BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3955

Length=1493
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011090165.1|  PREDICTED: serine--glyoxylate aminotransferase     763   0.0      Sesamum indicum [beniseed]
ref|NP_001265946.1|  Hop-interacting protein THI032                     753   0.0      Solanum lycopersicum
ref|XP_010277598.1|  PREDICTED: serine--glyoxylate aminotransferase     752   0.0      Nelumbo nucifera [Indian lotus]
ref|XP_006349776.1|  PREDICTED: serine--glyoxylate aminotransfera...    752   0.0      Solanum tuberosum [potatoes]
ref|XP_011080387.1|  PREDICTED: serine--glyoxylate aminotransfera...    749   0.0      Sesamum indicum [beniseed]
ref|XP_009619693.1|  PREDICTED: serine--glyoxylate aminotransferase     749   0.0      Nicotiana tomentosiformis
emb|CDP08481.1|  unnamed protein product                                748   0.0      Coffea canephora [robusta coffee]
ref|XP_004291746.1|  PREDICTED: serine--glyoxylate aminotransferase     748   0.0      Fragaria vesca subsp. vesca
ref|XP_010938608.1|  PREDICTED: serine--glyoxylate aminotransfera...    748   0.0      Elaeis guineensis
ref|XP_009775939.1|  PREDICTED: serine--glyoxylate aminotransferase     748   0.0      Nicotiana sylvestris
ref|XP_008227244.1|  PREDICTED: serine--glyoxylate aminotransferase     745   0.0      Prunus mume [ume]
gb|AGT38285.1|  serine--glyoxylate aminotransferase                     744   0.0      Gossypium hirsutum [American cotton]
ref|XP_009342610.1|  PREDICTED: serine--glyoxylate aminotransferase     744   0.0      Pyrus x bretschneideri [bai li]
ref|XP_008363560.1|  PREDICTED: serine--glyoxylate aminotransferase     743   0.0      Malus domestica [apple tree]
ref|XP_007015204.1|  Alanine:glyoxylate aminotransferase isoform 1      743   0.0      
ref|XP_007212264.1|  hypothetical protein PRUPE_ppa006653mg             743   0.0      Prunus persica
ref|XP_009338530.1|  PREDICTED: serine--glyoxylate aminotransfera...    743   0.0      
gb|KJB54389.1|  hypothetical protein B456_009G074800                    742   0.0      Gossypium raimondii
ref|XP_010045046.1|  PREDICTED: serine--glyoxylate aminotransferase     742   0.0      Eucalyptus grandis [rose gum]
gb|KDO44953.1|  hypothetical protein CISIN_1g0157291mg                  741   0.0      Citrus sinensis [apfelsine]
ref|XP_006470731.1|  PREDICTED: serine--glyoxylate aminotransfera...    741   0.0      Citrus sinensis [apfelsine]
gb|KHG14448.1|  Serine--glyoxylate aminotransferase -like protein       741   0.0      Gossypium arboreum [tree cotton]
gb|EPS59280.1|  serine-glyoxylate aminotransferase                      740   0.0      Genlisea aurea
ref|XP_008359496.1|  PREDICTED: serine--glyoxylate aminotransferase     740   0.0      
gb|KHG29969.1|  Serine--glyoxylate aminotransferase -like protein       739   0.0      Gossypium arboreum [tree cotton]
ref|XP_003600159.1|  Alanine glyoxylate aminotransferase                739   0.0      Medicago truncatula
ref|XP_006446249.1|  hypothetical protein CICLE_v10015490mg             739   0.0      Citrus clementina [clementine]
ref|XP_006843377.1|  PREDICTED: serine--glyoxylate aminotransferase     738   0.0      Amborella trichopoda
ref|XP_008812510.1|  PREDICTED: serine--glyoxylate aminotransferase     737   0.0      Phoenix dactylifera
ref|XP_004499480.1|  PREDICTED: serine--glyoxylate aminotransfera...    737   0.0      
gb|AFK40703.1|  unknown                                                 735   0.0      Medicago truncatula
gb|AAL47679.1|  aminotransferase 1                                      735   0.0      Cucumis melo [Oriental melon]
ref|XP_006584642.1|  PREDICTED: enzymatic resistance protein isof...    735   0.0      Glycine max [soybeans]
ref|XP_002298306.1|  hypothetical protein POPTR_0001s26020g             734   0.0      Populus trichocarpa [western balsam poplar]
ref|NP_001237048.1|  enzymatic resistance protein                       734   0.0      
ref|XP_011043786.1|  PREDICTED: serine--glyoxylate aminotransferase     734   0.0      Populus euphratica
ref|XP_012074477.1|  PREDICTED: serine--glyoxylate aminotransferase     733   0.0      Jatropha curcas
ref|XP_004139054.1|  PREDICTED: serine--glyoxylate aminotransferase     732   0.0      Cucumis sativus [cucumbers]
ref|XP_002531124.1|  serine-pyruvate aminotransferase, putative         732   0.0      Ricinus communis
gb|AAQ56192.1|  aminotransferase 1                                      732   0.0      Cucumis melo [Oriental melon]
ref|XP_010909203.1|  PREDICTED: serine--glyoxylate aminotransferase     732   0.0      Elaeis guineensis
gb|ABA00460.1|  serine-glyoxylate aminotransferase                      732   0.0      Spirodela polyrhiza
gb|ACJ61247.1|  serine glyoxylate aminotransferase 3                    732   0.0      Glycine max [soybeans]
ref|XP_007146302.1|  hypothetical protein PHAVU_006G029100g             732   0.0      Phaseolus vulgaris [French bean]
ref|XP_010557501.1|  PREDICTED: serine--glyoxylate aminotransferase     731   0.0      Tarenaya hassleriana [spider flower]
ref|XP_008449670.1|  PREDICTED: serine--glyoxylate aminotransfera...    731   0.0      Cucumis melo [Oriental melon]
gb|AGV54322.1|  serine glyoxylate aminotransferase 2                    731   0.0      Phaseolus vulgaris [French bean]
ref|NP_001284450.1|  serine--glyoxylate aminotransferase                731   0.0      Cucumis melo [Oriental melon]
gb|ABQ81922.1|  aminotransferase 2                                      730   0.0      Cucumis sativus [cucumbers]
ref|XP_009415566.1|  PREDICTED: serine--glyoxylate aminotransferase     729   0.0      Musa acuminata subsp. malaccensis [pisang utan]
gb|AAB95218.1|  putative serine-glyoxylate aminotransferase             729   0.0      Fritillaria agrestis
gb|ACJ61246.1|  serine glyoxylate aminotransferase 2                    729   0.0      Glycine max [soybeans]
ref|NP_001276276.1|  serine--glyoxylate aminotransferase-like           729   0.0      Glycine max [soybeans]
gb|KHN28521.1|  Serine--glyoxylate aminotransferase                     729   0.0      Glycine soja [wild soybean]
gb|ABQ81925.1|  aminotransferase 2                                      728   0.0      Cucumis melo [Oriental melon]
ref|XP_002313371.1|  aminotransferase 2 family protein                  728   0.0      
gb|ABQ81924.1|  aminotransferase 2                                      728   0.0      Cucumis sativus [cucumbers]
ref|NP_001284445.1|  serine--glyoxylate aminotransferase-like           728   0.0      Cucumis melo [Oriental melon]
dbj|BAJ33858.1|  unnamed protein product                                729   0.0      Eutrema halophilum
ref|XP_011032100.1|  PREDICTED: serine--glyoxylate aminotransfera...    727   0.0      Populus euphratica
ref|XP_006659561.1|  PREDICTED: serine--glyoxylate aminotransfera...    727   0.0      Oryza brachyantha
gb|AAL62332.1|AF461048_1  aminotransferase 2                            727   0.0      Cucumis melo [Oriental melon]
ref|XP_009410322.1|  PREDICTED: serine--glyoxylate aminotransfera...    727   0.0      Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006409690.1|  hypothetical protein EUTSA_v10022711mg             726   0.0      
ref|XP_004140203.1|  PREDICTED: serine--glyoxylate aminotransfera...    726   0.0      Cucumis sativus [cucumbers]
emb|CDY37208.1|  BnaA09g08290D                                          726   0.0      Brassica napus [oilseed rape]
emb|CDX81443.1|  BnaC09g08540D                                          725   0.0      
ref|XP_009112244.1|  PREDICTED: serine--glyoxylate aminotransferase     724   0.0      Brassica rapa
gb|ABK96624.1|  unknown                                                 724   0.0      Populus trichocarpa x Populus deltoides
dbj|BAJ90006.1|  predicted protein                                      723   0.0      Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010673724.1|  PREDICTED: serine--glyoxylate aminotransferase     723   0.0      Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009136209.1|  PREDICTED: serine--glyoxylate aminotransfera...    723   0.0      Brassica rapa
gb|AAQ56193.1|  aminotransferase 2                                      722   0.0      Cucumis melo [Oriental melon]
emb|CDX89604.1|  BnaC03g45180D                                          721   0.0      
gb|EMS66805.1|  Serine--glyoxylate aminotransferase                     720   0.0      Triticum urartu
ref|NP_001062170.1|  Os08g0502700                                       719   0.0      
ref|XP_003574732.2|  PREDICTED: serine--glyoxylate aminotransferase     719   0.0      Brachypodium distachyon [annual false brome]
ref|XP_010518509.1|  PREDICTED: serine--glyoxylate aminotransfera...    716   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_010488837.1|  PREDICTED: serine--glyoxylate aminotransfera...    715   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_004973838.1|  PREDICTED: serine--glyoxylate aminotransfera...    714   0.0      Setaria italica
ref|XP_002279236.1|  PREDICTED: serine--glyoxylate aminotransferase     714   0.0      Vitis vinifera
ref|NP_178969.1|  alanine--glyoxylate aminotransferase                  713   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002885871.1|  hypothetical protein ARALYDRAFT_480305             713   0.0      
ref|XP_004973837.1|  PREDICTED: serine--glyoxylate aminotransfera...    714   0.0      
emb|CAN84001.1|  hypothetical protein VITISV_007680                     713   0.0      Vitis vinifera
ref|XP_006297832.1|  hypothetical protein CARUB_v10013869mg             710   0.0      Capsella rubella
ref|XP_002444789.1|  hypothetical protein SORBIDRAFT_07g028080          705   0.0      Sorghum bicolor [broomcorn]
ref|XP_010467178.1|  PREDICTED: serine--glyoxylate aminotransfera...    703   0.0      Camelina sativa [gold-of-pleasure]
ref|NP_001148339.1|  LOC100281949                                       691   0.0      Zea mays [maize]
gb|ABF70331.1|  aminotransferase 1                                      686   0.0      Cucumis sativus [cucumbers]
gb|AEX09255.1|  alanine glyoxylate aminotransferase                     670   0.0      Peperomia bracteata
gb|ACN39798.1|  unknown                                                 672   0.0      Picea sitchensis
gb|ABK24112.1|  unknown                                                 671   0.0      Picea sitchensis
gb|AEX09250.1|  alanine glyoxylate aminotransferase                     669   0.0      Peperomia schizandra
emb|CBI24214.3|  unnamed protein product                                669   0.0      Vitis vinifera
gb|AEX09273.1|  alanine glyoxylate aminotransferase                     668   0.0      Peperomia cerrateae
gb|EYU35937.1|  hypothetical protein MIMGU_mgv1a026291mg                666   0.0      Erythranthe guttata [common monkey flower]
gb|AEX09293.1|  alanine glyoxylate aminotransferase                     666   0.0      Peperomia rupiseda
gb|AEX09257.1|  alanine glyoxylate aminotransferase                     665   0.0      Peperomia bracteata
gb|AEX09305.1|  alanine glyoxylate aminotransferase                     665   0.0      Peperomia pseudoverruculosa
gb|AEX09248.1|  alanine glyoxylate aminotransferase                     665   0.0      Peperomia questionis
gb|AEX09298.1|  alanine glyoxylate aminotransferase                     664   0.0      Peperomia cerrateae
gb|AEX09275.1|  alanine glyoxylate aminotransferase                     664   0.0      Peperomia parvisagittata
gb|AEX09253.1|  alanine glyoxylate aminotransferase                     664   0.0      Peperomia bracteata
gb|AEX09311.1|  alanine glyoxylate aminotransferase                     664   0.0      Peperomia andina
gb|AEX09258.1|  alanine glyoxylate aminotransferase                     663   0.0      Peperomia bracteata
gb|AEX09256.1|  alanine glyoxylate aminotransferase                     663   0.0      Peperomia bracteata
gb|AEX09254.1|  alanine glyoxylate aminotransferase                     663   0.0      Peperomia bracteata
gb|AEX09299.1|  alanine glyoxylate aminotransferase                     662   0.0      Peperomia cerrateae
gb|AEX09270.1|  alanine glyoxylate aminotransferase                     662   0.0      Peperomia verruculosa
gb|AEX09300.1|  alanine glyoxylate aminotransferase                     660   0.0      Peperomia parvifolia
ref|XP_003600160.1|  Alanine glyoxylate aminotransferase                662   0.0      
gb|AEX09306.1|  alanine glyoxylate aminotransferase                     660   0.0      Peperomia peruviana
gb|AEX09249.1|  alanine glyoxylate aminotransferase                     659   0.0      Peperomia aff. gracillima JN-2011
gb|AEX09267.1|  alanine glyoxylate aminotransferase                     659   0.0      Peperomia radiatinervosa
gb|AEX09286.1|  alanine glyoxylate aminotransferase                     658   0.0      Peperomia cyclaminoides
gb|AEX09276.1|  alanine glyoxylate aminotransferase                     658   0.0      Peperomia parvisagittata
gb|AEX09304.1|  alanine glyoxylate aminotransferase                     657   0.0      Peperomia chutanka
ref|XP_004491262.1|  PREDICTED: serine--glyoxylate aminotransfera...    659   0.0      Cicer arietinum [garbanzo]
gb|KDO44954.1|  hypothetical protein CISIN_1g0157291mg                  656   0.0      Citrus sinensis [apfelsine]
gb|AEX09263.1|  alanine glyoxylate aminotransferase                     655   0.0      Peperomia putlaensis
gb|AEX09295.1|  alanine glyoxylate aminotransferase                     655   0.0      Peperomia pugnicaudex
ref|XP_010094254.1|  Serine--glyoxylate aminotransferase                654   0.0      Morus notabilis
gb|AEX09301.1|  alanine glyoxylate aminotransferase                     654   0.0      Peperomia sp. JN-2011
ref|XP_003617296.1|  Alanine glyoxylate aminotransferase                656   0.0      Medicago truncatula
gb|AEX09308.1|  alanine glyoxylate aminotransferase                     653   0.0      Peperomia polycephala
gb|AEX09268.1|  alanine glyoxylate aminotransferase                     654   0.0      Peperomia peruviana
gb|AEX09274.1|  alanine glyoxylate aminotransferase                     652   0.0      Peperomia peruviana
ref|XP_006369573.1|  hypothetical protein POPTR_0001s26020g             652   0.0      
gb|AEX09303.1|  alanine glyoxylate aminotransferase                     645   0.0      Peperomia ayacuchoana
gb|AEX09265.1|  alanine glyoxylate aminotransferase                     642   0.0      Peperomia radiatinervosa
gb|AEX09245.1|  alanine glyoxylate aminotransferase                     641   0.0      Peperomia putlaensis
gb|AEX09259.1|  alanine glyoxylate aminotransferase                     640   0.0      Peperomia bracteata
gb|AEX09307.1|  alanine glyoxylate aminotransferase                     640   0.0      Peperomia verruculosa
gb|AEX09277.1|  alanine glyoxylate aminotransferase                     640   0.0      Peperomia cyclaminoides
gb|AEX09266.1|  alanine glyoxylate aminotransferase                     637   0.0      Peperomia peruviana
gb|AEX09285.1|  alanine glyoxylate aminotransferase                     637   0.0      Peperomia radiatinervosa
gb|AEX09283.1|  alanine glyoxylate aminotransferase                     635   0.0      Peperomia peruviana
gb|AEX09262.1|  alanine glyoxylate aminotransferase                     632   0.0      Peperomia aff. ovatopeltata JN-2011
gb|AEX09252.1|  alanine glyoxylate aminotransferase                     632   0.0      Peperomia exclamationis
gb|AEX09247.1|  alanine glyoxylate aminotransferase                     630   0.0      Peperomia cavispicata
gb|AEX09294.1|  alanine glyoxylate aminotransferase                     629   0.0      Peperomia sp. JN-2011
gb|AEX09302.1|  alanine glyoxylate aminotransferase                     627   0.0      Peperomia sp. JN-2011
gb|KJB83533.1|  hypothetical protein B456_013G252200                    619   0.0      Gossypium raimondii
gb|AEX09242.1|  alanine glyoxylate aminotransferase                     617   0.0      Peperomia aff. pinoi JN-2011
gb|AEX09288.1|  alanine glyoxylate aminotransferase                     616   0.0      Peperomia parvisagittata
gb|AEX09272.1|  alanine glyoxylate aminotransferase                     616   0.0      Peperomia cyclaminoides
gb|AEX09246.1|  alanine glyoxylate aminotransferase                     615   0.0      Peperomia elatior
gb|AEX09284.1|  alanine glyoxylate aminotransferase                     614   0.0      Peperomia peruviana
gb|AEX09251.1|  alanine glyoxylate aminotransferase                     612   0.0      Peperomia schizandra
gb|AEX09282.1|  alanine glyoxylate aminotransferase                     612   0.0      Peperomia cerrateae
ref|XP_002990557.1|  hypothetical protein SELMODRAFT_448066             614   0.0      Selaginella moellendorffii
gb|AEX09309.1|  alanine glyoxylate aminotransferase                     610   0.0      Peperomia wernerrauhii
gb|AEX09287.1|  alanine glyoxylate aminotransferase                     610   0.0      Peperomia cerrateae
ref|XP_002983655.1|  hypothetical protein SELMODRAFT_228964             612   0.0      
gb|AEX09244.1|  alanine glyoxylate aminotransferase                     608   0.0      Peperomia basiradicans
gb|AEX09264.1|  alanine glyoxylate aminotransferase                     608   0.0      Peperomia radiatinervosa
gb|AEX09292.1|  alanine glyoxylate aminotransferase                     607   0.0      Peperomia klopfensteinii
gb|AEX09310.1|  alanine glyoxylate aminotransferase                     607   0.0      Peperomia wernerrauhii
tpg|DAA47863.1|  TPA: hypothetical protein ZEAMMB73_595389              608   0.0      
gb|AEX09261.1|  alanine glyoxylate aminotransferase                     602   0.0      Peperomia aff. ovatopeltata JN-2011
gb|AEX09271.1|  alanine glyoxylate aminotransferase                     601   0.0      Peperomia peruviana
gb|AEX09281.1|  alanine glyoxylate aminotransferase                     597   0.0      Peperomia cyclaminoides
gb|AEX09269.1|  alanine glyoxylate aminotransferase                     595   0.0      Peperomia peruviana
gb|AEX09280.1|  alanine glyoxylate aminotransferase                     595   0.0      Peperomia peruviana
ref|XP_001755667.1|  predicted protein                                  595   0.0      
ref|XP_001783551.1|  predicted protein                                  595   0.0      
gb|AEX09291.1|  alanine glyoxylate aminotransferase                     592   0.0      Peperomia jalcaensis
gb|ABR16109.1|  unknown                                                 590   0.0      Picea sitchensis
gb|AEX09260.1|  alanine glyoxylate aminotransferase                     585   0.0      Peperomia aff. ovatopeltata JN-2011
gb|AEX09289.1|  alanine glyoxylate aminotransferase                     574   0.0      Peperomia gigantea
gb|AEX09290.1|  alanine glyoxylate aminotransferase                     568   0.0      Peperomia dolabella
ref|XP_002969615.1|  hypothetical protein SELMODRAFT_267279             571   0.0      Selaginella moellendorffii
ref|XP_002970880.1|  hypothetical protein SELMODRAFT_147375             571   0.0      Selaginella moellendorffii
ref|XP_006369569.1|  hypothetical protein POPTR_0001s26020g             565   0.0      
gb|AEX09243.1|  alanine glyoxylate aminotransferase                     552   0.0      Peperomia sp. JN-2011
ref|XP_001763095.1|  predicted protein                                  551   0.0      
gb|AGL09526.1|  alanine-glyoxylate aminotransferase                     537   0.0      Peperomia prostrata
gb|AGL09530.1|  alanine-glyoxylate aminotransferase                     530   0.0      Xymalos monospora
gb|AGL09524.1|  alanine-glyoxylate aminotransferase                     530   0.0      Calycanthus occidentalis [California-allspice]
gb|AGL09523.1|  alanine-glyoxylate aminotransferase                     523   0.0      Asarum caudatum
ref|XP_006369572.1|  hypothetical protein POPTR_0001s26020g             518   2e-179   
gb|AGL09527.1|  alanine-glyoxylate aminotransferase                     508   3e-176   Piper nigrum
gb|AGL09528.1|  alanine-glyoxylate aminotransferase                     507   2e-175   Saururus cernuus [swamp lily]
ref|XP_003617694.1|  Alanine glyoxylate aminotransferase                494   4e-169   
gb|AGL09525.1|  alanine-glyoxylate aminotransferase                     488   3e-168   Manekia incurva
ref|XP_003615391.1|  Alanine glyoxylate aminotransferase                476   3e-162   
gb|AGL09531.1|  alanine-glyoxylate aminotransferase                     469   5e-161   Zippelia begoniifolia
gb|AGL09529.1|  alanine-glyoxylate aminotransferase                     461   5e-158   Thottea sp. JN-2013
ref|XP_005709273.1|  serine--glyoxylate transaminase                    461   1e-155   Galdieria sulphuraria
ref|XP_008666471.1|  PREDICTED: serine--glyoxylate aminotransfera...    453   1e-154   
dbj|BAQ46928.1|  serine--glyoxylate aminotransferase                    453   1e-152   Methylobacterium aquaticum
ref|WP_040580464.1|  serine--glyoxylate aminotransferase                451   1e-151   
ref|WP_026610206.1|  serine--glyoxylate aminotransferase                448   1e-150   Methylocaldum szegediense
ref|WP_045369065.1|  serine--glyoxylate aminotransferase                448   2e-150   Methyloceanibacter caenitepidi
ref|WP_017485211.1|  serine--glyoxylate aminotransferase                444   6e-149   Methylobacterium sp. MB200
ref|WP_015950680.1|  serine--glyoxylate aminotransferase                443   1e-148   Methylorubrum extorquens
ref|WP_003597639.1|  serine--glyoxylate aminotransferase                442   3e-148   Methylobacteriaceae
ref|WP_036260471.1|  serine--glyoxylate aminotransferase                442   3e-148   Methylocapsa aurea
gb|KJB54393.1|  hypothetical protein B456_009G074800                    438   6e-148   Gossypium raimondii
ref|WP_012253362.1|  serine--glyoxylate aminotransferase                441   6e-148   Methylobacteriaceae
ref|WP_012453656.1|  serine--glyoxylate aminotransferase                441   8e-148   Methylorubrum populi
ref|WP_026608295.1|  serine--glyoxylate aminotransferase                441   2e-147   Methylocapsa acidiphila
gb|ABM96214.1|  serine-glyoxylate aminotransferase                      439   1e-146   Methylibium petroleiphilum PM1
ref|WP_041930245.1|  serine--glyoxylate aminotransferase                438   1e-146   
ref|WP_018267457.1|  serine--glyoxylate aminotransferase                438   1e-146   Methylosinus sp. LW4
ref|WP_036230592.1|  MULTISPECIES: serine--glyoxylate aminotransf...    437   3e-146   Methylibium
ref|WP_036293367.1|  serine--glyoxylate aminotransferase                437   4e-146   Methylosinus
ref|WP_024878012.1|  MULTISPECIES: serine--glyoxylate aminotransf...    437   4e-146   Methylocystaceae
ref|WP_012590731.1|  serine--glyoxylate aminotransferase                437   4e-146   Methylocella silvestris
ref|WP_015933415.1|  serine--glyoxylate aminotransferase                436   1e-145   Methylobacterium nodulans
ref|XP_002953765.1|  hypothetical protein VOLCADRAFT_75980              437   1e-145   Volvox carteri f. nagariensis
ref|XP_005648727.1|  serine glyoxylate aminotransferase                 436   2e-145   Coccomyxa subellipsoidea C-169
ref|XP_006369574.1|  hypothetical protein POPTR_0001s26020g             429   3e-145   
ref|WP_035525480.1|  serine--glyoxylate aminotransferase                434   5e-145   Paraburkholderia sacchari
ref|WP_003613273.1|  serine--glyoxylate aminotransferase                432   1e-144   Methylosinus
ref|WP_027172630.1|  serine--glyoxylate aminotransferase                432   4e-144   Methylobacterium
ref|WP_012405153.1|  serine--glyoxylate aminotransferase                432   4e-144   Paraburkholderia phymatum
ref|WP_026190999.1|  serine--glyoxylate aminotransferase                431   8e-144   Methylobacterium sp. WSM2598
ref|WP_012336184.1|  serine--glyoxylate aminotransferase                431   9e-144   Methylobacterium sp. 4-46
ref|WP_035937801.1|  serine--glyoxylate aminotransferase                431   1e-143   Caballeronia glathei
ref|WP_026175686.1|  serine--glyoxylate aminotransferase                430   2e-143   Methylobacterium sp. 88A
ref|WP_042306504.1|  serine--glyoxylate aminotransferase                431   2e-143   Paraburkholderia terrae
ref|WP_028367172.1|  serine--glyoxylate aminotransferase                429   6e-143   Burkholderia sp. UYPR1.413
ref|WP_007585769.1|  serine--glyoxylate aminotransferase                429   6e-143   Paraburkholderia hospita
ref|WP_035994918.1|  serine--glyoxylate aminotransferase                429   6e-143   Paraburkholderia caribensis
ref|WP_012320605.1|  MULTISPECIES: serine--glyoxylate aminotransf...    429   6e-143   Methylobacterium
ref|WP_010960683.1|  serine--glyoxylate aminotransferase                428   7e-143   Methylococcus capsulatus
ref|WP_007742731.1|  serine--glyoxylate aminotransferase                429   1e-142   Burkholderiaceae
ref|WP_007559580.1|  serine--glyoxylate aminotransferase                427   2e-142   Methylobacterium
ref|WP_026362994.1|  serine--glyoxylate aminotransferase                427   2e-142   Methylopila sp. M107
ref|WP_020188076.1|  hypothetical protein                               427   2e-142   Methylopila sp. 73B
ref|WP_045224300.1|  serine--glyoxylate aminotransferase                426   3e-142   Methyloterricola oryzae
ref|WP_018238561.1|  serine--glyoxylate aminotransferase                426   4e-142   Ensifer sp. BR816
ref|WP_026597137.1|  serine--glyoxylate aminotransferase                427   4e-142   Methylobacterium sp. 77
ref|WP_034858116.1|  serine--glyoxylate aminotransferase                426   4e-142   Ensifer sojae
ref|WP_028212654.1|  serine--glyoxylate aminotransferase                427   5e-142   Paraburkholderia mimosarum
ref|WP_022947294.1|  serine--glyoxylate aminotransferase                426   5e-142   Methylohalobius crimeensis
ref|WP_028223486.1|  serine--glyoxylate aminotransferase                427   7e-142   Paraburkholderia oxyphila
ref|WP_010687105.1|  Aminotransferase class V                           426   8e-142   Methylobacterium mesophilicum
ref|WP_017840623.1|  serine--glyoxylate aminotransferase                425   1e-141   Methylomicrobium buryatense
ref|WP_028755163.1|  serine--glyoxylate aminotransferase                424   2e-141   Rhizobium leucaenae
ref|WP_008058631.1|  serine--glyoxylate aminotransferase                423   8e-141   Methyloversatilis universalis
ref|WP_018410273.1|  serine--glyoxylate aminotransferase                422   2e-140   Methyloversatilis thermotolerans
ref|WP_020092657.1|  serine--glyoxylate aminotransferase                422   3e-140   Methylobacterium
ref|WP_003535479.1|  serine--glyoxylate aminotransferase                421   4e-140   Sinorhizobium meliloti
ref|WP_016921634.1|  serine--glyoxylate aminotransferase                421   4e-140   Methylocystis parvus
ref|WP_036271184.1|  serine--glyoxylate aminotransferase                421   5e-140   Methyloversatilis universalis
gb|AFZ62596.1|  serine-glyoxylate aminotransferase                      421   5e-140   Hyphomicrobium nitrativorans NL23
ref|WP_027147316.1|  MULTISPECIES: serine--glyoxylate aminotransf...    421   6e-140   Methylobacter
ref|WP_041319044.1|  serine--glyoxylate aminotransferase                421   8e-140   Hyphomicrobium nitrativorans
ref|WP_028097617.1|  serine--glyoxylate aminotransferase                421   8e-140   Dongia sp. URHE0060
ref|WP_026223456.1|  serine--glyoxylate aminotransferase                420   1e-139   Methylosarcina fibrata
ref|WP_043385155.1|  MULTISPECIES: serine--glyoxylate aminotransf...    420   1e-139   Methylobacterium
ref|WP_045834860.1|  serine--glyoxylate aminotransferase                420   2e-139   Hyphomicrobium sp. 99
ref|WP_012709136.1|  serine--glyoxylate aminotransferase                419   2e-139   Sinorhizobium fredii
ref|WP_037416404.1|  serine--glyoxylate aminotransferase                419   2e-139   Sinorhizobium sp. CCBAU 05631
ref|WP_037131645.1|  serine--glyoxylate aminotransferase                419   3e-139   Rhizobium sp. CF097
ref|WP_043355705.1|  serine--glyoxylate aminotransferase                419   3e-139   Methylobacterium
ref|WP_036253086.1|  serine--glyoxylate aminotransferase                419   3e-139   Methylobacter sp. BBA5.1
ref|WP_014329402.1|  serine--glyoxylate aminotransferase                419   3e-139   Sinorhizobium fredii
gb|AIQ91949.1|  Aminotransferase class V                                421   4e-139   Methylobacterium oryzae CBMB20
ref|WP_026616975.1|  serine--glyoxylate aminotransferase                419   4e-139   Sinorhizobium/Ensifer group
ref|WP_042673896.1|  serine--glyoxylate aminotransferase                419   6e-139   Methylobacterium sp. B34
ref|WP_043363897.1|  serine--glyoxylate aminotransferase                418   6e-139   Methyloversatilis discipulorum
ref|WP_040961132.1|  serine--glyoxylate aminotransferase                418   9e-139   Sinorhizobium fredii
ref|WP_036284904.1|  serine--glyoxylate aminotransferase                417   1e-138   Methylocystis sp. ATCC 49242
ref|WP_014762956.1|  serine--glyoxylate aminotransferase                417   1e-138   Sinorhizobium fredii
ref|WP_037384071.1|  serine--glyoxylate aminotransferase                417   1e-138   Sinorhizobium americanum
ref|WP_029644281.1|  serine--glyoxylate aminotransferase                417   1e-138   Methyloversatilis discipulorum
ref|WP_014149643.1|  serine--glyoxylate aminotransferase                417   2e-138   Methylomicrobium alcaliphilum
ref|WP_038511699.1|  serine--glyoxylate aminotransferase                417   2e-138   Granulibacter bethesdensis
ref|WP_005371842.1|  MULTISPECIES: serine--glyoxylate aminotransf...    416   3e-138   Methylomicrobium agile
ref|WP_020085137.1|  serine--glyoxylate aminotransferase                417   3e-138   Hyphomicrobium zavarzinii
ref|WP_031434945.1|  serine--glyoxylate aminotransferase                416   5e-138   Methylomarinum vadi
gb|AHJ64409.1|  Serine-pyruvate aminotransferase                        417   5e-138   Granulibacter bethesdensis CGDNIH4
ref|WP_011630756.1|  serine--glyoxylate aminotransferase                416   5e-138   Granulibacter bethesdensis
ref|WP_027999163.1|  serine--glyoxylate aminotransferase                415   9e-138   Sinorhizobium arboris
ref|WP_024925735.1|  MULTISPECIES: serine--glyoxylate aminotransf...    415   1e-137   Mesorhizobium
ref|WP_031597721.1|  serine--glyoxylate aminotransferase                415   2e-137   
gb|AHJ67030.1|  hypothetical protein GbCGDNIH2_0048                     416   2e-137   
ref|WP_038515723.1|  serine--glyoxylate aminotransferase                414   2e-137   
ref|WP_045777819.1|  serine--glyoxylate aminotransferase                412   8e-137   
gb|AHJ61786.1|  Serine-pyruvate aminotransferase                        414   8e-137   
ref|WP_023434100.1|  Serine--glyoxylate aminotransferase                412   1e-136   
ref|XP_001702107.1|  serine glyoxylate aminotransferase                 414   1e-136   
ref|XP_001702106.1|  serine glyoxylate aminotransferase                 414   1e-136   
sp|O08374.2|SGAA_HYPME  RecName: Full=Serine--glyoxylate aminotra...    412   1e-136   
ref|WP_026622911.1|  serine--glyoxylate aminotransferase                412   2e-136   
ref|WP_018405893.1|  serine--glyoxylate aminotransferase                412   2e-136   
dbj|BAQ18801.1|  serine-glyoxylate aminotransferase                     411   2e-136   
gb|ACN36238.1|  unknown                                                 409   2e-136   
ref|WP_013819317.1|  serine--glyoxylate aminotransferase                411   3e-136   
ref|WP_029648781.1|  serine--glyoxylate aminotransferase                411   3e-136   
ref|WP_015314900.1|  serine--glyoxylate aminotransferase                411   4e-136   
ref|WP_014890662.1|  serine--glyoxylate aminotransferase                411   5e-136   
ref|WP_019858769.1|  serine--glyoxylate aminotransferase                410   6e-136   
ref|WP_024298006.1|  serine--glyoxylate aminotransferase                410   9e-136   
ref|WP_040969922.1|  serine--glyoxylate aminotransferase                409   2e-135   
ref|WP_006203221.1|  serine--glyoxylate aminotransferase                409   2e-135   
ref|WP_013949995.1|  MULTISPECIES: serine--glyoxylate aminotransf...    409   3e-135   
ref|WP_042643125.1|  serine--glyoxylate aminotransferase                409   3e-135   
ref|WP_032930697.1|  serine--glyoxylate aminotransferase                409   4e-135   
ref|WP_023829410.1|  serine--glyoxylate aminotransferase                409   4e-135   
ref|WP_027168976.1|  serine--glyoxylate aminotransferase                408   4e-135   
ref|XP_011399157.1|  Serine-glyoxylate aminotransferase                 407   6e-135   
ref|WP_013894918.1|  serine--glyoxylate aminotransferase                407   8e-135   
ref|WP_027029542.1|  serine--glyoxylate aminotransferase                407   1e-134   
ref|WP_027051273.1|  serine--glyoxylate aminotransferase                407   2e-134   
ref|WP_013217108.1|  serine--glyoxylate aminotransferase                407   2e-134   
ref|WP_015599474.1|  serine--glyoxylate aminotransferase                407   2e-134   
ref|WP_023712721.1|  MULTISPECIES: serine--glyoxylate aminotransf...    406   3e-134   
ref|WP_023670792.1|  serine--glyoxylate aminotransferase                406   3e-134   
ref|XP_005851882.1|  hypothetical protein CHLNCDRAFT_33614              408   3e-134   
ref|WP_019867322.1|  serine--glyoxylate aminotransferase                406   3e-134   
ref|WP_023698325.1|  serine--glyoxylate aminotransferase                406   3e-134   
ref|WP_023685219.1|  serine--glyoxylate aminotransferase                406   4e-134   
ref|WP_023822176.1|  serine--glyoxylate aminotransferase                406   4e-134   
ref|WP_010910076.1|  serine--glyoxylate aminotransferase                405   5e-134   
ref|WP_023700366.1|  serine--glyoxylate aminotransferase                405   5e-134   
ref|WP_023690974.1|  MULTISPECIES: serine--glyoxylate aminotransf...    405   5e-134   
ref|WP_041003840.1|  serine--glyoxylate aminotransferase                405   6e-134   
ref|WP_023779196.1|  serine--glyoxylate aminotransferase                405   6e-134   
ref|WP_018329867.1|  serine--glyoxylate aminotransferase                405   7e-134   
ref|WP_027156802.1|  serine--glyoxylate aminotransferase                405   9e-134   
ref|WP_023731220.1|  MULTISPECIES: serine--glyoxylate aminotransf...    405   9e-134   
ref|WP_023706127.1|  MULTISPECIES: serine--glyoxylate aminotransf...    405   1e-133   
ref|WP_023805485.1|  serine--glyoxylate aminotransferase                405   1e-133   
gb|KIZ03753.1|  serine--glyoxylate transaminase                         406   1e-133   
emb|CAD13310.1|  serine-glyoxylate aminotransferase                     404   1e-133   
ref|WP_027163728.1|  serine--glyoxylate aminotransferase                405   1e-133   
ref|WP_023714322.1|  serine--glyoxylate aminotransferase                405   1e-133   
ref|WP_023818017.1|  serine--glyoxylate aminotransferase                404   1e-133   
ref|WP_027061369.1|  serine--glyoxylate aminotransferase                404   2e-133   
ref|WP_023690293.1|  serine--glyoxylate aminotransferase                404   2e-133   
ref|WP_023753463.1|  MULTISPECIES: serine--glyoxylate aminotransf...    404   2e-133   
ref|WP_014955398.1|  serine--glyoxylate aminotransferase                404   2e-133   
ref|WP_023746858.1|  MULTISPECIES: serine--glyoxylate aminotransf...    404   2e-133   
ref|WP_040981991.1|  serine--glyoxylate aminotransferase                404   3e-133   
ref|WP_020592928.1|  hypothetical protein                               403   3e-133   
ref|WP_041007618.1|  serine--glyoxylate aminotransferase                403   4e-133   
gb|AFK37194.1|  unknown                                                 397   4e-133   
ref|WP_031437003.1|  serine--glyoxylate aminotransferase                403   5e-133   
ref|WP_006890572.1|  serine--glyoxylate aminotransferase                403   5e-133   
ref|WP_013529882.1|  serine--glyoxylate aminotransferase                403   6e-133   
ref|WP_023763335.1|  serine--glyoxylate aminotransferase                403   7e-133   
ref|WP_023741624.1|  serine--glyoxylate aminotransferase                403   7e-133   
ref|WP_027044922.1|  serine--glyoxylate aminotransferase                402   8e-133   
ref|WP_023782620.1|  serine--glyoxylate aminotransferase                402   1e-132   
ref|WP_041011880.1|  serine--glyoxylate aminotransferase                402   1e-132   
ref|WP_023739129.1|  MULTISPECIES: serine--glyoxylate aminotransf...    402   1e-132   
ref|WP_027146511.1|  serine--glyoxylate aminotransferase                402   1e-132   
ref|WP_015317366.1|  serine--glyoxylate aminotransferase                402   2e-132   
ref|WP_023833857.1|  serine--glyoxylate aminotransferase                401   2e-132   
ref|WP_023769804.1|  MULTISPECIES: serine--glyoxylate aminotransf...    401   3e-132   
ref|WP_037133426.1|  serine--glyoxylate aminotransferase                401   3e-132   
ref|WP_026227793.1|  serine--glyoxylate aminotransferase                401   3e-132   
ref|WP_023827347.1|  serine--glyoxylate aminotransferase                400   6e-132   
ref|WP_024505109.1|  serine--glyoxylate aminotransferase                400   9e-132   
ref|XP_008666464.1|  PREDICTED: serine--glyoxylate aminotransfera...    393   1e-131   
ref|XP_005539023.1|  serine-glyoxylate aminotransferase                 398   7e-131   
gb|KJB54391.1|  hypothetical protein B456_009G074800                    390   1e-130   
dbj|GAN77535.1|  serine--glyoxylate transaminase                        397   1e-130   
ref|WP_023496630.1|  serine--glyoxylate aminotransferase SgaA           396   2e-130   
tpg|DAA47874.1|  TPA: hypothetical protein ZEAMMB73_131074              392   4e-130   
ref|WP_036274731.1|  serine--glyoxylate aminotransferase                395   6e-130   
ref|WP_033156535.1|  serine--glyoxylate aminotransferase                394   2e-129   
ref|WP_026604426.1|  serine--glyoxylate aminotransferase                393   4e-129   
ref|WP_037283573.1|  serine--glyoxylate aminotransferase                393   4e-129   
ref|WP_037126267.1|  serine--glyoxylate aminotransferase                393   5e-129   
ref|WP_020482091.1|  serine--glyoxylate aminotransferase                392   6e-129   
ref|WP_006005059.1|  serine--glyoxylate aminotransferase                391   2e-128   
ref|WP_043847105.1|  serine--glyoxylate aminotransferase                389   1e-127   
ref|WP_009211467.1|  serine--glyoxylate aminotransferase                389   3e-127   
ref|WP_010968118.1|  serine--glyoxylate aminotransferase                388   4e-127   
ref|WP_029964417.1|  serine--glyoxylate aminotransferase                387   2e-126   
ref|WP_034483968.1|  serine--glyoxylate aminotransferase                386   3e-126   
ref|WP_014989411.1|  serine--glyoxylate aminotransferase                385   8e-126   
ref|WP_018001111.1|  serine--glyoxylate aminotransferase                384   1e-125   
ref|WP_024351906.1|  serine--glyoxylate aminotransferase                384   1e-125   
ref|WP_034505845.1|  serine--glyoxylate aminotransferase                384   2e-125   
ref|WP_043774228.1|  serine--glyoxylate aminotransferase                383   4e-125   
ref|WP_015888023.1|  serine--glyoxylate aminotransferase                383   5e-125   
ref|WP_010395294.1|  serine--glyoxylate aminotransferase                381   1e-124   
ref|WP_037401694.1|  serine--glyoxylate aminotransferase                381   3e-124   
ref|WP_028719065.1|  serine--glyoxylate aminotransferase                380   3e-124   
ref|WP_037268413.1|  serine--glyoxylate aminotransferase                381   3e-124   
ref|WP_018238011.1|  serine--glyoxylate aminotransferase                380   8e-124   
ref|WP_011750154.1|  serine--glyoxylate aminotransferase                379   1e-123   
ref|WP_037471319.1|  serine--glyoxylate aminotransferase                379   1e-123   
ref|WP_040962653.1|  serine--glyoxylate aminotransferase                379   1e-123   
ref|WP_036741500.1|  serine--glyoxylate aminotransferase                378   3e-123   
ref|WP_043145413.1|  serine--glyoxylate aminotransferase                378   4e-123   
ref|WP_036753911.1|  serine--glyoxylate aminotransferase                378   4e-123   
ref|WP_024844788.1|  serine--glyoxylate aminotransferase                377   6e-123   
ref|WP_008757940.1|  serine--glyoxylate aminotransferase                377   7e-123   
tpg|DAA47908.1|  TPA: hypothetical protein ZEAMMB73_592349              371   9e-123   
ref|WP_015895604.1|  serine--glyoxylate aminotransferase                377   1e-122   
ref|WP_037380858.1|  serine--glyoxylate aminotransferase                376   2e-122   
gb|ERL97602.1|  serine-pyruvate aminotransferase/archaeal asparta...    377   2e-122   
ref|WP_028712351.1|  serine--glyoxylate aminotransferase                375   3e-122   
ref|WP_028716825.1|  serine--glyoxylate aminotransferase                375   4e-122   
ref|WP_039537917.1|  serine--glyoxylate aminotransferase                374   8e-122   
ref|WP_027288003.1|  serine--glyoxylate aminotransferase                374   9e-122   
ref|WP_011513322.1|  MULTISPECIES: serine--glyoxylate aminotransf...    374   1e-121   
ref|WP_020058450.1|  hypothetical protein                               374   1e-121   
ref|WP_037094842.1|  serine--glyoxylate aminotransferase                374   1e-121   
ref|WP_037245168.1|  serine--glyoxylate aminotransferase                374   2e-121   
ref|WP_026622392.1|  serine--glyoxylate aminotransferase                373   2e-121   
ref|WP_012177563.1|  serine--glyoxylate aminotransferase                373   3e-121   
ref|WP_023002149.1|  MULTISPECIES: serine--glyoxylate aminotransf...    373   4e-121   
ref|WP_037263007.1|  serine--glyoxylate aminotransferase                373   4e-121   
ref|WP_045683916.1|  serine--glyoxylate aminotransferase                373   4e-121   
ref|WP_040651093.1|  serine--glyoxylate aminotransferase                372   5e-121   
ref|WP_037249159.1|  serine--glyoxylate aminotransferase                372   6e-121   
ref|WP_014762541.1|  serine--glyoxylate aminotransferase                372   7e-121   
ref|WP_028035328.1|  serine--glyoxylate aminotransferase                372   7e-121   
ref|WP_041545642.1|  serine--glyoxylate aminotransferase                372   1e-120   
gb|ABG64679.1|  serine-glyoxylate aminotransferase apoenzyme            371   1e-120   
ref|WP_011455723.1|  serine--glyoxylate aminotransferase                371   2e-120   
ref|WP_009817966.1|  serine--glyoxylate aminotransferase                371   2e-120   
ref|WP_026850920.1|  serine--glyoxylate aminotransferase                370   2e-120   
ref|WP_011280657.1|  serine--glyoxylate aminotransferase                370   2e-120   
ref|WP_030092530.1|  serine--glyoxylate aminotransferase                370   4e-120   
ref|WP_038006422.1|  MULTISPECIES: serine--glyoxylate aminotransf...    369   6e-120   
ref|WP_008279759.1|  serine--glyoxylate aminotransferase                370   6e-120   
ref|WP_013046086.1|  serine--glyoxylate aminotransferase                370   7e-120   
ref|WP_039621788.1|  serine--glyoxylate aminotransferase                369   8e-120   
ref|WP_037197032.1|  serine--glyoxylate aminotransferase                369   8e-120   
gb|EAQ23658.1|  probable serine-glyoxylate aminotransferase             372   8e-120   
ref|WP_027260136.1|  serine--glyoxylate aminotransferase                369   9e-120   
ref|WP_011569032.1|  serine--glyoxylate aminotransferase                369   1e-119   
ref|WP_006935547.1|  serine--glyoxylate aminotransferase                369   2e-119   
ref|WP_010441851.1|  serine--glyoxylate aminotransferase                369   2e-119   
ref|WP_028957602.1|  serine--glyoxylate aminotransferase                368   2e-119   
ref|WP_014869675.1|  serine--glyoxylate aminotransferase                368   3e-119   
ref|WP_039166767.1|  serine--glyoxylate aminotransferase                368   3e-119   
ref|WP_009464599.1|  serine--glyoxylate aminotransferase                368   3e-119   
ref|WP_039187206.1|  serine--glyoxylate aminotransferase                368   3e-119   
ref|WP_037929134.1|  serine--glyoxylate aminotransferase                368   4e-119   
ref|WP_024927669.1|  MULTISPECIES: serine--glyoxylate aminotransf...    367   5e-119   
ref|WP_037276810.1|  serine--glyoxylate aminotransferase                367   6e-119   
ref|WP_043870950.1|  serine--glyoxylate aminotransferase                367   8e-119   
ref|WP_013961473.1|  serine--glyoxylate aminotransferase                367   8e-119   
ref|WP_039194170.1|  serine--glyoxylate aminotransferase                367   8e-119   
ref|WP_037308357.1|  serine--glyoxylate aminotransferase                367   9e-119   
ref|WP_007815045.1|  serine--glyoxylate aminotransferase                367   1e-118   
ref|WP_019294507.1|  MULTISPECIES: septum site-determining protein      366   1e-118   
ref|WP_019140317.1|  serine--glyoxylate aminotransferase                366   2e-118   
ref|WP_039152395.1|  MULTISPECIES: serine--glyoxylate aminotransf...    365   2e-118   
ref|WP_039195772.1|  serine--glyoxylate aminotransferase                365   3e-118   
ref|WP_039396834.1|  serine--glyoxylate aminotransferase                365   7e-118   
ref|WP_040450969.1|  serine--glyoxylate aminotransferase                364   8e-118   
ref|WP_037293454.1|  serine--glyoxylate aminotransferase                364   1e-117   
ref|WP_045023832.1|  serine--glyoxylate aminotransferase                363   1e-117   
ref|WP_010239996.1|  serine--glyoxylate aminotransferase                363   1e-117   
ref|WP_040618186.1|  serine--glyoxylate aminotransferase                363   1e-117   
ref|WP_008558487.1|  serine--glyoxylate aminotransferase                363   1e-117   
ref|WP_046002050.1|  serine--glyoxylate aminotransferase                363   1e-117   
gb|EBA13502.1|  Serine--glyoxylate transaminase                         363   2e-117   
ref|WP_017971680.1|  serine--glyoxylate aminotransferase                363   2e-117   
gb|ABR26028.1|  serine-glyoxylate aminotransferase                      355   3e-117   
ref|WP_046017321.1|  serine--glyoxylate aminotransferase                362   3e-117   
ref|WP_037279938.1|  serine--glyoxylate aminotransferase                362   3e-117   
ref|WP_012329920.1|  MULTISPECIES: serine--glyoxylate aminotransf...    362   4e-117   
ref|WP_007817284.1|  serine--glyoxylate aminotransferase                362   4e-117   
ref|WP_042112271.1|  serine--glyoxylate aminotransferase                363   4e-117   
ref|WP_046001615.1|  serine--glyoxylate aminotransferase                362   5e-117   
ref|WP_045983489.1|  serine--glyoxylate aminotransferase                362   6e-117   
ref|WP_029357831.1|  serine--glyoxylate aminotransferase                362   7e-117   
ref|WP_008280158.1|  serine--glyoxylate aminotransferase                362   7e-117   
ref|WP_006311601.1|  serine--glyoxylate aminotransferase                362   8e-117   
ref|WP_004668649.1|  serine--glyoxylate aminotransferase                362   8e-117   
ref|WP_020096326.1|  serine--glyoxylate aminotransferase                361   1e-116   
ref|WP_042251598.1|  serine--glyoxylate aminotransferase                361   1e-116   
ref|WP_007351739.1|  serine--glyoxylate aminotransferase                361   1e-116   
ref|WP_027233841.1|  serine--glyoxylate aminotransferase                361   1e-116   
ref|WP_036178803.1|  serine--glyoxylate aminotransferase                361   2e-116   
ref|WP_038147781.1|  serine--glyoxylate aminotransferase                360   3e-116   
ref|WP_029016266.1|  serine--glyoxylate aminotransferase                360   3e-116   
ref|WP_008888199.1|  serine--glyoxylate aminotransferase                360   3e-116   
ref|WP_023665384.1|  serine--glyoxylate aminotransferase                360   4e-116   
ref|WP_010808567.1|  aminotransferase class V                           360   6e-116   
ref|WP_026641447.1|  serine--glyoxylate aminotransferase                359   6e-116   
ref|WP_010686651.1|  serine--glyoxylate transaminase                    359   8e-116   
ref|WP_021102121.1|  Serine--glyoxylate aminotransferase                359   9e-116   
ref|WP_009834866.1|  serine--glyoxylate aminotransferase                358   1e-115   
ref|WP_024092553.1|  serine--glyoxylate aminotransferase                358   1e-115   
ref|WP_009178240.1|  serine--glyoxylate aminotransferase                358   1e-115   
ref|WP_037057439.1|  serine--glyoxylate aminotransferase                358   1e-115   
ref|WP_039365002.1|  serine--glyoxylate aminotransferase                358   2e-115   
ref|WP_044456571.1|  serine--glyoxylate aminotransferase                358   3e-115   
ref|WP_008209359.1|  serine--glyoxylate aminotransferase                358   3e-115   
ref|WP_020094516.1|  MULTISPECIES: serine--glyoxylate aminotransf...    357   3e-115   
ref|WP_038072032.1|  serine--glyoxylate aminotransferase                357   4e-115   
ref|WP_045240763.1|  serine--glyoxylate aminotransferase                357   5e-115   
ref|WP_039135088.1|  serine--glyoxylate aminotransferase                357   6e-115   
ref|WP_012078301.1|  serine--glyoxylate aminotransferase                357   1e-114   
ref|WP_039404613.1|  serine--glyoxylate aminotransferase                357   1e-114   
ref|WP_020084034.1|  serine--glyoxylate aminotransferase                356   1e-114   



>ref|XP_011090165.1| PREDICTED: serine--glyoxylate aminotransferase [Sesamum indicum]
Length=401

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/401 (93%), Positives = 392/401 (98%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIPDQV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPDQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVESEWGQG
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLDVLASK+AED AHTIKAICIVHNETATGVTNNLATVRK+LDHYQHPAL LVDGVSSI
Sbjct  121   ANLDVLASKIAEDKAHTIKAICIVHNETATGVTNNLATVRKILDHYQHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW DYLKF
Sbjct  181   CALDFRMDEWGIDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSVRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDN+IARHTRLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNIIARHTRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW+SDTVTAVV+PSYIDS+EIV++AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWYSDTVTAVVIPSYIDSTEIVRQAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEMVLKD+GYPVKLGSGVAAASAYLQN+TP+IPSRI
Sbjct  361   GCLAGVEMVLKDVGYPVKLGSGVAAASAYLQNSTPLIPSRI  401



>ref|NP_001265946.1| Hop-interacting protein THI032 [Solanum lycopersicum]
 ref|XP_010314658.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314659.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314661.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314662.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314663.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69795.1| Hop-interacting protein THI032 [Solanum lycopersicum]
Length=401

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/401 (92%), Positives = 389/401 (97%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYVN PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFL PTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQ+RLNF+VDVVES+WGQG
Sbjct  61    TPFLFPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANL+VLASK+AED +HTIKA+CIVHNETATGVTNNLATVRK+LDHYQHPAL LVDGVSSI
Sbjct  121   ANLEVLASKIAEDKSHTIKAVCIVHNETATGVTNNLATVRKILDHYQHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWSDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAVVVP +I+SSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVVVPPHIESSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEMVLKDIGYPVK GSGVAAASA+LQN+TP+IPSRI
Sbjct  361   GCLAGVEMVLKDIGYPVKFGSGVAAASAFLQNSTPLIPSRI  401



>ref|XP_010277598.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
 ref|XP_010277599.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
Length=401

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/401 (92%), Positives = 388/401 (97%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV APGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTT+G
Sbjct  1     MDYVYAPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDV+ESEWGQG
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVIESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLD+LASKLA DTAHTIKAICIVHNETATGVTNNLATVRK+LDHY+HPAL LVDGVSSI
Sbjct  121   ANLDILASKLAADTAHTIKAICIVHNETATGVTNNLATVRKILDHYRHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKSAKSVRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH+RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHSRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAVVVP YIDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVVVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  P+IPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPLIPSRI  401



>ref|XP_006349776.1| PREDICTED: serine--glyoxylate aminotransferase-like [Solanum 
tuberosum]
Length=401

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/401 (92%), Positives = 389/401 (97%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYVN PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFL PTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQ+RLNF+VDVVES+WGQG
Sbjct  61    TPFLFPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANL+VLASK+AED +HTIKA+CIVHNETATGVTNNLATVRK+LDHYQHPAL LVDGVSSI
Sbjct  121   ANLEVLASKIAEDKSHTIKAVCIVHNETATGVTNNLATVRKILDHYQHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWSDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAVVVP +I+SSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLL
Sbjct  301   EEWFSDTVTAVVVPPHIESSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGSLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEMVLKDIGYPVK GSGVAAASA+LQN+TP+IPSRI
Sbjct  361   GCLAGVEMVLKDIGYPVKFGSGVAAASAFLQNSTPLIPSRI  401



>ref|XP_011080387.1| PREDICTED: serine--glyoxylate aminotransferase-like [Sesamum 
indicum]
Length=401

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/401 (92%), Positives = 386/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIP+QVIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKT SG
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPEQVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTASG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDRIV+FLIGQFSLLWIDQQQRLNFNVDVVESEWGQG
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRIVTFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANL++LASK+AED  HTIKAICIVHNETATGVTNNLATVRK+LDHYQHPAL LVDGVSSI
Sbjct  121   ANLEILASKIAEDREHTIKAICIVHNETATGVTNNLATVRKILDHYQHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWG+DVALTGSQKALSLPTG+GIVCAS KAL A+KTAKSVRVFFDW DYLKF
Sbjct  181   CALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASAKALRATKTAKSVRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAVQAWGLKNCTQK
Sbjct  241   YKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGQATRLAVQAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW+SDTVTAVVVPS IDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLL
Sbjct  301   EEWYSDTVTAVVVPSNIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEMVLKD+GYPVKLGSGVAAASAYLQN+TP IPSRI
Sbjct  361   GCLAGVEMVLKDVGYPVKLGSGVAAASAYLQNSTPYIPSRI  401



>ref|XP_009619693.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana tomentosiformis]
Length=401

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/401 (92%), Positives = 387/401 (97%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYVN PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTK LLEDVKKIFKTTSG
Sbjct  1     MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKVLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNF+VDVVES+WGQG
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A+L+ LASK+A D +HTIKAICIVHNETATGVTNNLATVRK+LDHYQHPALLLVDGVSSI
Sbjct  121   ADLEALASKIAADKSHTIKAICIVHNETATGVTNNLATVRKILDHYQHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWSDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YKMGTYWPYTPSIQLLYGLRA LDLLFEEGL+NVIARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKMGTYWPYTPSIQLLYGLRAALDLLFEEGLENVIARHARLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAVVVP YIDS EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVVVPPYIDSVEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEMVLKD+GYPVK GSGVAAAS +LQN+TP+IPSRI
Sbjct  361   GCLAGVEMVLKDVGYPVKFGSGVAAASTFLQNSTPLIPSRI  401



>emb|CDP08481.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/401 (91%), Positives = 384/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYVN PGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TK LLEDVKKIFKT SG
Sbjct  1     MDYVNGPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKILLEDVKKIFKTESG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDV+ESEWGQG
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVIESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLD+LASKLAEDTAHTIKAICIVHNETATGVTNNLATVRK+LDHY HPAL +VDGVSSI
Sbjct  121   ANLDILASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKILDHYNHPALFVVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLK 
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKV  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSI LLYGLRA LDL+FEEGL+NV ARH RL  ATRLA++AWGLKNCTQK
Sbjct  241   YKLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVFARHARLAKATRLAMEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW+SDTVTAV+VP  IDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWYSDTVTAVLVPPNIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEMVLKD+GYPVKLGSGV AA AYLQNTTP+IPSRI
Sbjct  361   GCLAGVEMVLKDVGYPVKLGSGVGAACAYLQNTTPLIPSRI  401



>ref|XP_004291746.1| PREDICTED: serine--glyoxylate aminotransferase [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/401 (91%), Positives = 388/401 (97%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MD V APGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TK LLEDVKKIFKTT+G
Sbjct  1     MDNVYAPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKILLEDVKKIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVESEWGQG
Sbjct  61    TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLD+LASKLAEDTAHTIKA+CIVHNETATGVTNNLATVRK+LDHY+HPAL LVDGVSSI
Sbjct  121   ANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLATVRKILDHYRHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPS+QLLYGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTYWPYTPSVQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQLL
Sbjct  301   EEWVSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEMVL+D+GYPVKLGSGVAAASAYLQN TP+IPSR+
Sbjct  361   GCLAGVEMVLRDLGYPVKLGSGVAAASAYLQNNTPLIPSRV  401



>ref|XP_010938608.1| PREDICTED: serine--glyoxylate aminotransferase-like [Elaeis guineensis]
Length=401

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/401 (92%), Positives = 385/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTL+EDVKKIFKTTSG
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLIEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL F+VDV+ESEWG+G
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFDVDVIESEWGRG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLD+LA KLA DTAHTIKAICIVHNETATGVTNNLATVR LLD Y HPALLLVDGVSSI
Sbjct  121   ANLDMLAMKLATDTAHTIKAICIVHNETATGVTNNLATVRNLLDEYNHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGMGIICASPKALEASKTAKSVRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHNRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAVVVP YIDS+E+V+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVVVPPYIDSAEVVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCL+GVEMVLKDIGYPVKLGSGV AA+AYLQNTTPMIPSRI
Sbjct  361   GCLSGVEMVLKDIGYPVKLGSGVGAAAAYLQNTTPMIPSRI  401



>ref|XP_009775939.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana sylvestris]
Length=401

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/401 (92%), Positives = 386/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYVN PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTK LLEDVKKIFKTTSG
Sbjct  1     MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKVLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNF+VDVVES+WGQG
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFDVDVVESDWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A+L+ LASK+A D +HTIKAICIVHNETATGVTNNLATVRK+LDHYQHPAL LVDGVSSI
Sbjct  121   ADLEALASKIAADKSHTIKAICIVHNETATGVTNNLATVRKILDHYQHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWSDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YKMGTYWPYTPSIQLLYGLRA LDLLFEEGL+NVIARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKMGTYWPYTPSIQLLYGLRAALDLLFEEGLENVIARHARLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAVVVP YIDS EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVVVPPYIDSVEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEMVLKD+GYPVK GSGVAAAS +LQN+TP+IPSRI
Sbjct  361   GCLAGVEMVLKDVGYPVKFGSGVAAASTFLQNSTPLIPSRI  401



>ref|XP_008227244.1| PREDICTED: serine--glyoxylate aminotransferase [Prunus mume]
Length=401

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/401 (91%), Positives = 384/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TK LLEDVKKIFKTT+G
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKILLEDVKKIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVESEWGQG
Sbjct  61    TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLD+LASKLAEDTAHTIKAICIVHNETATGVTNNLA VR++LD Y+HPAL LVDGVSSI
Sbjct  121   ANLDILASKLAEDTAHTIKAICIVHNETATGVTNNLAQVRRILDEYRHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLR  LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ 
Sbjct  241   YKLGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQS  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEMVL+D+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  361   GCLAGVEMVLRDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>gb|AGT38285.1| serine--glyoxylate aminotransferase [Gossypium hirsutum]
 gb|KJB83532.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=401

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/401 (91%), Positives = 382/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY   PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1     MDYFYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61    TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLDVLA KLA D  HTIKAICIVHNETATGVTNNLATVRKLLDHY HPALLLVDGVSSI
Sbjct  121   ANLDVLAEKLAADRTHTIKAICIVHNETATGVTNNLATVRKLLDHYGHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEA+KTAKSVRVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEATKTAKSVRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDN+I RH+RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNIIERHSRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAV+VP YIDSSEIVKR WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVLVPPYIDSSEIVKRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>ref|XP_009342610.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
 ref|XP_009342611.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
Length=401

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/401 (91%), Positives = 383/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVK+IFKTTSG
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKTLLEDVKQIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61    TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLDVL SK+AEDTAHTIKAICIVHNETATGVTNNLA VRK+LD+Y HPAL LVDGVSSI
Sbjct  121   ANLDVLESKIAEDTAHTIKAICIVHNETATGVTNNLAKVRKILDNYMHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLR  LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ 
Sbjct  241   YKLGTYWPYTPSIQLLYGLRTALDLVFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQS  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQLL
Sbjct  301   EEWVSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEMVLKD+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  361   GCLAGVEMVLKDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>ref|XP_008363560.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/401 (91%), Positives = 383/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61    TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESDWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLDVL SK+AEDTAHTIKAICIVHNETATGVTNNLA VRK+LD+Y HPAL LVDGVSSI
Sbjct  121   ANLDVLESKIAEDTAHTIKAICIVHNETATGVTNNLAKVRKILDNYMHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASK+AKSVRVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKSAKSVRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ 
Sbjct  241   YKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQS  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQLL
Sbjct  301   EEWVSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEMVLKD+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  361   GCLAGVEMVLKDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>ref|XP_007015204.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015205.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015206.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32823.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32824.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32825.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
Length=401

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/401 (90%), Positives = 385/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PA+TKTLLEDVK IFKTT+G
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPAMTKTLLEDVKMIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG
Sbjct  61    TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANL++LA KLA D  HTIKAICIVHNETATGVTNNLATVRKLLDHY+HPALLLVDGVSSI
Sbjct  121   ANLEILAEKLASDYTHTIKAICIVHNETATGVTNNLATVRKLLDHYRHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTGIG+VCASPKALEASK+AKSVRVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGIGLVCASPKALEASKSAKSVRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GT+WPYTPS+QLLYGLRA LDL+FEEGLDNVI RH+RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTFWPYTPSVQLLYGLRAALDLIFEEGLDNVITRHSRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW+SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWYSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAA AYLQNT PMIPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAACAYLQNTIPMIPSRI  401



>ref|XP_007212264.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
 gb|EMJ13463.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
Length=401

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/401 (90%), Positives = 383/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TK LLEDVKKIFKTT+G
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKILLEDVKKIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             T F+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVESEWGQG
Sbjct  61    TSFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLD+LASKLAEDTAHTIKAICIVHNETATGVTNNLA VR++LD Y+HPAL LVDGVSSI
Sbjct  121   ANLDILASKLAEDTAHTIKAICIVHNETATGVTNNLAQVRRILDEYRHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLR  LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ 
Sbjct  241   YKLGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQS  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEMVL+D+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  361   GCLAGVEMVLRDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>ref|XP_009338530.1| PREDICTED: serine--glyoxylate aminotransferase-like [Pyrus x 
bretschneideri]
Length=401

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/401 (91%), Positives = 385/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIP+ V+R+M RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPEAVLRSMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPF+IPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61    TPFMIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLD+L SK+AEDTAHTIKAICIVHNETATGVTNNLA VRK+LD+Y+HPAL LVDGVSSI
Sbjct  121   ANLDILESKIAEDTAHTIKAICIVHNETATGVTNNLAKVRKILDNYRHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DYLKF
Sbjct  181   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ+
Sbjct  241   YKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQR  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW SDTVTAV+VP +IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWVSDTVTAVLVPPHIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEMVL+D+GYPVKLGSGVAAASAYLQN TP+IPSRI
Sbjct  361   GCLAGVEMVLRDVGYPVKLGSGVAAASAYLQNNTPLIPSRI  401



>gb|KJB54389.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54390.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54392.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54394.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=401

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/401 (90%), Positives = 385/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TK LLEDVKKIFKT++G
Sbjct  1     MDYVYGPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKNLLEDVKKIFKTSTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLD+LA KLA D +HTIKAICIVHNETATGVTNNLATVRKLLDHY+HPALLLVDGVSSI
Sbjct  121   ANLDILAEKLAADHSHTIKAICIVHNETATGVTNNLATVRKLLDHYRHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARHTR+G ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHTRMGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  401



>ref|XP_010045046.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 ref|XP_010045047.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 gb|KCW87200.1| hypothetical protein EUGRSUZ_B03720 [Eucalyptus grandis]
Length=401

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/401 (91%), Positives = 382/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIPDQVIRAM RNNEDYRSPA+PALTK LLEDVKKIFKTT+G
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPDQVIRAMNRNNEDYRSPAIPALTKILLEDVKKIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDR +SF+IGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRTISFMIGQFSLLWIDQQQRLGFNVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLD+LASKLA DTAHTIKA+CIVHNETATGVTNNLA VRK+LD Y+HPAL LVDGVSSI
Sbjct  121   ANLDILASKLAADTAHTIKAVCIVHNETATGVTNNLARVRKILDDYRHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS +VFFDWKDYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSYKVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y+MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RL T TRLAV+AWGLKNCTQK
Sbjct  241   YQMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHNRLATGTRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAVVVP YI+SSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVVVPPYIESSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEMVLKD+GYP+KLGSGV AASAY QNTTP+I SRI
Sbjct  361   GCLAGVEMVLKDVGYPIKLGSGVGAASAYFQNTTPLIASRI  401



>gb|KDO44953.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=401

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/401 (90%), Positives = 387/401 (97%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY+ APG+NHLFVPGPV+IPDQVIRAM RNNEDYRSPAVPALTKTLLED+KKIFKTTSG
Sbjct  1     MDYMYAPGKNHLFVPGPVHIPDQVIRAMNRNNEDYRSPAVPALTKTLLEDIKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRLNFNVDVVES+WG+G
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLNFNVDVVESDWGEG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A LDVLASKLA DTAHTIKAICIVHNETATGVTNNL+ VRKLLD Y+HPAL LVDGVSSI
Sbjct  121   AKLDVLASKLAADTAHTIKAICIVHNETATGVTNNLSKVRKLLDEYRHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CAIDFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDY+KF
Sbjct  181   CAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYIKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNELQLL
Sbjct  301   EEWFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>ref|XP_006470731.1| PREDICTED: serine--glyoxylate aminotransferase-like [Citrus sinensis]
Length=401

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/401 (90%), Positives = 387/401 (97%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY+ APG+NHLFVPGPV+IPDQVIRAM RNNEDYRSPAVPALTKTLLED+KKIFKTTSG
Sbjct  1     MDYMYAPGKNHLFVPGPVHIPDQVIRAMNRNNEDYRSPAVPALTKTLLEDIKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRLNFNVDVVES+WG+G
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLNFNVDVVESDWGEG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A LDVLASKLA DTAHTIKAICIVHNETATGVTNNL+ VRKLLD Y+HPAL LVDGVSSI
Sbjct  121   AKLDVLASKLAADTAHTIKAICIVHNETATGVTNNLSKVRKLLDDYRHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CAIDFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDY+KF
Sbjct  181   CAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYIKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNELQLL
Sbjct  301   EEWFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>gb|KHG14448.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/401 (91%), Positives = 382/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MD   APG+NHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1     MDNFYAPGKNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61    TPFMIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLDVLA KLA D  HTIKAICIVHNETATGVTNNLATVRKLLDHY HPALLLVDGVSSI
Sbjct  121   ANLDVLAEKLAADRTHTIKAICIVHNETATGVTNNLATVRKLLDHYGHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCAS KALEA+KTAKSVRVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASQKALEATKTAKSVRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVI RH+RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHSRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAV+VP YIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVLVPPYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>gb|EPS59280.1| serine-glyoxylate aminotransferase [Genlisea aurea]
Length=401

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/401 (90%), Positives = 385/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIP+QVIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPEQVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWG+G
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGRG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A+LD+LASK+A+D  H IKAICIVHNETATGVTNNLATVRK+LD YQHPAL LVDGVSSI
Sbjct  121   ADLDILASKIAQDKDHAIKAICIVHNETATGVTNNLATVRKILDQYQHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWG+DVALTGSQKALSLPTG+GI+CASPKALEA+K+AKSVRVFFDW DYLKF
Sbjct  181   CALDFRMDEWGIDVALTGSQKALSLPTGLGILCASPKALEATKSAKSVRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQ 
Sbjct  241   YKLGTYWPYTPSIQLLYGLRAALDLVFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQS  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW SDTVTA++VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWVSDTVTAIMVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVE+VL+D+GYPVKLGSGVAAASAY QN+TP+I SRI
Sbjct  361   GCLAGVELVLRDVGYPVKLGSGVAAASAYFQNSTPLISSRI  401



>ref|XP_008359496.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
 ref|XP_008359497.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/401 (91%), Positives = 384/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIP+ V+R+M RNNEDYRSPAVPA+TKTLLEDVKKIFKTT+G
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPEAVLRSMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLD+L SK+AEDTAHTIKAICIVHNETATGVTNNLA VRK+L++Y+HPAL LVDGVSSI
Sbjct  121   ANLDILESKIAEDTAHTIKAICIVHNETATGVTNNLAKVRKILBNYRHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DYLKF
Sbjct  181   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ+
Sbjct  241   YKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQR  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW SDTVTAV+VP +IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWVSDTVTAVLVPPHIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEMVL+D+GY VKLGSGVAAASAYLQN TP+IPSRI
Sbjct  361   GCLAGVEMVLRDVGYXVKLGSGVAAASAYLQNNTPLIPSRI  401



>gb|KHG29969.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/401 (90%), Positives = 385/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1     MDYVYGPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDR V+FLIGQFSLLWIDQQQRLNFNVDVVESEWGQG
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRTVTFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLD+LA KLA D +HTIKAICIVHNETATG+TNNLATVRKLLDHY+HPALLLVDGVSSI
Sbjct  121   ANLDILAEKLAADHSHTIKAICIVHNETATGITNNLATVRKLLDHYRHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GT+WPYTPSIQLLYGLRA LDL+FEEGLD+VIARH R+G ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDSVIARHNRMGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  401



>ref|XP_003600159.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70410.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/401 (90%), Positives = 385/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1     MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDRIVSF+IGQFSLLW+DQQQRL FNVDVVESEWG+G
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRIVSFVIGQFSLLWVDQQQRLKFNVDVVESEWGRG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A+LD+L SKLA D+AHTIKAICIVHNETATGVTNNLA VR+LLD YQHPALLLVDGVSSI
Sbjct  121   ADLDILESKLASDSAHTIKAICIVHNETATGVTNNLAKVRQLLDAYQHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVA+TGSQKALSLPTGIG V ASPKA+EASK+AKS+RVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPKAIEASKSAKSLRVFFDWSDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLGTATRLAV+AWGLKNCTQ+
Sbjct  241   YKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKNCTQE  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             G LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  361   GALAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_006446249.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 ref|XP_006446250.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59489.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59490.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
Length=401

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/401 (90%), Positives = 385/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY+ APG+NHLFVPGPV IPDQVIRAM RNNEDYRSPAVPALTKTLLED+KKIFKTTSG
Sbjct  1     MDYMYAPGKNHLFVPGPVQIPDQVIRAMNRNNEDYRSPAVPALTKTLLEDIKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRLNFNVDVVES+WG+G
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLNFNVDVVESDWGEG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A LDVLASKLA DTAHTIKAICIVHNETATGVTNNL+ VRKLLD Y+HPAL LVDGVSSI
Sbjct  121   AKLDVLASKLAADTAHTIKAICIVHNETATGVTNNLSKVRKLLDEYRHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CAIDFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDY+KF
Sbjct  181   CAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYIKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAV+VP +I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNELQLL
Sbjct  301   EEWFSDTVTAVIVPPHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>ref|XP_006843377.1| PREDICTED: serine--glyoxylate aminotransferase [Amborella trichopoda]
 gb|ERN05052.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
Length=401

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/401 (90%), Positives = 384/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY+  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYMYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSP DRIVSFL+GQFSLLWIDQQQRLNFNVDV+ESEWGQG
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPRDRIVSFLMGQFSLLWIDQQQRLNFNVDVIESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLD LASKLAED  HTIKAICIVHNETATGVTNNLATVR++LD  +HPALLLVDGVSSI
Sbjct  121   ANLDALASKLAEDRGHTIKAICIVHNETATGVTNNLATVRRILDDLRHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWG+DVALTGSQKALSLPTGIG+VCASPKALEASK+AKSVRVFFDW DYL+F
Sbjct  181   CALDFRMDEWGIDVALTGSQKALSLPTGIGLVCASPKALEASKSAKSVRVFFDWNDYLRF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAVV+P+ IDSSEIV+RAW RYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVVIPANIDSSEIVRRAWNRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCL+GVEM+LKD+GYPVKLGSGVAAASAYLQN+ PMI SRI
Sbjct  361   GCLSGVEMILKDVGYPVKLGSGVAAASAYLQNSIPMIASRI  401



>ref|XP_008812510.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812512.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812513.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812514.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
Length=401

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/401 (91%), Positives = 382/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL F+VDV+ESEWGQG
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFDVDVIESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLD+LA KLA D AHTIKAICIVHNETATGVTNNL+ VR LLD Y+HPALLLVDGVSSI
Sbjct  121   ANLDILAMKLAADRAHTIKAICIVHNETATGVTNNLSAVRNLLDEYRHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASK AKSVRVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGMGIICASPKALEASKMAKSVRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHGRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAVVVP YIDS+E+V+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVVVPPYIDSAEVVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCL+GVEM+LKD+G PVKLGSGVAAA+AYLQNT PMIPSRI
Sbjct  361   GCLSGVEMILKDLGCPVKLGSGVAAAAAYLQNTIPMIPSRI  401



>ref|XP_004499480.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/401 (90%), Positives = 382/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFL PT GTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVESEWG+G
Sbjct  61    TPFLFPTXGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGKG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLD+L SKLA D+AHTIKAICIVHNETATGVTNNLA VR++LD YQHPALLLVDGVSSI
Sbjct  121   ANLDILESKLASDSAHTIKAICIVHNETATGVTNNLAKVRQILDAYQHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVA+TGSQKA SLPTGIGIV ASPKA+EASK+AKS+RVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVAITGSQKAXSLPTGIGIVVASPKAIEASKSAKSLRVFFDWSDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ 
Sbjct  241   YKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQS  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW+SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWYSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYP+K GSGVAAASAYLQN  P+IPSRI
Sbjct  361   GCLAGVEMILKDVGYPIKYGSGVAAASAYLQNNIPLIPSRI  401



>gb|AFK40703.1| unknown [Medicago truncatula]
Length=401

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/401 (89%), Positives = 384/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1     MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWES LTNTLSPGDRIVSF+IGQFSLLW+DQQQRL FNVDVVESEWG+G
Sbjct  61    TPFLIPTTGTGAWESVLTNTLSPGDRIVSFVIGQFSLLWVDQQQRLKFNVDVVESEWGRG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A+LD+L SKLA D+AHTIKAICIVHNETATGVTNNLA VR+LLD YQHPALLLVDGVSSI
Sbjct  121   ADLDILESKLASDSAHTIKAICIVHNETATGVTNNLAKVRQLLDAYQHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVA+TGSQKALSLPTGIG V ASPKA+EASK+AKS+RVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPKAIEASKSAKSLRVFFDWSDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLGTATRLAV+AWGLKNCTQ+
Sbjct  241   YKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKNCTQE  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAVVVP YID +EIV+RAWKR+NLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVVVPPYIDGAEIVRRAWKRFNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             G LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  361   GALAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>gb|AAL47679.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/401 (91%), Positives = 385/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV APG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPALTKTLLEDVKKIFK+T+G
Sbjct  1     MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             T FLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES+WGQG
Sbjct  61    TTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLDVL SKLA D  HTIKAICIVHNETATGVTN+L+ VR LLD Y+HPALLLVDGVSSI
Sbjct  121   ANLDVLESKLATDGGHTIKAICIVHNETATGVTNDLSKVRFLLDKYKHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKT+KSV+VFFDWKDYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEMVLKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  361   GCLAGVEMVLKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_006584642.1| PREDICTED: enzymatic resistance protein isoform X1 [Glycine max]
 gb|ACE63506.1| alanine:glyoxylate aminotransferase [Vigna radiata]
 gb|ACU23313.1| unknown [Glycine max]
 gb|KHM99689.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/401 (89%), Positives = 385/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1     MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWG G
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGHG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A LDVL SK+A DT+HTIKAICIVHNETATGVTN+LA VR++LD YQHPALL+VDGVSSI
Sbjct  121   AKLDVLESKIASDTSHTIKAICIVHNETATGVTNDLAKVRQILDSYQHPALLIVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A PKA+EASK AKS+RVFFDWKDYLKF
Sbjct  181   CALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPKAIEASKHAKSLRVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLL
Sbjct  301   EEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPSRI  401



>ref|XP_002298306.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 ref|XP_006369570.1| aminotransferase 2 family protein [Populus trichocarpa]
 ref|XP_006369571.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|EEE83111.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66139.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|ERP66140.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=401

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/401 (89%), Positives = 381/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY   PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1     MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPF+IPTTGTGAWESALTNTLSPGDR VSF+IGQFSLLWIDQQ+RL FNVDVVES+WGQG
Sbjct  61    TPFIIPTTGTGAWESALTNTLSPGDRTVSFMIGQFSLLWIDQQKRLGFNVDVVESDWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLD+LASKLAEDTAHTIKA+CIVHNETATGVTNNLA VRK+LD Y+HPAL LVDGVSSI
Sbjct  121   ANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLAKVRKILDDYRHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKDYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I SRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIASRI  401



>ref|NP_001237048.1| enzymatic resistance protein [Glycine max]
 gb|AAZ94162.1| enzymatic resistance protein [Glycine max]
Length=401

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/401 (89%), Positives = 385/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1     MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWG G
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGHG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A LDVL SK+A DT+HTIKAICIVHNETATGVTN+LA VR++LD YQHPALL+VDGVSSI
Sbjct  121   AKLDVLESKIASDTSHTIKAICIVHNETATGVTNDLAKVRQILDSYQHPALLIVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASK AKS+RVFFDWKDYLKF
Sbjct  181   CALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y++GTYWPYTPSI LLYGLRA L+L+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YQLGTYWPYTPSIHLLYGLRAALNLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSRI  401



>ref|XP_011043786.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043787.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043788.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
Length=401

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/401 (90%), Positives = 381/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY   PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1     MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPF+IPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQ+RL FNVDVVES+WGQG
Sbjct  61    TPFIIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLGFNVDVVESDWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLD+LASKLAEDTAHTIKA+CIVHNETATGVTNNLA VRK+LD Y+HPALLLVDGVSSI
Sbjct  121   ANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLAKVRKILDDYRHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKDYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTFWPYTPSIQLLYGLREALDLLFLEGLDNVIARHARLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRI  401



>ref|XP_012074477.1| PREDICTED: serine--glyoxylate aminotransferase [Jatropha curcas]
 gb|KDP35982.1| hypothetical protein JCGZ_08377 [Jatropha curcas]
Length=401

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/401 (90%), Positives = 382/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY+  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTT+G
Sbjct  1     MDYMYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFL PTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61    TPFLFPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVESDWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLD+LA KLA DTAHTIKA+CIVHNETATGVTNNLATVR++LD Y+HPAL LVDGVSSI
Sbjct  121   ANLDILAEKLAADTAHTIKAVCIVHNETATGVTNNLATVRRILDDYRHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA+SVRVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTARSVRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAV+VP  IDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVLVPPSIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+L+D+GYPVKLGSGVAAASA+LQN TP+IPSRI
Sbjct  361   GCLAGVEMLLRDVGYPVKLGSGVAAASAFLQNNTPLIPSRI  401



>ref|XP_004139054.1| PREDICTED: serine--glyoxylate aminotransferase [Cucumis sativus]
 gb|KGN66521.1| Aminotransferase 1 [Cucumis sativus]
Length=401

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/401 (90%), Positives = 384/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV APG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPALTKTLLEDVKKIFK+T+G
Sbjct  1     MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTAG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             T FLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES+WGQG
Sbjct  61    TTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLDVL SKLA D   TIKAICIVHNETATGVTN+L+ VR LLD Y+HPALLLVDGVSSI
Sbjct  121   ANLDVLESKLAADGGQTIKAICIVHNETATGVTNDLSKVRFLLDKYKHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKT+KSV+VFFDWKDYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_002531124.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
 gb|EEF31258.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
Length=401

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/401 (90%), Positives = 381/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTT+G
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFL PTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL F+VDVV+S+WGQG
Sbjct  61    TPFLFPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFDVDVVKSQWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLD+LASKLA D+AHTIKA+CIVHNETATGVTN+LA VRK+LD Y+HPAL LVDGVSSI
Sbjct  121   ANLDILASKLAADSAHTIKAVCIVHNETATGVTNDLAKVRKILDDYRHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YKMGT+WPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGL NCTQK
Sbjct  241   YKMGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHARLGKATRLAVEAWGLNNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  P+IPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPLIPSRI  401



>gb|AAQ56192.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/401 (90%), Positives = 384/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV APG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPALTKTLLEDVKKIFK+T+G
Sbjct  1     MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             T FLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDV+ES+WGQG
Sbjct  61    TTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVIESDWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLDVL SKLA D  HTIKAICIVHNETATGVTN+L+ VR LLD Y+HPALLLVDGVSSI
Sbjct  121   ANLDVLESKLATDGGHTIKAICIVHNETATGVTNDLSKVRFLLDKYKHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKT+KSV+VFFDWKDYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVF IGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFSIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_010909203.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
 ref|XP_010909204.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
Length=402

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/402 (90%), Positives = 385/402 (96%), Gaps = 1/402 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES-EWGQ  982
             TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL F+VDV+ES EWGQ
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFDVDVIESGEWGQ  120

Query  981   GANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSS  802
             GANLD+LA+KLA D A+TIKAICIVHNETATGVTNNLA VR LLD Y+HPALLLVDGVSS
Sbjct  121   GANLDILATKLAADRAYTIKAICIVHNETATGVTNNLAAVRNLLDEYRHPALLLVDGVSS  180

Query  801   ICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLK  622
             ICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK AKS+RVFFDW DYLK
Sbjct  181   ICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKMAKSLRVFFDWNDYLK  240

Query  621   FYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQ  442
             FYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ
Sbjct  241   FYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQ  300

Query  441   KEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQL  262
             K+EWFSDTVTAVVVP YIDS+++V+R WKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQL
Sbjct  301   KDEWFSDTVTAVVVPPYIDSADVVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQL  360

Query  261   LGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             LGCL+GVEM+LKD+GYPVKLGSGVAAA+AYLQNTTPMIPSRI
Sbjct  361   LGCLSGVEMILKDVGYPVKLGSGVAAAAAYLQNTTPMIPSRI  402



>gb|ABA00460.1| serine-glyoxylate aminotransferase [Spirodela polyrhiza]
Length=401

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/401 (91%), Positives = 385/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES+WG G
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGLG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLDVLA KLA D +H+IKAICIVHNETATGVTNNLATVRKLLD Y+HPALLLVDGVSSI
Sbjct  121   ANLDVLAEKLAADHSHSIKAICIVHNETATGVTNNLATVRKLLDDYRHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI RH+RLGTATRLAV+AWGLKNCTQK
Sbjct  241   YKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIRRHSRLGTATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAVVVP YIDSSEIV+RAWKR+NLSLGLGLNKVAGKVFRIGHLGN+NELQLL
Sbjct  301   EEWFSDTVTAVVVPGYIDSSEIVRRAWKRFNLSLGLGLNKVAGKVFRIGHLGNVNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCL+GVEMVL+D+GYP KLGSGVAAA+AYL N TP+IPSRI
Sbjct  361   GCLSGVEMVLRDVGYPAKLGSGVAAAAAYLLNNTPLIPSRI  401



>gb|ACJ61247.1| serine glyoxylate aminotransferase 3 [Glycine max]
Length=401

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/401 (89%), Positives = 384/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKTT+G
Sbjct  1     MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWG G
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGHG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A LDVL SK+A DT+HTIKAICIVHNETATGVTN+LA VR++LD YQHPALL+VDGVSSI
Sbjct  121   AKLDVLESKIASDTSHTIKAICIVHNETATGVTNDLAKVRQILDSYQHPALLIVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A PKA+EASK AKS+RVFFDWKDYLKF
Sbjct  181   CALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPKAIEASKHAKSLRVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW+SDTVTAV+VP+YIDS+EIV+RAWKR NLSLGLGLNKVAGKVFRIGHLG+LNELQLL
Sbjct  301   EEWYSDTVTAVLVPAYIDSTEIVRRAWKRNNLSLGLGLNKVAGKVFRIGHLGHLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPSRI  401



>ref|XP_007146302.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 ref|XP_007146303.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18296.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18297.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
Length=401

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/401 (89%), Positives = 383/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1     MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
              PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61    IPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESDWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A LDVL SK+A DTAHTIKAICIVHNETATGVTNNLA VR++LD Y+HPALL+VDGVSSI
Sbjct  121   AKLDVLESKIASDTAHTIKAICIVHNETATGVTNNLAKVRQILDSYKHPALLIVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASKTAKS+RVFFDWKDYLKF
Sbjct  181   CALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH RLGTATRLAV+AWGLKNCTQK
Sbjct  241   YQLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW SDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG LNELQLL
Sbjct  301   EEWHSDTVTAVIVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGYLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+L+D+GYPVKLGSGVAAASAY +NT P+IPSRI
Sbjct  361   GCLAGVEMILQDVGYPVKLGSGVAAASAYFKNTIPLIPSRI  401



>ref|XP_010557501.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
 ref|XP_010557502.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
Length=401

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/401 (89%), Positives = 382/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWG+G
Sbjct  61    TPFIIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGRG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A+L VL+SKL++D  HTIKAICIVHNETATGVTN+++ VR LLDHY HPALLLVDGVSSI
Sbjct  121   ADLQVLSSKLSQDPQHTIKAICIVHNETATGVTNDISAVRALLDHYNHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWSDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAVQAWGLKNCTQK
Sbjct  241   YKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVQAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW+SDTVTAVVVP +IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWYSDTVTAVVVPPHIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+L+D+GYPVKLGSGVAAA AYLQN  P+IPSRI
Sbjct  361   GCLAGVEMILRDVGYPVKLGSGVAAACAYLQNNVPLIPSRI  401



>ref|XP_008449670.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
melo]
 gb|AAQ56195.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/401 (89%), Positives = 382/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61    TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A LDVLA+KLA DT HTIKA+CIVHNETATGVTN+L+ VR++LD Y+HPAL LVDGVSSI
Sbjct  121   AKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLSLVRRILDEYRHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYLKF
Sbjct  181   CALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|AGV54322.1| serine glyoxylate aminotransferase 2 [Phaseolus vulgaris]
Length=401

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/401 (89%), Positives = 383/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1     MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
              PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61    IPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESDWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A LDVL SK+A DTAHTIKAICIVHNETATGVTNNLA VR++LD Y+HPALL+VDGVSSI
Sbjct  121   AKLDVLESKIASDTAHTIKAICIVHNETATGVTNNLAKVRQILDSYKHPALLIVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASKTAKS+RVFFDWKDYLKF
Sbjct  181   CALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH RLGTATRLAV+AWGLKNCT+K
Sbjct  241   YQLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTATRLAVEAWGLKNCTEK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW SDTVTAVVVPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG LNELQLL
Sbjct  301   EEWHSDTVTAVVVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGYLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+L+D+GYPVKLGSGVAAASAY +NT P+IPSRI
Sbjct  361   GCLAGVEMILQDVGYPVKLGSGVAAASAYFKNTIPLIPSRI  401



>ref|NP_001284450.1| serine--glyoxylate aminotransferase [Cucumis melo]
 gb|AAQ56194.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/401 (90%), Positives = 383/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV APG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPAL KTLLEDVKKIFK+T+G
Sbjct  1     MDYVYAPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPALAKTLLEDVKKIFKSTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             T FLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES+WGQG
Sbjct  61    TTFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLDVL SKLA D  HTIKAICIVHNETATGVTN+L+ VR LLD Y+HPALLLVDGVSSI
Sbjct  121   ANLDVLESKLATDGGHTIKAICIVHNETATGVTNDLSKVRFLLDKYKHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKAL ASKT+KSV+VFFDWKDYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALVASKTSKSVKVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>gb|ABQ81922.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/401 (89%), Positives = 382/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKT+SG
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTSSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61    TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A LDVLA+KLA DT HTIKA+CIVHNETATGVTN+L+ VR++LD Y+HPAL LVDGVSSI
Sbjct  121   AKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLSLVRRILDEYRHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYLKF
Sbjct  181   CALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>ref|XP_009415566.1| PREDICTED: serine--glyoxylate aminotransferase [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/401 (89%), Positives = 384/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MD+V  PG+NHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1     MDFVYGPGKNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVESEWG+G
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFRVDVVESEWGRG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A+LD LASKL  D +HTIKA+CIVHNETATGVTN+LA VRKLLD Y+HPALLLVDGVSSI
Sbjct  121   ADLDALASKLEADRSHTIKAVCIVHNETATGVTNDLAAVRKLLDEYRHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASPKA+EA+KTAKSVRVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPKAMEAAKTAKSVRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ+
Sbjct  241   YKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQR  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAVVVPSYI+S+++VKRAW RYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVVVPSYINSADVVKRAWTRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCL+GVEMVL+D+GYPVKLGSGVAAA+AYL+N+TPMI SRI
Sbjct  361   GCLSGVEMVLRDVGYPVKLGSGVAAAAAYLRNSTPMITSRI  401



>gb|AAB95218.1| putative serine-glyoxylate aminotransferase [Fritillaria agrestis]
Length=401

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/401 (89%), Positives = 379/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIP+ VIRAM RNNEDYR+PA+PALTKTLLEDVKK+FKTT+G
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRAPAIPALTKTLLEDVKKLFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPF+IPTTGTGAWESALTNTLSPGD IVSFLIGQFSLLWIDQQQRL F VDV+ESEWGQG
Sbjct  61    TPFIIPTTGTGAWESALTNTLSPGDTIVSFLIGQFSLLWIDQQQRLKFKVDVIESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLD LASKLA D  HTIKA+CIVHNETATGVTNNLA VRKLLD Y HPALLLVDGVSSI
Sbjct  121   ANLDELASKLAADRTHTIKAVCIVHNETATGVTNNLAAVRKLLDDYNHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWG+DVALTGSQKALS+PTG+G +CASPKALEASKTA+S RVFFDW DYLKF
Sbjct  181   CALDFRMDEWGIDVALTGSQKALSMPTGMGFICASPKALEASKTAQSARVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQ+LYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKIGTYWPYTPSIQMLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW SDTVTAVVVP YIDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWHSDTVTAVVVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCL+GVEMVLKD+GYPVKLGSGVAAA+ YLQN+TPMIPSRI
Sbjct  361   GCLSGVEMVLKDVGYPVKLGSGVAAAATYLQNSTPMIPSRI  401



>gb|ACJ61246.1| serine glyoxylate aminotransferase 2 [Glycine max]
Length=401

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/401 (88%), Positives = 383/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKT +G
Sbjct  1     MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTITG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
              PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61    IPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A LDVL SK+A DT+HTIKAICI HNETATGVTN+LA VR++LD Y+HPALL+VDGVSSI
Sbjct  121   AKLDVLESKIASDTSHTIKAICIAHNETATGVTNDLAKVRQILDSYRHPALLIVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASK AKS+RVFFDWKDYLKF
Sbjct  181   CALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLL
Sbjct  301   EEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPSRI  401



>ref|NP_001276276.1| serine--glyoxylate aminotransferase-like [Glycine max]
 gb|ACU18294.1| unknown [Glycine max]
Length=401

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/401 (88%), Positives = 383/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKT +G
Sbjct  1     MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTITG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
              PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61    IPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A LDVL SK+A DT+HTIKAICIVHNETATGVTN+LA VR++LD Y+HPALL+VDGVSSI
Sbjct  121   AKLDVLESKIASDTSHTIKAICIVHNETATGVTNDLAKVRQILDSYRHPALLIVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASK AKS+RVFFDWKDYLKF
Sbjct  181   CALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCL GVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPSRI
Sbjct  361   GCLTGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSRI  401



>gb|KHN28521.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/401 (88%), Positives = 384/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY NAPGRNHLFVPGPVNIPDQ+IRAM RNNEDYRSPA+PA+TKTLLEDVKKIFKT +G
Sbjct  1     MDYFNAPGRNHLFVPGPVNIPDQIIRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTITG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
              PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQG
Sbjct  61    IPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A LDVL SK+A DT+HTIKAICIVHNETATGVTN+LA VR++LD Y+HPALL+VDGVSSI
Sbjct  121   AKLDVLESKIASDTSHTIKAICIVHNETATGVTNDLAKVRQILDSYRHPALLIVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASK AKS+RVFFDWKD+LKF
Sbjct  181   CALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDHLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSRI  401



>gb|ABQ81925.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/401 (89%), Positives = 381/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61    TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A LDVLA+KLA DT HTIKA+CIVHNETATGVTN+L+ VR++LD Y+HPAL LVDGVSSI
Sbjct  121   AKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLSLVRRILDEYRHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMD+WGVDVALTGSQK LSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYLKF
Sbjct  181   CALDFRMDDWGVDVALTGSQKVLSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW SDTVTAVVVP Y+DS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWHSDTVTAVVVPPYMDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>ref|XP_002313371.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE87326.1| aminotransferase 2 family protein [Populus trichocarpa]
Length=401

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/401 (89%), Positives = 377/401 (94%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY   PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1     MDYFYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
              PFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61    IPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLGFNVDVVESDWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLD+LASKLAEDTAHTIKA+CIVHNETATGVTNNLA VRK+LD Y HPAL LVDGVSSI
Sbjct  121   ANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLAKVRKILDDYSHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKA+EASKTAKSVRVFFDWKDYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASKTAKSVRVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YNLGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHARLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAVVVP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVVVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SR+
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRV  401



>gb|ABQ81924.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/401 (89%), Positives = 381/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPF  PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61    TPFSFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A LDVLA+KLA DT HTIKA+CIVHNETATGVTN+L+ VR++LD Y+HPAL LVDGVSSI
Sbjct  121   AKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLSLVRRILDEYRHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYLKF
Sbjct  181   CALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>ref|NP_001284445.1| serine--glyoxylate aminotransferase-like [Cucumis melo]
 gb|ABQ81923.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/401 (89%), Positives = 381/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61    TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A LDVLA+KLA DT HTIKA+CIVHNETATGVTN+L+ VR++LD Y+HPAL LVDGV SI
Sbjct  121   AKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLSLVRRILDEYRHPALFLVDGVPSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYLKF
Sbjct  181   CALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>dbj|BAJ33858.1| unnamed protein product [Thellungiella halophila]
Length=438

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/402 (88%), Positives = 383/402 (95%), Gaps = 0/402 (0%)
 Frame = -3

Query  1341  KMDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTS  1162
             KMDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTS
Sbjct  37    KMDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTS  96

Query  1161  GTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQ  982
             GTPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQ
Sbjct  97    GTPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQ  156

Query  981   GANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSS  802
             GANL VLASKL++D  H+IKAICIVHNETATGVTN+++ VR LLDHY+HPALLLVDGVSS
Sbjct  157   GANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSS  216

Query  801   ICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLK  622
             ICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLK
Sbjct  217   ICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLK  276

Query  621   FYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQ  442
             FYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQ
Sbjct  277   FYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQ  336

Query  441   KEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQL  262
             KEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQL
Sbjct  337   KEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQL  396

Query  261   LGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             LGCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  397   LGCLAGVEMILKDVGYPVVLGSGVAAASTYLQHHIPLIPSRI  438



>ref|XP_011032100.1| PREDICTED: serine--glyoxylate aminotransferase-like [Populus 
euphratica]
Length=401

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/401 (89%), Positives = 378/401 (94%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY   PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1     MDYFYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
              PFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61    IPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLGFNVDVVESDWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLD+LASKLAEDTAHTIKA+CIVHNETATGVTNNLA VRK+LD Y HPAL+LVDGVSSI
Sbjct  121   ANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLAKVRKILDDYSHPALVLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKA+EASKTAKSVRVFFDWKDYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASKTAKSVRVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YNLGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHARLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SR+
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRV  401



>ref|XP_006659561.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Oryza brachyantha]
 ref|XP_006659562.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Oryza brachyantha]
 ref|XP_006659563.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Oryza brachyantha]
Length=402

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/400 (90%), Positives = 379/400 (95%), Gaps = 0/400 (0%)
 Frame = -3

Query  1335  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  1156
             DY   PGRNHLFVPGPVNIPDQVIRAM R NEDYRSPAVPALTKTLLEDVK+IFKTT+GT
Sbjct  3     DYAYGPGRNHLFVPGPVNIPDQVIRAMNRQNEDYRSPAVPALTKTLLEDVKQIFKTTTGT  62

Query  1155  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  976
             PFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDVVES+WGQGA
Sbjct  63    PFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVVESDWGQGA  122

Query  975   NLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSIC  796
             +L  L  KL  D +HTIKAICIVHNETATGVTN+L+ VRKLLD ++HPALLLVDGVSSIC
Sbjct  123   DLAALDYKLRGDPSHTIKAICIVHNETATGVTNDLSAVRKLLDKHRHPALLLVDGVSSIC  182

Query  795   AIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFY  616
             A+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFY
Sbjct  183   AVDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWADYLKFY  242

Query  615   KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  436
             KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RHTRLGTATRLAV+AWGLKNCTQKE
Sbjct  243   KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIKRHTRLGTATRLAVEAWGLKNCTQKE  302

Query  435   EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  256
             EWFSDTVTAVVVPSYIDSSEIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLG
Sbjct  303   EWFSDTVTAVVVPSYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLG  362

Query  255   CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             CL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  363   CLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>gb|AAL62332.1|AF461048_1 aminotransferase 2 [Cucumis melo]
Length=401

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/401 (89%), Positives = 380/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ESEWG+G
Sbjct  61    TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESEWGEG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A LDVLA+KLA DT HTIKA+CIVHNETATGVTN+L+ VR++L  Y+HPAL LVDGVSSI
Sbjct  121   AKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLSLVRRILHEYRHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYLKF
Sbjct  181   CALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y +GTYWPYTPSIQLLYGLR  LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YNLGTYWPYTPSIQLLYGLRPALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>ref|XP_009410322.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410323.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/401 (89%), Positives = 383/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MD+  APGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1     MDFFYAPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGD+IVSFLIGQFSLLWIDQQQRLNFNVDV+ESEWG+G
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDKIVSFLIGQFSLLWIDQQQRLNFNVDVIESEWGRG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A+LD LASKLA D +H+IKA+CIVHNETATGVTNNLATVRKLLD + HPALLLVDGVSSI
Sbjct  121   ADLDALASKLAADWSHSIKAVCIVHNETATGVTNNLATVRKLLDEHNHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CAIDFRMDEWGVDVALTGSQKALS+PTG+GIVCASPKALEA+K+AKSVRVFFDW DYLKF
Sbjct  181   CAIDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPKALEAAKSAKSVRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YKMGTYWPYTPSIQLLYG RA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKMGTYWPYTPSIQLLYGFRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAV+VP +I+SS++VKRAW RYNLSLGLGLNKVAGKVFRIGHLGNLN+LQLL
Sbjct  301   EEWFSDTVTAVMVPPHINSSDVVKRAWTRYNLSLGLGLNKVAGKVFRIGHLGNLNDLQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCL+GVEMVL+D+GY VKLGSGVAAA+AYLQNT PMI SRI
Sbjct  361   GCLSGVEMVLRDVGYQVKLGSGVAAAAAYLQNTIPMISSRI  401



>ref|XP_006409690.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
 gb|ESQ51143.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
Length=401

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/401 (88%), Positives = 382/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61    TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANL VLASKL++D  H+IKAICIVHNETATGVTN+++ VR LLDHY+HPALLLVDGVSSI
Sbjct  121   ANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  361   GCLAGVEMILKDVGYPVVLGSGVAAASTYLQHHIPLIPSRI  401



>ref|XP_004140203.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN48108.1| Aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/401 (88%), Positives = 381/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNF VDV+ES+WG+G
Sbjct  61    TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFKVDVIESDWGEG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A LDVLA+KLA DT HTIKA+CIVHNETATGVTN+L+ VR++LD Y+HPAL LVDGVSSI
Sbjct  121   AKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLSLVRRILDEYRHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYLKF
Sbjct  181   CALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW SDTVTAV+VP YIDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLL
Sbjct  301   EEWHSDTVTAVLVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAAS+Y QN  P+IPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAASSYFQNNIPLIPSRI  401



>emb|CDY37208.1| BnaA09g08290D [Brassica napus]
Length=401

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/401 (88%), Positives = 382/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61    TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANL VLASKL++D  HTIKAICIVHNETATGVTN+++ VR +LDHY+HPALLLVDGVSSI
Sbjct  121   ANLQVLASKLSQDQNHTIKAICIVHNETATGVTNDISAVRTILDHYKHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPSRI
Sbjct  361   GCLAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPSRI  401



>emb|CDX81443.1| BnaC09g08540D [Brassica napus]
Length=401

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/401 (88%), Positives = 382/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY+N PGR+HLFVPGPVNIP+QV+RAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYMNGPGRHHLFVPGPVNIPEQVVRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61    TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANL VLASKL++D  HTIKAICIVHNETATGVTN+++ VR +LDHY+HPALLLVDGVSSI
Sbjct  121   ANLQVLASKLSQDQNHTIKAICIVHNETATGVTNDISAVRTILDHYKHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPSRI
Sbjct  361   GCLAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPSRI  401



>ref|XP_009112244.1| PREDICTED: serine--glyoxylate aminotransferase [Brassica rapa]
Length=401

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/401 (88%), Positives = 382/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61    TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANL VLA+KL++D  HTIKAICIVHNETATGVTN+++ VR +LDHY+HPALLLVDGVSSI
Sbjct  121   ANLQVLAAKLSQDQNHTIKAICIVHNETATGVTNDISAVRTILDHYKHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPSRI
Sbjct  361   GCLAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPSRI  401



>gb|ABK96624.1| unknown [Populus trichocarpa x Populus deltoides]
Length=401

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/401 (89%), Positives = 375/401 (94%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY   PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1     MDYFYGPGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
              PFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61    IPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQQRLGFNVDVVESDWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             AN D+LASKLAEDTAHTIKA+CIVHNETATGVTNNLA VRK+LD Y HPAL LVDGVSSI
Sbjct  121   ANFDILASKLAEDTAHTIKAVCIVHNETATGVTNNLAKVRKILDDYSHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKA+EASKTAKSVRVFFDWKDYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASKTAKSVRVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH R G ATRLAV+AWGLKNCTQK
Sbjct  241   YNLGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHARPGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAVVVP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWFSDTVTAVVVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SR+
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRV  401



>dbj|BAJ90006.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90413.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95504.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95684.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/401 (90%), Positives = 380/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY+N PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1     MDYMNGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFL PTTGTGAWESALTNTLSPGDRIVSF +GQFSLLWIDQQQRL F+VDVVES+WG G
Sbjct  61    TPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFSVDVVESDWGYG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A+L VL SKL  D+ HTIKAICIVHNETATGVTN+L  VRKLLD Y+HPALLLVDGVSSI
Sbjct  121   ADLGVLESKLRSDSQHTIKAICIVHNETATGVTNDLHAVRKLLDAYRHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDWKDYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVI RHTRLGTATRLAV AWGLKNCT+K
Sbjct  241   YKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKNCTEK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EE FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLL
Sbjct  301   EENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCL GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  361   GCLGGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  401



>ref|XP_010673724.1| PREDICTED: serine--glyoxylate aminotransferase [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/401 (87%), Positives = 384/401 (96%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1     MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQ+RL FNVDV+ESEWG+G
Sbjct  61    TPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQKRLGFNVDVIESEWGRG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A+L+ ++SK+A DTAHT+KAICIVHNETATGVTNNLATVR++LDHY HPALLLVDGVSSI
Sbjct  121   ADLEAMSSKIAADTAHTVKAICIVHNETATGVTNNLATVRRILDHYNHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFR DEWGVDVALTGSQKALSLPTG+GI+ ASPKALEA+KTAKSVRVFFDW DYLKF
Sbjct  181   CALDFRQDEWGVDVALTGSQKALSLPTGMGIISASPKALEATKTAKSVRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAVVVP +IDS+E+VKRAW+RYN+SLGLGLNKVAGKVFRIGHLGN+NELQLL
Sbjct  301   EEWFSDTVTAVVVPPHIDSNEVVKRAWRRYNMSLGLGLNKVAGKVFRIGHLGNINELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             G LAGVEM+LKD+GYPVKLGSGVAAA+AYLQN+TPMI SRI
Sbjct  361   GALAGVEMILKDVGYPVKLGSGVAAAAAYLQNSTPMITSRI  401



>ref|XP_009136209.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 ref|XP_009136210.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 emb|CDX93112.1| BnaA03g38340D [Brassica napus]
Length=401

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/401 (88%), Positives = 382/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVES+WGQG
Sbjct  61    TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANL VLASKL++D  H+IKAICIVHNETATGVTN+++ VR LLDHY+HPALLLVDGVSSI
Sbjct  121   ANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW S+TVTAV+VP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLL
Sbjct  301   EEWISNTVTAVMVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  361   GCLAGVEMILKDVGYPVVLGSGVAAASTYLQHQIPLIPSRI  401



>gb|AAQ56193.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/401 (88%), Positives = 380/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGRNHLFVPGPVNIP+QV+RAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             T FL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWID+QQRLNF VDV+ESEWG+G
Sbjct  61    TLFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDRQQRLNFKVDVIESEWGEG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A LDVLA+KLA DT HTIKA+CIVHNETATGVTN+L+ VR++LD Y+HPAL LVDGVSSI
Sbjct  121   AKLDVLAAKLAADTDHTIKAVCIVHNETATGVTNDLSLVRRILDEYRHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMD+WGV VALTGSQKALSLPTG+GIVCASP+ALEASKTAKS+RVFFDWKDYLKF
Sbjct  181   CALDFRMDDWGVGVALTGSQKALSLPTGVGIVCASPRALEASKTAKSLRVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  361   GCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>emb|CDX89604.1| BnaC03g45180D [Brassica napus]
Length=401

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/401 (87%), Positives = 382/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY+N PGR+HLFVPGPVNIP+QVIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYMNGPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPF+ PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVES+WGQG
Sbjct  61    TPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANL VLASKL++D  H+IKAICIVHNETATGVTN+++ VR LLDHY+HPALLLVDGVSSI
Sbjct  121   ANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW S+TVTAV+VP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLL
Sbjct  301   EEWISNTVTAVMVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  361   GCLAGVEMILKDVGYPVVLGSGVAAASTYLQHQIPLIPSRI  401



>gb|EMS66805.1| Serine--glyoxylate aminotransferase [Triticum urartu]
Length=401

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/401 (90%), Positives = 378/401 (94%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY+N PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1     MDYMNGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFL PTTGTGAWESALTNTLSPGDRIVSF +GQFSLLWIDQQQRL F+VDVVES+WG G
Sbjct  61    TPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLGFSVDVVESDWGYG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A+L  L SKL  D+ HTIKAICIVHNETATGVTN+L  VRKLLD Y+HPALLLVDGVSSI
Sbjct  121   ADLGALESKLRTDSQHTIKAICIVHNETATGVTNDLHAVRKLLDAYRHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDWKDYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVI RHTRLGTATRLAV AWGLKNCT K
Sbjct  241   YKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKNCTAK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EE FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLL
Sbjct  301   EENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCL GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  361   GCLGGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  401



>ref|NP_001062170.1| Os08g0502700 [Oryza sativa Japonica Group]
 dbj|BAD08917.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAD09269.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF24084.1| Os08g0502700 [Oryza sativa Japonica Group]
 gb|EAZ07527.1| hypothetical protein OsI_29783 [Oryza sativa Indica Group]
 gb|EAZ43252.1| hypothetical protein OsJ_27850 [Oryza sativa Japonica Group]
 dbj|BAG89198.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89373.1| unnamed protein product [Oryza sativa Japonica Group]
Length=402

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/400 (88%), Positives = 379/400 (95%), Gaps = 0/400 (0%)
 Frame = -3

Query  1335  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  1156
             DYV  PGRNHLFVPGPVNIPDQVIRAM+R NEDYRSPAVPALTKTLLEDVK+IFKTT+GT
Sbjct  3     DYVYGPGRNHLFVPGPVNIPDQVIRAMSRQNEDYRSPAVPALTKTLLEDVKQIFKTTTGT  62

Query  1155  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  976
             PFL PTTGTGAWESALTNTLSPGD+IVSFLIGQFSLLWIDQQQRLNFNVDVVES+WG GA
Sbjct  63    PFLFPTTGTGAWESALTNTLSPGDKIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGYGA  122

Query  975   NLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSIC  796
             +L  L  KL +D +H+IKAICIVHNETATGVTN+L+ VRK+LD ++HPALLLVDGVSSIC
Sbjct  123   DLAALDYKLRQDPSHSIKAICIVHNETATGVTNDLSAVRKILDKHRHPALLLVDGVSSIC  182

Query  795   AIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFY  616
             A+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDYLKFY
Sbjct  183   ALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWKDYLKFY  242

Query  615   KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  436
             KMGTYWPYTPSIQLLYGLR  LDL+FEEGL+NVI RH RLGTATRLAV+AWGLKNCTQKE
Sbjct  243   KMGTYWPYTPSIQLLYGLRTALDLIFEEGLENVIKRHNRLGTATRLAVEAWGLKNCTQKE  302

Query  435   EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  256
             EWFSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQL+G
Sbjct  303   EWFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLMG  362

Query  255   CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
              L+GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  363   ALSGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>ref|XP_003574732.2| PREDICTED: serine--glyoxylate aminotransferase [Brachypodium 
distachyon]
Length=461

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/405 (89%), Positives = 382/405 (94%), Gaps = 0/405 (0%)
 Frame = -3

Query  1350  EGEKMDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFK  1171
             E  KMDYV  PGRNHLFVPGPVNIPD VIRAM+R NEDYRSPAVPALTKTLLEDVKKIFK
Sbjct  57    ENSKMDYVYGPGRNHLFVPGPVNIPDPVIRAMSRQNEDYRSPAVPALTKTLLEDVKKIFK  116

Query  1170  TTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESE  991
             TT+GTPFL PTTGTGAWESALTNTLSPGDRIVSF +GQFSLLWIDQQQRLNF VDVVES+
Sbjct  117   TTTGTPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLNFQVDVVESD  176

Query  990   WGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDG  811
             WG GA+L  L +KL++D AHTIKA+CIVHNETATGVTN+L  VRKLLD Y+HPALLLVDG
Sbjct  177   WGHGADLGALETKLSQDAAHTIKAVCIVHNETATGVTNDLHAVRKLLDAYRHPALLLVDG  236

Query  810   VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  631
             VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASP+ALEASKTAKSVRVFFDWKD
Sbjct  237   VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPRALEASKTAKSVRVFFDWKD  296

Query  630   YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  451
             YLKFYKMGTYWPYTPSIQLLYGLRAGLDL+FEEGLDNVI RHTRLGTATR+AV+AWGLKN
Sbjct  297   YLKFYKMGTYWPYTPSIQLLYGLRAGLDLIFEEGLDNVIKRHTRLGTATRMAVEAWGLKN  356

Query  450   CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  271
             CTQKEE FSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  357   CTQKEENFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  416

Query  270   LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             LQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N TP+IPSRI
Sbjct  417   LQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNATPLIPSRI  461



>ref|XP_010518509.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518516.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518525.1| PREDICTED: serine--glyoxylate aminotransferase isoform X2 [Camelina 
sativa]
Length=401

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/401 (86%), Positives = 380/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61    TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANL VLASKL++D  H+IKAICIVHNETATGVTN+++ VR LLDHY+HPALLLVDGVSSI
Sbjct  121   ANLQVLASKLSQDENHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNK+AGKVFRIGHLGN+NELQLL
Sbjct  301   EEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKIAGKVFRIGHLGNVNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPV +GSGVAAAS YLQN  P+IPSRI
Sbjct  361   GCLAGVEMILKDVGYPVVMGSGVAAASTYLQNHIPLIPSRI  401



>ref|XP_010488837.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=401

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/401 (86%), Positives = 380/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61    TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANL VLASKL++D  H+IKAICIVHNETATGVTN+++ VR LLDHY+HPALLLVDGVSSI
Sbjct  121   ANLQVLASKLSQDENHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNK+AGKVFRIGHLGN+NELQLL
Sbjct  301   EEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKIAGKVFRIGHLGNVNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P+IPSRI
Sbjct  361   GCLAGVEMILKDVGYPIVMGSGVAAASTYLQNHIPLIPSRI  401



>ref|XP_004973838.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Setaria italica]
 ref|XP_004973839.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Setaria italica]
Length=402

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/400 (89%), Positives = 376/400 (94%), Gaps = 0/400 (0%)
 Frame = -3

Query  1335  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  1156
             DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVP LTK LLEDVKKIFKTT+GT
Sbjct  3     DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPVLTKILLEDVKKIFKTTTGT  62

Query  1155  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  976
             PF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WG+GA
Sbjct  63    PFIIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLGFNVDVVESDWGRGA  122

Query  975   NLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSIC  796
             +LDVL +KL +DTAHTIKAI IVHNETATGVTN+LATVRKLLD Y+HPAL+LVDGVSSIC
Sbjct  123   DLDVLEAKLRQDTAHTIKAIAIVHNETATGVTNDLATVRKLLDTYRHPALILVDGVSSIC  182

Query  795   AIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFY  616
             A+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASPKALEASKTAKSVRVFFDW DYLK Y
Sbjct  183   ALDFRMDEWGVDVALTGSQKALSMPTGLGIVCASPKALEASKTAKSVRVFFDWNDYLKSY  242

Query  615   KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  436
             K+G+YWPYTPSIQLLYGLRA LDLLF EGLDNV  RH RLGTATRLAV+AWGLKNCTQKE
Sbjct  243   KIGSYWPYTPSIQLLYGLRAALDLLFLEGLDNVFKRHKRLGTATRLAVEAWGLKNCTQKE  302

Query  435   EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  256
             EWFSDTVTAVVVP YIDS EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  303   EWFSDTVTAVVVPPYIDSGEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  362

Query  255   CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             CL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  363   CLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>ref|XP_002279236.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
 ref|XP_010651495.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
Length=401

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/401 (86%), Positives = 376/401 (94%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MD   APG NHLFVPGPVNIPD VIRAM RNNEDYR+P +PALTK LLEDVKKIFKTT+G
Sbjct  1     MDRYFAPGTNHLFVPGPVNIPDHVIRAMNRNNEDYRAPPIPALTKDLLEDVKKIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQ+RL FNVDV+ESEWGQG
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLRFNVDVIESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANL++LA K+A D AHTIKA+CIVHNETATGVTNNLA VR++LD Y+HPAL LVDGVSSI
Sbjct  121   ANLEILAEKIAADRAHTIKAVCIVHNETATGVTNNLAAVRRILDEYRHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCA PKALEASK+A+SVR FFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAGPKALEASKSAQSVRFFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GT+WPYTPSIQLLYG+RA LD++FEEGLDNVI RH+RLG ATRLAV+AWGLKNCTQ+
Sbjct  241   YKLGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHSRLGKATRLAVEAWGLKNCTQR  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LN++QLL
Sbjct  301   EEWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNDVQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPSRI
Sbjct  361   GCLAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPSRI  401



>ref|NP_178969.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 ref|NP_849951.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q56YA5.2|SGAT_ARATH RecName: Full=Serine--glyoxylate aminotransferase; AltName: Full=Alanine--glyoxylate 
aminotransferase; Short=AGT; AltName: 
Full=Asparagine aminotransferase; AltName: Full=Serine--pyruvate 
aminotransferase [Arabidopsis thaliana]
 gb|AAC26854.1| alanine:glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAD28669.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAB20811.1| serine glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM20136.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM45058.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06227.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06228.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
Length=401

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/401 (86%), Positives = 380/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVES+WGQG
Sbjct  61    TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANL VLASKL++D  HTIKAICIVHNETATGVTN+++ VR LLDHY+HPALLLVDGVSSI
Sbjct  121   ANLQVLASKLSQDENHTIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLGN+NELQLL
Sbjct  301   EEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+IPSRI
Sbjct  361   GCLAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLIPSRI  401



>ref|XP_002885871.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62130.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/401 (87%), Positives = 380/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61    TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANL VLASKL++D  HTIKAICIVHNETATGVTN+++ VR LLDHY+HPALLLVDGVSSI
Sbjct  121   ANLQVLASKLSQDENHTIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IAR+ RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARNARLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW S+TVTAV+VP +ID SEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLL
Sbjct  301   EEWISNTVTAVMVPPHIDGSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+IPSRI
Sbjct  361   GCLAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLIPSRI  401



>ref|XP_004973837.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Setaria italica]
Length=437

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/400 (89%), Positives = 376/400 (94%), Gaps = 0/400 (0%)
 Frame = -3

Query  1335  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  1156
             DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVP LTK LLEDVKKIFKTT+GT
Sbjct  38    DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPVLTKILLEDVKKIFKTTTGT  97

Query  1155  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  976
             PF+IPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WG+GA
Sbjct  98    PFIIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLGFNVDVVESDWGRGA  157

Query  975   NLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSIC  796
             +LDVL +KL +DTAHTIKAI IVHNETATGVTN+LATVRKLLD Y+HPAL+LVDGVSSIC
Sbjct  158   DLDVLEAKLRQDTAHTIKAIAIVHNETATGVTNDLATVRKLLDTYRHPALILVDGVSSIC  217

Query  795   AIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFY  616
             A+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASPKALEASKTAKSVRVFFDW DYLK Y
Sbjct  218   ALDFRMDEWGVDVALTGSQKALSMPTGLGIVCASPKALEASKTAKSVRVFFDWNDYLKSY  277

Query  615   KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  436
             K+G+YWPYTPSIQLLYGLRA LDLLF EGLDNV  RH RLGTATRLAV+AWGLKNCTQKE
Sbjct  278   KIGSYWPYTPSIQLLYGLRAALDLLFLEGLDNVFKRHKRLGTATRLAVEAWGLKNCTQKE  337

Query  435   EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  256
             EWFSDTVTAVVVP YIDS EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  338   EWFSDTVTAVVVPPYIDSGEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  397

Query  255   CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             CL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  398   CLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  437



>emb|CAN84001.1| hypothetical protein VITISV_007680 [Vitis vinifera]
Length=401

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/401 (86%), Positives = 374/401 (93%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MD   APG NHLFVPGPVNIPD VIRAM RNNEDYR+P +PALTK LLEDVKKIFKTT+G
Sbjct  1     MDRYFAPGTNHLFVPGPVNIPDHVIRAMNRNNEDYRAPPIPALTKDLLEDVKKIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQQ+RL FNVDV+ESEWGQG
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLRFNVDVIESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANL++LA K+A D AHTIKA+CIVHNETATGVTNNLA VR++LD Y HPAL LVDGVSSI
Sbjct  121   ANLEILAEKIAADRAHTIKAVCIVHNETATGVTNNLAAVRRILDEYXHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCA PKALEASK A+SVR FFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAGPKALEASKXAQSVRFFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GT+WPYTPSIQLLYG+RA LD++FEEGLDNVI RH+RLG ATRLAV+AWGLKNCTQ+
Sbjct  241   YKLGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHSRLGKATRLAVEAWGLKNCTQR  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LN++QLL
Sbjct  301   EEWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNDVQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPSRI
Sbjct  361   GCLAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPSRI  401



>ref|XP_006297832.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
 gb|EOA30730.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
Length=401

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/401 (86%), Positives = 379/401 (95%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVES+WGQG
Sbjct  61    TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANL VLASKL+ED +H+IKAICIVHNETATGVTN+++ VR LLDHY+HPALLLVDGVSSI
Sbjct  121   ANLQVLASKLSEDASHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW S+TVTAV+VP  ID SE+V+RAW+RYNLSLGLGLNKVAGKVFRIGHLGN+NELQLL
Sbjct  301   EEWISNTVTAVMVPPNIDGSEVVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P+I SRI
Sbjct  361   GCLAGVEMILKDVGYPIVMGSGVAAASTYLQNHIPLILSRI  401



>ref|XP_002444789.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
 gb|EES14284.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
Length=402

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/400 (87%), Positives = 370/400 (93%), Gaps = 0/400 (0%)
 Frame = -3

Query  1335  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  1156
             DYV  PGRNHLFVPGPVNIPD VIRAM R NEDYRSPA+PALTK LLEDVK+IFKTT+GT
Sbjct  3     DYVYGPGRNHLFVPGPVNIPDPVIRAMNRQNEDYRSPAIPALTKVLLEDVKRIFKTTTGT  62

Query  1155  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  976
             PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL F+VDVVES+WG GA
Sbjct  63    PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLGFDVDVVESDWGHGA  122

Query  975   NLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSIC  796
             +LD L  KL +DT HTIKA+ IVHNETATGVTN+LA VR LLD Y HPALLLVDGVSSIC
Sbjct  123   DLDALERKLRDDTLHTIKAVAIVHNETATGVTNDLAAVRTLLDAYAHPALLLVDGVSSIC  182

Query  795   AIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFY  616
             A+DFRMDEWGVDVALTGSQKALS+PTG+GIVCAS KALEASK A+SVRVFFDWKDYL+FY
Sbjct  183   ALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASSKALEASKAARSVRVFFDWKDYLRFY  242

Query  615   KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  436
             +MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATR AV+AWGLKNC QKE
Sbjct  243   EMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVKRHNRLGTATRFAVEAWGLKNCCQKE  302

Query  435   EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  256
             E FSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  303   ECFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  362

Query  255   CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             CL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  363   CLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>ref|XP_010467178.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=454

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/395 (86%), Positives = 374/395 (95%), Gaps = 0/395 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY+  PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSG
Sbjct  1     MDYMYGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFL PTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQ+RLNFNVDVVESEWGQG
Sbjct  61    TPFLFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANL VLASKL++D  H+IKAICIVHNETATGVTN+++ VR LLDHY+HPALLLVDGVSSI
Sbjct  121   ANLQVLASKLSQDENHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNK+AGKVFRIGHLGN+NELQLL
Sbjct  301   EEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKIAGKVFRIGHLGNVNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
             GCLAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P
Sbjct  361   GCLAGVEMILKDVGYPIVMGSGVAAASTYLQNHIP  395



>ref|NP_001148339.1| LOC100281949 [Zea mays]
 ref|XP_008675752.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 ref|XP_008675758.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 gb|ACG30854.1| serine--glyoxylate aminotransferase [Zea mays]
 gb|ACN28633.1| unknown [Zea mays]
 tpg|DAA47859.1| TPA: Serine--glyoxylate aminotransferase isoform 1 [Zea mays]
 tpg|DAA47860.1| TPA: Serine--glyoxylate aminotransferase isoform 2 [Zea mays]
 tpg|DAA47861.1| TPA: Serine--glyoxylate aminotransferase isoform 3 [Zea mays]
 tpg|DAA47862.1| TPA: Serine--glyoxylate aminotransferase isoform 4 [Zea mays]
Length=403

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/401 (85%), Positives = 366/401 (91%), Gaps = 1/401 (0%)
 Frame = -3

Query  1335  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  1156
             DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GT
Sbjct  3     DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGT  62

Query  1155  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  976
             PF+IPTTGTGAWESALTNTLSPGDR+VSFLIGQFSLLWIDQQ+RL F+VD VESEWGQGA
Sbjct  63    PFMIPTTGTGAWESALTNTLSPGDRVVSFLIGQFSLLWIDQQRRLGFDVDAVESEWGQGA  122

Query  975   NLDVLASKLAEDTA-HTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             +L  L  +L ED   H IKA+ IVHNETATGVTN+LA VR LLD + HPALLLVDGVSSI
Sbjct  123   DLAALERRLREDAPRHAIKAVAIVHNETATGVTNDLAAVRALLDKHAHPALLLVDGVSSI  182

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKDYL+F
Sbjct  183   CALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKDYLRF  242

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QK
Sbjct  243   YDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQK  302

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  303   EEWFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  362

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  363   GCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  403



>gb|ABF70331.1| aminotransferase 1 [Cucumis sativus]
Length=386

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/385 (89%), Positives = 364/385 (95%), Gaps = 0/385 (0%)
 Frame = -3

Query  1317  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  1138
             GR +  VPGPVNIP+ V+RAM RNNEDYRSPAVPALTKTLLEDVKKIFK+T+GT FLIPT
Sbjct  1     GRGNSIVPGPVNIPEPVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKSTAGTTFLIPT  60

Query  1137  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  958
             TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES+WGQGANLDVL 
Sbjct  61    TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESDWGQGANLDVLE  120

Query  957   SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFRM  778
             SKLA D   TIKAICIVHNETATGVTN+L+ VR LLD Y+HPALLLVDGVSSICA+DFRM
Sbjct  121   SKLAADGGQTIKAICIVHNETATGVTNDLSKVRFLLDKYKHPALLLVDGVSSICALDFRM  180

Query  777   DEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYW  598
             DEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKT+KSV+VFFDWKDYLKFY +GTYW
Sbjct  181   DEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDYLKFYNLGTYW  240

Query  597   PYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDT  418
             PYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATR AV+AWGLKNCTQKEEWFSDT
Sbjct  241   PYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRPAVEAWGLKNCTQKEEWFSDT  300

Query  417   VTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVE  238
             VTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVE
Sbjct  301   VTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVE  360

Query  237   MVLKDIGYPVKLGSGVAAASAYLQN  163
             M+LKD+GYPVKLGSGVAAAS  L N
Sbjct  361   MILKDVGYPVKLGSGVAAASESLVN  385



>gb|AEX09255.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/362 (91%), Positives = 351/362 (97%), Gaps = 0/362 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPAVPALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAVPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AHTIKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHTIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTP  360

Query  153   MI  148
             +I
Sbjct  361   LI  362



>gb|ACN39798.1| unknown [Picea sitchensis]
Length=401

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/401 (82%), Positives = 361/401 (90%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MD    PGRN LFVPGPVNIP+ V++AM RNNEDYR+P VPALTK LL DV KIFK+T+G
Sbjct  1     MDPFYGPGRNQLFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFL PTTGTGAWESALTNTLSP DRI+SF +GQFSLLWIDQ +RLNF+VDVV  EWG G
Sbjct  61    TPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
              +L++L +KL  D  H +KAIC VHNETATGVTNNLA +R ++D   HPAL LVDGVSS+
Sbjct  121   VDLEILRTKLEADKEHKVKAICCVHNETATGVTNNLAAIRTVIDDCMHPALFLVDGVSSV  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CAIDFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYLKF
Sbjct  181   CAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARHTRLG ATRLAV+AWGLKNCTQ+
Sbjct  241   YKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHTRLGRATRLAVEAWGLKNCTQR  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCL+GVEMVLKDIGYPVKLGSGVAAA+AYLQ TTP+I SR+
Sbjct  361   GCLSGVEMVLKDIGYPVKLGSGVAAAAAYLQMTTPLIASRV  401



>gb|ABK24112.1| unknown [Picea sitchensis]
Length=401

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/401 (82%), Positives = 360/401 (90%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MD    PGRN LFVPGPVNIP+ V+ AM RNNEDYR+P VPALTK LL DV KIFK+T+G
Sbjct  1     MDPFYGPGRNQLFVPGPVNIPEPVLHAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFL PTTGTGAWESALTNTLSP DRI+SF +GQFSLLWIDQ +RLNF+VDVV  EWG G
Sbjct  61    TPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
              +L++L +KL  D  H +KAIC VHNETATGVTNNLA +R ++D   HPAL LVDGVSS+
Sbjct  121   VDLEILRTKLEADKEHKVKAICCVHNETATGVTNNLAAIRTVIDDCMHPALFLVDGVSSV  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CAIDFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYLKF
Sbjct  181   CAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARHTRLG ATRLAV+AWGLKNCTQ+
Sbjct  241   YKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHTRLGRATRLAVEAWGLKNCTQR  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL
Sbjct  301   EEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCL+GVEMVLKDIGYPVKLGSGVAAA+AYLQ TTP+I SR+
Sbjct  361   GCLSGVEMVLKDIGYPVKLGSGVAAAAAYLQMTTPLIASRV  401



>gb|AEX09250.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=362

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/362 (91%), Positives = 352/362 (97%), Gaps = 0/362 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWG DVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGXDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH+RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTP  360

Query  153   MI  148
             +I
Sbjct  361   LI  362



>emb|CBI24214.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/374 (86%), Positives = 354/374 (95%), Gaps = 0/374 (0%)
 Frame = -3

Query  1257  MTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRI  1078
             M RNNEDYR+P +PALTK LLEDVKKIFKTT+GTPFLIPTTGTGAWESALTNTLSPGDR 
Sbjct  1     MNRNNEDYRAPPIPALTKDLLEDVKKIFKTTTGTPFLIPTTGTGAWESALTNTLSPGDRT  60

Query  1077  VSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNE  898
             VSFLIGQFSLLWIDQQ+RL FNVDV+ESEWGQGANL++LA K+A D AHTIKA+CIVHNE
Sbjct  61    VSFLIGQFSLLWIDQQKRLRFNVDVIESEWGQGANLEILAEKIAADRAHTIKAVCIVHNE  120

Query  897   TATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPT  718
             TATGVTNNLA VR++LD Y+HPAL LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPT
Sbjct  121   TATGVTNNLAAVRRILDEYRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPT  180

Query  717   GIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLF  538
             G+GIVCA PKALEASK+A+SVR FFDW DYLKFYK+GT+WPYTPSIQLLYG+RA LD++F
Sbjct  181   GMGIVCAGPKALEASKSAQSVRFFFDWNDYLKFYKLGTFWPYTPSIQLLYGMRAALDIIF  240

Query  537   EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAW  358
             EEGLDNVI RH+RLG ATRLAV+AWGLKNCTQ+EEWFSDTVTAVVVP YIDS+EIVKRAW
Sbjct  241   EEGLDNVIERHSRLGKATRLAVEAWGLKNCTQREEWFSDTVTAVVVPPYIDSTEIVKRAW  300

Query  357   KRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAAS  178
             KRYNLSLGLGLNKVAGKVFRIGHLG+LN++QLLGCLAGVEMVLKD+GYPVK+GSGV AAS
Sbjct  301   KRYNLSLGLGLNKVAGKVFRIGHLGHLNDVQLLGCLAGVEMVLKDVGYPVKMGSGVGAAS  360

Query  177   AYLQNTTPMIPSRI  136
             AYLQNT P+IPSRI
Sbjct  361   AYLQNTIPLIPSRI  374



>gb|AEX09273.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/362 (91%), Positives = 350/362 (97%), Gaps = 0/362 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA DTAH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDTAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTP  360

Query  153   MI  148
             +I
Sbjct  361   LI  362



>gb|EYU35937.1| hypothetical protein MIMGU_mgv1a026291mg, partial [Erythranthe 
guttata]
Length=359

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/359 (92%), Positives = 346/359 (96%), Gaps = 0/359 (0%)
 Frame = -3

Query  1212  LTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQ  1033
             LTK LLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWIDQ
Sbjct  1     LTKNLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQ  60

Query  1032  QQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKL  853
             QQRL FNVDVVES+WG GA+LD LASK+AEDTAHTIKA+CIVHNETATGVTNNLATVRK+
Sbjct  61    QQRLKFNVDVVESDWGAGADLDALASKIAEDTAHTIKAVCIVHNETATGVTNNLATVRKI  120

Query  852   LDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS  673
             LDHYQHPAL LVDGVSSICA+DFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEAS
Sbjct  121   LDHYQHPALFLVDGVSSICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEAS  180

Query  672   KTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLG  493
             KTA SVRVFFDW DYLKFYK+G+YWPYTPSIQLLYGLRA LDLLFEEGLDNVIARHTRL 
Sbjct  181   KTATSVRVFFDWNDYLKFYKLGSYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHTRLA  240

Query  492   TATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVA  313
              ATRLAV AWGLKNCTQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVA
Sbjct  241   KATRLAVDAWGLKNCTQKEEWFSDTVTAVIVPSYIDSAEIVRRAWKRYNLSLGLGLNKVA  300

Query  312   GKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYPV LGSGVAAASA+LQNTTP+IPSRI
Sbjct  301   GKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVTLGSGVAAASAFLQNTTPLIPSRI  359



>gb|AEX09293.1| alanine glyoxylate aminotransferase [Peperomia rupiseda]
Length=358

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/358 (91%), Positives = 348/358 (97%), Gaps = 0/358 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDRI+SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRIISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LDHY HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDHYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV++P YIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  160
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>gb|AEX09257.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
 gb|AEX09278.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
 gb|AEX09279.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=362

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/362 (90%), Positives = 350/362 (97%), Gaps = 0/362 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTP  360

Query  153   MI  148
             +I
Sbjct  361   LI  362



>gb|AEX09305.1| alanine glyoxylate aminotransferase [Peperomia pseudoverruculosa]
Length=362

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/362 (90%), Positives = 349/362 (96%), Gaps = 0/362 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+R WKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRGWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTP  360

Query  153   MI  148
             +I
Sbjct  361   LI  362



>gb|AEX09248.1| alanine glyoxylate aminotransferase [Peperomia questionis]
Length=360

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/360 (91%), Positives = 349/360 (97%), Gaps = 0/360 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AHTIKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHTIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTP  360



>gb|AEX09298.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/362 (90%), Positives = 349/362 (96%), Gaps = 0/362 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD++ HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNHNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTP  360

Query  153   MI  148
             +I
Sbjct  361   LI  362



>gb|AEX09275.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/362 (90%), Positives = 350/362 (97%), Gaps = 0/362 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQ+EE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQEEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTP  360

Query  153   MI  148
             +I
Sbjct  361   LI  362



>gb|AEX09253.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/362 (90%), Positives = 350/362 (97%), Gaps = 0/362 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGILCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTP  360

Query  153   MI  148
             +I
Sbjct  361   LI  362



>gb|AEX09311.1| alanine glyoxylate aminotransferase [Peperomia andina]
Length=362

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/362 (90%), Positives = 350/362 (97%), Gaps = 0/362 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRATLDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYI+S+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYINSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTP  360

Query  153   MI  148
             +I
Sbjct  361   LI  362



>gb|AEX09258.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/362 (90%), Positives = 349/362 (96%), Gaps = 0/362 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPAVPAL KTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAVPALAKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTP  360

Query  153   MI  148
             +I
Sbjct  361   LI  362



>gb|AEX09256.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/362 (91%), Positives = 349/362 (96%), Gaps = 0/362 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPAVPALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAVPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AHTIKAICIVH ETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDVAHTIKAICIVHXETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTP  360

Query  153   MI  148
             +I
Sbjct  361   LI  362



>gb|AEX09254.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/362 (90%), Positives = 350/362 (97%), Gaps = 0/362 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPAVPALTKTLLEDVKKIFKTTSGT F+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAVPALTKTLLEDVKKIFKTTSGTSFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA + AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASNAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTP  360

Query  153   MI  148
             +I
Sbjct  361   LI  362



>gb|AEX09299.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/362 (90%), Positives = 348/362 (96%), Gaps = 0/362 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSG PF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGAPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD++ HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNHNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTP  360

Query  153   MI  148
             +I
Sbjct  361   LI  362



>gb|AEX09270.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09296.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09297.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=362

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/362 (90%), Positives = 349/362 (96%), Gaps = 0/362 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTP  360

Query  153   MI  148
             +I
Sbjct  361   LI  362



>gb|AEX09300.1| alanine glyoxylate aminotransferase [Peperomia parvifolia]
Length=362

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/362 (90%), Positives = 349/362 (96%), Gaps = 0/362 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPAVPALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAVPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW D LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDNLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAW+RYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWERYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTP  360

Query  153   MI  148
             +I
Sbjct  361   LI  362



>ref|XP_003600160.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70411.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=408

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/360 (89%), Positives = 346/360 (96%), Gaps = 0/360 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYVN PGRNHLFVPGPVNIPDQVIRAM+RNNEDYRSPA+PALTKTLLEDVKKIFKTT+G
Sbjct  1     MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDRIVSF+IGQFSLLW+DQQQRL FNVDVVESEWG+G
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRIVSFVIGQFSLLWVDQQQRLKFNVDVVESEWGRG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A+LD+L SKLA D+AHTIKAICIVHNETATGVTNNLA VR+LLD YQHPALLLVDGVSSI
Sbjct  121   ADLDILESKLASDSAHTIKAICIVHNETATGVTNNLAKVRQLLDAYQHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVA+TGSQKALSLPTGIG V ASPKA+EASK+AKS+RVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPKAIEASKSAKSLRVFFDWSDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLGTATRLAV+AWGLKNCTQ+
Sbjct  241   YKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKNCTQE  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+ L+
Sbjct  301   EEWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEVTLI  360



>gb|AEX09306.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=362

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/362 (90%), Positives = 347/362 (96%), Gaps = 0/362 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDDYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
              RH RLG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLG
Sbjct  241   ERHARLGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTP  360

Query  153   MI  148
             +I
Sbjct  361   LI  362



>gb|AEX09249.1| alanine glyoxylate aminotransferase [Peperomia aff. gracillima 
JN-2011]
Length=358

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/358 (91%), Positives = 346/358 (97%), Gaps = 0/358 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AHTIKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHTIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  160
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>gb|AEX09267.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=362

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/362 (90%), Positives = 348/362 (96%), Gaps = 0/362 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL  +VDVVES+WG GANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGLDVDVVESDWGHGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGRATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTP  360

Query  153   MI  148
             +I
Sbjct  361   LI  362



>gb|AEX09286.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=358

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/358 (91%), Positives = 346/358 (97%), Gaps = 0/358 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGEATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  160
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>gb|AEX09276.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/362 (90%), Positives = 347/362 (96%), Gaps = 0/362 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTT G PF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTPGIPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGV NN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVANN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTP  360

Query  153   MI  148
             +I
Sbjct  361   LI  362



>gb|AEX09304.1| alanine glyoxylate aminotransferase [Peperomia chutanka]
Length=358

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/358 (91%), Positives = 345/358 (96%), Gaps = 0/358 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQ+RL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQERLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  160
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNT
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNT  358



>ref|XP_004491262.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/401 (80%), Positives = 364/401 (91%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PGR+HLFVPGP NIP+QVIRAM RNNE++R+PA+PALTK LL+DVKKIFKTTSG
Sbjct  1     MDYVYGPGRSHLFVPGPSNIPEQVIRAMNRNNENHRTPAIPALTKALLDDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
              PFLIP+TGTGAWESALTNTLSPGD+IVSFL+GQFSLLWI+QQ++LNF VDVVESEWGQ 
Sbjct  61    IPFLIPSTGTGAWESALTNTLSPGDQIVSFLMGQFSLLWIEQQKKLNFKVDVVESEWGQD  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A+LD L SKLA D +HTIKAICIVHNETATGVTN+L  +RK+LD+Y+HPAL++VD VSSI
Sbjct  121   ADLDALESKLASDKSHTIKAICIVHNETATGVTNDLPKLRKILDYYKHPALVIVDAVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
              A+DFRMDEWG+DVA+T SQKALSLPTG+GIVCASPKA+EASK A S+R +FDW  YLK 
Sbjct  181   GALDFRMDEWGIDVAVTSSQKALSLPTGMGIVCASPKAIEASKHATSLRSYFDWNGYLKC  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI+RH RL  ATRLAV+AWGLKNC Q 
Sbjct  241   YNLGTYWPYTPSIQLLYGLRATLDLIFEEGLENVISRHKRLAKATRLAVEAWGLKNCCQN  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             +E +SD+VTAVVVP+ IDS EIV RAWK+YNLSLG+GLNKVAGKVFRIGHLGN+NELQLL
Sbjct  301   KESYSDSVTAVVVPTNIDSGEIVNRAWKKYNLSLGVGLNKVAGKVFRIGHLGNINELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEMVL+D+GYP+K GSGVAAASAYL NT P+IPSRI
Sbjct  361   GCLAGVEMVLRDVGYPIKFGSGVAAASAYLHNTIPLIPSRI  401



>gb|KDO44954.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=367

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/359 (89%), Positives = 345/359 (96%), Gaps = 0/359 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY+ APG+NHLFVPGPV+IPDQVIRAM RNNEDYRSPAVPALTKTLLED+KKIFKTTSG
Sbjct  1     MDYMYAPGKNHLFVPGPVHIPDQVIRAMNRNNEDYRSPAVPALTKTLLEDIKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRLNFNVDVVES+WG+G
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLNFNVDVVESDWGEG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A LDVLASKLA DTAHTIKAICIVHNETATGVTNNL+ VRKLLD Y+HPAL LVDGVSSI
Sbjct  121   AKLDVLASKLAADTAHTIKAICIVHNETATGVTNNLSKVRKLLDEYRHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CAIDFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDY+KF
Sbjct  181   CAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYIKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQL  262
             EEWFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNE+  
Sbjct  301   EEWFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNEVMF  359



>gb|AEX09263.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=358

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/358 (90%), Positives = 345/358 (96%), Gaps = 0/358 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPAVPALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAVPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVR +LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CAS
Sbjct  121   LATVRNILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGILCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  160
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>gb|AEX09295.1| alanine glyoxylate aminotransferase [Peperomia pugnicaudex]
Length=356

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/356 (91%), Positives = 343/356 (96%), Gaps = 0/356 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  166
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQ
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQ  356



>ref|XP_010094254.1| Serine--glyoxylate aminotransferase [Morus notabilis]
 gb|EXB55505.1| Serine--glyoxylate aminotransferase [Morus notabilis]
Length=358

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/357 (90%), Positives = 342/357 (96%), Gaps = 0/357 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYVN PGR+HLFVPGPVNIP+ VIRAM RNNEDYRSPA+PA+TK LLEDVK IFKTTSG
Sbjct  1     MDYVNGPGRHHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPAMTKVLLEDVKMIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVES+WGQG
Sbjct  61    TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESDWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANL+VL +KLAED AH+IKAICIVHNETATGVTNNLA VR+LLD Y HPALLLVDGVSSI
Sbjct  121   ANLEVLEAKLAEDRAHSIKAICIVHNETATGVTNNLAKVRQLLDDYGHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASK+AKSVRVFFDW DYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKSAKSVRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  268
             EEW+SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+
Sbjct  301   EEWYSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEV  357



>gb|AEX09301.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=358

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/358 (90%), Positives = 345/358 (96%), Gaps = 0/358 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD   HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDDCNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
              RH RLG ATRLAV+AWGLKNCTQKEEWFS+TVTAV++P YIDS+EIV+RAWKRYNLSLG
Sbjct  241   DRHARLGKATRLAVEAWGLKNCTQKEEWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  160
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYLQNT
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLQNT  358



>ref|XP_003617296.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00255.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/401 (80%), Positives = 353/401 (88%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MD+   PGRNHLFVPGP NIP+ VIRAM RNNE++R+PA+  LTKTLL+DVKKIFKTTSG
Sbjct  1     MDFAYGPGRNHLFVPGPTNIPEHVIRAMNRNNENHRTPAITTLTKTLLDDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
              PFLIPTTGTGAWESALTNTLSPGDR VSFLIGQFSLLWI+QQ+RLNF VDVVESEWGQG
Sbjct  61    IPFLIPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIEQQKRLNFKVDVVESEWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A+LD L SKLA D  HTIKAICIVHNET TGVTN+L  VRK+LD YQHPAL++VD VSSI
Sbjct  121   ADLDALESKLASDKTHTIKAICIVHNETTTGVTNDLTKVRKILDKYQHPALIIVDAVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
              A+DFRMDEWGVDV +T SQKALSLPTG+GIVCA PKA+EA+K+A SVR FFDW  YLK 
Sbjct  181   GALDFRMDEWGVDVVVTSSQKALSLPTGMGIVCAGPKAIEATKSATSVRSFFDWNGYLKC  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y +GTYWPYTPSIQLLYGLRA LDL+FEEG +NVI RH RL  ATRLAV+AWGLKNC QK
Sbjct  241   YNLGTYWPYTPSIQLLYGLRAALDLVFEEGFENVILRHKRLAKATRLAVEAWGLKNCCQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEW+S +VTA+VVP  IDS EIV RAWKRYNLSLG GLNKVAGKVFRIGH+G+LNELQLL
Sbjct  301   EEWYSASVTAIVVPPNIDSGEIVSRAWKRYNLSLGGGLNKVAGKVFRIGHVGHLNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM LKD+GYPVKLGSGVAAASAYL N  P+IPSRI
Sbjct  361   GCLAGVEMTLKDVGYPVKLGSGVAAASAYLLNNVPLIPSRI  401



>gb|AEX09308.1| alanine glyoxylate aminotransferase [Peperomia polycephala]
Length=356

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/356 (90%), Positives = 343/356 (96%), Gaps = 0/356 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WGQGANLD+L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGQGANLDILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDDYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
              RH RLG ATRLAV+AWGLKNCTQKEEWFS+TVTAV++P YIDS+EIV+RAWKRYNLSLG
Sbjct  241   DRHARLGKATRLAVEAWGLKNCTQKEEWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  166
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQ
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQ  356



>gb|AEX09268.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=359

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/359 (90%), Positives = 344/359 (96%), Gaps = 0/359 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDDYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
              RH RLG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLG
Sbjct  241   DRHARLGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTT  157
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTT
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTT  359



>gb|AEX09274.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=358

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/358 (90%), Positives = 343/358 (96%), Gaps = 0/358 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDDYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
              RH RLG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLG
Sbjct  241   DRHARLGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  160
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNT
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNT  358



>ref|XP_006369573.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66142.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=381

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/360 (89%), Positives = 340/360 (94%), Gaps = 0/360 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY   PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1     MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPF+IPTTGTGAWESALTNTLSPGDR VSF+IGQFSLLWIDQQ+RL FNVDVVES+WGQG
Sbjct  61    TPFIIPTTGTGAWESALTNTLSPGDRTVSFMIGQFSLLWIDQQKRLGFNVDVVESDWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLD+LASKLAEDTAHTIKA+CIVHNETATGVTNNLA VRK+LD Y+HPAL LVDGVSSI
Sbjct  121   ANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLAKVRKILDDYRHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKDYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNCTQK
Sbjct  241   YKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKNCTQK  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
             EEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+  +
Sbjct  301   EEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEVTFI  360



>gb|AEX09303.1| alanine glyoxylate aminotransferase [Peperomia ayacuchoana]
Length=351

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/351 (91%), Positives = 339/351 (97%), Gaps = 0/351 (0%)
 Frame = -3

Query  1200  LLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL  1021
             LLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL
Sbjct  1     LLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRL  60

Query  1020  NFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHY  841
              FNVDVVES+WGQGANL++LASKLA D AH+IKAICIVHNETATGVTNNLATVRK+LD+Y
Sbjct  61    GFNVDVVESDWGQGANLEILASKLASDAAHSIKAICIVHNETATGVTNNLATVRKILDNY  120

Query  840   QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  661
              HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAK
Sbjct  121   NHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAK  180

Query  660   SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  481
             SVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATR
Sbjct  181   SVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATR  240

Query  480   LAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  301
             LAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVF
Sbjct  241   LAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVF  300

Query  300   RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  148
             RIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  301   RIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  351



>gb|AEX09265.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=353

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/353 (90%), Positives = 339/353 (96%), Gaps = 0/353 (0%)
 Frame = -3

Query  1206  KTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQ  1027
             KTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGD  +SFLIGQFSLLWIDQQQ
Sbjct  1     KTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDXTISFLIGQFSLLWIDQQQ  60

Query  1026  RLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLD  847
             RL F VDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNNLATVRK+LD
Sbjct  61    RLGFXVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNNLATVRKILD  120

Query  846   HYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKT  667
             +Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKT
Sbjct  121   NYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKT  180

Query  666   AKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTA  487
             AKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG A
Sbjct  181   AKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKA  240

Query  486   TRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGK  307
             TRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGK
Sbjct  241   TRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGK  300

Query  306   VFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  148
             VFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  301   VFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  353



>gb|AEX09245.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=349

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/349 (91%), Positives = 337/349 (97%), Gaps = 0/349 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AHTIKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHTIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVA  187
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVA  349



>gb|AEX09259.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=351

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/351 (90%), Positives = 338/351 (96%), Gaps = 0/351 (0%)
 Frame = -3

Query  1200  LLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL  1021
             LLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL
Sbjct  1     LLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRL  60

Query  1020  NFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHY  841
              FNVDVVES+WG GANL++LASKLA D AHTIKAICIVHNETATGVTNNLATVRK+LD+Y
Sbjct  61    GFNVDVVESDWGHGANLEILASKLASDVAHTIKAICIVHNETATGVTNNLATVRKILDNY  120

Query  840   QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  661
              HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAK
Sbjct  121   NHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAK  180

Query  660   SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  481
             SVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATR
Sbjct  181   SVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATR  240

Query  480   LAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  301
             LAV+A GLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVF
Sbjct  241   LAVEARGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVF  300

Query  300   RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  148
             RIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  301   RIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  351



>gb|AEX09307.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=351

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/351 (90%), Positives = 338/351 (96%), Gaps = 0/351 (0%)
 Frame = -3

Query  1200  LLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL  1021
             LLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL
Sbjct  1     LLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRL  60

Query  1020  NFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHY  841
              FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNNLATVRK+LD+Y
Sbjct  61    GFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNNLATVRKILDNY  120

Query  840   QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  661
              HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAK
Sbjct  121   NHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAK  180

Query  660   SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  481
             SVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATR
Sbjct  181   SVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATR  240

Query  480   LAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  301
             LAV+AWGLKNCTQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVF
Sbjct  241   LAVEAWGLKNCTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVF  300

Query  300   RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  148
             RIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  301   RIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  351



>gb|AEX09277.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=351

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/351 (90%), Positives = 338/351 (96%), Gaps = 0/351 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAA  181
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAA  351



>gb|AEX09266.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=350

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/350 (90%), Positives = 336/350 (96%), Gaps = 0/350 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDDYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
              RH RLG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLG
Sbjct  241   XRHARLGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAA  184
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAA  350



>gb|AEX09285.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=350

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/350 (90%), Positives = 336/350 (96%), Gaps = 0/350 (0%)
 Frame = -3

Query  1197  LEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLN  1018
             LEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL 
Sbjct  1     LEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLG  60

Query  1017  FNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQ  838
             F VDVVES+WG GANL++LASKLA D  H+IKAICIVHNETATGVTNNLATVRK+LD+Y 
Sbjct  61    FIVDVVESDWGHGANLEILASKLASDAGHSIKAICIVHNETATGVTNNLATVRKILDNYN  120

Query  837   HPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKS  658
             HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS
Sbjct  121   HPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKS  180

Query  657   VRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRL  478
             VRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRL
Sbjct  181   VRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRL  240

Query  477   AVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFR  298
             AV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFR
Sbjct  241   AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  300

Query  297   IGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  148
             IGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  301   IGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  350



>gb|AEX09283.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=349

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/349 (90%), Positives = 335/349 (96%), Gaps = 0/349 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDDYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
              RH RLG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLG
Sbjct  241   DRHARLGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVA  187
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVA  349



>gb|AEX09262.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=342

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/342 (91%), Positives = 332/342 (97%), Gaps = 0/342 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AHTIKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHTIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPV  208
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPV
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPV  342



>gb|AEX09252.1| alanine glyoxylate aminotransferase [Peperomia exclamationis]
Length=342

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/342 (91%), Positives = 332/342 (97%), Gaps = 0/342 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPAVPALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAVPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPV  208
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPV
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPV  342



>gb|AEX09247.1| alanine glyoxylate aminotransferase [Peperomia cavispicata]
Length=342

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/342 (91%), Positives = 331/342 (97%), Gaps = 0/342 (0%)
 Frame = -3

Query  1173  KTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES  994
             KTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES
Sbjct  1     KTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVES  60

Query  993   EWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVD  814
             +WGQGANL++LASKLA D AHTIKAICIVHNETATGVTNNLATVRK+LD+Y HPALLLVD
Sbjct  61    DWGQGANLEILASKLASDAAHTIKAICIVHNETATGVTNNLATVRKILDNYNHPALLLVD  120

Query  813   GVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWK  634
             GVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW 
Sbjct  121   GVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWN  180

Query  633   DYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLK  454
             DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLK
Sbjct  181   DYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLK  240

Query  453   NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  274
             NCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+N
Sbjct  241   NCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVN  300

Query  273   ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  148
             ELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  301   ELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  342



>gb|AEX09294.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=345

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/345 (90%), Positives = 332/345 (96%), Gaps = 0/345 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D A +IKA+CIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAXSIKAVCIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI
Sbjct  181   PKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLG  199
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK G
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFG  345



>gb|AEX09302.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=343

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/343 (90%), Positives = 330/343 (96%), Gaps = 0/343 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD   HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDDCNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
              RH RLG ATRLAV+AWGLKNCTQKEEWFS+TVTAV++P YIDS+EIV+RAWKRYNLSLG
Sbjct  241   DRHARLGKATRLAVEAWGLKNCTQKEEWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVK  205
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVK  343



>gb|KJB83533.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=342

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/339 (91%), Positives = 320/339 (94%), Gaps = 0/339 (0%)
 Frame = -3

Query  1152  FLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGAN  973
              L    GTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQGAN
Sbjct  4     LLFCILGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLKFNVDVVESEWGQGAN  63

Query  972   LDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICA  793
             LDVLA KLA D  HTIKAICIVHNETATGVTNNLATVRKLLDHY HPALLLVDGVSSICA
Sbjct  64    LDVLAEKLAADRTHTIKAICIVHNETATGVTNNLATVRKLLDHYGHPALLLVDGVSSICA  123

Query  792   IDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYK  613
             +DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEA+KTAKSVRVFFDW DYLKFYK
Sbjct  124   LDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEATKTAKSVRVFFDWNDYLKFYK  183

Query  612   MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  433
             +GT+WPYTPSIQLLYGLRA LDL+FEEGLDN+I RH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  184   LGTFWPYTPSIQLLYGLRAALDLIFEEGLDNIIERHSRLGKATRLAVEAWGLKNCTQKEE  243

Query  432   WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  253
             WFSDTVTAV+VP YIDSSEIVKR WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  244   WFSDTVTAVLVPPYIDSSEIVKRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  303

Query  252   LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  304   LAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  342



>gb|AEX09242.1| alanine glyoxylate aminotransferase [Peperomia aff. pinoi JN-2011]
Length=335

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/335 (91%), Positives = 323/335 (96%), Gaps = 0/335 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQ RL FNVDVVES+WG GANL+++ASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQTRLGFNVDVVESDWGLGANLEIMASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LDHY HPALLLVDGVSSICA+DFRMDEWG+DVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDHYNHPALLLVDGVSSICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEEW SDTVTAVV+PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEEWSSDTVTAVVIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVL  229
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVL
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVL  335



>gb|AEX09288.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=335

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/335 (91%), Positives = 325/335 (97%), Gaps = 0/335 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA DTAH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDTAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVL  229
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVL
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVL  335



>gb|AEX09272.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=338

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/338 (90%), Positives = 325/338 (96%), Gaps = 0/338 (0%)
 Frame = -3

Query  1197  LEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLN  1018
             LEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL 
Sbjct  1     LEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLG  60

Query  1017  FNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQ  838
             FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNNLATVRK+LD+Y 
Sbjct  61    FNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNNLATVRKILDNYN  120

Query  837   HPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKS  658
             HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS
Sbjct  121   HPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKS  180

Query  657   VRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRL  478
             VRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRL
Sbjct  181   VRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRL  240

Query  477   AVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFR  298
             AV+AWGLKNCTQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFR
Sbjct  241   AVEAWGLKNCTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  300

Query  297   IGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAA  184
             IGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  301   IGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAA  338



>gb|AEX09246.1| alanine glyoxylate aminotransferase [Peperomia elatior]
Length=335

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/335 (91%), Positives = 323/335 (96%), Gaps = 0/335 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AHTIKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHTIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDXYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVL  229
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVL
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVL  335



>gb|AEX09284.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=338

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/338 (90%), Positives = 324/338 (96%), Gaps = 0/338 (0%)
 Frame = -3

Query  1197  LEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLN  1018
             LEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL 
Sbjct  1     LEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLG  60

Query  1017  FNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQ  838
             FNVDVVES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNNLATVRK+LD Y 
Sbjct  61    FNVDVVESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNNLATVRKILDDYN  120

Query  837   HPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKS  658
             HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS
Sbjct  121   HPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKS  180

Query  657   VRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRL  478
             VRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRL
Sbjct  181   VRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRL  240

Query  477   AVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFR  298
             AV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFR
Sbjct  241   AVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  300

Query  297   IGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAA  184
             IGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  301   IGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAA  338



>gb|AEX09251.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=331

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/331 (91%), Positives = 322/331 (97%), Gaps = 0/331 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WGQGANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGQGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GV
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGV  331



>gb|AEX09282.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=332

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/332 (91%), Positives = 322/332 (97%), Gaps = 0/332 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA DTAH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDTAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVE  238
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVE
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVE  332



>ref|XP_002990557.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
 gb|EFJ08434.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
Length=401

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/401 (75%), Positives = 349/401 (87%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             M+Y  APGRNHLFVPGP N+P++VI+A +R NED+RSPA   L+K++L+ VK +FKT + 
Sbjct  1     MEYFPAPGRNHLFVPGPTNVPEKVIQAFSRGNEDHRSPAFATLSKSVLDGVKDLFKTKTA  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             T F+ PTTGTGAWESALTNTLSPGD+IVSF +GQFSLLWIDQ QRL FNVDVV+ EWG G
Sbjct  61    TSFIFPTTGTGAWESALTNTLSPGDKIVSFRLGQFSLLWIDQMQRLKFNVDVVDCEWGAG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A+L++L +KLA D  H IKAICIVHNET+TGVTN++ ++R LLD ++HPALLLVDGVSSI
Sbjct  121   ADLNILNAKLAMDYNHEIKAICIVHNETSTGVTNSIPSIRALLDKHKHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
              AI+F+MDEWGVDVALTGSQKAL LPTG+GIVCA PKALEA+KTA S RVFFDW DYLKF
Sbjct  181   GAIEFKMDEWGVDVALTGSQKALGLPTGLGIVCAGPKALEAAKTATSPRVFFDWADYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+G+YWPYTPS Q+LY LRA LDL+FEEGLDNVI RH RLG ATRLAV AWGLK CT++
Sbjct  241   YKLGSYWPYTPSSQMLYALRASLDLIFEEGLDNVIKRHARLGEATRLAVAAWGLKLCTKR  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
              EW SDTVTAVVVP YI+S ++VK AWK+YNLSLG+GLNKVAGKVFRIGHLG +NELQLL
Sbjct  301   PEWNSDTVTAVVVPPYINSLDVVKMAWKKYNLSLGVGLNKVAGKVFRIGHLGFVNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             G L+GVEM+LKDIGYPV LGSGVAAA+A+LQ  TP+I SR+
Sbjct  361   GALSGVEMILKDIGYPVVLGSGVAAAAAHLQKKTPLISSRL  401



>gb|AEX09309.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=335

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/335 (90%), Positives = 322/335 (96%), Gaps = 0/335 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++L+SKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILSSKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKXLDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSD VTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDAVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVL  229
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVL
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVL  335



>gb|AEX09287.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=331

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/331 (91%), Positives = 321/331 (97%), Gaps = 0/331 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA DTAH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDTAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GV
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGV  331



>ref|XP_002983655.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
 gb|EFJ15151.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
Length=401

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/401 (74%), Positives = 349/401 (87%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             M+Y  APGRNHLFVPGP N+P++VI+A +R NED+RSPA   L+K++L+ VK +FKT + 
Sbjct  1     MEYFPAPGRNHLFVPGPTNVPEKVIQAFSRGNEDHRSPAFATLSKSVLDGVKDLFKTKTA  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             T F+ PTTGTGAWESALTNTLSPGD+IVSF +GQFSLLWIDQ QRL FNVDVV+ EWG G
Sbjct  61    TSFIFPTTGTGAWESALTNTLSPGDKIVSFRLGQFSLLWIDQMQRLKFNVDVVDCEWGAG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A+L++L +KLA D  H IKAICIVHNET+TGVTN++ ++R LLD ++HPALLLVDGVSSI
Sbjct  121   ADLNILNAKLAMDYNHEIKAICIVHNETSTGVTNSIPSIRALLDKHKHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
              AI+F+MDEWGVDVALTGSQKAL LPTG+GIVCA PKALEA+KTA S RVFFDW DYLKF
Sbjct  181   GAIEFKMDEWGVDVALTGSQKALGLPTGLGIVCAGPKALEAAKTATSPRVFFDWADYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+G+YWPYTPS Q+LY LRA LDL+FEEGLDNVI RH RLG ATRLAV AWGLK CT++
Sbjct  241   YKVGSYWPYTPSSQMLYALRASLDLIFEEGLDNVIKRHARLGEATRLAVAAWGLKLCTKR  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
              EW SDTVTAVVVP Y++S ++VK AWK+YNLSLG+GLNKVAGKVFRIGHLG +NELQLL
Sbjct  301   PEWNSDTVTAVVVPPYLNSLDVVKMAWKKYNLSLGVGLNKVAGKVFRIGHLGFVNELQLL  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             G L+GVEM+LKDIGYPV LGSGVAAA+A+LQ  TP+I SR+
Sbjct  361   GALSGVEMILKDIGYPVVLGSGVAAAAAHLQKKTPLISSRL  401



>gb|AEX09244.1| alanine glyoxylate aminotransferase [Peperomia basiradicans]
Length=332

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/332 (91%), Positives = 321/332 (97%), Gaps = 0/332 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CAS
Sbjct  121   LATVRKILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGILCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGVE  238
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GVE
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGVE  332



>gb|AEX09264.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=334

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/334 (90%), Positives = 320/334 (96%), Gaps = 0/334 (0%)
 Frame = -3

Query  1200  LLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRL  1021
             LLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL
Sbjct  1     LLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRL  60

Query  1020  NFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHY  841
              FNVDVVES+WG GANL++LAS LA D  H+IKAICIVHNETATGVTNNLATVRK+LD+Y
Sbjct  61    GFNVDVVESDWGHGANLEILASXLASDAGHSIKAICIVHNETATGVTNNLATVRKILDNY  120

Query  840   QHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAK  661
              HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAK
Sbjct  121   NHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAK  180

Query  660   SVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  481
             SVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATR
Sbjct  181   SVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATR  240

Query  480   LAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVF  301
             LAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVF
Sbjct  241   LAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVF  300

Query  300   RIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLG  199
             RIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK G
Sbjct  301   RIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFG  334



>gb|AEX09292.1| alanine glyoxylate aminotransferase [Peperomia klopfensteinii]
Length=330

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/330 (91%), Positives = 318/330 (96%), Gaps = 0/330 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTT GTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTXGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LDHY HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKILDHYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV++P YIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAG  244
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+G
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSG  330



>gb|AEX09310.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=331

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/331 (91%), Positives = 320/331 (97%), Gaps = 0/331 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVRK+LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRKMLDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLG
Sbjct  241   ARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             LGLNKVAGKVFRIGHLGN+NELQLLGCL+GV
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLGCLSGV  331



>tpg|DAA47863.1| TPA: hypothetical protein ZEAMMB73_595389 [Zea mays]
Length=368

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/357 (84%), Positives = 323/357 (90%), Gaps = 1/357 (0%)
 Frame = -3

Query  1335  DYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGT  1156
             DYV  PGR HLFVPGPVNIPD VIRAM R NEDYRSPAVPALTK LLEDVKKIFKTT+GT
Sbjct  3     DYVYGPGRTHLFVPGPVNIPDPVIRAMNRQNEDYRSPAVPALTKVLLEDVKKIFKTTTGT  62

Query  1155  PFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGA  976
             PF+IPTTGTGAWESALTNTLSPGDR+VSFLIGQFSLLWIDQQ+RL F+VD VESEWGQGA
Sbjct  63    PFMIPTTGTGAWESALTNTLSPGDRVVSFLIGQFSLLWIDQQRRLGFDVDAVESEWGQGA  122

Query  975   NLDVLASKLAEDTA-HTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             +L  L  +L ED   H IKA+ IVHNETATGVTN+LA VR LLD + HPALLLVDGVSSI
Sbjct  123   DLAALERRLREDAPRHAIKAVAIVHNETATGVTNDLAAVRALLDKHAHPALLLVDGVSSI  182

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKDYL+F
Sbjct  183   CALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKDYLRF  242

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QK
Sbjct  243   YDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQK  302

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  268
             EEWFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+
Sbjct  303   EEWFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEV  359



>gb|AEX09261.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=327

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/327 (91%), Positives = 316/327 (97%), Gaps = 0/327 (0%)
 Frame = -3

Query  1173  KTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES  994
             KTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES
Sbjct  1     KTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVES  60

Query  993   EWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVD  814
             +WGQGANL++LASKLA D AHTIKAICIVHNETATGVTNNLATVRK+LD+Y HPALLLVD
Sbjct  61    DWGQGANLEILASKLASDAAHTIKAICIVHNETATGVTNNLATVRKILDNYNHPALLLVD  120

Query  813   GVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWK  634
             GVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW 
Sbjct  121   GVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWN  180

Query  633   DYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLK  454
             DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLK
Sbjct  181   DYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLK  240

Query  453   NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  274
             NCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+N
Sbjct  241   NCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVN  300

Query  273   ELQLLGCLAGVEMVLKDIGYPVKLGSG  193
             ELQLLGCL+GVEMVLKD+GYPVK GSG
Sbjct  301   ELQLLGCLSGVEMVLKDVGYPVKFGSG  327



>gb|AEX09271.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=332

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/332 (89%), Positives = 317/332 (95%), Gaps = 0/332 (0%)
 Frame = -3

Query  1182  KIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDV  1003
             KIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDV
Sbjct  1     KIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDV  60

Query  1002  VESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALL  823
             VES+WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNNLAT RK+LD Y HPALL
Sbjct  61    VESDWGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNNLATARKILDDYNHPALL  120

Query  822   LVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFF  643
             LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFF
Sbjct  121   LVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFF  180

Query  642   DWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAW  463
             DW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AW
Sbjct  181   DWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAW  240

Query  462   GLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG  283
             GLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG
Sbjct  241   GLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLG  300

Query  282   NLNELQLLGCLAGVEMVLKDIGYPVKLGSGVA  187
             N+NELQLLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  301   NVNELQLLGCLSGVEMVLKDVGYPVKFGSGVA  332



>gb|AEX09281.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=330

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/330 (90%), Positives = 316/330 (96%), Gaps = 0/330 (0%)
 Frame = -3

Query  1173  KTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVES  994
             KTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES
Sbjct  1     KTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVES  60

Query  993   EWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVD  814
             +WG GANL++LASKLA D AH+IKAICIVHNETATGVTNNLATVRK+LD+Y HPALLLVD
Sbjct  61    DWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNNLATVRKILDNYNHPALLLVD  120

Query  813   GVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWK  634
             GVSSICA+DFRMDEWGVDVALTGSQKA SLPTG+GIVCASPKALEASKTAKSVRVFFDW 
Sbjct  121   GVSSICALDFRMDEWGVDVALTGSQKAPSLPTGMGIVCASPKALEASKTAKSVRVFFDWN  180

Query  633   DYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLK  454
             DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLK
Sbjct  181   DYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLK  240

Query  453   NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  274
             NCTQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+N
Sbjct  241   NCTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVN  300

Query  273   ELQLLGCLAGVEMVLKDIGYPVKLGSGVAA  184
             ELQLLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  301   ELQLLGCLSGVEMVLKDVGYPVKFGSGVAA  330



>gb|AEX09269.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=328

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/328 (90%), Positives = 314/328 (96%), Gaps = 0/328 (0%)
 Frame = -3

Query  1170  TTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESE  991
             TTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES+
Sbjct  1     TTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVESD  60

Query  990   WGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDG  811
             WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNNLATVRK+LD Y HPALLLVDG
Sbjct  61    WGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNNLATVRKILDDYNHPALLLVDG  120

Query  810   VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  631
             VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  121   VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  180

Query  630   YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  451
             YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKN
Sbjct  181   YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHARLGKATRLAVEAWGLKN  240

Query  450   CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  271
             CTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  241   CTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  300

Query  270   LQLLGCLAGVEMVLKDIGYPVKLGSGVA  187
             LQLLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  301   LQLLGCLSGVEMVLKDVGYPVKFGSGVA  328



>gb|AEX09280.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=330

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/330 (89%), Positives = 314/330 (95%), Gaps = 0/330 (0%)
 Frame = -3

Query  1170  TTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESE  991
             T SGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES+
Sbjct  1     TXSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVESD  60

Query  990   WGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDG  811
             WGQGANL++L+SKLA D AH+IKAICIVHNETATGVTNNLATVRK+LD Y HPALLLVDG
Sbjct  61    WGQGANLEILSSKLASDAAHSIKAICIVHNETATGVTNNLATVRKILDDYNHPALLLVDG  120

Query  810   VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  631
             VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  121   VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  180

Query  630   YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  451
             YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKN
Sbjct  181   YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIXRHARLGKATRLAVEAWGLKN  240

Query  450   CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  271
             CTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKV GKVFRIGHLGN+NE
Sbjct  241   CTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVXGKVFRIGHLGNVNE  300

Query  270   LQLLGCLAGVEMVLKDIGYPVKLGSGVAAA  181
             LQLLGCL+GVEMVLKD+GYPVK GSGVAAA
Sbjct  301   LQLLGCLSGVEMVLKDVGYPVKFGSGVAAA  330



>ref|XP_001755667.1| predicted protein [Physcomitrella patens]
 gb|EDQ79340.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/402 (72%), Positives = 347/402 (86%), Gaps = 1/402 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             M+Y  APGRNHLFVPGP N+P+ ++RAM R+NED+RSPA P L+K++++DVK+IF+TT+ 
Sbjct  1     MEYYPAPGRNHLFVPGPTNVPEPILRAMNRSNEDHRSPAFPKLSKSVIDDVKQIFRTTTA  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             T F+ PTTGTGAWESALTNTLSPGD+I+SF +GQFSLLWIDQ QR NF+VDVV+ EWG G
Sbjct  61    TSFIFPTTGTGAWESALTNTLSPGDKIISFRLGQFSLLWIDQMQRYNFDVDVVDCEWGTG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
              +LD L  KL  D +H++KA+C+VHNET+TGVTN++  +R+++D  +HPALLLVDGVSSI
Sbjct  121   VDLDNLKQKLQSDWSHSVKAVCVVHNETSTGVTNDIGAIRRVMDEARHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
              AIDFRMD+W VDVALTGSQKALSLPTG+GIVCASPKAL A+K +KS RVFFDW DYLKF
Sbjct  181   GAIDFRMDDWKVDVALTGSQKALSLPTGLGIVCASPKALAAAKQSKSTRVFFDWGDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQ  442
             Y+ GTYWPYTPS Q+LYGLRA LD++  EEGLDNVIARH RLG ATR AV+AWGL  CTQ
Sbjct  241   YEAGTYWPYTPSSQMLYGLRASLDMILNEEGLDNVIARHCRLGEATRQAVKAWGLTLCTQ  300

Query  441   KEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQL  262
               +W SDTVTAVVVPS+I+S++IVK A+K+YNLSLG+GLNKVAGKVFRIGHLGN+NELQ+
Sbjct  301   DPKWKSDTVTAVVVPSWINSNDIVKIAYKKYNLSLGIGLNKVAGKVFRIGHLGNVNELQM  360

Query  261   LGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             LG LAGVE+ L ++GYPV LGSGVAAA A+L   TP+I SRI
Sbjct  361   LGALAGVELCLMEVGYPVTLGSGVAAAQAHLAKKTPLISSRI  402



>ref|XP_001783551.1| predicted protein [Physcomitrella patens]
 gb|EDQ51640.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/402 (72%), Positives = 346/402 (86%), Gaps = 1/402 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             M+Y  APGRNHLFVPGP N+P+ ++RAM R+NED+RSPA P L+K++++DVK+IF+T + 
Sbjct  1     MEYYPAPGRNHLFVPGPTNVPEPILRAMNRSNEDHRSPAFPKLSKSVIDDVKEIFRTKTA  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             T F+ PTTGTGAWESALTNTLSPGD+I+SF +GQFSLLWIDQ QR NF+VDVV+ EWG G
Sbjct  61    TSFIFPTTGTGAWESALTNTLSPGDKIISFRLGQFSLLWIDQMQRYNFDVDVVDCEWGAG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
              +LDVL  KL  D +H++KA+C+VHNET+TGVTN++  VR++LD   HPALLLVDGVSSI
Sbjct  121   IDLDVLKQKLVSDRSHSVKAVCVVHNETSTGVTNDIGAVRRVLDEANHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
              AIDFRMD+W VDVALTGSQKALSLPTG+GIVCASPKALEA+K +KS RVFFDW DYLKF
Sbjct  181   GAIDFRMDDWRVDVALTGSQKALSLPTGLGIVCASPKALEAAKRSKSTRVFFDWGDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQ  442
             Y+ GTYWPYTPS Q+LYGLRA LD++  EEGLDNVIARH RL  ATR AV+AWGL  CT+
Sbjct  241   YEAGTYWPYTPSSQMLYGLRASLDMILNEEGLDNVIARHCRLAEATRQAVRAWGLTLCTK  300

Query  441   KEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQL  262
               +W SDTVTAVVVPS+I+S++IVK A+K+YNLSLG+GLNKVAGKVFRIGHLGN+NELQL
Sbjct  301   DPKWKSDTVTAVVVPSWINSNDIVKIAYKKYNLSLGVGLNKVAGKVFRIGHLGNVNELQL  360

Query  261   LGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             LG LAGVE+ L ++GYPV LGSGVAAA A+L   TP+I SRI
Sbjct  361   LGALAGVELCLMEVGYPVTLGSGVAAAQAHLAKKTPLIVSRI  402



>gb|AEX09291.1| alanine glyoxylate aminotransferase [Peperomia jalcaensis]
Length=323

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/323 (91%), Positives = 312/323 (97%), Gaps = 0/323 (0%)
 Frame = -3

Query  1197  LEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLN  1018
             LEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL 
Sbjct  1     LEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLG  60

Query  1017  FNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQ  838
             FNVDVVES+WG GANL++LASKLA D AH+IKAICIVHNETATGVTNNLATVRK+LD+Y 
Sbjct  61    FNVDVVESDWGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNNLATVRKILDNYN  120

Query  837   HPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKS  658
             HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS
Sbjct  121   HPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKS  180

Query  657   VRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRL  478
             VRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRL
Sbjct  181   VRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRL  240

Query  477   AVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFR  298
             AV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFR
Sbjct  241   AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  300

Query  297   IGHLGNLNELQLLGCLAGVEMVL  229
             IGHLGN+NELQLLGCL+GVEMVL
Sbjct  301   IGHLGNVNELQLLGCLSGVEMVL  323



>gb|ABR16109.1| unknown [Picea sitchensis]
Length=359

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/356 (81%), Positives = 318/356 (89%), Gaps = 0/356 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MD    PGRN LFVPGPVNIP+ V++AM RNNEDYR+P VPALTK LL DV KIFK+T+G
Sbjct  1     MDPFYGPGRNQLFVPGPVNIPEPVLQAMNRNNEDYRAPPVPALTKKLLADVPKIFKSTTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPFL PTTGTGAWESALTNTLSP DRI+SF +GQFSLLWIDQ +RLNF+VDVV  EWG G
Sbjct  61    TPFLFPTTGTGAWESALTNTLSPRDRIISFEMGQFSLLWIDQMKRLNFDVDVVHCEWGTG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
              +L++L +KL  D  H +KAIC VHNETATGVTNNLA +R ++D   HPAL LVDGVSS+
Sbjct  121   VDLEILRTKLEADKEHKVKAICCVHNETATGVTNNLAAIRTVIDDCMHPALFLVDGVSSV  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CAIDFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYLKF
Sbjct  181   CAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             YK+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARH+RLG ATRLAV+AWGLKNCTQ+
Sbjct  241   YKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHSRLGRATRLAVEAWGLKNCTQR  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  271
             EEW+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  301   EEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|AEX09260.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=326

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/326 (90%), Positives = 310/326 (95%), Gaps = 0/326 (0%)
 Frame = -3

Query  1233  RSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQF  1054
             RSPA+PALTKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQF
Sbjct  1     RSPAIPALTKTLLEDVKKIFKTTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQF  60

Query  1053  SLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNN  874
             SLLWIDQQQRL FNVDVVES+WG GANL++LASKLA D AH IKAICIVHNETATGVTNN
Sbjct  61    SLLWIDQQQRLGFNVDVVESDWGHGANLEILASKLASDXAHXIKAICIVHNETATGVTNN  120

Query  873   LATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCAS  694
             LATVR +LD+Y HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCAS
Sbjct  121   LATVRXILDNYNHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAS  180

Query  693   PKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVI  514
             PKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI
Sbjct  181   PKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVI  240

Query  513   ARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  334
             ARH RLG ATRL V+AWGLKNCT KEE FSDTVTAV++PSYIDS+EIV+RAWKR NLSLG
Sbjct  241   ARHARLGKATRLXVEAWGLKNCTPKEECFSDTVTAVMIPSYIDSAEIVRRAWKRSNLSLG  300

Query  333   LGLNKVAGKVFRIGHLGNLNELQLLG  256
             LGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  301   LGLNKVAGKVFRIGHLGNVNELQLLG  326



>gb|AEX09289.1| alanine glyoxylate aminotransferase [Peperomia gigantea]
Length=312

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/312 (91%), Positives = 302/312 (97%), Gaps = 0/312 (0%)
 Frame = -3

Query  1161  GTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQ  982
             GTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES+WGQ
Sbjct  1     GTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVESDWGQ  60

Query  981   GANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSS  802
             GANL++LASKLA D AH+IKAICIVHNETATGVTNNLATVRK+LD+Y HPALLLVDGVSS
Sbjct  61    GANLEILASKLASDAAHSIKAICIVHNETATGVTNNLATVRKILDNYNHPALLLVDGVSS  120

Query  801   ICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLK  622
             ICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLK
Sbjct  121   ICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLK  180

Query  621   FYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQ  442
             FYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQ
Sbjct  181   FYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQ  240

Query  441   KEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQL  262
             KEEWFSDTVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQL
Sbjct  241   KEEWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQL  300

Query  261   LGCLAGVEMVLK  226
             LGCL+GVEMVLK
Sbjct  301   LGCLSGVEMVLK  312



>gb|AEX09290.1| alanine glyoxylate aminotransferase [Peperomia dolabella]
Length=311

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/311 (90%), Positives = 300/311 (96%), Gaps = 0/311 (0%)
 Frame = -3

Query  1170  TTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESE  991
             TTSGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES+
Sbjct  1     TTSGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVESD  60

Query  990   WGQGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDG  811
             WG GANL++LASKLA D AH+IKAICIVHNETATGVTNNLATVRK+LD+Y HPALLLVDG
Sbjct  61    WGHGANLEILASKLASDAAHSIKAICIVHNETATGVTNNLATVRKILDNYNHPALLLVDG  120

Query  810   VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  631
             VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  121   VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  180

Query  630   YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  451
             YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  181   YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  240

Query  450   CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  271
             CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  241   CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  300

Query  270   LQLLGCLAGVE  238
             LQLLGCL+GVE
Sbjct  301   LQLLGCLSGVE  311



>ref|XP_002969615.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
 gb|EFJ29703.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
Length=401

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/401 (70%), Positives = 333/401 (83%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY  APGRNHLFVPGP NIP +V++A+ R NED+RSPA P  ++ LL DV +IF T SG
Sbjct  1     MDYFMAPGRNHLFVPGPSNIPQKVMQALNRGNEDHRSPAFPVFSRQLLADVTRIFSTQSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPF+IPTTGTG WE A  NTLS GDR+++F+ GQFS LW  Q Q+L+F+VD V+ +WG G
Sbjct  61    TPFIIPTTGTGGWECAAVNTLSTGDRVLTFVFGQFSHLWSQQLQKLHFDVDAVQCQWGGG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
              +L VL SKL  D  H IKA+C+VHNET+TG+  NL  VR +LD  QHPALLLVDGVSSI
Sbjct  121   VDLGVLDSKLRADEEHRIKAVCVVHNETSTGININLGVVRAILDLNQHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
              A+ FRMDEW VDVALTGSQK+L LPTG+GI+CASPKALEASK+A+S R FFDW  YLK 
Sbjct  181   GALAFRMDEWKVDVALTGSQKSLGLPTGLGILCASPKALEASKSARSPRGFFDWSAYLKS  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y++G+YWPYTPSIQLLYGLRA LDLLFEEGL+NVI RH RL  ATRLAV+AWGL+ C + 
Sbjct  241   YELGSYWPYTPSIQLLYGLRAALDLLFEEGLENVIKRHHRLAHATRLAVKAWGLELCVKD  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
              E +SDTVTAVVVPSY++S+++V+ AW++YNLS+G+GLNKVAGKVFRIGHLG LNELQL+
Sbjct  301   PELYSDTVTAVVVPSYLNSTDVVRVAWRKYNLSIGIGLNKVAGKVFRIGHLGFLNELQLI  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
               LAGVEM LKD+G+PVKLGSGVAAA AYLQ +TP+IPSR+
Sbjct  361   SALAGVEMALKDVGFPVKLGSGVAAAQAYLQESTPLIPSRL  401



>ref|XP_002970880.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
 gb|EFJ28206.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
Length=401

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/401 (69%), Positives = 333/401 (83%), Gaps = 0/401 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY  APGRNHLFVPGP NIP +V++A+ R NED+RSPA P  ++ LL DV +IF T SG
Sbjct  1     MDYFMAPGRNHLFVPGPSNIPQKVMQALNRGNEDHRSPAFPVFSRQLLADVTRIFSTQSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPF+IPTTGTG WE A  NTLS GDR+++F+ GQFS LW  Q Q+L+F+VD V+ +WG G
Sbjct  61    TPFIIPTTGTGGWECAAVNTLSTGDRVLTFVFGQFSHLWSQQLQKLHFDVDAVQCQWGGG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
              +L VL SKL  D  H IKA+C+VHNET+TG+  NL  VR +LD  QHPALLLVDGVSSI
Sbjct  121   VDLGVLDSKLRADEEHRIKAVCVVHNETSTGININLGVVRAILDSNQHPALLLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
              A+ FRMDEW VDVALTGSQK+L LPTG+GI+CASPKALEASK+A+S R FFDW  YLK 
Sbjct  181   GALAFRMDEWKVDVALTGSQKSLGLPTGLGILCASPKALEASKSARSPRGFFDWSAYLKS  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y++G+YWPYTPSIQLLYGLRA LDLLFEEGL+NVI RH RL  ATRLAV+AWGL+ C + 
Sbjct  241   YELGSYWPYTPSIQLLYGLRAALDLLFEEGLENVIKRHHRLAHATRLAVKAWGLELCIKD  300

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
              E +SDTVTAVVVPSY++S+++V+ AW++YNLS+G+GLNKVAGKVFRIGHLG LNELQL+
Sbjct  301   PELYSDTVTAVVVPSYLNSTDVVRVAWRKYNLSIGIGLNKVAGKVFRIGHLGFLNELQLI  360

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
               LAGVEM LKD+G+PVKLGSGV+AA AYLQ +TP+IPSR+
Sbjct  361   SALAGVEMALKDVGFPVKLGSGVSAAQAYLQESTPLIPSRL  401



>ref|XP_006369569.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66138.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=311

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/311 (89%), Positives = 297/311 (95%), Gaps = 0/311 (0%)
 Frame = -3

Query  1068  LIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETAT  889
             +IGQFSLLWIDQQ+RL FNVDVVES+WGQGANLD+LASKLAEDTAHTIKA+CIVHNETAT
Sbjct  1     MIGQFSLLWIDQQKRLGFNVDVVESDWGQGANLDILASKLAEDTAHTIKAVCIVHNETAT  60

Query  888   GVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIG  709
             GVTNNLA VRK+LD Y+HPAL LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+G
Sbjct  61    GVTNNLAKVRKILDDYRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMG  120

Query  708   IVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEG  529
             IVCASPKALEASKTAKS RVFFDWKDYLKFYK+GT+WPYTPSIQLLYGLR  LDLLF EG
Sbjct  121   IVCASPKALEASKTAKSFRVFFDWKDYLKFYKLGTFWPYTPSIQLLYGLREALDLLFAEG  180

Query  528   LDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRY  349
             LDNVIARH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRY
Sbjct  181   LDNVIARHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRY  240

Query  348   NLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYL  169
             NLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYL
Sbjct  241   NLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYL  300

Query  168   QNTTPMIPSRI  136
             QN+TP+I SRI
Sbjct  301   QNSTPLIASRI  311



>gb|AEX09243.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=301

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/301 (91%), Positives = 291/301 (97%), Gaps = 0/301 (0%)
 Frame = -3

Query  1164  SGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWG  985
             SGTPF+IPTTGTGAWESALTNTLSPGDR +SFLIGQFSLLWIDQQQRL FNVDVVES+WG
Sbjct  1     SGTPFIIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLGFNVDVVESDWG  60

Query  984   QGANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVS  805
             QGANL++LASKLA D AHTIKAICIVHNETATGVTNNLATVRK+LD+Y HPALLLVDGVS
Sbjct  61    QGANLEILASKLASDAAHTIKAICIVHNETATGVTNNLATVRKILDNYNHPALLLVDGVS  120

Query  804   SICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYL  625
             SICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW DYL
Sbjct  121   SICALDFRMDEWGVDVALTGSQKALSLPTGMGILCASPKALEASKTAKSVRVFFDWNDYL  180

Query  624   KFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCT  445
             KFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCT
Sbjct  181   KFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCT  240

Query  444   QKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQ  265
             QKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQ
Sbjct  241   QKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQ  300

Query  264   L  262
             L
Sbjct  301   L  301



>ref|XP_001763095.1| predicted protein [Physcomitrella patens]
 gb|EDQ71972.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/402 (67%), Positives = 331/402 (82%), Gaps = 1/402 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             M+   APGRNHLFVPGP NIPD+V++AM RNNED+RSP  PAL K++LEDVK +F+T +G
Sbjct  1     MELFPAPGRNHLFVPGPTNIPDRVLQAMNRNNEDHRSPTFPALAKSVLEDVKLLFRTQTG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPF+ P++GTGAWESALTNT+SPGDRI+   +GQF +LWI+   RL+FNVDV+E EWG+G
Sbjct  61    TPFIFPSSGTGAWESALTNTMSPGDRIIVPRMGQFCVLWINLMTRLHFNVDVIECEWGEG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
              +L++L  KL  D  H +KA+C+VHNET+TGVTN+L+ VRK LD  +HPALLLVDGVSS+
Sbjct  121   IDLEILKQKLQSDHTHAVKAVCVVHNETSTGVTNDLSAVRKALDEARHPALLLVDGVSSV  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
              A+DFRMD+WGVDVALTGSQKALSLPTG+GI+CAS KA+E SK AK  R +FDW +YLK 
Sbjct  181   GAMDFRMDDWGVDVALTGSQKALSLPTGLGILCASLKAIETSKQAKYPRGYFDWAEYLKS  240

Query  618   YKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQ  442
             YK GTY PYTPS+QLLYGLRA LD++  +EGL+NVIARH RL  ATR AV+AWGL  C +
Sbjct  241   YKAGTYSPYTPSVQLLYGLRASLDIILKQEGLENVIARHLRLAEATRRAVRAWGLTVCAR  300

Query  441   KEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQL  262
             K +W S  VT VVVPS +DS++++K AWK+YNLSLGLGL +V GKVFRIGHLG +NELQL
Sbjct  301   KPQWDSAVVTGVVVPSSLDSNDVIKIAWKKYNLSLGLGLGEVNGKVFRIGHLGYVNELQL  360

Query  261   LGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             LG LAGVE+VL ++GYPV  GSGVAAA A+L   TP+I SR+
Sbjct  361   LGALAGVELVLLEVGYPVIFGSGVAAAQAFLSKQTPIIASRL  402



>gb|AGL09526.1| alanine-glyoxylate aminotransferase, partial [Peperomia prostrata]
Length=289

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/289 (92%), Positives = 281/289 (97%), Gaps = 0/289 (0%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTKTLLEDVKKIFKTTSGTPF+IP
Sbjct  1     PGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFIIP  60

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
             TTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRL FNVDVVES+WGQGANLD+L
Sbjct  61    TTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLGFNVDVVESDWGQGANLDIL  120

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
             ASKLA DTAH+IKAICIVHNETATGVTNNLATVRK+LDHY HP+LLLVDGVSSICA+DFR
Sbjct  121   ASKLASDTAHSIKAICIVHNETATGVTNNLATVRKILDHYNHPSLLLVDGVSSICALDFR  180

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
             MDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYL+FYKMGTY
Sbjct  181   MDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLRFYKMGTY  240

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLK  454
             WPYTPSIQLLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLK
Sbjct  241   WPYTPSIQLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLK  289



>gb|AGL09530.1| alanine-glyoxylate aminotransferase, partial [Xymalos monospora]
Length=289

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/289 (91%), Positives = 276/289 (96%), Gaps = 0/289 (0%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPA+PALTK LLEDVKKIFKT +GTPFLIP
Sbjct  1     PGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKILLEDVKKIFKTATGTPFLIP  60

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
             TTGTGAWES LTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL
Sbjct  61    TTGTGAWESTLTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  120

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
             ASKLA D AHTIKAICIVHNETATGVTNNLA VRK+LD Y+HPAL LVDGVSSICA+DFR
Sbjct  121   ASKLAADRAHTIKAICIVHNETATGVTNNLAAVRKILDDYRHPALFLVDGVSSICALDFR  180

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
             MDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDWKDYLKFY MGT+
Sbjct  181   MDEWGVDVALTGSQKALSLPTGMGIVCASPKALEATKTAKSVRVFFDWKDYLKFYNMGTF  240

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLK  454
             WPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLGTATRLAV+AWGLK
Sbjct  241   WPYTPSIQLLYGLRAALDLIFEEGLENVIARHNRLGTATRLAVEAWGLK  289



>gb|AGL09524.1| alanine-glyoxylate aminotransferase, partial [Calycanthus occidentalis]
Length=289

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/289 (91%), Positives = 278/289 (96%), Gaps = 0/289 (0%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTK LLEDVKKIFKTT+ TPF+IP
Sbjct  1     PGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKILLEDVKKIFKTTTATPFVIP  60

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
             TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDV+ES+WGQGANLDVL
Sbjct  61    TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVIESDWGQGANLDVL  120

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
             ASKLA DTAHTIKAICIVHNETATGVTNNLA VRKLLD Y+HPAL LVDGVSSICA+DFR
Sbjct  121   ASKLAADTAHTIKAICIVHNETATGVTNNLAAVRKLLDEYRHPALFLVDGVSSICALDFR  180

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
             MDEWG+DVALTGSQKALS+PTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK+GT+
Sbjct  181   MDEWGIDVALTGSQKALSMPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKLGTF  240

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLK  454
             WPYTPSIQLLYGLRA LDL+F+EGLDNVIARH+RLG ATRLAV+AWGLK
Sbjct  241   WPYTPSIQLLYGLRAALDLIFDEGLDNVIARHSRLGKATRLAVEAWGLK  289



>gb|AGL09523.1| alanine-glyoxylate aminotransferase, partial [Asarum caudatum]
Length=289

 Score =   523 bits (1347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/289 (90%), Positives = 275/289 (95%), Gaps = 0/289 (0%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSGTPFLIP
Sbjct  1     PGRNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSGTPFLIP  60

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
             TTGTGAWESALTNTLSPGD+ VSFLIGQFSLLWIDQQQRL FNV+V+ESEWGQGANLD+L
Sbjct  61    TTGTGAWESALTNTLSPGDQTVSFLIGQFSLLWIDQQQRLKFNVNVIESEWGQGANLDIL  120

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
             ASKLA D+ H IKAICIVHNETATGVTNNLA VRK+LD Y+HPAL LVDGVSSICA+DFR
Sbjct  121   ASKLAADSEHKIKAICIVHNETATGVTNNLAAVRKILDDYKHPALFLVDGVSSICALDFR  180

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
             MDEWG+DVALTGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW DYLKFYK+GTY
Sbjct  181   MDEWGIDVALTGSQKALSLPTGMGIICASPKALEASKTAKSVRVFFDWADYLKFYKLGTY  240

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLK  454
             WPYTPSIQLLYGLRA LDLLFEEGLDNVIARHTRLG ATR AV+AWGLK
Sbjct  241   WPYTPSIQLLYGLRAALDLLFEEGLDNVIARHTRLGKATRHAVEAWGLK  289



>ref|XP_006369572.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66141.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=321

 Score =   518 bits (1335),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 255/286 (89%), Positives = 270/286 (94%), Gaps = 0/286 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDY   PGRNHLFVPGPVNIP+ V+RAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSG
Sbjct  1     MDYFYGPGRNHLFVPGPVNIPESVLRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             TPF+IPTTGTGAWESALTNTLSPGDR VSF+IGQFSLLWIDQQ+RL FNVDVVES+WGQG
Sbjct  61    TPFIIPTTGTGAWESALTNTLSPGDRTVSFMIGQFSLLWIDQQKRLGFNVDVVESDWGQG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANLD+LASKLAEDTAHTIKA+CIVHNETATGVTNNLA VRK+LD Y+HPAL LVDGVSSI
Sbjct  121   ANLDILASKLAEDTAHTIKAVCIVHNETATGVTNNLAKVRKILDDYRHPALFLVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
             CA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKDYLKF
Sbjct  181   CALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKDYLKF  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATR  481
             YK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATR
Sbjct  241   YKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKATR  286



>gb|AGL09527.1| alanine-glyoxylate aminotransferase, partial [Piper nigrum]
Length=275

 Score =   508 bits (1309),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 253/275 (92%), Positives = 264/275 (96%), Gaps = 0/275 (0%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGRNHLFVPGPVNIP+ VIRAM RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP
Sbjct  1     PGRNHLFVPGPVNIPEPVIRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  60

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
             TTGTGAWESALTNTLSPGDRI+SFLIGQFSLLWIDQQQRL FNVDVVES+WGQGANLD+L
Sbjct  61    TTGTGAWESALTNTLSPGDRIISFLIGQFSLLWIDQQQRLGFNVDVVESDWGQGANLDIL  120

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
             ASKLA DT HTIKAICIVHNETATGVTNNL TVRK+LD Y HPALLLVDGVSSICA+DFR
Sbjct  121   ASKLASDTTHTIKAICIVHNETATGVTNNLLTVRKILDQYNHPALLLVDGVSSICALDFR  180

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
             MDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKT+KSVRVFFDW DYLK YKMGTY
Sbjct  181   MDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTSKSVRVFFDWSDYLKVYKMGTY  240

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRL  496
             WPYTPSIQLLYGLRA LDL+FEEGL+NVIARHTRL
Sbjct  241   WPYTPSIQLLYGLRAALDLIFEEGLENVIARHTRL  275



>gb|AGL09528.1| alanine-glyoxylate aminotransferase, partial [Saururus cernuus]
Length=279

 Score =   507 bits (1305),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 254/278 (91%), Positives = 266/278 (96%), Gaps = 0/278 (0%)
 Frame = -3

Query  1287  VNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESAL  1108
             VNIP+ VIRAM RNNEDYRSPAVPA+TKTLLEDVKKIFKTTSGTPF+IPTTGTGAWESAL
Sbjct  1     VNIPEPVIRAMNRNNEDYRSPAVPAMTKTLLEDVKKIFKTTSGTPFMIPTTGTGAWESAL  60

Query  1107  TNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHT  928
             TNTLSPGDRIVSFLIGQFSLLWIDQQQRL FNVDVVESEWGQGANLD+LASKLA DTAHT
Sbjct  61    TNTLSPGDRIVSFLIGQFSLLWIDQQQRLGFNVDVVESEWGQGANLDILASKLAADTAHT  120

Query  927   IKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALT  748
             IKAICIVHNETATGVTNNLATVRK+LD Y HPALLLVDGVSSICA+DFRMDEWG+DVALT
Sbjct  121   IKAICIVHNETATGVTNNLATVRKILDDYGHPALLLVDGVSSICALDFRMDEWGIDVALT  180

Query  747   GSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQlly  568
             GSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW DYLKFYK GTYWPYTPSIQLLY
Sbjct  181   GSQKALSLPTGMGILCASPKALEASKTAKSVRVFFDWNDYLKFYKFGTYWPYTPSIQLLY  240

Query  567   glragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLK  454
             GLRA LDL+FEEGLDNVI+RH RL  ATRLAV+AWGLK
Sbjct  241   GLRAALDLIFEEGLDNVISRHRRLAKATRLAVEAWGLK  278



>ref|XP_003617694.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00653.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=350

 Score =   494 bits (1271),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 269/402 (67%), Positives = 299/402 (74%), Gaps = 53/402 (13%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MD+   P RNHLFVPG  NIP+ VI   T             LTKTLL+DVKKIFKT  G
Sbjct  1     MDFAYGPERNHLFVPGSTNIPEHVIPITT-------------LTKTLLDDVKKIFKTVYG  47

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
               FLIPTTG    ESALTNT+SPG R +SFLIGQFSLLWI+QQ+RLNF VDVVESEWGQG
Sbjct  48    ISFLIPTTGI---ESALTNTMSPGYRTISFLIGQFSLLWIEQQKRLNFKVDVVESEWGQG  104

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             ANL+               AICIVHNET TGVTNNL         YQHPAL++ D V SI
Sbjct  105   ANLE---------------AICIVHNETTTGVTNNLT-------KYQHPALIIGDAVFSI  142

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
              A+DFRMDEWGVDV +T SQKALSLPTG+GIVCA PKA+E                YLK 
Sbjct  143   GALDFRMDEWGVDVVVTSSQKALSLPTGMGIVCAGPKAIE--------------NGYLKC  188

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y +GTYWPYTPSI LLYGLRA LDL+FEEG +NVI RH RL  ATRLAV+AWGLKNC Q+
Sbjct  189   YNLGTYWPYTPSIPLLYGLRAALDLIFEEGFENVILRHKRLTKATRLAVEAWGLKNCCQQ  248

Query  438   EE-WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQL  262
             EE W+S +VTA++VP  ID+ EIV RAWKRYNLSLG GLNKVAGKVFRIGH+GNLNELQL
Sbjct  249   EEEWYSASVTAIIVPPNIDNGEIVSRAWKRYNLSLGGGLNKVAGKVFRIGHVGNLNELQL  308

Query  261   LGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             LGCLAGVEM+LK++GY +KLGSGVAAASAYL N  P+IPSRI
Sbjct  309   LGCLAGVEMILKEVGYLLKLGSGVAAASAYLLNNVPLIPSRI  350



>gb|AGL09525.1| alanine-glyoxylate aminotransferase, partial [Manekia incurva]
Length=267

 Score =   488 bits (1256),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 248/266 (93%), Positives = 257/266 (97%), Gaps = 0/266 (0%)
 Frame = -3

Query  1251  RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVS  1072
             RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSP DRIVS
Sbjct  2     RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPCDRIVS  61

Query  1071  FLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETA  892
             FLIGQFSLLWIDQQQRL FNVDVVES+WGQGANLD+LASKLA DT HTIKAICIVHNETA
Sbjct  62    FLIGQFSLLWIDQQQRLGFNVDVVESDWGQGANLDILASKLASDTTHTIKAICIVHNETA  121

Query  891   TGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGI  712
             TGVTNNLATVRK+LD Y+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTGI
Sbjct  122   TGVTNNLATVRKILDTYKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGI  181

Query  711   GIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEE  532
             GIVCASPKALEASKT+KSVRVFFDW DYLKFYKMGT+WPYTPSIQLLYGLRA LDLLFEE
Sbjct  182   GIVCASPKALEASKTSKSVRVFFDWNDYLKFYKMGTFWPYTPSIQLLYGLRAALDLLFEE  241

Query  531   GLDNVIARHTRLGTATRLAVQAWGLK  454
             GL+NVIARH RLG ATRLAV+AWGLK
Sbjct  242   GLENVIARHGRLGKATRLAVEAWGLK  267



>ref|XP_003615391.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES98349.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=343

 Score =   476 bits (1224),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 259/401 (65%), Positives = 291/401 (73%), Gaps = 58/401 (14%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MD+   PGRNHLFVPG              NNE++R+PA+ ALTKTLL+DVKKIFKTTS 
Sbjct  1     MDFAYGPGRNHLFVPG--------------NNENHRTPAITALTKTLLDDVKKIFKTTSR  46

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
              PFLIPTT                   V FLIGQFSLLWI+QQ+ LNF +DVVESEWGQG
Sbjct  47    IPFLIPTT-------------------VYFLIGQFSLLWIEQQKCLNFKIDVVESEWGQG  87

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
              +LD L SKLA D  HTIKAICIVHNET T        +      YQHP+L++VD VSSI
Sbjct  88    VDLDALESKLASDKTHTIKAICIVHNETTT------CNIIDFKYKYQHPSLIIVDAVSSI  141

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
              A+DFRMDEWGVDV +T SQKALSL TG+GIVCA PKA+EASK+A S+R FFDW  YLK 
Sbjct  142   GALDFRMDEWGVDVVVTSSQKALSLSTGMGIVCAGPKAIEASKSATSLRSFFDWNGYLKC  201

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
             Y +GTYWPYTPSIQLLYGLRA LDL+FEEG +NVI RH       +L V           
Sbjct  202   YNLGTYWPYTPSIQLLYGLRAALDLVFEEGFENVILRH-------KLVV-----------  243

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
              EW+S +VTA+V P  IDS EIV RAWKR NLSLG GLNKVAGKVFRIGH+G+LNELQLL
Sbjct  244   -EWYSASVTAIVGPPNIDSGEIVSRAWKRCNLSLGGGLNKVAGKVFRIGHVGHLNELQLL  302

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             GCLAGVEM LKD+GYPV+LGSGVAAASAYL N  P+IPSRI
Sbjct  303   GCLAGVEMTLKDVGYPVQLGSGVAAASAYLLNNVPIIPSRI  343



>gb|AGL09531.1| alanine-glyoxylate aminotransferase, partial [Zippelia begoniifolia]
Length=259

 Score =   469 bits (1208),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 237/259 (92%), Positives = 249/259 (96%), Gaps = 0/259 (0%)
 Frame = -3

Query  1242  EDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLI  1063
             EDYRSPAVPALTKTLL+DVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLI
Sbjct  1     EDYRSPAVPALTKTLLQDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFLI  60

Query  1062  GQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETATGV  883
             GQFSLLWIDQQQRL FNVDVVES+WGQGANLD+LASKLA DT+HTIKAICIVHNETATGV
Sbjct  61    GQFSLLWIDQQQRLGFNVDVVESDWGQGANLDILASKLASDTSHTIKAICIVHNETATGV  120

Query  882   TNNLATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIV  703
             TNNLATVR +LD Y+HPALLLVDGVSSICA+DFRMDEW VDVALTGSQKALSLPTG+GI+
Sbjct  121   TNNLATVRNILDTYKHPALLLVDGVSSICALDFRMDEWEVDVALTGSQKALSLPTGMGIL  180

Query  702   CASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLD  523
             CASPKALEASKT+KSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLD
Sbjct  181   CASPKALEASKTSKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLD  240

Query  522   NVIARHTRLGTATRLAVQA  466
             NVI RH RLG ATRLAV+A
Sbjct  241   NVIDRHARLGKATRLAVEA  259



>gb|AGL09529.1| alanine-glyoxylate aminotransferase, partial [Thottea sp. JN-2013]
Length=252

 Score =   461 bits (1187),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 231/252 (92%), Positives = 244/252 (97%), Gaps = 0/252 (0%)
 Frame = -3

Query  1251  RNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVS  1072
             RNNEDYRSPAVP LTKTLLEDVKKIFKTT+GTPFLIPTTGTGAWESALTNTLSPGDRIVS
Sbjct  1     RNNEDYRSPAVPLLTKTLLEDVKKIFKTTAGTPFLIPTTGTGAWESALTNTLSPGDRIVS  60

Query  1071  FLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKLAEDTAHTIKAICIVHNETA  892
             FLIGQFSLLWIDQQQRLNFNVDVVES+WG+GA+L+VLASKLA DT+HTIKAIC+VHNETA
Sbjct  61    FLIGQFSLLWIDQQQRLNFNVDVVESDWGRGADLEVLASKLAADTSHTIKAICLVHNETA  120

Query  891   TGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGI  712
             TGVTNNLA VR++LDHY HPAL LVDGVSSICA+DFRMDEWG+DVALTGSQKALSLPTG+
Sbjct  121   TGVTNNLAAVRRILDHYGHPALFLVDGVSSICALDFRMDEWGIDVALTGSQKALSLPTGM  180

Query  711   GIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEE  532
             GIVCAS KALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEE
Sbjct  181   GIVCASDKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAALDLVFEE  240

Query  531   GLDNVIARHTRL  496
             GLDNVIARH RL
Sbjct  241   GLDNVIARHNRL  252



>ref|XP_005709273.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
 gb|EME32753.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
Length=400

 Score =   461 bits (1187),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 223/390 (57%), Positives = 293/390 (75%), Gaps = 1/390 (0%)
 Frame = -3

Query  1317  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  1138
             G+N L VPGP N+PD+V+RAM RN+ED+RSP  PAL KT+LE++K +F TT G  F+ P 
Sbjct  5     GKNFLMVPGPTNVPDRVLRAMHRNSEDHRSPDFPALAKTVLENIKWVFGTTKGRSFIFPA  64

Query  1137  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  958
             +GTGAWE+ALTNTL+ GD+++S   GQFS LWID  QRL   V +++ +WG+G  +D+L+
Sbjct  65    SGTGAWEAALTNTLNKGDKVISVRFGQFSHLWIDMMQRLGLEVTILDVDWGEGIPIDILS  124

Query  957   SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFRM  778
             S +A+DT H  +A+C+VHNET TGVT ++A VR +LD Y HPALL+VDGVSSI +I F+M
Sbjct  125   SYIAQDTRHEYQAVCVVHNETTTGVTTDIAAVRNILDRYHHPALLMVDGVSSIASIPFKM  184

Query  777   DEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYW  598
             DEW VD+A+TGSQK L LP G+G+VCAS KALE SK     RVFF ++D +    +G Y+
Sbjct  185   DEWKVDLAITGSQKGLMLPAGLGMVCASEKALERSKKNNLHRVFFSFEDMIVNNDVG-YF  243

Query  597   PYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDT  418
             PYTPSI LLYGL+  L +L EEGL++V  RH RL    R AV+AWGLK C +  + +SDT
Sbjct  244   PYTPSIPLLYGLKESLAMLMEEGLESVYVRHRRLAHGVRRAVEAWGLKTCCKNPKEYSDT  303

Query  417   VTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVE  238
             VTAVVVP   D+ ++++ A+++YNLSLG GL KV G+VFRIGHLG+LNEL +L  LAG E
Sbjct  304   VTAVVVPEGFDAQQVIRIAYEKYNLSLGAGLMKVRGRVFRIGHLGDLNELMVLATLAGTE  363

Query  237   MVLKDIGYPVKLGSGVAAASAYLQNTTPMI  148
             M + ++G P+KLGSGVAAAS Y   T+  +
Sbjct  364   MAMLEVGIPIKLGSGVAAASEYYMKTSKQV  393



>ref|XP_008666471.1| PREDICTED: serine--glyoxylate aminotransferase-like [Zea mays]
 tpg|DAA47907.1| TPA: hypothetical protein ZEAMMB73_592349 [Zea mays]
Length=262

 Score =   453 bits (1166),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 223/258 (86%), Positives = 243/258 (94%), Gaps = 0/258 (0%)
 Frame = -3

Query  909  VHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKAL  730
            +HNETATGVTN+LA VR LLD + HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKAL
Sbjct  5    MHNETATGVTNDLAAVRALLDKHAHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKAL  64

Query  729  SLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragl  550
            S+PTG+GIVCASP+ALEASKTA+SVRVFFDWKDYL+FY MGTYWPYTPSIQLLYGLR  L
Sbjct  65   SMPTGMGIVCASPRALEASKTARSVRVFFDWKDYLRFYDMGTYWPYTPSIQLLYGLRTAL  124

Query  549  dlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIV  370
            DL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QKEEWFSDTVTAVVVP  IDS+E+V
Sbjct  125  DLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQKEEWFSDTVTAVVVPPNIDSAEVV  184

Query  369  KRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGV  190
            + AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCL+GVEMVLKD+GYPVKLGSGV
Sbjct  185  RHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDVGYPVKLGSGV  244

Query  189  AAASAYLQNTTPMIPSRI  136
            AAA+AYL N+TP+IPSRI
Sbjct  245  AAAAAYLSNSTPLIPSRI  262



>dbj|BAQ46928.1| serine--glyoxylate aminotransferase [Methylobacterium aquaticum]
Length=396

 Score =   453 bits (1166),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 226/387 (58%), Positives = 289/387 (75%), Gaps = 1/387 (0%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGRN LFVPGP NIPD+V RAM   +ED+RS A P LT  L E+ KKIFK+  G  FL P
Sbjct  7     PGRNFLFVPGPTNIPDRVQRAMIVPSEDHRSSAFPELTLPLFEETKKIFKSREGQIFLFP  66

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
              TGTGAWE+ALTNTLSPGDR+++   GQFS LWID  +R+  +V+V E EWG+GA+ D +
Sbjct  67    ATGTGAWEAALTNTLSPGDRVLAPRYGQFSTLWIDLARRVGLDVEVQEEEWGKGADPDRI  126

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
                L  D  H IKA+ +VHNET TGVT+++  VRK +D   HPA+L VDGVS+I +IDFR
Sbjct  127   EEALRADREHRIKAVLVVHNETTTGVTSDIGAVRKAIDAAGHPAMLFVDGVSAIGSIDFR  186

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
              +EW VD A+TGSQK L LP G+GIVCAS +ALEASKTA+  RVFFD+ D  K    G Y
Sbjct  187   AEEWRVDCAITGSQKGLMLPAGLGIVCASKRALEASKTAECRRVFFDFGDQAKANATG-Y  245

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  421
             +PYTP++ +LYGLR  L  + +EGL+NV ARH RL  +TR AV+AWGL  C ++E+W+SD
Sbjct  246   FPYTPALPMLYGLREALRCVEDEGLENVFARHRRLADSTRAAVEAWGLTLCAKEEKWYSD  305

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             TV+AV+VP  ++ +E++  A+KRYNL+LG GL++VAGK+FRIGH+G+LNEL LLG LAGV
Sbjct  306   TVSAVMVPDGVNGAEVIDIAYKRYNLALGAGLSQVAGKLFRIGHIGDLNELMLLGALAGV  365

Query  240   EMVLKDIGYPVKLGSGVAAASAYLQNT  160
             EM + D G  ++ GSGVAAA   L+ +
Sbjct  366   EMAMLDAGIRIEPGSGVAAAQKSLRGS  392



>ref|WP_040580464.1| serine--glyoxylate aminotransferase [Methyloferula stellata]
Length=404

 Score =   451 bits (1161),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 222/391 (57%), Positives = 287/391 (73%), Gaps = 1/391 (0%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGR+ LFVPGP N+PD+++RAM    ED+R+P  P LTK +LED+KKIFKTT+G  F+ P
Sbjct  10    PGRHFLFVPGPTNVPDRILRAMHVPMEDHRNPTFPDLTKPILEDLKKIFKTTTGQCFVYP  69

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
             +TGTG WE+ALTNTLSPGD+++    GQFS LW D  QR+  +V V++ EWG G + + +
Sbjct  70    STGTGGWEAALTNTLSPGDKVIVSRYGQFSALWTDLAQRIGLDVQVIDEEWGTGTHPEHI  129

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
              + L  D  H IK + +V NETATGVT+++  VRK +D  +HPALL VDGVSSI  IDFR
Sbjct  130   HAILEADKEHKIKGVLVVQNETATGVTSDVGAVRKAMDAAKHPALLYVDGVSSIGCIDFR  189

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
             MDEWGVD+A+ GSQK   LP G+ IV AS KALEA  TAK  RVFF+++D +K    G Y
Sbjct  190   MDEWGVDLAVAGSQKGFMLPAGLAIVGASQKALEARHTAKCARVFFNFEDMIKSNATG-Y  248

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  421
             +PYTPS+ LLYGLR  + ++FEEG +NV  RH  L +  R AV AWGLKNC  + +WFSD
Sbjct  249   FPYTPSLPLLYGLRESMKMMFEEGQENVFQRHHYLASGVRAAVSAWGLKNCATEPKWFSD  308

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             TVTA+VVP   + ++++  A++RYNL+LG GL KVAGKVFRIGHLG+LNEL +LG LAG 
Sbjct  309   TVTAIVVPEGFNGADVIATAYRRYNLALGAGLAKVAGKVFRIGHLGDLNELMVLGALAGA  368

Query  240   EMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  148
             EM + DIG  ++ GSGVAAA  Y +++  +I
Sbjct  369   EMSMLDIGIKIEPGSGVAAAQNYFRSSNSVI  399



>ref|WP_026610206.1| serine--glyoxylate aminotransferase [Methylocaldum szegediense]
Length=394

 Score =   448 bits (1153),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 225/394 (57%), Positives = 281/394 (71%), Gaps = 1/394 (0%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGR HL+VPGP NIPD ++ AM    ED+R P  P L + LLED+KKIF+T SG  F+ P
Sbjct  2     PGRTHLYVPGPTNIPDSILSAMHVPMEDHRRPDFPELIQPLLEDLKKIFQTKSGQCFIFP  61

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
              TGT  WE ALTNTLSPGD+++++  GQFS LWID  +RL F+V+  E  WG+G  LD L
Sbjct  62    ATGTAGWEIALTNTLSPGDKVLAYRFGQFSHLWIDMARRLGFDVEYEEVPWGEGVPLDRL  121

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
              ++L  DT H IKA+ I HNETATGVT++LA VRK LD   HPA+  VDGVSSI +IDFR
Sbjct  122   EARLKADTKHEIKALLICHNETATGVTSDLAGVRKALDAANHPAMFFVDGVSSIASIDFR  181

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
             MDEWG+D+ L GSQK   LP G+ ++C S KALEA  TAKS R F D +D++     G Y
Sbjct  182   MDEWGIDIGLAGSQKGFMLPAGLALLCFSQKALEARHTAKSRRCFLDIQDHITNNASG-Y  240

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  421
             +PYTPSI LLYGLR  +DLL EEGL NV ARH RL    R AV+AWGL+ C +  +W+S+
Sbjct  241   FPYTPSIPLLYGLRKAIDLLLEEGLQNVFARHQRLAEGVRRAVKAWGLELCARDPKWYSN  300

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             TV+A+VVP   D+ +++  A+ RYNLSLG GL++VAGKVFRIGHLG+LNEL L   +AG 
Sbjct  301   TVSAIVVPQGYDARDVMHYAYHRYNLSLGAGLSEVAGKVFRIGHLGDLNELMLCSAIAGA  360

Query  240   EMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  139
             EM ++D+G  V  GSGVAAA  Y + T P +  R
Sbjct  361   EMAMRDVGIQVTPGSGVAAACEYWRETAPAVKPR  394



>ref|WP_045369065.1| serine--glyoxylate aminotransferase [Methyloceanibacter caenitepidi]
Length=403

 Score =   448 bits (1152),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 218/387 (56%), Positives = 286/387 (74%), Gaps = 1/387 (0%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGRN LFVPGP N+PD+++RAM    ED+RSP  P+LT  L E++KK+F+T  G   + P
Sbjct  7     PGRNFLFVPGPTNVPDRILRAMHVPMEDHRSPDFPSLTIPLFEEMKKVFQTREGQVVIFP  66

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
             ++GTGAWESALTNTLSPGD++++   GQFS LWI+  +R    V V E EWG GA+ D +
Sbjct  67    SSGTGAWESALTNTLSPGDKLLAPRFGQFSHLWIELARRHGLEVVVQEEEWGTGADPDRI  126

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
                L  D AH IK I +VHNETATGVT+++A VR+ +D   HPALL VDGVSSI +IDFR
Sbjct  127   EEALRADKAHEIKGILVVHNETATGVTSDVAAVRRAIDAAGHPALLYVDGVSSIGSIDFR  186

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
              DEWGVD+A+TGSQK + LP G+GIVCASPKAL    TA   R +F+  D+ K    G Y
Sbjct  187   FDEWGVDLAITGSQKGMMLPAGLGIVCASPKALARMDTATCTRAYFNLADHFK-ANAGGY  245

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  421
             +PYTP++ LLYGLR  L ++FEEGLDN+ ARH  L + TR AV AWGL  C ++ +W SD
Sbjct  246   FPYTPALPLLYGLRESLAMMFEEGLDNIFARHRYLASGTRAAVDAWGLSLCAKEPKWQSD  305

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             TV+A++VP+  + ++++ RA++RYNL+LG GL++VAGK+FRIGHLG+LNEL LLG ++G 
Sbjct  306   TVSAIMVPAGFNGADVIDRAYRRYNLALGAGLSEVAGKLFRIGHLGDLNELMLLGAISGA  365

Query  240   EMVLKDIGYPVKLGSGVAAASAYLQNT  160
             EM ++D+G  V+ GSGVAAA  Y +N 
Sbjct  366   EMSMRDVGIQVEPGSGVAAAQEYFRNA  392



>ref|WP_017485211.1| serine--glyoxylate aminotransferase [Methylobacterium sp. MB200]
Length=402

 Score =   444 bits (1142),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 228/397 (57%), Positives = 282/397 (71%), Gaps = 6/397 (2%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             M     PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T G
Sbjct  1     MAATRRPGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             T FL P +GTG WESALTNTL+ GD++++   GQFS LWID  QRL  +V V E EWG G
Sbjct  61    TIFLFPASGTGIWESALTNTLARGDKVLTARYGQFSHLWIDMAQRLGLDVIVQEEEWGTG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A  D +   L  D  H IKA+ +VHNETATGVT+N+  VRK +D   HPA+L VDGVSSI
Sbjct  121   AKADKIEEALRADKDHQIKAVMVVHNETATGVTSNIGAVRKAIDAAGHPAMLFVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFFDWK  634
              ++ F  DEW VD A+ GSQK L LP G+G++C S KAL+A+     +  +  RV+FDW+
Sbjct  181   GSLPFYADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVYFDWE  240

Query  633   DYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLK  454
             D+ K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AWGLK
Sbjct  241   DHKKQNPAG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWGLK  299

Query  453   NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  274
              C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LN
Sbjct  300   TCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGDLN  359

Query  273   ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQN  163
             EL LLG +AG EM L D G  V  GSGVAAAS+YL+ 
Sbjct  360   ELSLLGAIAGAEMSLLDNGVKVTPGSGVAAASSYLRE  396



>ref|WP_015950680.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ACK82978.1| aminotransferase class V [Methylobacterium extorquens CM4]
Length=402

 Score =   443 bits (1140),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 228/398 (57%), Positives = 282/398 (71%), Gaps = 6/398 (2%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             M     PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T G
Sbjct  1     MAATRRPGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             T FL P +GTG WESAL+NTL+ GD++V+   GQFS LWID  QRL  +V V E EWG G
Sbjct  61    TIFLFPASGTGIWESALSNTLARGDKVVAARFGQFSHLWIDMAQRLGLDVVVQEEEWGTG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A  + +   L  D  H IKA+ +VHNETATGVT+N+  VRK +D   HPALL VDGVSSI
Sbjct  121   AKPEKIEEALRADKNHEIKAVMVVHNETATGVTSNIGAVRKAIDAAGHPALLFVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFFDWK  634
              ++ F+ DEW VD A+ GSQK L LP G+G++C S KAL+A+     +  +  RV+FDW+
Sbjct  181   GSLPFKADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVYFDWE  240

Query  633   DYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLK  454
             D  K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AWGLK
Sbjct  241   DQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWGLK  299

Query  453   NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  274
              C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LN
Sbjct  300   TCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGDLN  359

Query  273   ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  160
             EL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  360   ELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_003597639.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 sp|P55819.2|SGAA_METEA RecName: Full=Serine--glyoxylate aminotransferase; Short=SGAT 
[Methylobacterium extorquens AM1]
 gb|ACS39570.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
AM1]
 emb|CAX24121.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
DM4]
 gb|EHP94104.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
DSM 13060]
Length=402

 Score =   442 bits (1138),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 227/398 (57%), Positives = 282/398 (71%), Gaps = 6/398 (2%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             M     PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T G
Sbjct  1     MAATRRPGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             T FL P +GTG WESAL+NTL+ GD++++   GQFS LWID  QRL  +V V E EWG G
Sbjct  61    TIFLFPASGTGIWESALSNTLARGDKVLAARFGQFSHLWIDMAQRLGLDVVVQEEEWGTG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A  + +   L  D  H IKA+ +VHNETATGVT+N+  VRK +D   HPALL VDGVSSI
Sbjct  121   AKPEKIEEALRADKNHEIKAVMVVHNETATGVTSNIGAVRKAIDAAGHPALLFVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFFDWK  634
              ++ F+ DEW VD A+ GSQK L LP G+G++C S KAL+A+     +  +  RV+FDW+
Sbjct  181   GSLPFKADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVYFDWE  240

Query  633   DYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLK  454
             D  K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AWGLK
Sbjct  241   DQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWGLK  299

Query  453   NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  274
              C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LN
Sbjct  300   TCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGDLN  359

Query  273   ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  160
             EL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  360   ELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_036260471.1| serine--glyoxylate aminotransferase [Methylocapsa aurea]
Length=412

 Score =   442 bits (1138),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 217/384 (57%), Positives = 281/384 (73%), Gaps = 1/384 (0%)
 Frame = -3

Query  1317  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  1138
             GR+ LFVPGP N+PD+V+RAM    ED+RS   P LT  L +D+KK+FK+T G  F+ P+
Sbjct  3     GRHFLFVPGPTNVPDRVLRAMLVAMEDHRSSKFPELTLPLFQDLKKVFKSTDGQVFIFPS  62

Query  1137  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  958
             +GTGAWE+  +NTLSPGD++++   GQFS LWID  QRL  +V V+E EWG G   + + 
Sbjct  63    SGTGAWEAGFSNTLSPGDKVLASRFGQFSHLWIDMAQRLGLDVQVLEEEWGTGVKPEKIE  122

Query  957   SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFRM  778
               L  D AH IK +  VHNETATGVT+++  VRK +D   HPALL VDGVSSI ++DFR 
Sbjct  123   EILRADKAHAIKGVMAVHNETATGVTSDIGAVRKAIDAANHPALLFVDGVSSIGSLDFRT  182

Query  777   DEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYW  598
             DEW VD+A+ GSQK L LP G+GIVCASP+ALEASKTA   RVFFD+ D +K    G Y+
Sbjct  183   DEWRVDLAIAGSQKGLMLPAGLGIVCASPRALEASKTAGLKRVFFDFNDMIKANATG-YF  241

Query  597   PYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDT  418
             PYTP++ +LYGLR  L +LFEE L++V  RH  L    R AV+AWGLK C  + +W+SDT
Sbjct  242   PYTPALPMLYGLRESLKILFEEKLEHVFERHHVLAGGVRAAVKAWGLKPCATEPKWYSDT  301

Query  417   VTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVE  238
             VTA+VVP  I+ ++++  A++RYNLSLG GL++VAGKVFRIGHLG+LN+L +LG + G E
Sbjct  302   VTAIVVPPGINGADVIDAAYRRYNLSLGAGLSQVAGKVFRIGHLGDLNDLMVLGAIGGAE  361

Query  237   MVLKDIGYPVKLGSGVAAASAYLQ  166
             M + D+G  VKLGSGV AA A+ +
Sbjct  362   MAMADVGIDVKLGSGVGAAQAHFR  385



>gb|KJB54393.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=306

 Score =   438 bits (1126),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 216/238 (91%), Positives = 231/238 (97%), Gaps = 0/238 (0%)
 Frame = -3

Query  849  DHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASK  670
            DHY+HPALLLVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK
Sbjct  69   DHYRHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASK  128

Query  669  TAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGT  490
            +AKSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARHTR+G 
Sbjct  129  SAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHTRMGK  188

Query  489  ATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAG  310
            ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAG
Sbjct  189  ATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAG  248

Query  309  KVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
            KVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  249  KVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  306


 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             MDYV  PG+NHLFVPGPVNIP+ V+RAM RNNEDYRSPA+PA+TK LLEDVKKIFKT++G
Sbjct  1     MDYVYGPGKNHLFVPGPVNIPEPVLRAMNRNNEDYRSPAIPAMTKNLLEDVKKIFKTSTG  60

Query  1158  TPFLIPTT  1135
             TPFLIPTT
Sbjct  61    TPFLIPTT  68



>ref|WP_012253362.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ABY30194.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
PA1]
Length=402

 Score =   441 bits (1135),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 226/398 (57%), Positives = 282/398 (71%), Gaps = 6/398 (2%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             M     PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T G
Sbjct  1     MAATRRPGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             T FL P +GTG WESAL+NTL+ GD++++   GQFS LWID  QRL  +V V E EWG G
Sbjct  61    TIFLFPASGTGIWESALSNTLARGDKVLAARFGQFSHLWIDMAQRLGLDVVVQEEEWGTG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A  + +   L  D  H IKA+ +VHNETATGVT+N+  VRK +D   HPALL VDGVSSI
Sbjct  121   AKPEKIEEALRADKNHEIKAVMVVHNETATGVTSNIGAVRKAIDAAGHPALLFVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFFDWK  634
              ++ F+ DEW VD A+ GSQK L LP G+G++C S +AL+A+     +  +  RV+FDW+
Sbjct  181   GSLPFKADEWKVDCAIAGSQKGLMLPAGLGVICVSQRALKAAEGQSGRNDRLARVYFDWE  240

Query  633   DYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLK  454
             D  K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AWGLK
Sbjct  241   DQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWGLK  299

Query  453   NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  274
              C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LN
Sbjct  300   TCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGDLN  359

Query  273   ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  160
             EL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  360   ELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_012453656.1| serine--glyoxylate aminotransferase [Methylobacterium populi]
 gb|ACB79910.1| aminotransferase class V [Methylobacterium populi BJ001]
Length=402

 Score =   441 bits (1134),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 227/398 (57%), Positives = 282/398 (71%), Gaps = 6/398 (2%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             M     PGRNHLFVPGP NIPD+V+RAM   +ED+RS   P+LTK L ED KK+F +T G
Sbjct  1     MAATRRPGRNHLFVPGPTNIPDRVMRAMMVQSEDHRSVDFPSLTKPLFEDTKKVFGSTEG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             T FL P +GTG WESALTNTL+ GD++++   GQFS LWID  QRL  +V V E EWG G
Sbjct  61    TIFLFPASGTGIWESALTNTLARGDKVLTSRYGQFSHLWIDMAQRLGLDVIVQEEEWGTG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A  + +   L  D  H IKA+ +VHNETATGVT+N+  VRK +D   HPA+L VDGVSSI
Sbjct  121   AKPEKIEEALRADKNHEIKAVMVVHNETATGVTSNIGAVRKAIDAAGHPAMLFVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFFDWK  634
              ++ F  DEW VD A+ GSQK L LP G+G++C S KAL+A+     +  +  RV+FDW+
Sbjct  181   GSLPFYADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVYFDWE  240

Query  633   DYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLK  454
             D+ K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AWGLK
Sbjct  241   DHKKQNPAG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWGLK  299

Query  453   NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  274
              C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LN
Sbjct  300   TCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGDLN  359

Query  273   ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  160
             EL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  360   ELSLLGAIAGAEMSLLDNGVNVTPGSGVAAASSYLREN  397



>ref|WP_026608295.1| serine--glyoxylate aminotransferase [Methylocapsa acidiphila]
Length=412

 Score =   441 bits (1133),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 214/387 (55%), Positives = 287/387 (74%), Gaps = 1/387 (0%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGR+ LFVPGP N+PD+V RAM    ED+RS   P LT  L ED+KK+FK+  G  F+ P
Sbjct  2     PGRHFLFVPGPTNVPDRVQRAMLVAMEDHRSSKFPELTLPLFEDLKKVFKSVDGQVFIFP  61

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
             ++GTGAWE++L+NTLSPGD++++   GQFS LWID  QRL  +V V+E EWG G   + +
Sbjct  62    SSGTGAWEASLSNTLSPGDKVLASRFGQFSHLWIDLAQRLGLDVQVLEEEWGTGVKPEKI  121

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
              + L ED +H IKA+  VHNETATGVT+++  VRK +D   HPALL VDGVSSI ++DFR
Sbjct  122   EAILREDKSHQIKAVLAVHNETATGVTSDIGAVRKAIDAANHPALLYVDGVSSIGSLDFR  181

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
              DEW VD+A+ GSQK L LP G+GIVCASP+AL A+KTA   RV+FD+ D +K    G Y
Sbjct  182   ADEWRVDLAIAGSQKGLMLPAGLGIVCASPRALAATKTAGLKRVYFDFADMIKANATG-Y  240

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  421
             +PYTP++ +LYGLR  + +LFEE L++V  RH  L    R AV+AWGL  C ++ +W SD
Sbjct  241   FPYTPALPMLYGLRESMRILFEEKLEHVFERHHVLAGGVRAAVKAWGLHPCAKEAKWDSD  300

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             TVTA+VVP+ I+ ++++  A++RYNLSLG GL++VAGKVFRIGHLG+LN+L +LG +AG 
Sbjct  301   TVTAIVVPAGINGADVIDTAYRRYNLSLGAGLSQVAGKVFRIGHLGDLNDLMVLGAIAGA  360

Query  240   EMVLKDIGYPVKLGSGVAAASAYLQNT  160
             EM ++D+G  ++LGSGV AA  + ++T
Sbjct  361   EMAMRDVGIDIQLGSGVGAAQEHFRST  387



>gb|ABM96214.1| serine-glyoxylate aminotransferase [Methylibium petroleiphilum 
PM1]
Length=415

 Score =   439 bits (1129),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 219/386 (57%), Positives = 285/386 (74%), Gaps = 2/386 (1%)
 Frame = -3

Query  1317  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  1138
             GRN LFVPGP N+P++V RAM  + ED+RS   P LTK++LED+K +FKTT+GTP + P 
Sbjct  3     GRNFLFVPGPTNVPERVQRAMVVSMEDHRSSKFPDLTKSVLEDLKAVFKTTTGTPIIFPA  62

Query  1137  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  958
             TGTG WE+ALTNTLSPGD +++   GQFS LWID   RL F V+ VE EWG+G  ++  A
Sbjct  63    TGTGGWEAALTNTLSPGDLVLASRFGQFSHLWIDMITRLGFQVETVECEWGEGVPVEKYA  122

Query  957   SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFRM  778
               LA+D  H IKA+   HNETATGVT+++A VRK LD  +HPALLLVD VSS+ +IDFRM
Sbjct  123   EILAKDKGHKIKAVIATHNETATGVTSDIAGVRKALDDARHPALLLVDAVSSLGSIDFRM  182

Query  777   DEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYW  598
             DEWGVD+ ++GSQK L LP G+GIVCAS KAL+A +++ + R FFD+ D +K    G Y+
Sbjct  183   DEWGVDICVSGSQKGLMLPAGLGIVCASEKALKARESSTAPRCFFDFGDMIKANATG-YF  241

Query  597   PYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKEEWFSD  421
             PYTP++ +LYGLR  L ++ EEGL+N+  RHT L +  R AV   W L  C +  +W+SD
Sbjct  242   PYTPALPMLYGLRESLTMIKEEGLENIFWRHTYLASGVRAAVLDGWKLGLCAKDPKWYSD  301

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             TV+A+VVP  I+ + ++  A++RYNLSLG GL+KVAGKVFRIGHLG+LNEL +LG LAG 
Sbjct  302   TVSAIVVPEGINGAHVIDVAFRRYNLSLGAGLSKVAGKVFRIGHLGDLNELMVLGALAGA  361

Query  240   EMVLKDIGYPVKLGSGVAAASAYLQN  163
             EM + D+G  ++ GSGVAAA  Y + 
Sbjct  362   EMSMLDVGIRIEPGSGVAAAQKYFRT  387



>ref|WP_041930245.1| serine--glyoxylate aminotransferase, partial [Methylibium petroleiphilum]
Length=395

 Score =   438 bits (1126),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 219/386 (57%), Positives = 285/386 (74%), Gaps = 2/386 (1%)
 Frame = -3

Query  1317  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  1138
             GRN LFVPGP N+P++V RAM  + ED+RS   P LTK++LED+K +FKTT+GTP + P 
Sbjct  3     GRNFLFVPGPTNVPERVQRAMVVSMEDHRSSKFPDLTKSVLEDLKAVFKTTTGTPIIFPA  62

Query  1137  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  958
             TGTG WE+ALTNTLSPGD +++   GQFS LWID   RL F V+ VE EWG+G  ++  A
Sbjct  63    TGTGGWEAALTNTLSPGDLVLASRFGQFSHLWIDMITRLGFQVETVECEWGEGVPVEKYA  122

Query  957   SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFRM  778
               LA+D  H IKA+   HNETATGVT+++A VRK LD  +HPALLLVD VSS+ +IDFRM
Sbjct  123   EILAKDKGHKIKAVIATHNETATGVTSDIAGVRKALDDARHPALLLVDAVSSLGSIDFRM  182

Query  777   DEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYW  598
             DEWGVD+ ++GSQK L LP G+GIVCAS KAL+A +++ + R FFD+ D +K    G Y+
Sbjct  183   DEWGVDICVSGSQKGLMLPAGLGIVCASEKALKARESSTAPRCFFDFGDMIKANATG-YF  241

Query  597   PYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKEEWFSD  421
             PYTP++ +LYGLR  L ++ EEGL+N+  RHT L +  R AV   W L  C +  +W+SD
Sbjct  242   PYTPALPMLYGLRESLTMIKEEGLENIFWRHTYLASGVRAAVLDGWKLGLCAKDPKWYSD  301

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             TV+A+VVP  I+ + ++  A++RYNLSLG GL+KVAGKVFRIGHLG+LNEL +LG LAG 
Sbjct  302   TVSAIVVPEGINGAHVIDVAFRRYNLSLGAGLSKVAGKVFRIGHLGDLNELMVLGALAGA  361

Query  240   EMVLKDIGYPVKLGSGVAAASAYLQN  163
             EM + D+G  ++ GSGVAAA  Y + 
Sbjct  362   EMSMLDVGIRIEPGSGVAAAQKYFRT  387



>ref|WP_018267457.1| serine--glyoxylate aminotransferase [Methylosinus sp. LW4]
Length=397

 Score =   438 bits (1126),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 216/382 (57%), Positives = 281/382 (74%), Gaps = 1/382 (0%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGRN LFVPGP NIPD+++RAM   +ED+RSP  P LT  L   +KK+FKT SG  F+ P
Sbjct  7     PGRNFLFVPGPTNIPDRILRAMNVVSEDHRSPKFPELTLPLFTQLKKVFKTESGQAFIFP  66

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
              +GTG WE+A+TNTLSPGD++++   GQF+ LWID  +R+  +V   + EWG G N D +
Sbjct  67    ASGTGGWEAAITNTLSPGDKVIAQRFGQFTHLWIDLAKRIGLDVIEQDEEWGVGNNPDRI  126

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
                L  D  H IKA+   HNETATGVT+++  VRK +D+ +HPALL VDGVSS+ ++DF+
Sbjct  127   EETLKADKNHEIKAVFATHNETATGVTSDIGAVRKAIDNAKHPALLFVDGVSSVGSLDFK  186

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
              DEWGVDVA++GSQK   LP G+ ++  S KAL+A +TAK  R +FD++D++K    G Y
Sbjct  187   QDEWGVDVAVSGSQKGFMLPAGLALLSVSQKALKAGETAKLHRAYFDFQDHVKANATG-Y  245

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  421
             +PYTP++ LLYGLR  L++LFEEGLD V ARH  L    R AV AWGLK C ++ +W SD
Sbjct  246   FPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKPCAKEAKWNSD  305

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             TVTA+VVP   D++++++ A+KRYNL+LG GLNKVAGKVFRIGHLG+LNEL LLG +AG 
Sbjct  306   TVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNKVAGKVFRIGHLGDLNELMLLGAIAGA  365

Query  240   EMVLKDIGYPVKLGSGVAAASA  175
             EM + D+G PV  GSGVAAA A
Sbjct  366   EMAMLDVGIPVTAGSGVAAAQA  387



>ref|WP_036230592.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylibium]
 gb|EWS54025.1| Soluble hydrogenase 42 kDa subunit [Methylibium sp. T29]
 gb|EWS61014.1| Soluble hydrogenase 42 kDa subunit [Methylibium sp. T29-B]
Length=415

 Score =   437 bits (1125),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 218/385 (57%), Positives = 285/385 (74%), Gaps = 2/385 (1%)
 Frame = -3

Query  1317  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  1138
             GRN LFVPGP N+P++V RAM  + ED+RS   P LTK++LED+K +FKTT+GTP + P 
Sbjct  3     GRNFLFVPGPTNVPERVQRAMVVSMEDHRSSKFPDLTKSVLEDLKAVFKTTNGTPIIFPA  62

Query  1137  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  958
             TGTG WE+ALTNTLSPGD +++   GQFS LWID   RL F V+ VE EWG+G  ++  A
Sbjct  63    TGTGGWEAALTNTLSPGDLVLASRFGQFSHLWIDMITRLGFQVETVECEWGEGVPVEKYA  122

Query  957   SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFRM  778
               L++D  H IKA+   HNETATGVT+++A VRK LD  +HPALLLVD VSS+ +IDFRM
Sbjct  123   EILSKDKGHRIKAVIATHNETATGVTSDIAGVRKALDDARHPALLLVDAVSSLGSIDFRM  182

Query  777   DEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYW  598
             DEWGVD+ ++GSQK L LP G+GIVCAS KAL+A +++ + R FFD+ D +K    G Y+
Sbjct  183   DEWGVDICVSGSQKGLMLPAGLGIVCASEKALKARESSTAPRCFFDFGDMIKANATG-YF  241

Query  597   PYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKEEWFSD  421
             PYTP++ +LYGLR  L ++ EEGL+N+  RHT L +  R AV   W L  C +  +W+SD
Sbjct  242   PYTPALPMLYGLRESLTMIKEEGLENIFWRHTYLASGVRAAVLDGWKLGLCAKDPKWYSD  301

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             TV+A+VVP  I+ + ++  A++RYNLSLG GL+KVAGKVFRIGHLG+LNEL +LG LAG 
Sbjct  302   TVSAIVVPEGINGAHVIDVAFRRYNLSLGAGLSKVAGKVFRIGHLGDLNELMVLGALAGA  361

Query  240   EMVLKDIGYPVKLGSGVAAASAYLQ  166
             EM + D+G  ++ GSGVAAA  Y +
Sbjct  362   EMSMLDVGIKIEPGSGVAAAQKYFR  386



>ref|WP_036293367.1| serine--glyoxylate aminotransferase [Methylosinus sp. PW1]
Length=397

 Score =   437 bits (1123),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 215/382 (56%), Positives = 281/382 (74%), Gaps = 1/382 (0%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGRN LFVPGP NIPD+++RAM   +ED+RSP  P LT  L   +KK+FKT +G  F+ P
Sbjct  7     PGRNFLFVPGPTNIPDRILRAMNVVSEDHRSPKFPELTLPLFTQLKKVFKTETGQAFIFP  66

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
              +GTG WE+A+TNTLSPGD++++   GQF+ LWID  +R+  +V   + EWG G N D +
Sbjct  67    ASGTGGWEAAITNTLSPGDKVIAQRFGQFTHLWIDLAKRIGLDVIEQDEEWGVGNNPDRI  126

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
                L  D  H IKA+   HNETATGVT+++  VRK +D+ +HPALL VDGVSS+ ++DF+
Sbjct  127   EETLKADKNHEIKAVFATHNETATGVTSDIGAVRKAIDNAKHPALLFVDGVSSVGSLDFK  186

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
              DEWGVDVA++GSQK   LP G+ ++  S KAL+A +TAK  R +FD++D++K    G Y
Sbjct  187   QDEWGVDVAVSGSQKGFMLPAGLALLSVSQKALKAGETAKLHRAYFDFQDHVKANATG-Y  245

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  421
             +PYTP++ LLYGLR  L++LFEEGLD V ARH  L    R AV AWGLK C ++ +W SD
Sbjct  246   FPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKPCAKEAKWNSD  305

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             TVTA+VVP   D++++++ A+KRYNL+LG GLNKVAGKVFRIGHLG+LNEL LLG +AG 
Sbjct  306   TVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNKVAGKVFRIGHLGDLNELMLLGAIAGA  365

Query  240   EMVLKDIGYPVKLGSGVAAASA  175
             EM + D+G PV  GSGVAAA A
Sbjct  366   EMAMLDVGIPVTAGSGVAAAQA  387



>ref|WP_024878012.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylocystaceae]
Length=397

 Score =   437 bits (1123),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 215/382 (56%), Positives = 280/382 (73%), Gaps = 1/382 (0%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGRN LFVPGP NIPD+++RAM   +ED+RSP  P LT  L   +KK+FKT S   F+ P
Sbjct  7     PGRNFLFVPGPTNIPDRILRAMNVVSEDHRSPKFPELTLPLFTQLKKVFKTESAQAFIFP  66

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
              +GTG WE+A+TNTLSPGD++++   GQF+ LWID  +R+  +V   + EWG G N D +
Sbjct  67    ASGTGGWEAAITNTLSPGDKVIAQRFGQFTHLWIDLAKRIGLDVIEQDEEWGVGNNPDRI  126

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
                L  D  H IKA+   HNETATGVT+++  VRK +D+ +HPA+L VDGVSS+ ++DF+
Sbjct  127   EETLKADKNHEIKAVFATHNETATGVTSDIGAVRKAIDNAKHPAMLFVDGVSSVGSLDFK  186

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
              DEWGVDVA++GSQK   LP G+ I+  S KAL+A +TAK  R +FD++D++K    G Y
Sbjct  187   QDEWGVDVAVSGSQKGFMLPAGLAIMSVSQKALKAGETAKLHRAYFDFQDHVKANATG-Y  245

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  421
             +PYTP++ LLYGLR  L++LFEEGLD V ARH  L    R AV AWGLK C ++ +W SD
Sbjct  246   FPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKPCAKEAKWNSD  305

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             TVTA+VVP   D++++++ A+KRYNL+LG GLNKVAGKVFRIGHLG+LNEL LLG +AG 
Sbjct  306   TVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNKVAGKVFRIGHLGDLNELMLLGAIAGA  365

Query  240   EMVLKDIGYPVKLGSGVAAASA  175
             EM + D+G PV  GSGVAAA A
Sbjct  366   EMAMLDVGIPVTAGSGVAAAQA  387



>ref|WP_012590731.1| serine--glyoxylate aminotransferase [Methylocella silvestris]
 gb|ACK50661.1| aminotransferase class V [Methylocella silvestris BL2]
Length=396

 Score =   437 bits (1123),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 212/390 (54%), Positives = 279/390 (72%), Gaps = 1/390 (0%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGR+ LFVPGP N+P++V RAM    ED+RSP  P LT  L +D+KKI+KT  G  FL P
Sbjct  2     PGRHFLFVPGPTNVPERVARAMVVPMEDHRSPKFPELTLPLFQDLKKIYKTKDGQVFLFP  61

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
             ++GTGAWESA  NTLSPGD+++    GQFS LWID  QR+ F+V ++E EWG G   + +
Sbjct  62    SSGTGAWESAFNNTLSPGDKVLMSRFGQFSHLWIDMAQRMGFDVQILEEEWGTGVKPEKI  121

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
                L  D +H IKA+   HNETATGV +++A VRK +D   HPALL VD VSS+ ++DFR
Sbjct  122   EEILRADKSHQIKAVTATHNETATGVASDIAAVRKAMDAAGHPALLFVDAVSSLGSLDFR  181

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
              DEWGVD+A++GSQK L LP G+G++  S KAL ASKTA S R +FD+ D +K    G Y
Sbjct  182   QDEWGVDLAVSGSQKGLMLPAGLGVLGVSQKALAASKTATSKRCYFDFDDMIKANATG-Y  240

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  421
             +PYTP + LLYGLR  L ++ +EGL+N+  RH+ L    R AV+AWGL  C ++ +W+SD
Sbjct  241   FPYTPPLPLLYGLRESLKMIEDEGLENIFVRHSHLAGGVRAAVKAWGLTPCAKEPKWYSD  300

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             TVTA+VVP   ++ +++  A+ RYNLSLG GL++VAGKVFRIGHLG+LNEL +LG LAG 
Sbjct  301   TVTAIVVPPQFNAVQVISTAYSRYNLSLGAGLSQVAGKVFRIGHLGDLNELMVLGALAGA  360

Query  240   EMVLKDIGYPVKLGSGVAAASAYLQNTTPM  151
             EM + D+G PV LGSGV AA ++ +   P+
Sbjct  361   EMAMADVGIPVTLGSGVGAAQSFYRAAAPV  390



>ref|WP_015933415.1| serine--glyoxylate aminotransferase [Methylobacterium nodulans]
 gb|ACL61852.1| aminotransferase class V [Methylobacterium nodulans ORS 2060]
Length=417

 Score =   436 bits (1122),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 217/387 (56%), Positives = 281/387 (73%), Gaps = 1/387 (0%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGRN LFVPGP N+P++V RAM    ED+RS + P LT  L E++KK+FK+  G  F+ P
Sbjct  7     PGRNFLFVPGPTNVPERVQRAMIVPMEDHRSSSFPDLTLPLFENMKKVFKSKDGQVFIFP  66

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
             ++GTGAWE+ALTNTLSPGDR+++   GQFS LWID  QR+  +V + + EWG GAN D +
Sbjct  67    SSGTGAWEAALTNTLSPGDRVLASRFGQFSTLWIDLAQRVGLDVVIQDEEWGTGANPDRI  126

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
                L  D  H IKA+ IVHNETATGVT+++  VR+ +D   HPA+L VDGVSSI +IDFR
Sbjct  127   EEALRADRDHRIKAVLIVHNETATGVTSDIGAVRRAIDAANHPAMLYVDGVSSIGSIDFR  186

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
               EWGVD A+TGSQK L LP G+GIVC SPKAL A KTA+  RV+FD+ D  K    G Y
Sbjct  187   ASEWGVDCAITGSQKGLMLPAGLGIVCVSPKALAAYKTAECRRVYFDFGDMSKANATG-Y  245

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  421
             +PYTP++ LLYGLR  +  LFEEGL+ V  RH  L    R AV+AWGL  C ++ +W+SD
Sbjct  246   FPYTPALPLLYGLRESMACLFEEGLERVFERHRVLADGCRAAVKAWGLTLCAKEPKWYSD  305

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             TV+A++VP  I+ ++++  A++RYNL+LG GL+KVAGK+FRIGHLG+LN+L LLG LAG 
Sbjct  306   TVSAIMVPEGINGADVIDIAFRRYNLALGAGLSKVAGKLFRIGHLGDLNDLMLLGALAGA  365

Query  240   EMVLKDIGYPVKLGSGVAAASAYLQNT  160
             EM + D G  ++ GSGVAAA  + + T
Sbjct  366   EMSMLDAGIKIEPGSGVAAAQQHFRET  392



>ref|XP_002953765.1| hypothetical protein VOLCADRAFT_75980 [Volvox carteri f. nagariensis]
 gb|EFJ45089.1| hypothetical protein VOLCADRAFT_75980 [Volvox carteri f. nagariensis]
Length=449

 Score =   437 bits (1124),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 223/394 (57%), Positives = 282/394 (72%), Gaps = 1/394 (0%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGRNHLFVPGPVNI ++V+RAM    +++R P      K  LED K I+ T   TPF+  
Sbjct  52    PGRNHLFVPGPVNIHERVLRAMHVPGQNHRDPWFAQFFKDCLEDTKLIYGTKEATPFIFS  111

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
              TGTG WE+ALTNTLSPGD++V F  G FS LWID  QRL  +V VV+  WG+GAN D+L
Sbjct  112   GTGTGGWEAALTNTLSPGDKVVCFRYGLFSHLWIDMMQRLGLDVQVVDRPWGEGANEDIL  171

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
                L +DT   IKA+ +VHNET TGVT+++A VRK +D   HPALLLVDGVSSI A++FR
Sbjct  172   EEILRKDTEKKIKAVAVVHNETTTGVTSDIAGVRKAMDAANHPALLLVDGVSSIGALEFR  231

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
             MD+W VDVA+TGSQKALSLPTG+  V ASPKALEA K+AK  RV++D+ D L+    G  
Sbjct  232   MDDWRVDVAVTGSQKALSLPTGLAFVAASPKALEAMKSAKLKRVYYDFADMLRTNPSGNV  291

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  421
              PYTPS+ +LYG+R  + +L EEG++NV ARH RLG   R AV+ WGLK   +   W SD
Sbjct  292   -PYTPSLAMLYGMRESIKMLREEGMENVFARHHRLGEGARRAVEGWGLKLLCKNPRWRSD  350

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             ++T V VP  IDS++IVK A+ +Y+LSLG+GL ++ GKVFRIGHLGN+NEL L+  LAG 
Sbjct  351   SLTVVEVPEGIDSNKIVKVAYAKYDLSLGIGLAQINGKVFRIGHLGNMNELMLVSALAGA  410

Query  240   EMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  139
             EM + D G P++ GSGV  A  Y Q T+ +I +R
Sbjct  411   EMAMIDAGVPIRPGSGVGKAIEYWQQTSSVIKTR  444



>ref|XP_005648727.1| serine glyoxylate aminotransferase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24183.1| serine glyoxylate aminotransferase [Coccomyxa subellipsoidea 
C-169]
Length=434

 Score =   436 bits (1122),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 228/394 (58%), Positives = 282/394 (72%), Gaps = 1/394 (0%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGRNHL VPGPVNI +QV+RAM R ++++R P  P   + +LED K IFKTT GTPF+ P
Sbjct  41    PGRNHLAVPGPVNIHEQVMRAMDRPSQNHRDPWFPPFFQQILEDTKYIFKTTEGTPFIFP  100

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
              TGTG WE ALTNTLSPGD++V+F  GQFS LWID  QRL  +V VVE EWG GA+   L
Sbjct  101   GTGTGGWEVALTNTLSPGDKVVTFRYGQFSHLWIDMMQRLGLDVQVVEVEWGGGADEAKL  160

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
                L  DT   IKA+ +VHNET TGVT+++  VR+++D   HPALLLVDGVSSI A+DFR
Sbjct  161   EQILKADTDKKIKAVAVVHNETTTGVTSDIGQVRQVMDSVSHPALLLVDGVSSIGALDFR  220

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
              DEW VD A+TGSQKALSLPTG+G+V  S KALEA KTA+  RV++D +D L     G  
Sbjct  221   FDEWKVDAAVTGSQKALSLPTGLGLVAVSQKALEARKTAQLKRVYYDLEDQLATNPSGNV  280

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  421
              PYTPSI LLYGLR  L L+  EG+DNVIARH RL   TR AV+ WGLK   ++  W SD
Sbjct  281   -PYTPSIPLLYGLRETLGLIKAEGMDNVIARHHRLAEGTRKAVEGWGLKLLCKEPRWNSD  339

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             ++T +  P  +DS +IVK A+ RYNLSLG+GL++VAGKVFRIGHLGN +E+ +   L G 
Sbjct  340   SLTVIKTPEGVDSGKIVKEAYSRYNLSLGVGLSEVAGKVFRIGHLGNNDEVMVGSYLFGA  399

Query  240   EMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  139
             EM +   G P++ GSGV+ A  Y   T+ +IP+R
Sbjct  400   EMAMISAGVPIEPGSGVSKAIEYWAATSNVIPTR  433



>ref|XP_006369574.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66143.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=244

 Score =   429 bits (1102),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 213/238 (89%), Positives = 226/238 (95%), Gaps = 0/238 (0%)
 Frame = -3

Query  849  DHYQHPALLLVDGVSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASK  670
            D Y+HPAL LVDGVSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK
Sbjct  7    DDYRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASK  66

Query  669  TAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGT  490
            TAKS RVFFDWKDYLKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG 
Sbjct  67   TAKSFRVFFDWKDYLKFYKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGK  126

Query  489  ATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAG  310
            ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAG
Sbjct  127  ATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAG  186

Query  309  KVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
            KVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I SRI
Sbjct  187  KVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIASRI  244



>ref|WP_035525480.1| serine--glyoxylate aminotransferase [Burkholderia sacchari]
 gb|KHD21372.1| serine--glyoxylate aminotransferase [Burkholderia sacchari]
Length=418

 Score =   434 bits (1117),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 216/391 (55%), Positives = 283/391 (72%), Gaps = 2/391 (1%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGRN L VPGP NIPD V+RAM  + ED+RS   P L   +L D+K+++KTTSG PF+ P
Sbjct  10    PGRNILAVPGPTNIPDAVLRAMVVSMEDHRSTRFPELANGVLSDLKRLYKTTSGQPFIFP  69

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
             ++GTGAWE+ALTNTLSPGDR++    GQFS LW D  QRL F V++++ +WG+G  ++ +
Sbjct  70    SSGTGAWEAALTNTLSPGDRVLVARFGQFSHLWADMAQRLGFEVEILDVDWGEGVPVERI  129

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
                L  D  H IK I   HNETATGVT+++  +R  +D+  HPALL VDGVSSI  IDFR
Sbjct  130   EEVLKADKKHQIKGILACHNETATGVTSDIGALRHAMDNAHHPALLFVDGVSSIGCIDFR  189

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
             MD+W VD+A+TGSQK L LP G+GI+C SPKAL+A +TAKS R +FD  D +K    G Y
Sbjct  190   MDDWRVDLAVTGSQKGLMLPAGLGILCVSPKALKAIETAKSKRCYFDLGDMIKANATG-Y  248

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKEEWFS  424
             +PYTP++ LLYGLR  LDL+F+EGLDNV ARH  L    R AV + WGL+ C +  +W+S
Sbjct  249   FPYTPALSLLYGLRTALDLIFQEGLDNVFARHHHLAQGVRAAVTEGWGLELCAKGPKWYS  308

Query  423   DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  244
             DTV+A+VVP   +++ ++ RA++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L   +AG
Sbjct  309   DTVSAIVVPQGFNAANVIDRAFRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLTSAIAG  368

Query  243   VEMVLKDIGYPVKLGSGVAAASAYLQNTTPM  151
              EM + D+G  V+ GSG  AA+ Y +   P+
Sbjct  369   AEMAMLDVGIDVRPGSGTGAATQYWRTHDPL  399



>ref|WP_003613273.1| serine--glyoxylate aminotransferase [Methylosinus trichosporium]
Length=397

 Score =   432 bits (1112),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 213/388 (55%), Positives = 282/388 (73%), Gaps = 1/388 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             M     PGRN LFVPGP NIPD+++RAM   +ED+RSP  P LT  L   +KK+FKT SG
Sbjct  1     MSNSRIPGRNFLFVPGPTNIPDRILRAMNVVSEDHRSPKFPELTLPLFTQLKKVFKTESG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
               F+ P +GTG WE+A+TNTLSPGD++++   GQF+ LWID  +R+  +V   + EWG G
Sbjct  61    QAFIFPASGTGGWEAAITNTLSPGDKVIAQRFGQFTHLWIDLAKRIGLDVIEQDEEWGTG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
              N + +   L  D  H IKA+   HNETATGVT+++  VRK +D+ +HPA+L VDGVSS+
Sbjct  121   NNPERIEETLKADKNHEIKAVFATHNETATGVTSDIGAVRKAIDNAKHPAMLFVDGVSSV  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
              ++DF+ DEWGVDVA++GSQK   LP G+ ++  S KAL+A +TAK  R +FD++D++K 
Sbjct  181   GSLDFKQDEWGVDVAVSGSQKGFMLPAGLALLSVSQKALKAGETAKLHRAYFDFQDHVKA  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
                G Y+PYTP++ LLYGLR  L++LFEEGLD V ARH  L    R AV AWGLK C ++
Sbjct  241   NATG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKPCAKE  299

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
              +W SDTVTA++VP   D++++++ A+KRYNL+LG GL+KVAGKVFRIGHLG+LNEL LL
Sbjct  300   SKWNSDTVTAILVPEGFDAAKVIEIAYKRYNLALGAGLSKVAGKVFRIGHLGDLNELMLL  359

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASA  175
             G +AG EM + D+G PV  GSGVAAA A
Sbjct  360   GAIAGAEMAMLDVGIPVTPGSGVAAAQA  387



>ref|WP_027172630.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 10]
Length=402

 Score =   432 bits (1110),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 225/397 (57%), Positives = 279/397 (70%), Gaps = 6/397 (2%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             M     PGRNHLFVPGP NIPD+V RAM   +ED+RS   P LTK L E+ K +F +T G
Sbjct  1     MAATRRPGRNHLFVPGPTNIPDRVQRAMIVPSEDHRSVDFPTLTKPLFEETKAVFGSTEG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             T FL P +GTG WESALTNTL  GD +++   GQFS LWID  QRL  NV V E EWG G
Sbjct  61    TIFLFPASGTGIWESALTNTLHRGDTVLTSRFGQFSHLWIDMAQRLGLNVIVQEEEWGTG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             AN   +   L  DT H IKA+  VHNETATGVT+++  VRK +D   HPALL VDGVSSI
Sbjct  121   ANPQRIEEALRADTNHEIKAVMTVHNETATGVTSDIGAVRKAIDAAGHPALLFVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA-----KSVRVFFDWK  634
              ++ F  DEW VD A+ GSQK L LP G+G++C S KAL+A++++     +   V+FDW 
Sbjct  181   GSLPFYADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAESSSGPNDRLAHVYFDWA  240

Query  633   DYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLK  454
             D+ K    G Y+PYTP++ LLYGLR  L  L EEGL+NV  RH  LG ATR AV AWGLK
Sbjct  241   DHQKQNGAG-YFPYTPALPLLYGLREALACLREEGLENVYHRHAVLGEATRQAVAAWGLK  299

Query  453   NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  274
              C ++ +W SDTVTA++VP  +D++ I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LN
Sbjct  300   TCAKEAKWNSDTVTAILVPEGVDAAAIIKHAFVRYNLALGAGLSQVAGKVFRIGHVGDLN  359

Query  273   ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQN  163
             EL LLG +AG EM + D G  V+ GSGVAAAS+YL+ 
Sbjct  360   ELSLLGAIAGAEMAMLDNGVKVQPGSGVAAASSYLRE  396



>ref|WP_012405153.1| serine--glyoxylate aminotransferase [Burkholderia phymatum]
 gb|ACC74993.1| Serine--glyoxylate transaminase [Burkholderia phymatum STM815]
Length=421

 Score =   432 bits (1112),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 218/389 (56%), Positives = 282/389 (72%), Gaps = 2/389 (1%)
 Frame = -3

Query  1317  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  1138
             GRN L VPGP N+PD V+RAM  + ED+RS   P L   LL D+KKI++T  G PF+ P+
Sbjct  11    GRNILAVPGPTNVPDAVLRAMVVSMEDHRSTKFPELAHGLLSDLKKIYRTAEGQPFIFPS  70

Query  1137  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  958
             +GTGAWE+ALTNTLSPGDR++    GQFS LW D  QRL F+V++++ +WG+G  ++ +A
Sbjct  71    SGTGAWEAALTNTLSPGDRVLVPRFGQFSHLWADMAQRLGFDVEILDVDWGEGVPVERIA  130

Query  957   SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFRM  778
               L  D  HTIK I   HNETATGVT+++  +R+ +D  +HPALL VDGVSSI  IDFRM
Sbjct  131   EILKADGQHTIKGILACHNETATGVTSDIGALRRAMDDARHPALLFVDGVSSIGCIDFRM  190

Query  777   DEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYW  598
             DEWGVD+A+TGSQK L LP G+GI+C S KAL+A   AKS R +FD  D ++    G Y+
Sbjct  191   DEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKAISHAKSRRCYFDLADMVRTNATG-YF  249

Query  597   PYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKEEWFSD  421
             PYTP++ LLYGLRA LDLLFEEGL+NV ARH  L    R AV + WGL+ C +   W SD
Sbjct  250   PYTPALSLLYGLRAALDLLFEEGLENVFARHHYLAAGVRAAVTEGWGLELCAKAPRWHSD  309

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             TV+A+VVP  +++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L+  +AG 
Sbjct  310   TVSAIVVPEGVNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLMSAIAGA  369

Query  240   EMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
             EM + D G  V+ GSGV AA  Y +  TP
Sbjct  370   EMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>ref|WP_026190999.1| serine--glyoxylate aminotransferase [Methylobacterium sp. WSM2598]
Length=417

 Score =   431 bits (1109),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 213/387 (55%), Positives = 280/387 (72%), Gaps = 1/387 (0%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGRN LFVPGP N+P++V RAM    ED+RS + P LT  L E++KK+FK+  G  F+ P
Sbjct  7     PGRNFLFVPGPTNVPERVQRAMIVPMEDHRSSSFPDLTLPLFENLKKVFKSKDGQVFIFP  66

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
             ++GTGAWE+ALTNTLSPGDR+++   GQFS LWID  QR+  +V + + EWG GAN + +
Sbjct  67    SSGTGAWEAALTNTLSPGDRVLASRFGQFSTLWIDLAQRVGLDVVIQDEEWGTGANPERI  126

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
                L  D  H IKA+ +VHNETATGVT+++  VR+ +D   HPA+L VDGVSSI +IDFR
Sbjct  127   EEALRADREHRIKAVLVVHNETATGVTSDVGAVRRAIDAANHPAMLYVDGVSSIGSIDFR  186

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
               EWGVD A+TGSQK L LP G+GIVC SPKAL A KTA+  RV+FD+ D  K    G Y
Sbjct  187   ATEWGVDCAITGSQKGLMLPAGLGIVCVSPKALAAYKTAECRRVYFDFGDMSKANATG-Y  245

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  421
             +PYTP++ LLYGLR  +  LFEEGL+ V  RH  L    R AV+AWGL  C ++ +W+SD
Sbjct  246   FPYTPALPLLYGLREAMACLFEEGLERVFERHRVLADGCRAAVKAWGLTLCAKEPKWYSD  305

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             TV+A++VP  ++ ++++  A++RYNL+LG GL+KVAGK+FRIGHLG+LN+L LLG LAG 
Sbjct  306   TVSAIMVPEGVNGADVIDVAFRRYNLALGAGLSKVAGKLFRIGHLGDLNDLMLLGALAGA  365

Query  240   EMVLKDIGYPVKLGSGVAAASAYLQNT  160
             EM + D G  ++ GSGV AA  + + T
Sbjct  366   EMAMLDAGIRIEPGSGVGAAQKHFRET  392



>ref|WP_012336184.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 4-46]
 gb|ACA20808.1| Serine--glyoxylate transaminase [Methylobacterium sp. 4-46]
Length=417

 Score =   431 bits (1109),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 213/387 (55%), Positives = 280/387 (72%), Gaps = 1/387 (0%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGRN LFVPGP N+P++V RAM    ED+RS + P LT  L E++KK+FK+  G  F+ P
Sbjct  7     PGRNFLFVPGPTNVPERVQRAMIVPMEDHRSSSFPDLTLPLFENLKKVFKSKDGQVFIFP  66

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
             ++GTGAWE+ALTNTLSPGDR+++   GQFS LWID  QR+  +V + + EWG GAN + +
Sbjct  67    SSGTGAWEAALTNTLSPGDRVLASRFGQFSTLWIDLAQRVGLDVVIQDEEWGTGANPERI  126

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
                L  D  H IKA+ +VHNETATGVT+++  VR+ +D   HPA+L VDGVSSI +IDFR
Sbjct  127   EEALRADREHRIKAVLVVHNETATGVTSDVGAVRRAIDAANHPAMLYVDGVSSIGSIDFR  186

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
               EWGVD A+TGSQK L LP G+GIVC SPKAL A KTA+  RV+FD+ D  K    G Y
Sbjct  187   ATEWGVDCAITGSQKGLMLPAGLGIVCVSPKALAAYKTAECRRVYFDFGDMSKANATG-Y  245

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  421
             +PYTP++ LLYGLR  +  LFEEGL+ V  RH  L    R AV+AWGL  C ++ +W+SD
Sbjct  246   FPYTPALPLLYGLREAMACLFEEGLERVFERHRVLADGCRAAVKAWGLTLCAKEPKWYSD  305

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             TV+A++VP  ++ ++++  A++RYNL+LG GL+KVAGK+FRIGHLG+LN+L LLG LAG 
Sbjct  306   TVSAIMVPDGVNGADVIDVAFRRYNLALGAGLSKVAGKLFRIGHLGDLNDLMLLGALAGA  365

Query  240   EMVLKDIGYPVKLGSGVAAASAYLQNT  160
             EM + D G  ++ GSGV AA  + + T
Sbjct  366   EMAMLDAGIRIEPGSGVGAAQKHFRET  392



>ref|WP_035937801.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 gb|KDR42451.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 emb|CDY78627.1| Serine--glyoxylate aminotransferase [Burkholderia glathei]
Length=419

 Score =   431 bits (1109),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 217/384 (57%), Positives = 278/384 (72%), Gaps = 2/384 (1%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGRN L VPGP NIPDQV+R+M  + ED+RS   P L   +L D+K ++KTT+G PF+ P
Sbjct  10    PGRNFLAVPGPTNIPDQVLRSMVVSMEDHRSSKFPELANGVLSDLKALYKTTTGQPFIFP  69

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
             ++GTGAWE+ALTNTLSPGD++V    GQFS LW D   RL F V +V+ EWG+G  ++ +
Sbjct  70    SSGTGAWEAALTNTLSPGDKVVVARFGQFSHLWADMAHRLGFEVQIVDVEWGEGVPVERI  129

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
                L  D  HTIK I   HNETATGVT+++  +R  +D+ +HPALL VDGVSSI  IDFR
Sbjct  130   EEILRADKQHTIKGILACHNETATGVTSDIGALRAAMDNARHPALLFVDGVSSIGCIDFR  189

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
             MD+W VD+A+TGSQK L LP G+GI+C S KAL+AS+TA S R +FD  D +K    G Y
Sbjct  190   MDDWRVDLAVTGSQKGLMLPAGLGILCVSQKALKASETATSRRCYFDLADMIKANATG-Y  248

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKEEWFS  424
             +PYTP++ LLYGLR  LDLLFEEGLDNV ARH  L    R A+ + W L  C +  +W S
Sbjct  249   FPYTPALPLLYGLRTALDLLFEEGLDNVFARHHYLAQGVRAAITEGWDLGVCAKAPKWHS  308

Query  423   DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  244
             DTV+A+VVP   +++ ++ RA++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L+G +AG
Sbjct  309   DTVSAIVVPEKFNAAHVIDRAYRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLMGAIAG  368

Query  243   VEMVLKDIGYPVKLGSGVAAASAY  172
              EM + DIG  V+ GSG  AA+ Y
Sbjct  369   AEMAMLDIGIDVRPGSGTGAAAQY  392



>ref|WP_026175686.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 88A]
Length=402

 Score =   430 bits (1106),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 225/397 (57%), Positives = 278/397 (70%), Gaps = 6/397 (2%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             M     PGRNHLFVPGP NIPD+V RAM   +ED+RS   P LTK L E+ K +F +T G
Sbjct  1     MAATRRPGRNHLFVPGPTNIPDRVQRAMIVPSEDHRSVDFPTLTKPLFEETKAVFGSTEG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             T FL P +GTG WESALTNTL  GD +++   GQFS LWID  QRL  NV V E EWG G
Sbjct  61    TIFLFPASGTGIWESALTNTLHRGDTVLTSRFGQFSHLWIDMAQRLGLNVIVQEEEWGTG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             AN   +   L  DT H IKA+  VHNETATGVT+++  VRK +D   HPALL VDGVSSI
Sbjct  121   ANPQRIEEALRADTNHEIKAVMTVHNETATGVTSDIGAVRKAIDAAGHPALLFVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA-----KSVRVFFDWK  634
              ++ F  DEW VD A+ GSQK L LP G+G++C S KAL+A++++     +   V+FDW 
Sbjct  181   GSLPFYADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAESSSGPNDRLAHVYFDWA  240

Query  633   DYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLK  454
             D+ K    G Y+PYTP++ LLYGLR  L  L EEGL+NV  RH  L  ATR AV AWGLK
Sbjct  241   DHQKQNGAG-YFPYTPALPLLYGLREALACLREEGLENVYHRHAVLAEATRQAVAAWGLK  299

Query  453   NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  274
              C ++ +W SDTVTA++VP  ID++ I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LN
Sbjct  300   TCAKEAKWNSDTVTAILVPEGIDAAAIIKHAFVRYNLALGAGLSQVAGKVFRIGHVGDLN  359

Query  273   ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQN  163
             EL LLG +AG EM + D G  V+ GSGVAAAS+YL+ 
Sbjct  360   ELSLLGAIAGAEMAMLDNGVKVQPGSGVAAASSYLRE  396



>ref|WP_042306504.1| serine--glyoxylate aminotransferase [Burkholderia terrae]
Length=422

 Score =   431 bits (1107),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 218/390 (56%), Positives = 281/390 (72%), Gaps = 2/390 (1%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGRN L VPGP N+PD V RAM  + ED+RS   P LT  LL D+KKI++T  G PF+ P
Sbjct  10    PGRNILAVPGPTNVPDAVQRAMVVSMEDHRSTKFPELTHGLLSDLKKIYRTAEGQPFIFP  69

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
             ++GTGAWE+ALTNTLSPGDR++    GQFS LW D  QRL F+V++++ +WG+G  ++ +
Sbjct  70    SSGTGAWEAALTNTLSPGDRVLVPRFGQFSHLWADMAQRLGFDVEILDVDWGEGVPVERI  129

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
                L  D  HTIK I   HNETATGVT+++  +R+ +D   HPALL VDGVSSI  IDFR
Sbjct  130   GEILKADRQHTIKGILACHNETATGVTSDIGALRRAMDDAGHPALLFVDGVSSIGCIDFR  189

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
             MDEWGVD+A+TGSQK L LP G+GI+C S KAL+    AKS R +FD  D ++    G Y
Sbjct  190   MDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKTIGHAKSRRCYFDLADMVRTNATG-Y  248

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKEEWFS  424
             +PYTP++ LLYGLRA LDLLFEEGLDNV ARH  L +  R A+ + WGL+ C +  +W S
Sbjct  249   FPYTPALSLLYGLRAALDLLFEEGLDNVFARHHYLASGVRAAITEGWGLEVCAKAPKWHS  308

Query  423   DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  244
             DTV+A+VVP   ++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L+  +AG
Sbjct  309   DTVSAIVVPEGFNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLVSAIAG  368

Query  243   VEMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
              EM + D G  V+ GSGV AA  Y +  TP
Sbjct  369   AEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>ref|WP_028367172.1| serine--glyoxylate aminotransferase [Burkholderia sp. UYPR1.413]
Length=421

 Score =   429 bits (1104),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 219/389 (56%), Positives = 279/389 (72%), Gaps = 2/389 (1%)
 Frame = -3

Query  1317  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  1138
             GRN L VPGP NIPD V+RAM  + ED+RS   P L   LL D+KKI++T  G PF+ P+
Sbjct  11    GRNILAVPGPTNIPDAVLRAMVVSMEDHRSTKFPELAHGLLSDLKKIYRTAEGQPFIFPS  70

Query  1137  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  958
             +GTGAWE+ALTNTLSPGDR++    GQFS LW D  QRL F+V++++ +WG+G  ++ +A
Sbjct  71    SGTGAWEAALTNTLSPGDRVLVPRFGQFSHLWADMAQRLGFDVEILDVDWGEGVPVERIA  130

Query  957   SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFRM  778
               L  D  HTIK I   HNETATGVT+++  +R+ +D   HPALL VDGVSSI  IDFRM
Sbjct  131   EILKADGQHTIKGILACHNETATGVTSDIGELRRAMDAADHPALLFVDGVSSIGCIDFRM  190

Query  777   DEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYW  598
             DEWGVD+A+TGSQK L LP G+GI+C S KAL+A   AKS R +FD  D ++    G Y+
Sbjct  191   DEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKAISHAKSRRCYFDLADMVRTNATG-YF  249

Query  597   PYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKEEWFSD  421
             PYTP++ LLYGLRA LDLLFEEGL+NV ARH  L +  R AV + WGL  C +   W SD
Sbjct  250   PYTPALSLLYGLRAALDLLFEEGLENVFARHHYLASGVRAAVTEGWGLSLCAKAPRWHSD  309

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             TV+A+VVP  ++ ++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L+  +AG 
Sbjct  310   TVSAIVVPEGVNGAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLMSAIAGA  369

Query  240   EMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
             EM + D G  V  GSGV AA  Y +  TP
Sbjct  370   EMAMLDAGIDVCPGSGVGAAGQYWRTHTP  398



>ref|WP_007585769.1| serine--glyoxylate aminotransferase [Burkholderia terrae]
 gb|EIM98368.1| serine--glyoxylate transaminase [Burkholderia terrae BS001]
Length=422

 Score =   429 bits (1104),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 217/390 (56%), Positives = 281/390 (72%), Gaps = 2/390 (1%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGRN L VPGP N+PD V RAM  + ED+RS   P LT  LL D+KKI++T  G PF+ P
Sbjct  10    PGRNILAVPGPTNVPDAVQRAMVVSMEDHRSTKFPELTHGLLSDLKKIYRTAEGQPFIFP  69

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
             ++GTGAWE+ALTNTLSPGDR++    GQFS LW D  QRL F+V++++ +WG+G  ++ +
Sbjct  70    SSGTGAWEAALTNTLSPGDRVLVPRFGQFSHLWADMAQRLGFDVEILDVDWGEGVPVERI  129

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
                L  D  HTIK I   HNETATGVT+++  +R+ +D   HPALL VDGVSSI  IDFR
Sbjct  130   GEILKADRQHTIKGILACHNETATGVTSDIGALRRAMDAAGHPALLFVDGVSSIGCIDFR  189

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
             MDEWGVD+A+TGSQK L LP G+GI+C S KAL+    AKS R +FD  D ++    G Y
Sbjct  190   MDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKTIGHAKSRRCYFDLADMVRTNATG-Y  248

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKEEWFS  424
             +PYTP++ LLYGLRA LDLLF+EGLDNV ARH  L +  R A+ + WGL+ C +  +W S
Sbjct  249   FPYTPALSLLYGLRAALDLLFQEGLDNVFARHHYLASGVRAAITEGWGLEVCAKAPKWHS  308

Query  423   DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  244
             DTV+A+VVP   ++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L+  +AG
Sbjct  309   DTVSAIVVPEGFNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLVSAIAG  368

Query  243   VEMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
              EM + D G  V+ GSGV AA  Y +  TP
Sbjct  369   AEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>ref|WP_035994918.1| serine--glyoxylate aminotransferase [Burkholderia caribensis]
 gb|ETY83415.1| Serine--glyoxylate aminotransferase [Burkholderia caribensis 
MBA4]
Length=422

 Score =   429 bits (1104),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 217/390 (56%), Positives = 281/390 (72%), Gaps = 2/390 (1%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGRN L VPGP N+PD V RAM  + ED+RS   P LT  LL D+KKI++T  G PF+ P
Sbjct  10    PGRNILAVPGPTNVPDAVQRAMVVSMEDHRSTKFPELTHGLLSDLKKIYRTAEGQPFIFP  69

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
             ++GTGAWE+ALTNTLSPGDR++    GQFS LW D  QRL F+V++++ +WG+G  ++ +
Sbjct  70    SSGTGAWEAALTNTLSPGDRVLVPRFGQFSHLWADMAQRLGFDVEILDVDWGEGVPVERI  129

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
                L  D  HTIK I   HNETATGVT+++  +R+ +D   HPALL VDGVSSI  IDFR
Sbjct  130   GEILKADRQHTIKGILACHNETATGVTSDIGALRRAMDAAGHPALLFVDGVSSIGCIDFR  189

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
             MDEWGVD+A+TGSQK L LP G+GI+C S KAL+    AKS R +FD  D ++    G Y
Sbjct  190   MDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKTIGHAKSRRCYFDLADMVRTNATG-Y  248

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKEEWFS  424
             +PYTP++ LLYGLRA LDLLF+EGLDNV ARH  L +  R A+ + WGL+ C +  +W S
Sbjct  249   FPYTPALSLLYGLRAALDLLFQEGLDNVFARHHYLASGVRAAITEGWGLEVCAKAPKWHS  308

Query  423   DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  244
             DTV+A+VVP   ++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L+  +AG
Sbjct  309   DTVSAIVVPEGFNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLVSAIAG  368

Query  243   VEMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
              EM + D G  V+ GSGV AA  Y +  TP
Sbjct  369   AEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>ref|WP_012320605.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacterium]
 gb|ACB25646.1| aminotransferase class V [Methylobacterium radiotolerans JCM 
2831]
 gb|KIU30995.1| serine--glyoxylate aminotransferase [Methylobacterium radiotolerans]
 dbj|GAN47418.1| class V aminotransferase [Methylobacterium sp. ME121]
Length=402

 Score =   429 bits (1102),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 219/398 (55%), Positives = 284/398 (71%), Gaps = 6/398 (2%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             M     PGRNHLF+PGP NIP++V+RAM   +ED+RSP+ P L K LL+D K +F +T+G
Sbjct  1     MAATRRPGRNHLFIPGPTNIPERVLRAMHVPSEDHRSPSFPELVKPLLQDSKMVFGSTNG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             T  L P++GTG WESAL+NTL  GD++++   GQFS LW+D  QRL  +V V E EWG G
Sbjct  61    TVILFPSSGTGIWESALSNTLCRGDKVLTARYGQFSHLWVDMAQRLGLDVIVQEEEWGAG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A+   +   L  D  H IKA+ +VHNETATGVT+++  VRK +D   HPALL VDG+SSI
Sbjct  121   ADPQKIEEALRADKDHAIKAVMVVHNETATGVTSDIGAVRKAIDAAGHPALLFVDGISSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASK--TAKSVRV---FFDWK  634
              ++ F+MDEWGVD A+ GSQK   LP G+G++C SPKAL+ ++  T ++ R+   +F WK
Sbjct  181   GSLPFKMDEWGVDCAIAGSQKGFMLPAGLGLICISPKALKIAEGGTGRNDRLGHAYFAWK  240

Query  633   DYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLK  454
             D L     G Y+PYTP + LLYGLR  L ++ EEGL+NV  RH  L  ATR AV AWGLK
Sbjct  241   DQLAANATG-YFPYTPVLPLLYGLREALAIVKEEGLENVYHRHHVLAEATRQAVAAWGLK  299

Query  453   NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  274
              C ++ +W SDTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRIGHLG+LN
Sbjct  300   PCAKEPKWNSDTVTAIVVPEGADAAKVITHAYERYNLSLGAGLSKVAGKVFRIGHLGDLN  359

Query  273   ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  160
             EL LLG +AG EM + D G  V  GSGVAAAS+YL+  
Sbjct  360   ELSLLGAIAGAEMAMLDCGIKVTPGSGVAAASSYLREN  397



>ref|WP_010960683.1| serine--glyoxylate aminotransferase [Methylococcus capsulatus]
 gb|AAU92322.1| serine--glyoxylate aminotransferase [Methylococcus capsulatus 
str. Bath]
Length=395

 Score =   428 bits (1101),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 220/395 (56%), Positives = 282/395 (71%), Gaps = 1/395 (0%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGRNHL+VPGP NIPD V+ AM    ED+R P  PAL   LLE++KK+F+T +G  F+ P
Sbjct  2     PGRNHLYVPGPTNIPDAVLSAMHVPMEDHRRPDFPALVTPLLENLKKVFRTEAGQCFIFP  61

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
              TGT  WE AL+NTLSPGD+++S+  GQFS LWID  +RL   V+  E  WGQG  LD L
Sbjct  62    ATGTAGWEIALSNTLSPGDKVLSYRFGQFSHLWIDLARRLGLEVEYEEVPWGQGVPLDRL  121

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
              ++L  DTAH IKA+ I HNETATGVTN+L  VRK +D   HPAL  VDGVSSI ++DFR
Sbjct  122   EARLKADTAHEIKAVLICHNETATGVTNDLPAVRKAIDAAGHPALFYVDGVSSIGSLDFR  181

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
             MDEWG+D+ + GSQK   LP G+ ++  S KAL+A ++AK  R F D  D++  +  G +
Sbjct  182   MDEWGIDIGVAGSQKGFMLPAGLALLGFSQKALKARESAKCKRAFLDINDHI-LHNAGGF  240

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  421
             +PYTPSI LLYGLR  L+LL EEGL+NV ARH RL    R AV AWGL+ C Q  +W+S+
Sbjct  241   FPYTPSIPLLYGLRKSLELLLEEGLENVYARHARLAEGVRRAVAAWGLQLCAQDPKWYSN  300

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             TV+AVVVP   D+ +++  A+ RYNLSLG GL++V+GKVFRIGHLG+LNEL L   + G 
Sbjct  301   TVSAVVVPPEFDARDVIHTAYFRYNLSLGAGLSEVSGKVFRIGHLGDLNELSLASAIVGS  360

Query  240   EMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  136
             EM + D+G P+  GSG+AAASA+ + T P+I  R+
Sbjct  361   EMAMLDVGIPLTPGSGIAAASAHWRETAPVIQPRV  395



>ref|WP_007742731.1| serine--glyoxylate aminotransferase [Burkholderia sp. BT03]
 gb|EUC15360.1| Serine--glyoxylate transaminase [Burkholderia sp. BT03]
Length=422

 Score =   429 bits (1103),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 217/390 (56%), Positives = 281/390 (72%), Gaps = 2/390 (1%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGRN L VPGP N+PD V RAM  + ED+RS   P LT  LL D+KKI++T  G PF+ P
Sbjct  10    PGRNILAVPGPTNVPDAVQRAMVVSMEDHRSTKFPELTHGLLSDLKKIYRTAEGQPFIFP  69

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
             ++GTGAWE+ALTNTLSPGDR++    GQFS LW D  QRL F+V++++ +WG+G  ++ +
Sbjct  70    SSGTGAWEAALTNTLSPGDRVLVPRFGQFSHLWADMAQRLGFDVEILDVDWGEGVPVERI  129

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
                L  D  HTIK I   HNETATGVT+++  +R+ +D   HPALL VDGVSSI  IDFR
Sbjct  130   GEILKADRQHTIKGILACHNETATGVTSDIGALRRAMDAAGHPALLFVDGVSSIGCIDFR  189

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
             MDEWGVD+A+TGSQK L LP G+GI+C S KAL+    AKS R +FD  D ++    G Y
Sbjct  190   MDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKTIGHAKSRRCYFDLADMVRTNATG-Y  248

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKEEWFS  424
             +PYTP++ LLYGLRA LDLLF+EGLDNV ARH  L +  R A+ + WGL+ C +  +W S
Sbjct  249   FPYTPALSLLYGLRAALDLLFQEGLDNVFARHHYLASGVRAAITEGWGLEVCAKAPKWHS  308

Query  423   DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  244
             DTV+A+VVP   ++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L+  +AG
Sbjct  309   DTVSAIVVPEGFNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLVSAIAG  368

Query  243   VEMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
              EM + D G  V+ GSGV AA  Y +  TP
Sbjct  369   AEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>ref|WP_007559580.1| serine--glyoxylate aminotransferase [Methylobacterium sp. GXF4]
 gb|EIZ86366.1| class V aminotransferase [Methylobacterium sp. GXF4]
Length=402

 Score =   427 bits (1099),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 220/397 (55%), Positives = 282/397 (71%), Gaps = 6/397 (2%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             M     PGRNHLF+PGP NIPD+V+RAM   +ED+RSP  P L K LL+D K +F +T+G
Sbjct  1     MAATRRPGRNHLFIPGPTNIPDRVLRAMHVPSEDHRSPGFPELVKPLLQDAKIVFGSTAG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             T  L P++GTG WESAL+NTL  GD++++   GQFS LW+D  QRL  +V V E EWG G
Sbjct  61    TVILFPSSGTGIWESALSNTLCRGDKVLTSRYGQFSHLWVDMAQRLGLDVIVQEEEWGTG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A+   +   L  D  H IKA+ +VHNETATGVT+++A VRK LD   HPALL VDG+SSI
Sbjct  121   ADPQKIEEALRADKDHAIKAVMVVHNETATGVTSDIAAVRKALDAAGHPALLFVDGISSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASK--TAKSVRV---FFDWK  634
              ++ F MDEW VD A+ GSQK   LP G+G++C SPKAL+ ++  T ++ R+   +F WK
Sbjct  181   GSLPFYMDEWKVDCAIAGSQKGFMLPAGLGLICISPKALKIAEGGTGRNDRLGHAYFAWK  240

Query  633   DYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLK  454
             D L     G Y+PYTP + LLYGLR  L ++ EEGL+N+  RH  L  ATR AV AWGLK
Sbjct  241   DQLAANATG-YFPYTPVLPLLYGLREALAIVKEEGLENIYHRHHVLAEATRQAVAAWGLK  299

Query  453   NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  274
              C ++ +W SDTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRIGHLG+LN
Sbjct  300   PCAKEPKWNSDTVTAIVVPEGADAAKVITHAYERYNLSLGAGLSKVAGKVFRIGHLGDLN  359

Query  273   ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQN  163
             EL LLG +AG EM + D G  V  GSGVAAAS+YL+ 
Sbjct  360   ELSLLGAIAGAEMAMLDCGIKVTPGSGVAAASSYLRE  396



>ref|WP_026362994.1| serine--glyoxylate aminotransferase [Methylopila sp. M107]
Length=402

 Score =   427 bits (1099),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 206/387 (53%), Positives = 277/387 (72%), Gaps = 1/387 (0%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PG+N LFVPGP N+P++V+RAM  + ED+RSP  P LTK L E +KK++KTT G  F+ P
Sbjct  5     PGKNFLFVPGPTNVPERVLRAMVVSQEDHRSPIFPELTKPLYEGLKKVYKTTEGQVFIFP  64

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
             ++GTG WE+AL NTL+PGD++++   GQFS LW D  QRL  +V ++E EWG GA+ + +
Sbjct  65    SSGTGGWEAALANTLAPGDKVLNSRFGQFSHLWTDMAQRLGLDVQILEEEWGTGAHEEKI  124

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
                L  D AH IKA+ +VHNETATGVT+N+  +RK +D  +HPALLLVD VS + +IDFR
Sbjct  125   EEALVADKAHEIKAVMVVHNETATGVTSNIGAIRKAIDAAKHPALLLVDSVSGLGSIDFR  184

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
              DEW VD A++GSQK L LP G+G V  S KAL   K +K  +V+FD++D++     G Y
Sbjct  185   FDEWKVDCAVSGSQKGLMLPAGLGFVAVSQKALNLRKNSKLNKVYFDFQDHINTNPSG-Y  243

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  421
             +PYTP+  LL+GL+  L  + +EGL+ +  RH+ L  ATR A+ AWGLK C +   W SD
Sbjct  244   FPYTPATPLLHGLKEALACIEDEGLEQIFHRHSVLANATRKAIDAWGLKLCAKSPRWHSD  303

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             TV+A++ P  ID+++I+  A+ RYNL+LG GL+KVAGKVFRIGH+G+LNEL LLG LAG 
Sbjct  304   TVSAILAPEGIDAAKIIATAYNRYNLALGAGLSKVAGKVFRIGHIGDLNELMLLGALAGA  363

Query  240   EMVLKDIGYPVKLGSGVAAASAYLQNT  160
             EM + D G  +K GSGV AA  YL++ 
Sbjct  364   EMAMLDNGVKIKAGSGVGAAQDYLRDN  390



>ref|WP_020188076.1| hypothetical protein [Methylopila sp. 73B]
Length=402

 Score =   427 bits (1099),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 207/387 (53%), Positives = 276/387 (71%), Gaps = 1/387 (0%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PG+N LFVPGP N+P++V+RAM  + ED+RSP  P LTK L E +KK+FKT  G  F+ P
Sbjct  5     PGKNFLFVPGPTNVPERVLRAMVVSQEDHRSPIFPELTKPLYEGLKKVFKTKDGQVFIFP  64

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
             ++GTG WE+ALTNTL+PGD++++   GQFS LW D  QRL  +V + E EWG GA+ + +
Sbjct  65    SSGTGGWEAALTNTLAPGDKVLTARFGQFSHLWTDMAQRLGLDVQIQEEEWGTGAHEEKI  124

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
                L  DTAH IKA+ +VHNETATGVT+N+  +RK +D  +HPALL VD VS + +IDFR
Sbjct  125   EEALVADTAHEIKAVMVVHNETATGVTSNIGAIRKAMDAAKHPALLFVDSVSGLGSIDFR  184

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
              DEW VD A++GSQK L LP G+G VC S +AL   K +K  +V+FD++D +     G Y
Sbjct  185   FDEWKVDCAVSGSQKGLMLPAGLGFVCVSQQALNLRKNSKLNKVYFDFQDQINTNPSG-Y  243

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  421
             +PYTP+  LL+GLR  L  + +EGL+ +  RH  L  ATR AV AWGLK C +   W SD
Sbjct  244   FPYTPATPLLHGLRESLQCIEDEGLEQIFRRHHVLAEATRKAVDAWGLKLCAKSPRWHSD  303

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             TV+A++ P  ID+++I++ A+ RYNL+LG GL+KVAG+VFRIGH+G+LNEL LLG +AG 
Sbjct  304   TVSAILAPEGIDAAKIIRHAYDRYNLALGAGLSKVAGRVFRIGHIGDLNELMLLGAIAGA  363

Query  240   EMVLKDIGYPVKLGSGVAAASAYLQNT  160
             EM + D G  +K GSGV AA  YL++ 
Sbjct  364   EMSMLDNGVKIKAGSGVGAAQDYLRDN  390



>ref|WP_045224300.1| serine--glyoxylate aminotransferase [Methylococcaceae bacterium 
73a]
Length=394

 Score =   426 bits (1096),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 220/394 (56%), Positives = 278/394 (71%), Gaps = 1/394 (0%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGRNHL+VPGP NIPD V+ AM   ++D+R+P  P L K LLED+KKIF+T  G  F+ P
Sbjct  2     PGRNHLYVPGPTNIPDAVLSAMHVPSQDHRAPDFPKLVKPLLEDLKKIFRTEKGQCFIFP  61

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
              TGT  WE ALTNTLSPGD+++++  GQFS LWID  +RL  +V+  E  WGQG  +D L
Sbjct  62    ATGTAGWEIALTNTLSPGDKVLTYRFGQFSHLWIDLAKRLGLDVEFHEVPWGQGVPVDHL  121

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
              ++L ED +H IKA+   HNETATGVT++L  +RK +D   HPAL  +DGVSSI +I+FR
Sbjct  122   EARLKEDKSHQIKAVLACHNETATGVTSDLPAIRKAIDAAAHPALFYIDGVSSIASIEFR  181

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
             MDEWGVDVAL+GSQK   LP G+ ++C S KAL A + A+  R F D  D+   +  G Y
Sbjct  182   MDEWGVDVALSGSQKGFMLPAGLALLCFSQKALAAREGAQCKRAFLDIYDH-TVHNPGGY  240

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  421
             +PYTPSI LL+GLR  LDLL EEGLD V ARH RL   TR AV AWGLK C Q  +W+S+
Sbjct  241   FPYTPSIPLLHGLRKALDLLLEEGLDTVYARHARLAEGTRRAVAAWGLKLCAQDPKWYSN  300

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             TV+A+VVP   D+ +++  A+ RYNLSLG GL++V GKVFRIGHLG+LNEL L   +AG 
Sbjct  301   TVSAIVVPEGFDARDVMHYAYHRYNLSLGAGLSEVMGKVFRIGHLGDLNELMLCSAIAGA  360

Query  240   EMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  139
             EM ++D+G  V  GSGV AA  Y + T P +  R
Sbjct  361   EMAMRDVGIQVTPGSGVGAACEYWRETAPALAPR  394



>ref|WP_018238561.1| serine--glyoxylate aminotransferase [Ensifer sp. BR816]
Length=396

 Score =   426 bits (1096),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 213/380 (56%), Positives = 271/380 (71%), Gaps = 1/380 (0%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PG NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK   G  F+ P
Sbjct  2     PGYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNQDGRVFIYP  61

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
             ++GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ 
Sbjct  62    SSGTGAWEAAMTNVLSPGDRLLMSRFGQFSHLWVDMAERLGFEVDCLDREWGTGVPVELY  121

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
             A +LA D AH IKA+ + HNETATGVT+++A VR  LD   HPALL VDGVSSI +IDFR
Sbjct  122   AERLAADKAHEIKAVFVTHNETATGVTSDVAAVRAALDACGHPALLFVDGVSSIGSIDFR  181

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
              DEWGVD A++GSQK   LP G+G +  S KALEA+KTA+ +R +F + D +K    G Y
Sbjct  182   QDEWGVDCAVSGSQKGFMLPAGLGFLSVSQKALEAAKTARHMRCYFSFDDMIKTNDTG-Y  240

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  421
             +PYTP  QLL GLRA LDL+FEEGL+N+ ARH  L    R  V AWGLK C  + +W SD
Sbjct  241   FPYTPPTQLLRGLRAALDLIFEEGLENIFARHHHLANGVRAGVSAWGLKLCATEPKWHSD  300

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             TV+A+ +P  ID +E+++ A++ YN SLG GL+KVAGKVFRIGHLG+LNE+ +LG L+  
Sbjct  301   TVSAIRLPEGIDGAEVIRHAYRTYNTSLGSGLSKVAGKVFRIGHLGSLNEVMVLGALSAA  360

Query  240   EMVLKDIGYPVKLGSGVAAA  181
             E+ L D G  ++ GSGV AA
Sbjct  361   ELTLLDCGVAIEPGSGVGAA  380



>ref|WP_026597137.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 77]
Length=402

 Score =   427 bits (1097),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 222/397 (56%), Positives = 279/397 (70%), Gaps = 6/397 (2%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             M     PGRNHLFVPGP NIPD+V RAM   +ED+RS   PALTK L E+ K +F +T G
Sbjct  1     MAATRRPGRNHLFVPGPTNIPDRVQRAMIVPSEDHRSVDFPALTKPLFEETKAVFGSTEG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             T FL P +GTG WE+ALTNTL  GD++++   GQFS LWID  QRL  NV V E EWG G
Sbjct  61    TIFLFPASGTGIWEAALTNTLHRGDKVLTSRFGQFSHLWIDMAQRLGLNVIVQEEEWGTG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A+ + +   L  DT H IKA+  VHNETATGVT+++  VRK +D   HPALL VDGVSSI
Sbjct  121   ASPERIEEALRADTNHEIKAVMTVHNETATGVTSDIGAVRKAIDAAGHPALLFVDGVSSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA-----KSVRVFFDWK  634
              ++ F  D W VD A+ GSQK L LP G+G++C S KAL+A++++     +   V+FDW 
Sbjct  181   GSLPFYADAWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAESSSGPNDRLAHVYFDWA  240

Query  633   DYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLK  454
             D+ K    G Y+PYTP + LLYGLR  L  L EEGL+NV  RH  L  ATR AV AWGLK
Sbjct  241   DHQKQNGAG-YFPYTPPLPLLYGLREALACLREEGLENVYNRHKVLAEATRQAVAAWGLK  299

Query  453   NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  274
              C ++ +W SDTVTA++VP  +D++ I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LN
Sbjct  300   TCAKEAKWNSDTVTAILVPEGVDAAAIIKHAFMRYNLALGAGLSQVAGKVFRIGHVGDLN  359

Query  273   ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQN  163
             EL LLG +AG EM + D G  V+ GSGVAAAS+YL+ 
Sbjct  360   ELSLLGAIAGAEMSMLDNGVKVQPGSGVAAASSYLRE  396



>ref|WP_034858116.1| serine--glyoxylate aminotransferase [Ensifer sojae]
Length=396

 Score =   426 bits (1096),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 212/379 (56%), Positives = 273/379 (72%), Gaps = 1/379 (0%)
 Frame = -3

Query  1317  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  1138
             G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+ P+
Sbjct  3     GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNENGRVFIYPS  62

Query  1137  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  958
             +GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ A
Sbjct  63    SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLGFEVDCLDMEWGTGVPVELYA  122

Query  957   SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFRM  778
              +L+ D AH+IKA+ + HNETATGVT+++A VR  LD   HPALL VDGVSSI +IDFR 
Sbjct  123   ERLSADKAHSIKAVFVTHNETATGVTSDVAAVRAALDACNHPALLFVDGVSSIGSIDFRQ  182

Query  777   DEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYW  598
             DEWGVD A++GSQK   LP G+G +  S KALEA+KTA+ +R +F + D +K    G Y+
Sbjct  183   DEWGVDCAVSGSQKGFMLPAGLGFLSVSQKALEAAKTARHMRCYFSFDDMIKTNDTG-YF  241

Query  597   PYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDT  418
             PYTP  QLL GLRA LDL+FEEGL+N+ ARH  L    R AV AWGLK C  + +W SDT
Sbjct  242   PYTPPTQLLRGLRAALDLIFEEGLENIFARHHHLANGVRAAVSAWGLKLCATEPKWHSDT  301

Query  417   VTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVE  238
             V+A+ VP  +D +E+++ A++ YN SLG GL+KVAGKVFRIGHLG+LNE+ +LG L+  E
Sbjct  302   VSAIRVPEGVDGAEVIRHAYRTYNTSLGSGLSKVAGKVFRIGHLGSLNEVMVLGALSAAE  361

Query  237   MVLKDIGYPVKLGSGVAAA  181
             + L D G  ++ GSGV AA
Sbjct  362   LTLLDCGVKIEPGSGVGAA  380



>ref|WP_028212654.1| serine--glyoxylate aminotransferase [Burkholderia mimosarum]
Length=419

 Score =   427 bits (1098),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 216/384 (56%), Positives = 278/384 (72%), Gaps = 2/384 (1%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGRN L VPGP NIPD V+RAM  + ED+RS   P L   +L D+K+++KTTSG PF+ P
Sbjct  10    PGRNILAVPGPTNIPDAVLRAMVVSMEDHRSSRFPELANGVLSDLKRLYKTTSGQPFIFP  69

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
             ++GTGAWE+ALTNTLSPGDR++    GQFS LW D  QRL F V++++ +WG+G  +  +
Sbjct  70    SSGTGAWEAALTNTLSPGDRVLVARFGQFSHLWADMAQRLGFEVEIIDVDWGEGVPVARI  129

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
                L  D  H IK I   HNETATGVT+++  +R  +D+  HPALL VDGVSSI  IDFR
Sbjct  130   EEVLRADKQHQIKGILACHNETATGVTSDIGALRHAMDNAHHPALLFVDGVSSIGCIDFR  189

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
             MD+W VD+A+TGSQK L LP G+GI+CASPKAL+A + A+S R +FD  D +K    G Y
Sbjct  190   MDDWRVDLAVTGSQKGLMLPAGLGILCASPKALKAMEHAQSRRCYFDLGDMIKANATG-Y  248

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKEEWFS  424
             +PYTP++ LLYGLRA LDLLFEEGLDNV ARH  L    R AV + WGL+ C +  +W S
Sbjct  249   FPYTPALSLLYGLRASLDLLFEEGLDNVFARHHYLAAGVRAAVTEGWGLELCAKAPKWHS  308

Query  423   DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  244
             DTVTA+VVP   +++ ++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L   ++G
Sbjct  309   DTVTAIVVPQGFNAAHVIDTAFRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLTSAISG  368

Query  243   VEMVLKDIGYPVKLGSGVAAASAY  172
              EM + D+G  V+ GSG  AA+ Y
Sbjct  369   AEMAMLDVGIDVRPGSGTGAATQY  392



>ref|WP_022947294.1| serine--glyoxylate aminotransferase [Methylohalobius crimeensis]
Length=395

 Score =   426 bits (1095),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 212/394 (54%), Positives = 275/394 (70%), Gaps = 2/394 (1%)
 Frame = -3

Query  1317  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  1138
             GRNHL+VPGP N PD V+ AM    ED+R+P    L K LLED+KK+F+T  G  FL P 
Sbjct  3     GRNHLYVPGPTNAPDSVLSAMHVPMEDHRAPDFSELVKPLLEDLKKVFRTEKGQVFLFPA  62

Query  1137  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  958
             TGT  WE A+TNTLSPGD+++S+  GQFS LWI   QR+  +V+  E  WG+G  L+ L 
Sbjct  63    TGTAGWEVAMTNTLSPGDKVLSYRFGQFSHLWIQSAQRMGLDVEYHEVPWGEGVPLEHLE  122

Query  957   SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFRM  778
              +L EDT H IK + I HNETATGVTN+LA +R++LD   HPAL ++DGVSSI +I+FRM
Sbjct  123   QRLQEDTNHEIKGLLICHNETATGVTNDLAAIRRILDATGHPALFMIDGVSSIGSIEFRM  182

Query  777   DEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYW  598
             D+WGVDVALTGSQK   LP G   VC SPKALE   TAK  R F + +D ++  + G Y+
Sbjct  183   DDWGVDVALTGSQKGFMLPAGNAYVCFSPKALEKRHTAKCPRSFLNIEDQIQANQTG-YF  241

Query  597   PYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKEEWFSD  421
             PYTP+  +L+GLR  L+LL  EG+DNV ARH RL    R AV   WGL  C +  +W+SD
Sbjct  242   PYTPNTSMLHGLRQVLNLLLAEGMDNVYARHHRLAEGARRAVLDGWGLTLCARDPKWYSD  301

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             +V+A+VVP   D+ +++  A+ RYNLSLG GL++VAGKVFRIGH+G+LNEL L G + G 
Sbjct  302   SVSAIVVPEGFDARDVMHVAYNRYNLSLGGGLSEVAGKVFRIGHMGDLNELMLAGAIVGA  361

Query  240   EMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  139
             EM ++D G  +K GSG+ AA  Y ++T P +P +
Sbjct  362   EMAMRDAGIDLKPGSGITAAMEYWRDTAPPVPGK  395



>ref|WP_028223486.1| serine--glyoxylate aminotransferase [Burkholderia oxyphila]
Length=421

 Score =   427 bits (1097),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 215/390 (55%), Positives = 280/390 (72%), Gaps = 2/390 (1%)
 Frame = -3

Query  1320  PGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIP  1141
             PGRN L VPGP NIPD V+RAM  + ED+RS   P L   +L D+K+++KTTSG PF+ P
Sbjct  10    PGRNILAVPGPTNIPDAVLRAMVVSMEDHRSTRFPELANGVLSDLKRLYKTTSGQPFIFP  69

Query  1140  TTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVL  961
             ++GTGAWE+ALTNTLSPGDR++    GQFS LW D  QRL F V++VE +WG+G  ++ +
Sbjct  70    SSGTGAWEAALTNTLSPGDRVLVARFGQFSHLWADMAQRLGFEVEIVEVDWGEGVPVERI  129

Query  960   ASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFR  781
                L  D  H IK I   HNETATGVT+++  +R  +D+  HPALL VDGVSSI  IDFR
Sbjct  130   EEVLKADKKHQIKGILACHNETATGVTSDIGALRHAMDNAHHPALLFVDGVSSIGCIDFR  189

Query  780   MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  601
             MD+W VD+A+TGSQK L LP G+GI+C SPKAL+A + A+S R +FD  D +K    G Y
Sbjct  190   MDDWRVDLAVTGSQKGLMLPAGLGILCVSPKALKAMEHAQSKRCYFDLADMIKANATG-Y  248

Query  600   WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKEEWFS  424
             +PYTP++ LLYGLRA LDL+F+EGL+NV ARH  L    R AV + WGL+ C +  +W S
Sbjct  249   FPYTPALSLLYGLRAALDLIFQEGLENVFARHHYLAQGVRAAVTEGWGLELCAKAPKWHS  308

Query  423   DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  244
             DTV+A+VVP   +++ ++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L   +AG
Sbjct  309   DTVSAIVVPQGFNAANVIDVAFRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLTSAIAG  368

Query  243   VEMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
              EM + D+G  V+ GSG  AA+ Y +   P
Sbjct  369   AEMAMLDVGIDVRPGSGTGAATQYWRTHDP  398



>ref|WP_010687105.1| Aminotransferase class V [Methylobacterium mesophilicum]
 gb|EMS39671.1| Aminotransferase class V [Methylobacterium mesophilicum SR1.6/6]
Length=402

 Score =   426 bits (1095),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 218/398 (55%), Positives = 285/398 (72%), Gaps = 6/398 (2%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             M     PGRNHLF+PGP NIP++V+RAM   +ED+RSP+ P L K LL+D K +F +T+G
Sbjct  1     MAATRRPGRNHLFIPGPTNIPERVLRAMHVPSEDHRSPSFPELVKPLLQDSKMVFGSTNG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             T  L P++GTG WESAL+NTL  GD++++   GQFS LW+D  QRL  +V V + EWG G
Sbjct  61    TVILFPSSGTGIWESALSNTLCRGDKVLTARYGQFSHLWVDMAQRLGLDVIVQDEEWGAG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A+   +   L  D  H IKA+ +VHNETATGVT+++  VRK +D   HPALL VDG+SSI
Sbjct  121   ADPQKIEEALRADKDHAIKAVMVVHNETATGVTSDIGAVRKAIDAAGHPALLFVDGISSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASK--TAKSVRV---FFDWK  634
              ++ F+MDEWGVD A+ GSQK   LP G+G++C SPKAL+ ++  T ++ R+   +F WK
Sbjct  181   GSLPFKMDEWGVDCAIAGSQKGFMLPAGLGLICISPKALKIAEGGTGRNDRLGHAYFAWK  240

Query  633   DYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLK  454
             D L     G Y+PYTP + LLYGLR  L+++ EEGL+NV  RH  L  ATR AV AWGLK
Sbjct  241   DQLAANATG-YFPYTPVLPLLYGLREALEIVKEEGLENVYHRHHVLAEATRQAVAAWGLK  299

Query  453   NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  274
              C ++ +W SDTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRIGHLG+LN
Sbjct  300   PCAKEPKWNSDTVTAIVVPEGADAAKVIIHAFERYNLSLGAGLSKVAGKVFRIGHLGDLN  359

Query  273   ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  160
             EL LLG +AG EM + D G  V  GSGVAAAS+YL+  
Sbjct  360   ELSLLGAIAGAEMAMLDCGIKVTPGSGVAAASSYLREN  397



>ref|WP_017840623.1| serine--glyoxylate aminotransferase [Methylomicrobium buryatense]
Length=387

 Score =   425 bits (1093),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 222/386 (58%), Positives = 276/386 (72%), Gaps = 2/386 (1%)
 Frame = -3

Query  1317  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  1138
             GRNHL+VPGP NIPD+V+ AM   +ED+RSP  P L K LLED+KK+FKT +G  F+ P 
Sbjct  3     GRNHLYVPGPTNIPDEVLSAMHVPSEDHRSPIFPELFKPLLEDLKKVFKTETGHSFIFPA  62

Query  1137  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  958
             TGT  WE ALTNTLSPGD+++ +  GQFS LW    +RL F V V+E  WG+G  LD L 
Sbjct  63    TGTAGWEIALTNTLSPGDKVLIYRFGQFSHLWAAMAKRLGFEVIVIERPWGEGIPLDDLE  122

Query  957   SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFRM  778
             ++L ED  H IKAI   HNETATGVT+++  VRK +D   HPALL VDGVSSI +IDFRM
Sbjct  123   ARLKEDGQHEIKAILATHNETATGVTSDIGGVRKAMDAAGHPALLFVDGVSSIASIDFRM  182

Query  777   DEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYW  598
             DEWGVD A++GSQK   LP G  +V  S KA+ A  TA+S R F D KD L   K G Y 
Sbjct  183   DEWGVDGAISGSQKGFMLPAGAALVAFSQKAIAACDTAQSRRAFLDLKDQLASNKDG-YT  241

Query  597   PYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDT  418
             PYTPSI +LYGLR  LDLL  EGL+NV ARH RL   TR A+ AWGL+ C  K  + S+T
Sbjct  242   PYTPSIPMLYGLRKALDLLLAEGLENVYARHYRLAEGTRKAIAAWGLELCA-KPGFESNT  300

Query  417   VTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVE  238
             V+AVVVP+  D+ +++  A+ +YN+SLG GLN+VAGKVFRIGH+G++N++ +LG +AGVE
Sbjct  301   VSAVVVPAGKDARDVIATAYSKYNISLGAGLNEVAGKVFRIGHVGDMNDVSMLGAIAGVE  360

Query  237   MVLKDIGYPVKLGSGVAAASAYLQNT  160
             M L D G+ +K GSGVAAA  Y + T
Sbjct  361   MALLDNGFDIKAGSGVAAAIEYYRTT  386



>ref|WP_028755163.1| serine--glyoxylate aminotransferase [Rhizobium leucaenae]
Length=396

 Score =   424 bits (1091),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 213/379 (56%), Positives = 271/379 (72%), Gaps = 1/379 (0%)
 Frame = -3

Query  1317  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  1138
             G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKK+FK  +G  F+ P+
Sbjct  3     GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFADVKKVFKNHNGRVFIYPS  62

Query  1137  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  958
             +GTGAWE+A+TN LSPGDR++    GQFS LW+D  +RL F VD ++ EWG G  +++ A
Sbjct  63    SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAERLGFEVDCLDMEWGTGVPVELYA  122

Query  957   SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFRM  778
              +L  D AH IKA+ + HNETATGVT+++A VR  LD   HPALL VDGVSSI +IDFR 
Sbjct  123   ERLVADKAHKIKAVFVTHNETATGVTSDVAAVRAALDACGHPALLFVDGVSSIGSIDFRQ  182

Query  777   DEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYW  598
             DEWGVD A++GSQK   LP G+G +  S KAL+A+KTA+ +R +F ++D +K    G Y+
Sbjct  183   DEWGVDCAVSGSQKGFMLPAGLGFLSVSQKALDAAKTARHMRCYFSFEDMIKTNDTG-YF  241

Query  597   PYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDT  418
             PYTP  QLL GLRA LDL+FEEGL+N+ ARH  L    R AV AWGLK C  + +W SDT
Sbjct  242   PYTPPTQLLRGLRAALDLIFEEGLENIFARHHHLANGVRAAVSAWGLKLCATEPKWHSDT  301

Query  417   VTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVE  238
             V+A+ +P  ID  E++K A++ YN SLG GL+KVAGKVFRIGHLG+LNE+ +LG L   E
Sbjct  302   VSAIRLPEGIDGVEVIKHAYRAYNTSLGSGLSKVAGKVFRIGHLGSLNEVMVLGALGAAE  361

Query  237   MVLKDIGYPVKLGSGVAAA  181
             + L D G  ++ GSGVAAA
Sbjct  362   LTLLDCGVKIEAGSGVAAA  380



>ref|WP_008058631.1| serine--glyoxylate aminotransferase [Methyloversatilis universalis]
 gb|EGK73403.1| Serine-glyoxylate aminotransferase [Methyloversatilis universalis 
FAM5]
Length=396

 Score =   423 bits (1087),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 212/389 (54%), Positives = 272/389 (70%), Gaps = 2/389 (1%)
 Frame = -3

Query  1317  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  1138
             GRNHL+VPGP N P++++RAM    ED+RSP  P L  ++L D+KK+FKTT GT F  P 
Sbjct  6     GRNHLYVPGPTNTPERILRAMVVPQEDHRSPKFPELALSVLTDLKKVFKTTEGTIFTFPA  65

Query  1137  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  958
             +GTG WE+ALTNTLSPGD+I+    GQFS LW D  QR+ F V V++ EWG G   D   
Sbjct  66    SGTGMWEAALTNTLSPGDKILCSRFGQFSHLWADMAQRMGFEVQVLDCEWGTGVPYDQYE  125

Query  957   SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFRM  778
               L  D  H IKA+    NETATGVT+++  VRK +++  HPALL+VD VSS+ +IDFRM
Sbjct  126   EILRADKEHKIKAVLACQNETATGVTSDIGRVRKAINNANHPALLMVDTVSSLVSIDFRM  185

Query  777   DEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYW  598
             DEWGVD A++GSQK   LP G+GI+  SPKAL+A +TA S R +FD  D LK    G Y+
Sbjct  186   DEWGVDCAVSGSQKGFMLPAGMGILGVSPKALKAMETATSRRCYFDLGDMLKNNATG-YF  244

Query  597   PYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQ-AWGLKNCTQKEEWFSD  421
             PYTPSI +LYG+R  L+ +FEEGL+N+ ARH  L +  R AVQ  W L  C +  EW+SD
Sbjct  245   PYTPSIPMLYGMRESLNTIFEEGLENIFARHNYLASGVRAAVQEGWKLNLCAKAPEWYSD  304

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             TV+A++VP   D+++++  A+ +YNLSLG GL+KVAGKVFRIGHLG+LN L L+  +AG 
Sbjct  305   TVSAILVPEGFDATKVISNAYAKYNLSLGAGLSKVAGKVFRIGHLGDLNALSLMSAIAGA  364

Query  240   EMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
             EM + D G  V  GSGVAAAS Y +   P
Sbjct  365   EMSMLDNGINVTPGSGVAAASTYWRTHAP  393



>ref|WP_018410273.1| serine--glyoxylate aminotransferase [Methyloversatilis sp. NVD]
Length=396

 Score =   422 bits (1085),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 212/389 (54%), Positives = 271/389 (70%), Gaps = 2/389 (1%)
 Frame = -3

Query  1317  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  1138
             GRNHLFVPGP N+PD+V+RAM    ED+RSP  P LTK++L D+KK+FKTT GT    P 
Sbjct  6     GRNHLFVPGPTNVPDRVLRAMVVAQEDHRSPKFPELTKSVLADLKKVFKTTEGTILTFPA  65

Query  1137  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  958
             +GTG WE+ALTNTLSPGD+++    GQFS LW D  QRL F V +++ EWG G   D   
Sbjct  66    SGTGMWEAALTNTLSPGDKVLCSRFGQFSHLWADMAQRLGFEVQILDVEWGTGVPYDQYE  125

Query  957   SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFRM  778
               L  D  H IKA+    NETATGVT+++  VR+ +D+  HPALL+VD VSS+ +IDFRM
Sbjct  126   EVLRADKEHKIKAVLACQNETATGVTSDIGRVRRAMDNANHPALLMVDTVSSLVSIDFRM  185

Query  777   DEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYW  598
             D+WGVD A++GSQK   LP G+GI+  SPKAL+A   A S R +FD KD +     G Y+
Sbjct  186   DDWGVDCAVSGSQKGFMLPAGMGILGMSPKALKAMDGATSRRCYFDIKDMVNANATG-YF  244

Query  597   PYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQ-AWGLKNCTQKEEWFSD  421
             PYTPSI +LYG+R  LD +FEEGL+ + ARH  L    R AVQ  W L  C +  EW+S+
Sbjct  245   PYTPSIPMLYGMREALDTIFEEGLEEIFARHEYLAAGVRAAVQEGWKLNLCAKAPEWYSN  304

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             TV+A+VVP   D+++++  A+++YNLSLG GL+KVAGKVFRIGHLG+LN L L+  +AG 
Sbjct  305   TVSAIVVPEGFDAAKVISNAYQKYNLSLGAGLSKVAGKVFRIGHLGDLNMLSLMSAIAGA  364

Query  240   EMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
             EM + D G  V  GSGVAAAS Y +   P
Sbjct  365   EMSMLDNGINVTPGSGVAAASTYWRTHAP  393



>ref|WP_020092657.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 285MFTsu5.1]
Length=402

 Score =   422 bits (1084),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 218/397 (55%), Positives = 279/397 (70%), Gaps = 6/397 (2%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             M     PGRNHLF+PGP NIP++V+RAM   +ED+RSP+ P L K LL+D K +F +T+G
Sbjct  1     MAATRRPGRNHLFIPGPTNIPERVLRAMHVPSEDHRSPSFPELVKPLLQDSKMVFGSTAG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
             T  L P++GTG WESAL+NTL  GD +++   GQFS LW+D  QRL  +V V E EWG G
Sbjct  61    TVILFPSSGTGIWESALSNTLCRGDTVLTSRYGQFSHLWVDMAQRLGLDVVVQEEEWGTG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
             A+   +   L  D  H IKA+ +VHNETATGVT+++  VRK +D   HPALL VDG+SSI
Sbjct  121   ADPQKIEEALRADKDHKIKAVMVVHNETATGVTSDIGAVRKAIDAAGHPALLFVDGISSI  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALE--ASKTAKSVRV---FFDWK  634
              ++ F MD W VD A+ GSQK   LP G+G++C SPKAL+   S T ++ R+   +F WK
Sbjct  181   GSLPFEMDAWKVDCAIAGSQKGFMLPAGLGLICISPKALKIAESGTGRNDRLGHAYFAWK  240

Query  633   DYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLK  454
             D L     G Y+PYTP + LLYGLR  L ++ EEGL+NV  RH  L  ATR AV AWGLK
Sbjct  241   DQLAANATG-YFPYTPVLPLLYGLREALAVVKEEGLENVYHRHHVLAEATRQAVAAWGLK  299

Query  453   NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  274
              C ++ +W SDTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRIGHLG+LN
Sbjct  300   PCAKEPKWNSDTVTAIVVPEGADAAKVITHAYERYNLSLGAGLSKVAGKVFRIGHLGDLN  359

Query  273   ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQN  163
             EL LLG +AG EM + D G  V  GSGVAAAS+YL+ 
Sbjct  360   ELSLLGAIAGAEMAMIDCGIKVTPGSGVAAASSYLRE  396



>ref|WP_003535479.1| serine--glyoxylate aminotransferase [Sinorhizobium meliloti]
 gb|EHK74228.1| serine--glyoxylate aminotransferase [Sinorhizobium meliloti CCNWSX0020]
Length=396

 Score =   421 bits (1083),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 210/379 (55%), Positives = 270/379 (71%), Gaps = 1/379 (0%)
 Frame = -3

Query  1317  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  1138
             G NHLF+PGP NIP+QV +AM    ED RSP  P LT  L  DVKKIFK  +G  F+ P+
Sbjct  3     GYNHLFIPGPTNIPEQVRQAMNLPMEDMRSPRYPELTLPLFSDVKKIFKNQNGRVFIYPS  62

Query  1137  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  958
             +GTGAWE+A+TN LSPGDR++    GQFS LW+D   RL F VD ++ EWG G  +++ A
Sbjct  63    SGTGAWEAAMTNVLSPGDRVLMSRFGQFSHLWVDMAARLGFEVDCIDREWGTGVPVELYA  122

Query  957   SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFRM  778
              +L+ D AH IKA+ + HNETATGVT+++A VR  LD   HPALL VDGVSSI +IDFR 
Sbjct  123   ERLSADKAHKIKAVFVTHNETATGVTSDVAAVRAALDACAHPALLFVDGVSSIGSIDFRQ  182

Query  777   DEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYW  598
             DEWGVD A++GSQK   LP G+G +  S KALEA+KTA+ +R +F + D +K    G Y+
Sbjct  183   DEWGVDCAVSGSQKGFMLPAGLGFLSVSEKALEAAKTARHMRCYFSFDDMIKTNDTG-YF  241

Query  597   PYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDT  418
             PYTP  QLL GLRA LDL+FEEGL+N+ ARH  L +  R AV AWGLK C  + +W SDT
Sbjct  242   PYTPPTQLLRGLRAALDLIFEEGLENIFARHHHLASGVRAAVSAWGLKLCATEPKWHSDT  301

Query  417   VTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVE  238
             V+A+ +P  +D  E+++ A++ Y+ SLG GL+KVAGKVFRIGHLG+LNE+ +LG L   E
Sbjct  302   VSAIRLPEGVDGVEVIRHAYRTYSTSLGSGLSKVAGKVFRIGHLGSLNEVMVLGALGAAE  361

Query  237   MVLKDIGYPVKLGSGVAAA  181
             + L D G  ++ G+GV AA
Sbjct  362   LTLLDCGVKIEPGAGVGAA  380



>ref|WP_016921634.1| serine--glyoxylate aminotransferase [Methylocystis parvus]
Length=397

 Score =   421 bits (1083),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 208/391 (53%), Positives = 275/391 (70%), Gaps = 1/391 (0%)
 Frame = -3

Query  1338  MDYVNAPGRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSG  1159
             M     PGRN LFVPGP N+PD+++RAM   +ED+RSP  P L K L   +KK+F T  G
Sbjct  1     MQNSRVPGRNFLFVPGPTNLPDRIVRAMAVASEDHRSPTFPDLVKPLFPGLKKVFGTEKG  60

Query  1158  TPFLIPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQG  979
               F+ P +GTG WE+A+TNTLSPGD++++   GQFS LWID   RL   V   E  WG G
Sbjct  61    HAFIFPASGTGGWEAAITNTLSPGDKVLAQRFGQFSHLWIDLANRLGLEVIKQERPWGTG  120

Query  978   ANLDVLASKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSI  799
              + +++   L  D  H IKA+   HNETATGV++++A VRK +D  +HPALL VDGVSS+
Sbjct  121   NDPELIEETLKADKNHEIKAVFATHNETATGVSSDIAAVRKAIDAAKHPALLFVDGVSSV  180

Query  798   CAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKF  619
              +++F+MDEWGVDV ++GSQK   LP G+ ++ ASPKA++A KT K  R +F+++D +  
Sbjct  181   ASLEFKMDEWGVDVIVSGSQKGFMLPAGLLLMAASPKAIDAGKTNKGRRAYFEFQDMIAQ  240

Query  618   YKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  439
                G Y+PYTPS+ LLYGL+  L +LFEEGLD V  RH  L   TR AV AWGLK C ++
Sbjct  241   NANG-YFPYTPSVPLLYGLKESLSILFEEGLDQVYKRHHHLAEGTRAAVAAWGLKTCAKE  299

Query  438   EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  259
              +W SDTVTA+VVP   D+ ++++ A+KRYNL+LG GL++VAGKVFRIGHLG+LNEL LL
Sbjct  300   PKWNSDTVTAIVVPEGYDAVKVIETAYKRYNLALGAGLSEVAGKVFRIGHLGDLNELMLL  359

Query  258   GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  166
             G +AG EM + D G  ++ GSGVAAA A  +
Sbjct  360   GAIAGAEMAMLDNGIKIEAGSGVAAAQAVFR  390



>ref|WP_036271184.1| serine--glyoxylate aminotransferase [Methyloversatilis universalis]
Length=396

 Score =   421 bits (1082),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 213/389 (55%), Positives = 271/389 (70%), Gaps = 2/389 (1%)
 Frame = -3

Query  1317  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  1138
             GRNHL+VPGP N P++++RAM    ED+RSP  P LTK++L D+KK+FKTT GT    P 
Sbjct  6     GRNHLYVPGPTNTPERILRAMVVPQEDHRSPKFPELTKSVLADLKKVFKTTEGTVLTFPA  65

Query  1137  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  958
             +GTG WE+ALTNTLSPGD+I+    GQFS LW D  QRL F V +++ EWG G   D   
Sbjct  66    SGTGMWETALTNTLSPGDKILCSRFGQFSHLWADMAQRLGFEVQILDVEWGTGVPYDQYE  125

Query  957   SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFRM  778
               L  D  H IKA+    NETATGVT+++  VRK +++  HPALL+VD VSS+ +IDFRM
Sbjct  126   EVLRADKEHKIKAVLACQNETATGVTSDIGRVRKAINNANHPALLMVDTVSSLVSIDFRM  185

Query  777   DEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYW  598
             DEWGVD A++GSQK   LP G+GI+  SPKAL+A  T+ S R +FD KD L     G Y+
Sbjct  186   DEWGVDCAVSGSQKGFMLPAGMGILGMSPKALKAIDTSTSRRCYFDIKDMLNANATG-YF  244

Query  597   PYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQ-AWGLKNCTQKEEWFSD  421
             PYTPSI +LYG+R  LD +FEEGL+ + ARH  L    R AVQ  W L  C +  EW+S+
Sbjct  245   PYTPSIPMLYGMREALDTIFEEGLETIFARHEYLANGVRAAVQEGWKLNLCAKAPEWYSN  304

Query  420   TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  241
             TV+A+VVP   D+++++  A+ +YNLSLG GL+KVAGKVFRIGHLG+LN L L+  +AG 
Sbjct  305   TVSAIVVPEGFDAAKVISNAYAKYNLSLGAGLSKVAGKVFRIGHLGDLNALSLMSAIAGA  364

Query  240   EMVLKDIGYPVKLGSGVAAASAYLQNTTP  154
             EM + D G  V  GSGVAAAS Y +  TP
Sbjct  365   EMSMLDNGINVTPGSGVAAASTYWRTHTP  393



>gb|AFZ62596.1| serine-glyoxylate aminotransferase [Hyphomicrobium nitrativorans 
NL23]
 gb|AHB49532.1| serine--glyoxylate aminotransferase [Hyphomicrobium nitrativorans 
NL23]
Length=400

 Score =   421 bits (1082),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 215/391 (55%), Positives = 274/391 (70%), Gaps = 4/391 (1%)
 Frame = -3

Query  1308  HLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPTTGT  1129
             HLF+PGP N+PD V  AM    ED RSP  P  T  + ED+KK FK   G  F+ P++GT
Sbjct  8     HLFIPGPTNVPDAVRMAMNLPMEDMRSPEFPKFTLPIFEDLKKAFKMKDGRVFIFPSSGT  67

Query  1128  GAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLASKL  949
             GAWESA+ NTL+ GD+++    GQFSLLW+D  +RL  NV + + EWG G  L+  A  L
Sbjct  68    GAWESAIENTLAVGDKVLMSRFGQFSLLWVDMAERLGLNVVLCDEEWGTGVPLEKYADIL  127

Query  948   AEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFRMDEW  769
             A+DTAH IKA+   HNETATGV++++A VRK LD  +HPA+L VD VS + ++D RM EW
Sbjct  128   AKDTAHEIKAVFATHNETATGVSSDIAGVRKALDAAKHPAMLFVDSVSGVGSLDMRMGEW  187

Query  768   GVDVALTGSQKALSLPTGIGIVCASPKALEASKT--AKSVRVFFDWKDYLKFYKMGTYWP  595
             GVD  ++GSQK   LPTG+GI+  S KAL+A+K+   +  R FF W+D +K    G ++P
Sbjct  188   GVDCCVSGSQKGFMLPTGLGILAVSQKALDANKSLNGRMNRCFFSWEDMIKTNDQG-FFP  246

Query  594   YTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTV  415
             YTP+ QL+ GLR  LDLLF EG+DNV ARHTRL +  R AV AWGLK C ++ +W SDTV
Sbjct  247   YTPATQLIRGLRTSLDLLFAEGIDNVFARHTRLASGVRAAVDAWGLKLCAKEPKWHSDTV  306

Query  414   TAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM  235
             +A++VP  IDS+ +VK A+ RYN SLG+GLNKVAGKVFRIGHLG L+E  + G L  VEM
Sbjct  307   SAILVPEGIDSANVVKTAYYRYNTSLGVGLNKVAGKVFRIGHLGALDEYMIGGVLFSVEM  366

Query  234   VLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  142
              LKD G PVKLGSG  AA+ Y  N  P+ P+
Sbjct  367   ALKDCGVPVKLGSGTGAAAEYFVN-NPVKPA  396



>ref|WP_027147316.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacter]
Length=388

 Score =   421 bits (1081),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 212/386 (55%), Positives = 280/386 (73%), Gaps = 2/386 (1%)
 Frame = -3

Query  1317  GRNHLFVPGPVNIPDQVIRAMTRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLIPT  1138
             GRNHL++PGP N+P +V+ AM  N ED+RSP  P L K LL+D+KK+FKT +G  F+ P 
Sbjct  3     GRNHLYIPGPTNVPSEVLNAMHVNMEDHRSPIFPKLLKPLLQDLKKVFKTETGQAFVFPA  62

Query  1137  TGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQQRLNFNVDVVESEWGQGANLDVLA  958
             TGT  WE ALTNTL+PGD+++ +  GQFS LW +  +RL F+V++ +  WG+G  LD L 
Sbjct  63    TGTAGWEIALTNTLNPGDKVLIYRFGQFSHLWAEMAKRLGFDVEIHQEAWGKGIPLDKLE  122

Query  957   SKLAEDTAHTIKAICIVHNETATGVTNNLATVRKLLDHYQHPALLLVDGVSSICAIDFRM  778
             ++L ED+ H IKA+   HNETATGVT+++  VRK ++   HPALL VDGVSSI ++DFRM
Sbjct  123   ARLKEDSQHEIKAVLATHNETATGVTSDIGGVRKAMNAANHPALLFVDGVSSIASLDFRM  182

Query  777   DEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYW  598
             DEWGVD A++GSQK   LP G   V  S KAL+A +T+   R F D KD +   K G Y 
Sbjct  183   DEWGVDGAISGSQKGFMLPAGGAFVAFSQKALQACETSTYPRCFLDLKDQMSANKDG-YT  241

Query  597   PYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDT  418
             PYTPS+ +LYGLR  LDLLFEEGL+NV ARH RL   TR AV+AWGLK C Q   + SDT
Sbjct  242   PYTPSLPILYGLRKALDLLFEEGLENVYARHHRLAEGTRKAVEAWGLKLCAQP-GFESDT  300

Query  417   VTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVE  238
             V+A+VVP   D+ +++  A+ +YN+SLG GL++VAGKVFRIGH+G++N++ +LG +AGVE
Sbjct  301   VSAIVVPEGKDARDVISTAFNKYNISLGAGLSEVAGKVFRIGHVGDMNDVSMLGAIAGVE  360

Query  237   MVLKDIGYPVKLGSGVAAASAYLQNT  160
             M + D G+ +K GSGVAAA  Y ++T
Sbjct  361   MAMLDNGFDIKPGSGVAAAIEYYRST  386



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4575529313201