrus sinensis]
Length=531

 Score =   120 bits (300),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 104/278 (37%), Positives = 131/278 (47%), Gaps = 54/278 (19%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             K+ VDSLVK+AY+NW    EYDGK L S  N                  N +       A
Sbjct  290   KISVDSLVKRAYDNWHQVLEYDGKFLSSLTN------------------NTKKAIKSSAA  331

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYE--NTQFAPndqqqlmn  875
             P  S  S  D G     +            +   MSS  R QY+  N Q AP  Q     
Sbjct  332   PTVS--SNYDTGRCTSTTQ----------TRQQYMSSEPRSQYQSGNHQHAPVTQLIEFP  379

Query  874   nsqqmqNARYDNNVGLALGPPQ---SSCFPTVGSSVQQTNLNSFE-DWSNTRD-KGVEEY  710
                     R D    + L  PQ   S  F  +         + F  DWS  R+  G+E++
Sbjct  380   F------VRPDQTSLMILNNPQAVLSGSFDHLSVGNAAAGGSYFPGDWSRPRNGHGLEDF  433

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPED-----GFGFTPFMAPSPSFGY  545
             L+EE IR+RS EMLEN+DMQ LL+  SMG  AS +   +     G  + P M  +    Y
Sbjct  434   LAEE-IRVRSSEMLENDDMQRLLKTLSMGMTASYDHSHEACYSYGIQYEPPMDQT----Y  488

Query  544   DEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              +D  R  GKAVVGWLK+KAA+RWG F+RK+AAERRAQ
Sbjct  489   KQDLSRGSGKAVVGWLKLKAALRWGIFVRKRAAERRAQ  526



>ref|XP_011043291.1| PREDICTED: uncharacterized protein LOC105138780 isoform X4 [Populus 
euphratica]
Length=578

 Score =   120 bits (300),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 80/104 (77%), Gaps = 6/104 (6%)
 Frame = -1

Query  727  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH--ASVNIPEDGFGFTPFM---AP  563
            +G E++ SEEEIR RSH+MLENEDMQ LLR+F+MGG   +S ++ E G+ ++ +M   +P
Sbjct  468  RGKEDFFSEEEIRTRSHDMLENEDMQQLLRIFNMGGQGLSSNSVTEYGYPYSSYMPSPSP  527

Query  562  SPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             P++   ++  R  GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  528  CPNYSLSDNPSRSSGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  571


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 51/82 (62%), Gaps = 4/82 (5%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             K+YVDSLV KAY+NW+   EYDG +LL FK  +    ++N++P GQ D+ N  ++Q   P
Sbjct  375   KIYVDSLVNKAYDNWMHVMEYDGNSLLDFKQHQGVAASQNDVPSGQQDFLNPYDHQDSLP  434

Query  1060  RLPAPVQSEPSALDPGMLIGGS  995
              +  PV SE   +  G  IGGS
Sbjct  435   TISVPVPSEQPVVHSGPAIGGS  456



>gb|KDO59436.1| hypothetical protein CISIN_1g007350mg [Citrus sinensis]
 gb|KDO59437.1| hypothetical protein CISIN_1g007350mg [Citrus sinensis]
Length=607

 Score =   120 bits (301),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 104/278 (37%), Positives = 131/278 (47%), Gaps = 54/278 (19%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             K+ VDSLVK+AY+NW    EYDGK L S  N                  N +       A
Sbjct  366   KISVDSLVKRAYDNWHQVLEYDGKFLSSLTN------------------NTKKAIKSSAA  407

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYE--NTQFAPndqqqlmn  875
             P  S  S  D G     +            +   MSS  R QY+  N Q AP  Q     
Sbjct  408   PTVS--SNYDTGRCTSTTQ----------TRQQYMSSEPRSQYQSGNHQHAPVTQLIEFP  455

Query  874   nsqqmqNARYDNNVGLALGPPQ---SSCFPTVGSSVQQTNLNSFE-DWSNTRD-KGVEEY  710
                     R D    + L  PQ   S  F  +         + F  DWS  R+  G+E++
Sbjct  456   F------VRPDQTSLMILNNPQAVLSGSFDHLSVGNAAAGGSYFPGDWSRPRNGHGLEDF  509

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPED-----GFGFTPFMAPSPSFGY  545
             L+EE IR+RS EMLEN+DMQ LL+  SMG  AS +   +     G  + P M  +    Y
Sbjct  510   LAEE-IRVRSSEMLENDDMQRLLKTLSMGMTASYDHSHEACYSYGIQYEPPMDQT----Y  564

Query  544   DEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              +D  R  GKAVVGWLK+KAA+RWG F+RK+AAERRAQ
Sbjct  565   KQDLSRGSGKAVVGWLKLKAALRWGIFVRKRAAERRAQ  602



>gb|AAN65370.1| calmodulin-binding protein 60-D [Phaseolus vulgaris]
Length=285

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 99/277 (36%), Positives = 132/277 (48%), Gaps = 50/277 (18%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             K+ VDSLVKKAY+NW    EYDGK L S  N K  +     Q+ + +S            
Sbjct  42    KMSVDSLVKKAYDNWDQVVEYDGKVLNSLTNMKKGSRTLATQIMHHDSF-----------  90

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  869
             P Q   SA D                     S++ S        N Q    +        
Sbjct  91    PEQQCSSAKDK-------------------VSYVSSEP------NQQLQITNNYSAGPGL  125

Query  868   qqmqNARYDNN-VGLALGPPQ---SSCFPTVGSSVQQTNLNSFE-DWSNTRD-KGVEEYL  707
                   R D+  VG +L   Q   SS    V     +   N F  DW+  R+ +G+E+ +
Sbjct  126   TDYLFGRSDSQMVGTSLTDSQISLSSSMNYVTGENHENGGNYFAGDWARPRNGQGLEDIV  185

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIP---EDGFGFTPFMAPS---PSFGY  545
             +EE +RLRS EMLE++DMQ LL+  + G + S N+    E  + ++    P     S G 
Sbjct  186   AEE-LRLRSSEMLESDDMQRLLKTINAGVNMSANLGHSNESCYTYSLQYEPEMYHHSLGE  244

Query  544   DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             D+ +P  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  245   DQGKP-SGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  280



>gb|KJB69416.1| hypothetical protein B456_011G022600 [Gossypium raimondii]
Length=605

 Score =   119 bits (299),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 95/273 (35%), Positives = 136/273 (50%), Gaps = 45/273 (16%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             KVYVD LVKKAYENW+   EYD K+            ++  +PM    Y +         
Sbjct  362   KVYVDGLVKKAYENWMHVIEYDAKSSPGSNEDDNTGCSKANVPMDLQAYPS------HHQ  415

Query  1060  RLPAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqql  881
              LP+ +  E   +D G+ +G     + M A   +Q  + S ++R+  + TQ         
Sbjct  416   VLPSLLVPEQPPMDSGLNVG-----DPMAA---SQLPMQSQNARLNAQTTQL--------  459

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSE  701
                         ++N      P  SS  P     V  +N+  F+          +++LSE
Sbjct  460   ----NGALFTELNDNELTHHCPSHSSSKPGF-HGVAASNIPPFK-------AEADDFLSE  507

Query  700   EEIRLRSHEMLENEDMQHLLRLFSMG--GHASVNIPEDGFGFTPFMAPSPSFGYDEDRP-  530
             EEI +RS+E+LENEDMQHLLR+ +MG  GH + N     +  T   APS + G++++   
Sbjct  508   EEIIMRSNEVLENEDMQHLLRVINMGSHGHGASNPCSSTYMPT---APSLNCGFNKEEAL  564

Query  529   -RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
                GKAVVGWLK+KAA+RWG F RKK AER A+
Sbjct  565   SSSGKAVVGWLKLKAALRWGVFTRKKVAERLAR  597



>gb|AHI49901.1| calmodulin-binding protein, partial [Lavandula angustifolia]
Length=84

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 62/79 (78%), Gaps = 3/79 (4%)
 Frame = -1

Query  664  NEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGY--DEDRPRPGKAVVGWLKIK  491
            NE+MQ LLR+FS+G     N+PEDG+GF P  AP PS G   +ED+ R GKAVVGWLKIK
Sbjct  1    NEEMQDLLRIFSLGSQTPANVPEDGYGF-PSHAPLPSPGLTLNEDQTRSGKAVVGWLKIK  59

Query  490  AAMRWGFFIRKKAAERRAQ  434
            AAMRWG FIRKKAAERRAQ
Sbjct  60   AAMRWGIFIRKKAAERRAQ  78



>ref|XP_006473988.1| PREDICTED: uncharacterized protein LOC102629839 [Citrus sinensis]
Length=607

 Score =   119 bits (297),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 103/278 (37%), Positives = 130/278 (47%), Gaps = 54/278 (19%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             K+ VDSLVK+AY+NW    EYDGK L S  N                  N +       A
Sbjct  366   KISVDSLVKRAYDNWHQVLEYDGKFLSSLTN------------------NTKKAIKSSAA  407

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYE--NTQFAPndqqqlmn  875
             P  S  S  D G     +            +   MSS  R QY+  N Q AP  Q     
Sbjct  408   PTVS--SNYDTGRCTSTTQ----------TRQQYMSSEPRSQYQSGNHQHAPVTQLIEFP  455

Query  874   nsqqmqNARYDNNVGLALGPPQ---SSCFPTVGSSVQQTNLNSFE-DWSNTRD-KGVEEY  710
                     R D    + L  PQ   S  F  +         + F  DWS  R+  G+E++
Sbjct  456   F------VRPDQTSLMILNNPQAVLSGSFDHLSVGNAAAGGSYFPGDWSRPRNGHGLEDF  509

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPED-----GFGFTPFMAPSPSFGY  545
             L+EE IR+RS EMLEN+DMQ LL+  SMG  A  +   +     G  + P M  +    Y
Sbjct  510   LAEE-IRVRSSEMLENDDMQRLLKTLSMGMTAGYDHSHEACYSYGIQYEPPMDQT----Y  564

Query  544   DEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              +D  R  GKAVVGWLK+KAA+RWG F+RK+AAERRAQ
Sbjct  565   KQDLSRGSGKAVVGWLKLKAALRWGIFVRKRAAERRAQ  602



>ref|XP_012071464.1| PREDICTED: uncharacterized protein LOC105633479 isoform X1 [Jatropha 
curcas]
 gb|KDP38647.1| hypothetical protein JCGZ_04000 [Jatropha curcas]
Length=610

 Score =   118 bits (295),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 99/281 (35%), Positives = 133/281 (47%), Gaps = 59/281 (21%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             KV VDSLVK+AYENW    EYDGK L +  N K      +                   A
Sbjct  368   KVSVDSLVKQAYENWHQVMEYDGKVLNTLMNTKNGRRTSV-------------------A  408

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  869
             P+            +     N  + +  + Q   +SS      E  Q    +    +   
Sbjct  409   PI------------VDNYDTNHYITSNQNRQQQYISSE-----EGLQSQAVNNHTSVPQL  451

Query  868   qqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNS----FE-DWSNTRD-KGVEEYL  707
              +    R D++  + L   Q     T GSS+   ++ +    F  DWS TR+ +G+E+Y 
Sbjct  452   IEFPFVRSDHDAVMTLNNQQ---VATAGSSMDHMSVATPGTYFSGDWSQTRNGQGLEDYF  508

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFT-------PFMAPSPSFG  548
             +EE IRLRS EMLE+ DMQ LL+ F MG    +    +GFG +          A  P   
Sbjct  509   AEE-IRLRSTEMLESGDMQRLLKTFGMGIGVGMG---NGFGSSDEGCYSYSIQAYEPQMD  564

Query  547   --YDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
               Y ++R R  GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  565   QVYAQERSRGSGKAVVGWLKLKAALRWGIFIRKRAAERRAQ  605



>ref|XP_010265653.1| PREDICTED: uncharacterized protein LOC104603341 [Nelumbo nucifera]
Length=607

 Score =   118 bits (295),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 98/275 (36%), Positives = 128/275 (47%), Gaps = 50/275 (18%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             K+ VDSLVK AYENW    EYDGK LL                   NSLN          
Sbjct  368   KISVDSLVKTAYENWNYVIEYDGKVLL-------------------NSLNGSRGAEAAAL  408

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  869
                +    +D  +L    + N    A++    +I  S  ++     +F            
Sbjct  409   AGTNNHPLVDNYILGSACAQNHAPSAQHFQNDNIQPSGHQL----IEFP-----------  453

Query  868   qqmqNARYDNNVGLALGPPQSSC-----FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLS  704
                   R D  VGL L  PQ S      + +VG+S    +  S +       +G+E++LS
Sbjct  454   ----YGRSDPTVGLTLTTPQPSFTGNIDYSSVGASSLGGSYLSGDFVHPHEGQGLEDFLS  509

Query  703   EEEIRLRSHEMLENEDMQHLLRLFSMG-----GHASVNIPEDGFGFTPFMAPSPSFGYDE  539
             EE IRLRS +MLEN+DMQ LLR F+       G A V+  E  + +     P   F   +
Sbjct  510   EE-IRLRSSQMLENDDMQRLLRTFNTEVDVGVGTAFVHSDEACYSYDAPYEPRREFEQQQ  568

Query  538   DRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              R   GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  569   SRS-SGKAVVGWLKLKAALRWGIFIRKRAAERRAQ  602



>ref|XP_002523509.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF38848.1| calmodulin binding protein, putative [Ricinus communis]
Length=425

 Score =   114 bits (284),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 105/288 (36%), Positives = 133/288 (46%), Gaps = 77/288 (27%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPR-LP  1052
             +V VDS VK+AYENW    EYDGK L                    NSL N     R L 
Sbjct  187   QVLVDSSVKRAYENWHQVIEYDGKVL--------------------NSLTNAKNGKRALV  226

Query  1051  APVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQ-YENTQFAPndqqqlmn  875
             AP+                         Y    +I S+ +R Q Y +++  P  Q    +
Sbjct  227   APIVDN----------------------YETNHYISSNQNRQQPYISSEPGPQSQAVNNH  264

Query  874   nsqqmqN----ARYDNNVGLALGPPQ----------SSCFPTVGSSVQQTNLNSFEDWSN  737
              S          R DNN  + +  PQ          S   P VG S          DWS 
Sbjct  265   PSVPQLIEFPFVRSDNNAIMTVNNPQGGLAGGMDHMSVGTPGVGGSYFSG------DWSR  318

Query  736   TRD-KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMG---GHASVNIPEDGFGFTPFM  569
              R+ +GVE++ +EE IRLRS EMLE++DMQ LL+ F +G   GH+     E  + ++   
Sbjct  319   PRNGQGVEDFFTEE-IRLRSSEMLEHDDMQRLLKSFGIGSGFGHSD----EACYSYS-IQ  372

Query  568   APSPSF--GYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             A  P     Y + R R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  373   AYEPQIDQAYTQGRGRGSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  420



>ref|XP_007138149.1| hypothetical protein PHAVU_009G184300g [Phaseolus vulgaris]
 gb|ESW10143.1| hypothetical protein PHAVU_009G184300g [Phaseolus vulgaris]
Length=614

 Score =   115 bits (289),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 100/277 (36%), Positives = 132/277 (48%), Gaps = 50/277 (18%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             K+ VDSLVKKAY+NW    EYDGK L S  N K  +     Q+ + +S            
Sbjct  371   KMSVDSLVKKAYDNWDQVVEYDGKVLNSLTNMKKGSRTLATQIMHHDSF-----------  419

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  869
             P Q   SA D                     S++ S        N Q    +        
Sbjct  420   PEQQCSSAKD-------------------KVSYVSSEP------NQQLQITNNYSAGPGL  454

Query  868   qqmqNARYDNN-VGLALGPPQ---SSCFPTVGSSVQQTNLNSFE-DWSNTRD-KGVEEYL  707
                   R D+  VG +L   Q   SS    V     +   N F  DWS  R+ +G+E+ +
Sbjct  455   TDYLFGRSDSQMVGTSLTDSQISLSSSMNYVTGENHENGGNYFAGDWSRPRNGQGLEDIV  514

Query  706   SEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIP---EDGFGFTPFMAPS---PSFGY  545
             +EE +RLRS EMLE++DMQ LL+  + G + S N+    E  + ++    P     S G 
Sbjct  515   AEE-LRLRSSEMLESDDMQRLLKTINAGVNMSANLGHSNESCYTYSLQYEPEMYHHSLGE  573

Query  544   DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             D+ +P  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  574   DQGKP-SGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  609



>ref|XP_002535201.1| hypothetical protein RCOM_0245460 [Ricinus communis]
 gb|EEF27182.1| hypothetical protein RCOM_0245460 [Ricinus communis]
Length=192

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 76/142 (54%), Gaps = 3/142 (2%)
 Frame = -1

Query  850  RYDNNVGLALGPPQSSC---FPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEEEIRLRS  680
            R DN+VGLALGPP S     F  +                 T  + +   L  +      
Sbjct  44   RNDNSVGLALGPPHSYLAQGFKLLALPCSHLVSILLMTGPTTGTRELMNTLLRKRFASEV  103

Query  679  HEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRPRPGKAVVGWL  500
               L  +         + GG+A+VNIPEDGF F P+ A SP   YD++  RP KAVVGWL
Sbjct  104  MRCLRMKICNTCFDSLAWGGNAAVNIPEDGFSFPPYTAASPMPNYDKNGVRPNKAVVGWL  163

Query  499  KIKAAMRWGFFIRKKAAERRAQ  434
            KIKAAMR GFFIRKKAAERRAQ
Sbjct  164  KIKAAMRSGFFIRKKAAERRAQ  185


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  765  ISILLRTGLTPVTRGLRNICLRRRFVSEAMKC*RMKICSTCFGSSAW  625
            +SILL TG T  TR L N  LR+RF SE M+C RMKIC+TCF S AW
Sbjct  75   VSILLMTGPTTGTRELMNTLLRKRFASEVMRCLRMKICNTCFDSLAW  121



>emb|CBI18672.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   113 bits (283),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 96/267 (36%), Positives = 128/267 (48%), Gaps = 70/267 (26%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             K+  DSLVK+AYENW    EYDGK L S  + K        +V  S+S+           
Sbjct  300   KISTDSLVKRAYENWSQVVEYDGKVLNSLIDSK--------KVTTSSSI-----------  340

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSS-RMQYENTQFAPndqqqlmnn  872
             P+       D  +     S N           HI S  S + Q+EN              
Sbjct  341   PIVDHGHVRDHYIRTAPHSKN-----------HIPSDPSPQCQHENNH-------PSARQ  382

Query  871   sqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTRDKGVEEYLSEEEI  692
               +    R D  + +AL  PQ++             L+S  D+ N   +G+E+Y SEE I
Sbjct  383   LIEYPFVRSDPTMEMALTTPQAA-------------LSSSMDYMN--GQGLEDYFSEE-I  426

Query  691   RLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRPRP-GKA  515
             RLRS EMLEN++MQ +L+ F+MG        + G G        P+FG+ +D      KA
Sbjct  427   RLRSSEMLENDEMQRMLKTFNMG-------VDTGMG--------PAFGHSDDACYSYRKA  471

Query  514   VVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             VVGWLK++AA+RWG FIRKKAAERRAQ
Sbjct  472   VVGWLKLRAALRWGIFIRKKAAERRAQ  498



>ref|XP_003633161.1| PREDICTED: uncharacterized protein LOC100255894 [Vitis vinifera]
Length=618

 Score =   114 bits (285),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 102/286 (36%), Positives = 138/286 (48%), Gaps = 61/286 (21%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             K+  DSLVK+AYENW    EYDGK L S  + K        +V  S+S+           
Sbjct  368   KISTDSLVKRAYENWSQVVEYDGKVLNSLIDSK--------KVTTSSSI-----------  408

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSS-RMQYENTQFAPndqqqlmnn  872
             P+       D  +     S N           HI S  S + Q+EN              
Sbjct  409   PIVDHGHVRDHYIRTAPHSKN-----------HIPSDPSPQCQHENNH-------PSARQ  450

Query  871   sqqmqNARYDNNVGLALGPPQSSC-----FPTVGSSVQQTNLNSFEDWSNTRD-KGVEEY  710
               +    R D  + +AL  PQ++      + + G+S +     S  D S +R+ +G+E+Y
Sbjct  451   LIEYPFVRSDPTMEMALTTPQAALSSSMDYMSAGTSARGNPYLS-GDCSRSRNGQGLEDY  509

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMG---------GHA-----SVNIPEDGFGFTPF  572
              SEE IRLRS EMLEN++MQ +L+ F+MG         GH+     S +IP +      F
Sbjct  510   FSEE-IRLRSSEMLENDEMQRMLKTFNMGVDTGMGPAFGHSDDACYSYSIPYERQMDQTF  568

Query  571   MAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
                  +FG    R   GKAVVGWLK++AA+RWG FIRKKAAERRAQ
Sbjct  569   GQMDQAFGQVHGRG-TGKAVVGWLKLRAALRWGIFIRKKAAERRAQ  613



>gb|KJB27328.1| hypothetical protein B456_004G291200 [Gossypium raimondii]
Length=574

 Score =   113 bits (283),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 101/283 (36%), Positives = 132/283 (47%), Gaps = 59/283 (21%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             K++VDSLVK+AYENW    EYD K L + ++ K  N                        
Sbjct  328   KLFVDSLVKRAYENWHQVIEYDDKVLNTLRSTKVAN------------------------  363

Query  1048  PVQSEPSALDPGMLIGGSSYNEN---MGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  878
                  PSA      +  ++Y+ +     A+ S Q +I S  S   + N       Q    
Sbjct  364   -----PSAAP----VNDNNYDADYYATTAQKSRQQYITSEPSPQCHNNNTHQTVHQLIEF  414

Query  877   nnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFE-DWSNTRD-KGVEEY  710
                +  QNA    N   AL P  ++    P  G+S     ++ F  DWS  R   G E++
Sbjct  415   PFGRSDQNAAMTMNNQKALLPSTTTISYMPIGGNST--AGVSGFAGDWSRPRTGHGFEDF  472

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDE--D  536
              +EE IRLRS EMLE +DMQ LL+ F +G          GFG     + + +  YD   D
Sbjct  473   FAEE-IRLRSSEMLETDDMQRLLKTFGVGVGMGA-----GFGHPDESSYAYTIPYDHQMD  526

Query  535   RPRP---------GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              P P         GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  527   HPYPYVPERGKGSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  569



>gb|KJB27327.1| hypothetical protein B456_004G291200 [Gossypium raimondii]
Length=610

 Score =   113 bits (283),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 101/283 (36%), Positives = 132/283 (47%), Gaps = 59/283 (21%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             K++VDSLVK+AYENW    EYD K L + ++ K  N                        
Sbjct  364   KLFVDSLVKRAYENWHQVIEYDDKVLNTLRSTKVAN------------------------  399

Query  1048  PVQSEPSALDPGMLIGGSSYNEN---MGARYSNQSHIMSSSSRMQYENTQFAPndqqqlm  878
                  PSA      +  ++Y+ +     A+ S Q +I S  S   + N       Q    
Sbjct  400   -----PSAAP----VNDNNYDADYYATTAQKSRQQYITSEPSPQCHNNNTHQTVHQLIEF  450

Query  877   nnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFE-DWSNTRD-KGVEEY  710
                +  QNA    N   AL P  ++    P  G+S     ++ F  DWS  R   G E++
Sbjct  451   PFGRSDQNAAMTMNNQKALLPSTTTISYMPIGGNST--AGVSGFAGDWSRPRTGHGFEDF  508

Query  709   LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDE--D  536
              +EE IRLRS EMLE +DMQ LL+ F +G          GFG     + + +  YD   D
Sbjct  509   FAEE-IRLRSSEMLETDDMQRLLKTFGVGVGMGA-----GFGHPDESSYAYTIPYDHQMD  562

Query  535   RPRP---------GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              P P         GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  563   HPYPYVPERGKGSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  605



>gb|KHG21283.1| pentafunctional arom polypeptide [Gossypium arboreum]
Length=610

 Score =   113 bits (283),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 100/292 (34%), Positives = 128/292 (44%), Gaps = 77/292 (26%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN--ELPMGQVDYSNSLNNQLQQPRL  1055
             K++VDSLVK+AYENW    EYD K L + +  K  N    P+   +Y         Q   
Sbjct  364   KLFVDSLVKRAYENWHQVIEYDDKVLNTLRRTKVANPSAAPVNDNNYDADYYATTAQKSR  423

Query  1054  PAPVQSEPSALDPG--------MLI----GGSSYNENMGARYSNQSHIMSSSSRMQYENT  911
                + SEPS   P          LI    G S  N  M    +NQ  ++ S++ + Y   
Sbjct  424   QQYITSEPSPQCPNNNTHQTVHQLIEFPFGRSDQNAIM--TMNNQKALLPSTTTISY---  478

Query  910   QFAPndqqqlmnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFE-DWSNT  734
                                                   P  G+S     ++ F  DWS  
Sbjct  479   -------------------------------------MPIGGNST--AGVSGFAGDWSRP  499

Query  733   RD-KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSP  557
             R   G E++ +EE IRLRS EMLE +DMQ LL+ F +G          GFG     + + 
Sbjct  500   RTGHGFEDFFAEE-IRLRSSEMLETDDMQRLLKTFGVGVGMGA-----GFGHPDESSYAY  553

Query  556   SFGYDE--DRPRP---------GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             +  YD   D P P         GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  554   TIPYDHQMDHPYPYAPERGKGSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  605



>ref|NP_001291237.1| uncharacterized LOC105121148 [Populus euphratica]
 gb|AEL95441.1| calmodulin-binding protein [Populus euphratica]
Length=610

 Score =   112 bits (281),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 95/280 (34%), Positives = 132/280 (47%), Gaps = 58/280 (21%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             KV VDSLVK+AYENW    EYDGK L S  + K                           
Sbjct  369   KVSVDSLVKRAYENWHHVVEYDGKVLNSLASNKGGK------------------------  404

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  869
                             G+S    + + Y    +I S  ++ Q+  ++ +P  Q  + + S
Sbjct  405   ----------------GASAAPIVDSSYERNQYITSDQNKQQFIPSEPSPQYQAIINHPS  448

Query  868   qqmqN----ARYDNNVGLALGPPQSSC-----FPTVGSSVQQTNLNSFEDWSNTRD-KGV  719
                       R D N  + L  PQ++      + +VG+ V  T      DWS  R   G+
Sbjct  449   VPQLIKFPFVRSDQNAAMTLNNPQAALSGGTDYMSVGTPVGDTCFPG--DWSRPRTGNGL  506

Query  718   EEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHAS----VNIPEDGFGFT-PFMAPSPS  554
             E++ +EE IR+RS EMLE++DMQ LL+   MGG       V+  E  + ++     P   
Sbjct  507   EDFFTEE-IRVRSSEMLESDDMQRLLKTLGMGGVGMGPGFVHPDEPCYSYSVQAYEPQRD  565

Query  553   FGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
               Y ++R R  KAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  566   QTYAQERGRGSKAVVGWLKLKAALRWGIFVRKKAAERRAQ  605



>emb|CDY20299.1| BnaC04g36570D [Brassica napus]
Length=591

 Score =   112 bits (279),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 100/280 (36%), Positives = 129/280 (46%), Gaps = 73/280 (26%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             K+  D LVK AYENW    EYDGK L         N LP+ + +             LP 
Sbjct  365   KISADILVKIAYENWHKAVEYDGKLL---------NCLPVAEKEIKG----------LPE  405

Query  1048  P-VQSEPSALDPGMLIGGSSYNENMGARYSNQSH---IMSSSSRMQYENTQFAPndqqql  881
             P + + P+A +   L        N   R + Q H   I  S      E  QF        
Sbjct  406   PKMVTAPTAQNHQQL-------HNQNNRQTVQCHQNAITYSPLPQPVEYPQFVQQHC---  455

Query  880   mnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSNTR-DKGVEEYLS  704
                                     S   P++ S+VQ  + N+ EDW   R  +G+E+  S
Sbjct  456   ------------------------SQLLPSLPSNVQ--DYNNGEDWCRPRAGQGLEDIFS  489

Query  703   EEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFT---------PFMAPSPSF  551
             EE IRLRS EMLE +DMQ LL+ F +G + ++   + GFG T         P+ A   + 
Sbjct  490   EE-IRLRSSEMLETDDMQRLLKTFGIGMN-TMGTTQGGFGQTDESCYGYNMPYQAQIDN-  546

Query  550   GYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
              Y  +R R  GKAVVGWLK+KAA+RWG FIRKKAAERR Q
Sbjct  547   TYRRERNRGSGKAVVGWLKLKAALRWGIFIRKKAAERRPQ  586



>gb|EAZ30858.1| hypothetical protein OsJ_14930 [Oryza sativa Japonica Group]
Length=610

 Score =   111 bits (277),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 88/236 (37%), Positives = 130/236 (55%), Gaps = 18/236 (8%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKK----ARNELPMGQVDYSNSLNNQLQQP  1061
             +++ D+LVK+AY++W++  EYDGK LL FK KK     R++       Y +S  +     
Sbjct  376   RLFADTLVKQAYDDWINVVEYDGKELLRFKQKKKSVTTRSDTAKASTSYPSSYGSTHSHK  435

Query  1060  RLP-APVQSEPSALDPGMLIGGSSY-NENMGARYSNQSHIMSSSSRMQYENTQFAPndqq  887
             +L   PV  E S++      G  +  N +  ARY+     +S S  M Y+ +   P   +
Sbjct  436   QLTGGPVNIEQSSMSSMSEDGTRNMSNGSQAARYAANPQDISQSITMPYDMSSLRP---E  492

Query  886   qlmnnsqqmqNARYDNNVGLALGPPQSSC--FPTVGSSVQQTNLNSFEDWSNTRDK--GV  719
             +    S     A   +N+ LALGP Q     F  +G S+Q + LN F+DWS  ++   GV
Sbjct  493   EQFAGSSIQTQASRSSNM-LALGPTQQQNFEFSALGQSMQPSPLNPFDDWSRLQENRGGV  551

Query  718   EEYLSEEEIRLRSHEMLEN-EDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPS  554
             ++YL  EEIR+RSHE+LEN EDMQ +LR+ SMGG +S N+   G GF+P  A S +
Sbjct  552   DDYLM-EEIRVRSHEILENEEDMQQMLRILSMGG-SSANM-NHGDGFSPLHAVSCT  604



>ref|XP_011017983.1| PREDICTED: uncharacterized protein LOC105121148 [Populus euphratica]
Length=610

 Score =   111 bits (277),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 94/280 (34%), Positives = 132/280 (47%), Gaps = 58/280 (21%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             KV VDSLVK+AYENW    EYDGK L S  + K                           
Sbjct  369   KVSVDSLVKRAYENWHHVVEYDGKVLNSLASNKGGK------------------------  404

Query  1048  PVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmnns  869
                             G+S    + + Y    +I S  ++ Q+  ++ +P  Q  + + S
Sbjct  405   ----------------GASAAPIVDSSYERNQYITSDQNKQQFIPSEPSPQYQAIINHPS  448

Query  868   qqmqN----ARYDNNVGLALGPPQSSC-----FPTVGSSVQQTNLNSFEDWSNTRD-KGV  719
                       R D N  + L  PQ++      + +VG+ V  T      DWS  R   G+
Sbjct  449   VPQLIKFPFVRSDQNAAMTLNNPQAALSGGTDYMSVGTPVGDTCFPG--DWSRPRTGNGL  506

Query  718   EEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHAS----VNIPEDGFGFT-PFMAPSPS  554
             E++ +EE IR+RS EMLE++DMQ LL+   MGG       V+  E  + ++     P   
Sbjct  507   EDFFTEE-IRVRSSEMLESDDMQRLLKTLGMGGVGMGPGFVHPDEPCYSYSVQAYEPQRD  565

Query  553   FGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
               Y ++R R  KAVVGWLK+KAA+RWG F+RKKAAERRA+
Sbjct  566   QTYAQERGRGSKAVVGWLKLKAALRWGIFVRKKAAERRAR  605



>ref|XP_007011980.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 gb|EOY29599.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
Length=642

 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 93/277 (34%), Positives = 129/277 (47%), Gaps = 52/277 (19%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARN--ELPMGQVDYSNSLNNQLQQPRL  1055
             KV+VDSLVK+AYENW    EY+   L S  + K  N     + + ++         Q   
Sbjct  401   KVFVDSLVKRAYENWHQVIEYEDTVLNSLASTKRTNPSTASINENNHDADYYTTTTQKTR  460

Query  1054  PAPVQSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmn  875
                + SEPS                                + Q  NT +A     +   
Sbjct  461   QQYITSEPSP-------------------------------QCQNNNTHYAVPQLIEFPF  489

Query  874   nsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFE-DWSNTRD-KGVEEYLSE  701
                        NN    L  P S+ +  +G+S     ++ F  DWS  R+ +G+E++ +E
Sbjct  490   GRSDQNAVMTMNNQKELL--PGSTNYMQIGNST--AGVSGFAADWSRPRNGQGLEDFFAE  545

Query  700   EEIRLRSHEMLENEDMQHLLRLFSMG-------GHASVNIPEDGFGFTPFMAPSPSFGYD  542
             E IRLRS EMLE++DMQ LL+ F +G       GH+     E  + +T          Y 
Sbjct  546   E-IRLRSSEMLESDDMQRLLKTFGVGVGMGAGFGHSD----EACYTYTIPYDHQIDHSYA  600

Query  541   EDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             ++R R  GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  601   QERGRGSGKAVVGWLKLKAALRWGIFIRKRAAERRAQ  637



>ref|XP_009366145.1| PREDICTED: uncharacterized protein LOC103955955 [Pyrus x bretschneideri]
Length=611

 Score =   108 bits (270),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 96/283 (34%), Positives = 136/283 (48%), Gaps = 62/283 (22%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFK-NKKARNELPMGQVDYSN-------SLNNQ  1073
             KV VDSLVK+AY+NW    EYDGK L +   NKK     P    DY+N       S + Q
Sbjct  368   KVSVDSLVKRAYDNWQQVIEYDGKVLHALAGNKKVTRASPAPVADYNNYAIMDHHSASTQ  427

Query  1072  LQQPRLPAPV--QSEPSALDPGMLIGGSSYNENMGARYSNQSHIMSSSSRMQYENTQFAP  899
               Q + PA    Q +P    P +    S + E    R SNQ+ ++               
Sbjct  428   NSQQQYPAQFSQQFQPENNHPSV----SQFIEFPFVR-SNQTELI---------------  467

Query  898   ndqqqlmnnsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQTNLNSFEDWSN-TRDKG  722
                             +++N    AL P  +   P+VG S      +   DW+      G
Sbjct  468   ----------------KFNNPEPAAL-PSSTGYMPSVGGS------DFSGDWTRPNYGNG  504

Query  721   VEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIP------EDGFGFTPFMAPS  560
             +++++++E IR+RS EMLE++DMQ LL+ FSMG              E  + ++    P 
Sbjct  505   LDDFVADE-IRIRSSEMLESDDMQRLLKTFSMGAGVGAGGTGFGASDESCYNYSVQYEPQ  563

Query  559   PSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
                 + ++  +  GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  564   IDQPFRKEHAKSSGKAVVGWLKLKAALRWGIFIRKRAAERRAQ  606



>emb|CDY46137.1| BnaA04g14250D [Brassica napus]
Length=601

 Score =   108 bits (269),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 100/286 (35%), Positives = 133/286 (47%), Gaps = 75/286 (26%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             K+  D LVK AYENW    EYDGK L         N LP+ + +             LP 
Sbjct  365   KISADILVKIAYENWHKAVEYDGKLL---------NCLPVAEKEIKG----------LPE  405

Query  1048  P-VQSEPSALDPGMLIGGSSYNEN-MGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmn  875
             P + + P+A +   L     +N+N   A   +Q+ I  S      E  QF          
Sbjct  406   PKMVTAPTAQNHQQL-----HNQNNRQAVQCHQNVIPYSPLPQPIEYPQFVQQHC-----  455

Query  874   nsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQ--------TNLNSFEDWSNTR-DKG  722
                                   S   P++ S+VQ+        +N  + EDW   R  +G
Sbjct  456   ----------------------SQLLPSLPSNVQEYNSRPMESSNAYNGEDWCRPRAGQG  493

Query  721   VEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFT---------PFM  569
             +E+  SEE IRLRS EMLE +DMQ LL+ F +G + ++   + GFG T         P+ 
Sbjct  494   LEDIFSEE-IRLRSSEMLETDDMQRLLKTFGIGMN-TMGTTQGGFGQTDESCYGYNMPYQ  551

Query  568   APSPSFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             A   +  Y  +R R  GKAVVGWLK+KAA+RWG FIRKKAAERR Q
Sbjct  552   AQIDN-TYRRERNRGSGKAVVGWLKLKAALRWGIFIRKKAAERRPQ  596



>ref|XP_009140532.1| PREDICTED: uncharacterized protein LOC103864534 isoform X1 [Brassica 
rapa]
Length=601

 Score =   108 bits (269),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 100/286 (35%), Positives = 133/286 (47%), Gaps = 75/286 (26%)
 Frame = -1

Query  1228  KVYVDSLVKKAYENWLSEREYDGKTLLSFKNKKARNELPMGQVDYSNSLNNQLQQPRLPA  1049
             K+  D LVK AYENW    EYDGK L         N LP+ + +             LP 
Sbjct  365   KISADILVKIAYENWHKAVEYDGKLL---------NCLPVAEKEIKG----------LPE  405

Query  1048  P-VQSEPSALDPGMLIGGSSYNEN-MGARYSNQSHIMSSSSRMQYENTQFAPndqqqlmn  875
             P + + P+A +   L     +N+N   A   +Q+ I  S      E  QF          
Sbjct  406   PKMVTAPTAQNHQQL-----HNQNNRQAVQCHQNVIPYSPLPQPIEYPQFVQQHC-----  455

Query  874   nsqqmqNARYDNNVGLALGPPQSSCFPTVGSSVQQ--------TNLNSFEDWSNTR-DKG  722
                                   S   P++ S+VQ+        +N  + EDW   R  +G
Sbjct  456   ----------------------SQLLPSLPSNVQEYNSRPMEGSNAYNGEDWCRPRAGQG  493

Query  721   VEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFT---------PFM  569
             +E+  SEE IRLRS EMLE +DMQ LL+ F +G + ++   + GFG T         P+ 
Sbjct  494   LEDIFSEE-IRLRSSEMLETDDMQRLLKTFGIGMN-TMGTTQGGFGQTDESCYGYNMPYQ  551

Query  568   APSPSFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  434
             A   +  Y  +R R  GKAVVGWLK+KAA+RWG FIRKKAAERR Q
Sbjct  552   AQIDN-TYRRERNRGSGKAVVGWLKLKAALRWGIFIRKKAAERRPQ  596



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3461876544493