BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3951

Length=984
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHN26125.1|  Glucose-6-phosphate isomerase                           467   6e-160   Glycine soja [wild soybean]
emb|CDP11483.1|  unnamed protein product                                464   1e-158   Coffea canephora [robusta coffee]
ref|XP_003519196.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    468   4e-158   Glycine max [soybeans]
gb|KHN09015.1|  Glucose-6-phosphate isomerase                           465   7e-157   Glycine soja [wild soybean]
ref|XP_003526535.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    465   7e-157   Glycine max [soybeans]
ref|XP_008219393.1|  PREDICTED: LOW QUALITY PROTEIN: glucose-6-ph...    465   9e-157   Prunus mume [ume]
ref|XP_007222012.1|  hypothetical protein PRUPE_ppa002932mg             464   2e-156   Prunus persica
ref|XP_002301084.1|  hypothetical protein POPTR_0002s10420g             463   3e-156   Populus trichocarpa [western balsam poplar]
gb|AES98218.2|  glucose-6-phosphate isomerase                           463   3e-156   Medicago truncatula
ref|XP_003615260.1|  Glucose-6-phosphate isomerase                      464   4e-156   
ref|XP_009770115.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    462   7e-156   Nicotiana sylvestris
ref|XP_008378564.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    458   7e-156   
gb|KHN08244.1|  Glucose-6-phosphate isomerase                           462   1e-155   Glycine soja [wild soybean]
ref|XP_003522754.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    462   1e-155   Glycine max [soybeans]
ref|XP_008444947.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    462   1e-155   Cucumis melo [Oriental melon]
ref|XP_007141251.1|  hypothetical protein PHAVU_008G180200g             461   2e-155   Phaseolus vulgaris [French bean]
ref|XP_002514018.1|  glucose-6-phosphate isomerase, putative            462   2e-155   Ricinus communis
ref|XP_011074228.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    462   2e-155   Sesamum indicum [beniseed]
ref|XP_009342567.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    461   5e-155   Pyrus x bretschneideri [bai li]
ref|XP_004148412.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    461   5e-155   Cucumis sativus [cucumbers]
ref|XP_006433853.1|  hypothetical protein CICLE_v10000603mg             460   7e-155   Citrus clementina [clementine]
gb|KJB58924.1|  hypothetical protein B456_009G230800                    460   7e-155   Gossypium raimondii
gb|KDO81122.1|  hypothetical protein CISIN_1g007074mg                   460   1e-154   Citrus sinensis [apfelsine]
ref|XP_009417608.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    459   1e-154   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008378562.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    459   2e-154   
gb|KHG25467.1|  Glucose-6-phosphate isomerase                           459   2e-154   Gossypium arboreum [tree cotton]
emb|CBI19242.3|  unnamed protein product                                454   2e-154   Vitis vinifera
ref|XP_008338925.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    459   3e-154   
ref|XP_012067970.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    458   3e-154   Jatropha curcas
ref|XP_004299713.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    459   3e-154   Fragaria vesca subsp. vesca
ref|XP_011016894.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    458   3e-154   Populus euphratica
ref|XP_010061514.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    458   4e-154   Eucalyptus grandis [rose gum]
ref|XP_006472503.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    458   6e-154   Citrus sinensis [apfelsine]
ref|XP_004490428.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    457   8e-154   
ref|XP_004490427.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    457   9e-154   Cicer arietinum [garbanzo]
ref|XP_008811018.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    456   2e-153   Phoenix dactylifera
ref|XP_010939741.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    456   4e-153   Elaeis guineensis
ref|XP_002285696.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    455   6e-153   Vitis vinifera
gb|KJB64170.1|  hypothetical protein B456_010G035600                    455   7e-153   Gossypium raimondii
gb|KJB64171.1|  hypothetical protein B456_010G035600                    454   1e-152   Gossypium raimondii
ref|XP_006338083.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    454   1e-152   Solanum tuberosum [potatoes]
ref|XP_010266267.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    454   2e-152   Nelumbo nucifera [Indian lotus]
gb|AFC88848.1|  glucose-6-phosphate isomerase                           449   2e-152   Tetragonia tetragonioides
ref|NP_001234583.1|  glucose-6-phosphate isomerase                      454   2e-152   
ref|XP_010521052.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    454   2e-152   Tarenaya hassleriana [spider flower]
gb|KHG02611.1|  Glucose-6-phosphate isomerase                           452   5e-152   Gossypium arboreum [tree cotton]
ref|XP_009373815.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    452   9e-152   Pyrus x bretschneideri [bai li]
ref|XP_006841224.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    452   1e-151   Amborella trichopoda
ref|XP_009373819.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    452   1e-151   Pyrus x bretschneideri [bai li]
ref|XP_003578256.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    452   1e-151   Brachypodium distachyon [annual false brome]
gb|AIU34465.1|  putative glucose-6-phosphate isomerase                  451   4e-151   Taraxacum brevicorniculatum
ref|XP_010675347.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    450   6e-151   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010433744.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    449   1e-150   Camelina sativa [gold-of-pleasure]
ref|XP_010272935.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    449   2e-150   Nelumbo nucifera [Indian lotus]
emb|CDY03434.1|  BnaC01g16480D                                          449   2e-150   
emb|CAA03982.1|  glucose-6-phosphate isomerase                          448   3e-150   Spinacia oleracea
ref|XP_006283347.1|  hypothetical protein CARUB_v10004391mg             448   3e-150   Capsella rubella
ref|XP_010448542.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    448   3e-150   Camelina sativa [gold-of-pleasure]
ref|XP_009138293.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    448   3e-150   Brassica rapa
emb|CDY34296.1|  BnaA01g13990D                                          448   4e-150   Brassica napus [oilseed rape]
ref|XP_002867655.1|  hypothetical protein ARALYDRAFT_492381             448   4e-150   Arabidopsis lyrata subsp. lyrata
ref|XP_009380895.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    447   4e-150   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX92647.1|  BnaC07g39050D                                          447   9e-150   
ref|NP_001063415.1|  Os09g0465600                                       447   1e-149   
dbj|BAD08451.1|  glucose-6-phosphate isomerase                          447   1e-149   Oryza sativa Japonica Group [Japonica rice]
gb|EEC84721.1|  hypothetical protein OsI_31689                          447   1e-149   Oryza sativa Indica Group [Indian rice]
emb|CDY11024.1|  BnaA03g46830D                                          446   1e-149   Brassica napus [oilseed rape]
gb|EYU36464.1|  hypothetical protein MIMGU_mgv1a002902mg                447   1e-149   Erythranthe guttata [common monkey flower]
ref|NP_194193.2|  phosphoglucose isomerase 1                            446   2e-149   Arabidopsis thaliana [mouse-ear cress]
emb|CEF52500.1|  Cs92274 plastidic phosphoglucose isomerase             446   3e-149   Arabidopsis thaliana [mouse-ear cress]
emb|CAA23001.1|  glucose-6-phosphate isomerase                          446   3e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010439004.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    445   4e-149   Camelina sativa [gold-of-pleasure]
ref|XP_002462509.1|  hypothetical protein SORBIDRAFT_02g027000          445   5e-149   Sorghum bicolor [broomcorn]
ref|XP_006660715.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    445   5e-149   Oryza brachyantha
ref|XP_004957064.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    445   5e-149   Setaria italica
ref|XP_010530225.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    445   5e-149   Tarenaya hassleriana [spider flower]
ref|XP_009137464.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    443   3e-148   Brassica rapa
ref|XP_010107702.1|  Glucose-6-phosphate isomerase                      444   4e-148   
ref|NP_001147983.1|  glucose-6-phosphate isomerase                      441   1e-147   
gb|ACF84319.1|  unknown                                                 441   1e-147   Zea mays [maize]
gb|AAF24124.1|AF120494_1  phosphoglucose isomerase precursor            441   3e-147   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413409.1|  hypothetical protein EUTSA_v10024695mg             439   2e-146   Eutrema salsugineum [saltwater cress]
gb|EPS64968.1|  glucose-6-phosphate isomerase                           435   6e-146   Genlisea aurea
gb|ABR16270.1|  unknown                                                 437   7e-146   Picea sitchensis
ref|NP_001168977.1|  uncharacterized protein LOC100382805               437   1e-145   Zea mays [maize]
gb|EAZ07365.1|  hypothetical protein OsI_29615                          437   1e-145   Oryza sativa Indica Group [Indian rice]
ref|XP_006660218.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    434   2e-145   
ref|NP_001062053.1|  Os08g0478800                                       436   2e-145   
gb|EAZ43091.1|  hypothetical protein OsJ_27683                          436   2e-145   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008651420.1|  PREDICTED: glucose-6-phosphate isomerase iso...    431   5e-143   Zea mays [maize]
ref|XP_007018186.1|  Glucose-6-phosphate isomerase isoform 1            415   1e-136   
ref|XP_001762355.1|  predicted protein                                  409   9e-136   
ref|XP_002970310.1|  hypothetical protein SELMODRAFT_147101             408   2e-135   
ref|XP_002978474.1|  hypothetical protein SELMODRAFT_108783             408   2e-135   
gb|EMT13737.1|  Glucose-6-phosphate isomerase                           400   1e-131   
ref|NP_001078444.1|  phosphoglucose isomerase 1                         361   6e-117   Arabidopsis thaliana [mouse-ear cress]
gb|KHN25059.1|  Glucose-6-phosphate isomerase                           328   3e-109   Glycine soja [wild soybean]
gb|KJB64172.1|  hypothetical protein B456_010G035600                    336   2e-107   Gossypium raimondii
ref|XP_010272936.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    328   5e-104   Nelumbo nucifera [Indian lotus]
tpg|DAA40277.1|  TPA: hypothetical protein ZEAMMB73_545188              323   2e-102   
ref|XP_007018187.1|  Glucose-6-phosphate isomerase isoform 2            304   3e-96    
ref|XP_009604867.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    290   8e-95    Nicotiana tomentosiformis
ref|WP_009554363.1|  glucose-6-phosphate isomerase                      295   7e-92    Oscillatoriales cyanobacterium JSC-12
ref|WP_017322014.1|  glucose-6-phosphate isomerase                      295   8e-92    cyanobacterium PCC 7702
ref|WP_006106108.1|  glucose-6-phosphate isomerase                      295   1e-91    Coleofasciculus chthonoplastes
ref|WP_019489916.1|  glucose-6-phosphate isomerase                      293   6e-91    Calothrix sp. PCC 7103
ref|WP_044290801.1|  glucose-6-phosphate isomerase                      290   3e-90    
ref|WP_039737191.1|  glucose-6-phosphate isomerase                      291   4e-90    
ref|WP_015227550.1|  glucose-6-phosphate isomerase                      290   5e-90    Halothece sp. PCC 7418
ref|WP_040938053.1|  glucose-6-phosphate isomerase                      291   5e-90    
gb|AFY54049.1|  glucose-6-phosphate isomerase                           290   1e-89    Rivularia sp. PCC 7116
ref|WP_035121197.1|  glucose-6-phosphate isomerase                      288   2e-89    
ref|WP_036531294.1|  glucose-6-phosphate isomerase                      288   4e-89    Neosynechococcus sphagnicola
ref|WP_029634654.1|  glucose-6-phosphate isomerase [                    288   6e-89    [Scytonema hofmanni] UTEX B 1581
ref|WP_018400182.1|  hypothetical protein                               287   8e-89    filamentous cyanobacterium ESFC-1
ref|WP_017310420.1|  glucose-6-phosphate isomerase                      287   9e-89    Fischerella sp. PCC 9339
gb|EAW46724.1|  glucose-6-phosphate isomerase                           286   1e-88    Nodularia spumigena CCY9414
ref|WP_040931879.1|  glucose-6-phosphate isomerase                      287   2e-88    
ref|WP_015140444.1|  glucose-6-phosphate isomerase                      286   2e-88    Nostoc sp. PCC 7524
ref|WP_015229719.1|  glucose-6-phosphate isomerase                      286   2e-88    Dactylococcopsis salina
ref|WP_017661233.1|  glucose-6-phosphate isomerase                      286   2e-88    Geitlerinema sp. PCC 7105
ref|WP_017315368.1|  glucose-6-phosphate isomerase                      286   3e-88    Mastigocladopsis repens
ref|WP_015190580.1|  glucose-6-phosphate isomerase                      286   3e-88    Gloeocapsa sp. PCC 7428
ref|WP_017803973.1|  glucose-6-phosphate isomerase                      285   4e-88    Nodularia spumigena
ref|WP_016868155.1|  glucose-6-phosphate isomerase                      285   4e-88    
ref|WP_008180763.1|  glucose-6-phosphate isomerase                      285   5e-88    Moorea producens
ref|WP_036482868.1|  glucose-6-phosphate isomerase                      285   7e-88    Myxosarcina sp. GI1
ref|WP_015220786.1|  glucose-6-phosphate isomerase                      285   8e-88    Cyanobacterium aponinum
ref|WP_015143167.1|  glucose-6-phosphate isomerase                      285   9e-88    Pleurocapsa minor
ref|WP_039726011.1|  MULTISPECIES: glucose-6-phosphate isomerase        285   1e-87    Lyngbya confervoides
ref|WP_037220824.1|  glucose-6-phosphate isomerase                      284   1e-87    
gb|KIJ81304.1|  glucose-6-phosphate isomerase                           284   1e-87    
ref|WP_015955750.1|  glucose-6-phosphate isomerase                      284   2e-87    Cyanothece sp. PCC 7424
ref|WP_012410277.1|  glucose-6-phosphate isomerase                      283   3e-87    Nostoc punctiforme
gb|KIE07545.1|  glucose-6-phosphate isomerase                           283   3e-87    
ref|WP_045873392.1|  glucose-6-phosphate isomerase                      283   3e-87    Nostocales
ref|WP_015183178.1|  glucose-6-phosphate isomerase                      283   3e-87    Microcoleus sp. PCC 7113
ref|WP_011613372.1|  glucose-6-phosphate isomerase                      283   4e-87    Trichodesmium erythraeum
ref|WP_015203112.1|  glucose-6-phosphate isomerase                      283   5e-87    Crinalium epipsammum
ref|WP_016871330.1|  MULTISPECIES: glucose-6-phosphate isomerase        281   9e-87    
ref|WP_017653850.1|  glucose-6-phosphate isomerase                      281   1e-86    Fortiea contorta
ref|WP_015171468.1|  glucose-6-phosphate isomerase                      281   1e-86    Geitlerinema sp. PCC 7407
ref|WP_009782694.1|  glucose-6-phosphate isomerase                      281   2e-86    Lyngbya sp. PCC 8106
ref|WP_016860819.1|  glucose-6-phosphate isomerase                      281   2e-86    Fischerella muscicola
gb|EPF24002.1|  Glucose-6-phosphate isomerase                           271   3e-86    Microcystis aeruginosa SPC777
gb|EHC15954.1|  Glucose-6-phosphate isomerase                           281   3e-86    Fischerella thermalis
ref|WP_019507243.1|  hypothetical protein                               281   3e-86    Pleurocapsa sp. PCC 7319
ref|WP_006634277.1|  glucose-6-phosphate isomerase                      281   3e-86    Microcoleus vaginatus
ref|WP_026087390.1|  glucose-6-phosphate isomerase                      280   3e-86    Chlorogloeopsis fritschii
ref|WP_015193169.1|  glucose-6-phosphate isomerase                      280   5e-86    Stanieria cyanosphaera
ref|WP_007358100.1|  MULTISPECIES: glucose-6-phosphate isomerase        280   5e-86    Kamptonema
ref|WP_041036461.1|  glucose-6-phosphate isomerase                      280   5e-86    Tolypothrix campylonemoides
ref|WP_027841326.1|  glucose-6-phosphate isomerase                      280   7e-86    Mastigocoleus testarum
ref|WP_035984938.1|  glucose-6-phosphate isomerase                      280   7e-86    Leptolyngbya sp. KIOST-1
ref|WP_026730901.1|  glucose-6-phosphate isomerase                      280   8e-86    Fischerella sp. PCC 9605
ref|WP_008232649.1|  Glucose-6-phosphate isomerase                      279   1e-85    Richelia intracellularis
ref|WP_015146974.1|  glucose-6-phosphate isomerase                      279   1e-85    Oscillatoria acuminata
ref|WP_008228780.1|  Glucose-6-phosphate isomerase                      278   2e-85    Richelia intracellularis
ref|WP_017746118.1|  glucose-6-phosphate isomerase                      278   3e-85    Scytonema hofmannii
dbj|BAQ65381.1|  glucose-6-phosphate isomerase                          278   3e-85    Geminocystis sp. NIES-3709
ref|WP_023067352.1|  phosphoglucose isomerase family protein            278   4e-85    Lyngbya aestuarii
ref|WP_015156915.1|  glucose-6-phosphate isomerase                      278   4e-85    Chroococcidiopsis thermalis
ref|WP_013324389.1|  glucose-6-phosphate isomerase                      278   4e-85    Cyanothece sp. PCC 7822
ref|WP_039713129.1|  glucose-6-phosphate isomerase                      278   4e-85    
ref|WP_026102112.1|  glucose-6-phosphate isomerase                      277   6e-85    Geminocystis herdmanii
ref|WP_015178388.1|  glucose-6-phosphate isomerase                      277   8e-85    Oscillatoria nigro-viridis
ref|WP_010995224.1|  glucose-6-phosphate isomerase                      277   8e-85    Nostocaceae
ref|WP_017298730.1|  hypothetical protein                               276   1e-84    Nodosilinea nodulosa
ref|WP_024544497.1|  glucose-6-phosphate isomerase                      276   1e-84    Synechococcus sp. NKBG15041c
ref|WP_045054403.1|  glucose-6-phosphate isomerase                      276   1e-84    Aliterella atlantica
ref|WP_002766618.1|  glucose-6-phosphate isomerase                      276   1e-84    Microcystis aeruginosa
ref|WP_030007267.1|  glucose-6-phosphate isomerase                      276   2e-84    Synechococcus sp. NKBG042902
dbj|BAQ60104.1|  glucose-6-phosphate isomerase                          276   2e-84    Geminocystis sp. NIES-3708
ref|WP_006519785.1|  glucose-6-phosphate isomerase                      276   2e-84    Leptolyngbya sp. PCC 7375
ref|WP_009633959.1|  glucose-6-phosphate isomerase                      276   2e-84    Synechocystis sp. PCC 7509
ref|WP_002788681.1|  glucose-6-phosphate isomerase                      276   3e-84    Microcystis aeruginosa
emb|CCE20320.1|  Glucose-6-phosphate isomerase                          275   3e-84    Arthrospira sp. PCC 8005
ref|WP_010872791.1|  glucose-6-phosphate isomerase                      275   4e-84    Synechocystis
ref|WP_006621857.1|  glucose-6-phosphate isomerase                      275   5e-84    Arthrospira platensis
ref|WP_035153545.1|  glucose-6-phosphate isomerase                      275   5e-84    Calothrix sp. 336/3
ref|WP_006668847.1|  glucose-6-phosphate isomerase                      275   5e-84    Arthrospira
ref|WP_015111823.1|  glucose-6-phosphate isomerase                      275   5e-84    Nostoc sp. PCC 7107
ref|WP_023070461.1|  glucose-6-phosphate isomerase                      275   6e-84    Leptolyngbya sp. Heron Island J
ref|WP_006455302.1|  glucose-6-phosphate isomerase                      275   7e-84    Synechococcus sp. PCC 7335
ref|WP_011320408.1|  glucose-6-phosphate isomerase                      274   1e-83    Trichormus variabilis
ref|WP_012306591.1|  glucose-6-phosphate isomerase                      274   1e-83    Synechococcus
ref|WP_015161306.1|  glucose-6-phosphate isomerase                      274   1e-83    Chamaesiphon minutus
ref|WP_015127110.1|  glucose-6-phosphate isomerase                      274   1e-83    Calothrix sp. PCC 7507
ref|WP_017718111.1|  glucose-6-phosphate isomerase                      273   2e-83    Oscillatoria sp. PCC 10802
ref|WP_015214525.1|  glucose-6-phosphate isomerase                      273   2e-83    Anabaena cylindrica
ref|WP_028947160.1|  glucose-6-phosphate isomerase                      273   2e-83    Synechocystis sp. PCC 6714
ref|WP_039203444.1|  glucose-6-phosphate isomerase                      263   2e-83    
ref|WP_016950192.1|  glucose-6-phosphate isomerase                      273   3e-83    Anabaena sp. PCC 7108
ref|WP_008317107.1|  glucose-6-phosphate isomerase                      273   3e-83    Leptolyngbya sp. PCC 6406
ref|WP_002757376.1|  glucose-6-phosphate isomerase                      273   4e-83    Microcystis aeruginosa
ref|WP_041234628.1|  glucose-6-phosphate isomerase                      273   4e-83    
gb|AFZ48680.1|  glucose-6-phosphate isomerase                           272   5e-83    Cyanobacterium stanieri PCC 7202
ref|WP_041643098.1|  glucose-6-phosphate isomerase                      272   5e-83    Trichormus azollae
ref|WP_023171410.1|  glucose-6-phosphate isomerase                      272   6e-83    Gloeobacter kilaueensis
gb|ADI64627.1|  Glucose-6-phosphate isomerase                           272   6e-83    'Nostoc azollae' 0708
ref|WP_004161559.1|  glucose-6-phosphate isomerase                      272   7e-83    Microcystis aeruginosa
ref|WP_026787654.1|  glucose-6-phosphate isomerase                      272   8e-83    Planktothrix rubescens
ref|WP_015164239.1|  glucose-6-phosphate isomerase                      272   8e-83    Pseudanabaena sp. PCC 7367
ref|WP_006529689.1|  glucose-6-phosphate isomerase                      271   9e-83    Gloeocapsa sp. PCC 73106
ref|WP_015201010.1|  glucose-6-phosphate isomerase                      271   9e-83    Calothrix parietina
ref|WP_002798750.1|  glucose-6-phosphate isomerase                      271   1e-82    Microcystis aeruginosa
ref|WP_026796492.1|  glucose-6-phosphate isomerase                      271   1e-82    Planktothrix
ref|WP_002802157.1|  glucose-6-phosphate isomerase                      271   1e-82    Microcystis aeruginosa
ref|WP_045362683.1|  glucose-6-phosphate isomerase                      271   2e-82    Microcystis aeruginosa
ref|WP_008203131.1|  glucose-6-phosphate isomerase                      271   2e-82    Microcystis sp. T1-4
ref|WP_027402980.1|  glucose-6-phosphate isomerase                      271   2e-82    Aphanizomenon flos-aquae
gb|ESS73728.1|  glucose-6-phosphate isomerase Pgi                       271   2e-82    Methyloglobulus morosus KoM1
ref|WP_042154237.1|  glucose-6-phosphate isomerase                      271   2e-82    Planktothrix agardhii
ref|WP_006618634.1|  glucose-6-phosphate isomerase                      271   2e-82    Arthrospira platensis
ref|WP_017285984.1|  glucose-6-phosphate isomerase                      270   3e-82    Leptolyngbya boryana
ref|WP_013044065.1|  glucose-6-phosphate isomerase                      270   5e-82    Coraliomargarita akajimensis
ref|WP_028090636.1|  glucose-6-phosphate isomerase                      270   5e-82    Dolichospermum circinale
ref|WP_026795511.1|  MULTISPECIES: glucose-6-phosphate isomerase        270   5e-82    Planktothrix
ref|WP_012164582.1|  glucose-6-phosphate isomerase                      270   5e-82    Acaryochloris marina
ref|WP_015210240.1|  glucose-6-phosphate isomerase                      270   6e-82    Cylindrospermum stagnale
ref|WP_013817364.1|  glucose-6-phosphate isomerase                      270   6e-82    Methylomonas methanica
ref|WP_012593812.1|  MULTISPECIES: glucose-6-phosphate isomerase        270   6e-82    Cyanothece
ref|WP_002784921.1|  Glucose-6-phosphate isomerase                      269   7e-82    Microcystis aeruginosa
ref|WP_010470262.1|  glucose-6-phosphate isomerase                      269   8e-82    Acaryochloris sp. CCMEE 5410
ref|WP_009545914.1|  MULTISPECIES: glucose-6-phosphate isomerase        269   9e-82    Cyanothece
ref|WP_028082099.1|  glucose-6-phosphate isomerase                      269   1e-81    Dolichospermum circinale
ref|WP_002768243.1|  glucose-6-phosphate isomerase                      268   1e-81    Microcystis aeruginosa
gb|ACB50017.1|  glucose-6-phosphate isomerase                           269   1e-81    Cyanothece sp. ATCC 51142
ref|WP_015078659.1|  glucose-6-phosphate isomerase (PGI)                268   1e-81    Anabaena sp. 90
ref|WP_009342721.1|  glucose-6-phosphate isomerase                      268   2e-81    Raphidiopsis brookii
ref|WP_015135901.1|  glucose-6-phosphate isomerase                      268   2e-81    Leptolyngbya sp. PCC 7376
ref|WP_002744648.1|  glucose-6-phosphate isomerase                      268   2e-81    Microcystis aeruginosa
ref|WP_008274806.1|  glucose-6-phosphate isomerase                      268   2e-81    Cyanothece sp. CCY0110
ref|WP_002737763.1|  glucose-6-phosphate isomerase                      268   2e-81    Microcystis aeruginosa
ref|WP_002752368.1|  glucose-6-phosphate isomerase                      268   2e-81    Microcystis aeruginosa
ref|WP_002776042.1|  glucose-6-phosphate isomerase                      268   3e-81    Microcystis aeruginosa
ref|WP_002792485.1|  glucose-6-phosphate isomerase                      268   3e-81    Microcystis aeruginosa
ref|WP_024971160.1|  glucose-6-phosphate isomerase                      268   3e-81    Microcystis aeruginosa
ref|WP_006510266.1|  glucose-6-phosphate isomerase                      268   3e-81    Xenococcus sp. PCC 7305
ref|WP_006277122.1|  glucose-6-phosphate isomerase                      267   7e-81    Cylindrospermopsis raciborskii
ref|WP_022609225.1|  glucose-6-phosphate isomerase                      266   9e-81    Rubidibacter lacunae
ref|WP_009547551.1|  MULTISPECIES: glucose-6-phosphate isomerase        266   1e-80    Cyanothece
ref|WP_036306529.1|  glucose-6-phosphate isomerase                      266   1e-80    
ref|WP_015838689.1|  glucose-6-phosphate isomerase                      266   1e-80    Geobacter sp. M21
ref|WP_011429295.1|  glucose-6-phosphate isomerase                      265   5e-80    Synechococcus sp. JA-3-3Ab
ref|WP_019500287.1|  hypothetical protein                               265   5e-80    Pseudanabaena sp. PCC 6802
ref|WP_007305399.1|  glucose-6-phosphate isomerase                      264   6e-80    Crocosphaera watsonii
ref|WP_007310646.1|  glucose-6-phosphate isomerase                      264   6e-80    Crocosphaera watsonii
ref|WP_040054149.1|  glucose-6-phosphate isomerase                      264   1e-79    
ref|WP_009625633.1|  Glucose-6-phosphate isomerase                      264   1e-79    Pseudanabaena biceps
emb|CCQ69360.1|  Glucose-6-phosphate isomerase                          264   1e-79    Crocosphaera watsonii WH 0402
ref|WP_044106551.1|  glucose-6-phosphate isomerase                      263   2e-79    cyanobacterium endosymbiont of Epithemia turgida
ref|WP_015719033.1|  glucose-6-phosphate isomerase                      261   7e-79    Geobacter sp. M18
ref|WP_039729186.1|  MULTISPECIES: glucose-6-phosphate isomerase        261   1e-78    Lyngbya confervoides
ref|WP_002633630.1|  glucose-6-phosphate isomerase                      261   1e-78    Myxococcus hansupus
ref|WP_011434454.1|  glucose-6-phosphate isomerase                      261   2e-78    Synechococcus sp. JA-2-3B'a(2-13)
ref|WP_011940554.1|  glucose-6-phosphate isomerase                      260   3e-78    Geobacter uraniireducens
gb|ADB95108.1|  glucose-6-phosphate isomerase                           259   4e-78    Candidatus Atelocyanobacterium thalassa isolate ALOHA
ref|WP_013937458.1|  glucose-6-phosphate isomerase                      259   4e-78    Myxococcus macrosporus
ref|WP_041487725.1|  glucose-6-phosphate isomerase                      258   1e-77    Candidatus Atelocyanobacterium thalassa
ref|WP_017305628.1|  hypothetical protein                               258   1e-77    Spirulina subsalsa
ref|WP_011556828.1|  glucose-6-phosphate isomerase                      258   2e-77    Myxococcus xanthus
ref|WP_012531843.1|  glucose-6-phosphate isomerase                      257   3e-77    Geobacter bemidjiensis
ref|WP_012646586.1|  glucose-6-phosphate isomerase                      256   6e-77    Geobacter daltonii
ref|WP_026842173.1|  glucose-6-phosphate isomerase                      256   8e-77    Geobacter bremensis
ref|WP_011244376.1|  MULTISPECIES: glucose-6-phosphate isomerase        256   9e-77    Synechococcus
ref|WP_017326848.1|  hypothetical protein                               256   1e-76    Synechococcus sp. PCC 7336
ref|WP_022478075.1|  glucose-6-phosphate isomerase                      246   2e-76    
ref|WP_002628702.1|  Glucose-6-phosphate isomerase                      255   2e-76    Cystobacter fuscus
ref|WP_015353024.1|  glucose-6-phosphate isomerase                      254   4e-76    Myxococcus stipitatus
ref|WP_007360779.1|  glucose-6-phosphate isomerase                      254   5e-76    Opitutaceae bacterium TAV1
ref|WP_002619398.1|  glucose-6-phosphate isomerase                      253   1e-75    Stigmatella aurantiaca
ref|WP_012375827.1|  glucose-6-phosphate isomerase                      253   1e-75    Opitutus terrae
ref|WP_007414257.1|  glucose-6-phosphate isomerase                      253   2e-75    Pedosphaera parvula
ref|WP_015169303.1|  glucose-6-phosphate isomerase                      251   6e-75    Synechococcus sp. PCC 7502
ref|WP_044197646.1|  glucose-6-phosphate isomerase                      251   6e-75    Hyalangium minutum
gb|KFE62312.1|  Glucose-6-phosphate isomerase                           251   7e-75    Hyalangium minutum
ref|WP_039645456.1|  glucose-6-phosphate isomerase                      251   1e-74    Geobacter
ref|WP_041404001.1|  glucose-6-phosphate isomerase                      249   3e-74    
ref|WP_043582814.1|  glucose-6-phosphate isomerase                      249   4e-74    
gb|ADG69805.1|  Glucose-6-phosphate isomerase                           249   4e-74    
ref|WP_039741214.1|  glucose-6-phosphate isomerase                      249   4e-74    
ref|WP_009511456.1|  glucose-6-phosphate isomerase                      249   4e-74    
ref|WP_045668152.1|  glucose-6-phosphate isomerase                      249   5e-74    
ref|WP_012238297.1|  glucose-6-phosphate isomerase                      249   6e-74    
ref|WP_010941965.1|  glucose-6-phosphate isomerase                      249   6e-74    
ref|WP_014400271.1|  glucose-6-phosphate isomerase                      249   6e-74    
ref|WP_015122972.1|  glucose-6-phosphate isomerase                      248   1e-73    
ref|WP_004512442.1|  glucose-6-phosphate isomerase                      248   1e-73    
ref|WP_010583635.1|  glucose-6-phosphate isomerase                      247   2e-73    
ref|WP_044235602.1|  glucose-6-phosphate isomerase                      247   3e-73    
ref|WP_041970771.1|  glucose-6-phosphate isomerase                      246   7e-73    
ref|WP_025782014.1|  glucose-6-phosphate isomerase                      246   8e-73    
dbj|GAM08832.1|  glucose-6-phosphate isomerase                          246   9e-73    
ref|WP_043399765.1|  glucose-6-phosphate isomerase                      245   1e-72    
ref|WP_026099696.1|  glucose-6-phosphate isomerase                      245   2e-72    
ref|WP_041243323.1|  glucose-6-phosphate isomerase                      244   3e-72    
gb|ACD95736.1|  Glucose-6-phosphate isomerase                           243   3e-72    
ref|WP_011056564.1|  glucose-6-phosphate isomerase                      243   1e-71    
ref|WP_024125643.1|  glucose-6-phosphate isomerase Pgi                  242   2e-71    
ref|WP_006977581.1|  glucose-6-phosphate isomerase                      241   4e-71    
ref|WP_038170100.1|  glucose-6-phosphate isomerase                      238   6e-70    
ref|WP_029734706.1|  glucose-6-phosphate isomerase                      238   9e-70    
ref|WP_020738669.1|  glucose-6-phosphate isomerase                      238   1e-69    
ref|WP_010510852.1|  glucose-6-phosphate isomerase                      237   2e-69    
ref|WP_009962961.1|  glucose-6-phosphate isomerase                      236   3e-69    
ref|WP_013565473.1|  glucose-6-phosphate isomerase                      236   5e-69    
ref|WP_011735281.1|  glucose-6-phosphate isomerase                      235   7e-69    
ref|WP_012626232.1|  glucose-6-phosphate isomerase                      234   1e-68    
ref|WP_018970763.1|  hypothetical protein                               233   3e-68    
ref|WP_008102014.1|  glucose-6-phosphate isomerase                      233   3e-68    
gb|KJR40512.1|  glucose-6-phosphate isomerase                           231   2e-67    
ref|WP_018051640.1|  glucose-6-phosphate isomerase                      231   3e-67    
ref|WP_028260482.1|  glucose-6-phosphate isomerase                      231   4e-67    
ref|WP_042503503.1|  glucose-6-phosphate isomerase                      228   3e-66    
sp|Q7U6T0.1|G6PI_SYNPX  RecName: Full=Glucose-6-phosphate isomera...    228   6e-66    
ref|WP_010152387.1|  glucose-6-phosphate isomerase                      224   2e-64    
ref|WP_022398218.1|  glucose-6-phosphate isomerase                      223   2e-64    
ref|WP_038544717.1|  glucose-6-phosphate isomerase                      222   9e-64    
ref|WP_006852589.1|  glucose-6-phosphate isomerase                      221   1e-63    
ref|WP_022197390.1|  glucose-6-phosphate isomerase                      221   2e-63    
ref|WP_012421002.1|  glucose-6-phosphate isomerase                      221   2e-63    
ref|WP_028952047.1|  glucose-6-phosphate isomerase                      220   4e-63    
ref|WP_035614409.1|  glucose-6-phosphate isomerase                      219   8e-63    
ref|WP_011619301.1|  glucose-6-phosphate isomerase                      219   9e-63    
ref|WP_041384970.1|  glucose-6-phosphate isomerase                      218   2e-62    
sp|Q7V7M6.2|G6PI_PROMM  RecName: Full=Glucose-6-phosphate isomera...    218   3e-62    
emb|CAE20889.1|  Phosphoglucose isomerase (PGI)                         218   3e-62    
ref|WP_036915729.1|  MULTISPECIES: glucose-6-phosphate isomerase        218   4e-62    
ref|WP_041375139.1|  glucose-6-phosphate isomerase                      218   4e-62    
gb|ABM78251.1|  Phosphoglucose isomerase (PGI)                          218   4e-62    
gb|KGG25893.1|  Glucose-6-phosphate isomerase                           218   4e-62    
gb|KGG24742.1|  Glucose-6-phosphate isomerase                           218   5e-62    
ref|YP_002048816.1|  glucose-6-phosphate isomerase                      217   2e-61    
ref|WP_041445358.1|  glucose-6-phosphate isomerase                      216   2e-61    
gb|ADY56508.1|  glucose-6-phosphate isomerase                           216   3e-61    
ref|WP_015108230.1|  glucose-6-phosphate isomerase                      215   3e-61    
ref|WP_011125098.1|  MULTISPECIES: glucose-6-phosphate isomerase        215   4e-61    
ref|WP_037980669.1|  glucose-6-phosphate isomerase                      214   6e-61    
ref|WP_036918256.1|  MULTISPECIES: glucose-6-phosphate isomerase        214   6e-61    
gb|KGG15269.1|  Glucose-6-phosphate isomerase                           214   9e-61    
gb|EAQ74537.1|  glucose-6-phosphate isomerase                           214   9e-61    
ref|WP_041434765.1|  glucose-6-phosphate isomerase                      214   1e-60    
ref|WP_007097924.1|  glucose-6-phosphate isomerase                      214   1e-60    
ref|WP_043696472.1|  glucose-6-phosphate isomerase                      214   1e-60    
emb|CDP16221.1|  unnamed protein product                                202   1e-60    
gb|ABB35135.1|  Glucose-6-phosphate isomerase                           214   1e-60    
gb|AII45242.1|  glucose-6-phosphate isomerase                           214   1e-60    
ref|WP_038004915.1|  glucose-6-phosphate isomerase                      213   2e-60    
gb|EAR18703.1|  glucose-6-phosphate isomerase                           213   2e-60    
ref|WP_011359899.1|  glucose-6-phosphate isomerase                      213   2e-60    
ref|WP_006851839.1|  glucose-6-phosphate isomerase                      213   3e-60    
ref|WP_036903026.1|  glucose-6-phosphate isomerase                      213   3e-60    
ref|WP_041379168.1|  glucose-6-phosphate isomerase                      212   4e-60    
ref|WP_043736938.1|  glucose-6-phosphate isomerase                      212   5e-60    
emb|CAK28250.1|  Glucose-6-phosphate isomerase                          212   5e-60    
dbj|BAM04908.1|  glucose-6-phosphate isomerase                          212   7e-60    
ref|WP_038554838.1|  glucose-6-phosphate isomerase                      211   8e-60    
ref|WP_034425691.1|  glucose-6-phosphate isomerase                      211   9e-60    
ref|WP_009789756.1|  glucose-6-phosphate isomerase                      211   1e-59    
ref|WP_041428833.1|  glucose-6-phosphate isomerase                      211   1e-59    
ref|WP_007102473.1|  glucose-6-phosphate isomerase                      211   1e-59    
emb|CAK23685.1|  Glucose-6-phosphate isomerase                          211   1e-59    
ref|WP_020149911.1|  hypothetical protein                               209   4e-59    
ref|WP_019110513.1|  MULTISPECIES: hypothetical protein                 209   5e-59    
ref|WP_012195427.1|  glucose-6-phosphate isomerase                      209   6e-59    
gb|KJS83383.1|  glucose-6-phosphate isomerase                           209   1e-58    
ref|WP_034132197.1|  glucose-6-phosphate isomerase                      209   1e-58    
sp|Q46L16.2|G6PI_PROMT  RecName: Full=Glucose-6-phosphate isomera...    208   1e-58    
ref|WP_014794446.1|  glucose-6-phosphate isomerase                      208   2e-58    
ref|WP_011293854.1|  glucose-6-phosphate isomerase                      208   2e-58    
ref|WP_006911242.1|  glucose-6-phosphate isomerase                      208   2e-58    
ref|WP_036907556.1|  glucose-6-phosphate isomerase                      207   3e-58    
ref|WP_019850767.1|  glucose-6-phosphate isomerase                      207   3e-58    
ref|WP_011823677.1|  glucose-6-phosphate isomerase                      206   9e-58    
ref|WP_006715513.1|  glucose-6-phosphate isomerase                      206   9e-58    
ref|WP_020492466.1|  glucose-6-phosphate isomerase                      206   1e-57    
ref|WP_015044823.1|  MULTISPECIES: glucose-6-phosphate isomerase        205   2e-57    
ref|WP_010317053.1|  glucose-6-phosphate isomerase                      204   3e-57    
gb|AIQ97101.1|  Glucose-6-phosphate isomerase                           204   5e-57    
ref|WP_019224626.1|  MULTISPECIES: glucose-6-phosphate isomerase        204   6e-57    
ref|WP_038652569.1|  glucose-6-phosphate isomerase                      203   8e-57    
gb|EHL06593.1|  glucose-6-phosphate isomerase                           202   2e-56    
emb|CDX02117.1|  Glucose-6-phosphate isomerase                          202   2e-56    
ref|WP_011460008.1|  glucose-6-phosphate isomerase                      202   3e-56    
ref|WP_015944462.1|  glucose-6-phosphate isomerase                      201   5e-56    
ref|WP_018211407.1|  glucose-6-phosphate isomerase                      201   6e-56    
ref|WP_019475118.1|  hypothetical protein                               201   6e-56    
ref|WP_036897821.1|  glucose-6-phosphate isomerase                      201   7e-56    
ref|WP_015262619.1|  glucose-6-phosphate isomerase                      201   1e-55    
ref|WP_036920994.1|  glucose-6-phosphate isomerase                      198   9e-55    
ref|WP_025938364.1|  glucose-6-phosphate isomerase                      195   1e-54    
ref|WP_032515925.1|  glucose-6-phosphate isomerase                      196   3e-54    
ref|WP_025961154.1|  glucose-6-phosphate isomerase                      196   5e-54    
ref|WP_025925289.1|  MULTISPECIES: glucose-6-phosphate isomerase        195   9e-54    
ref|WP_025937442.1|  glucose-6-phosphate isomerase                      192   1e-53    
ref|WP_040407279.1|  glucose-6-phosphate isomerase                      195   1e-53    
ref|WP_032521421.1|  glucose-6-phosphate isomerase                      194   3e-53    
ref|WP_025930327.1|  glucose-6-phosphate isomerase                      194   3e-53    
ref|WP_032514375.1|  glucose-6-phosphate isomerase                      193   4e-53    
ref|WP_025931888.1|  glucose-6-phosphate isomerase                      193   5e-53    
ref|WP_025952782.1|  glucose-6-phosphate isomerase                      193   5e-53    
ref|WP_032524440.1|  glucose-6-phosphate isomerase                      193   6e-53    
ref|WP_010308564.1|  glucose-6-phosphate isomerase                      193   6e-53    
ref|WP_032518584.1|  glucose-6-phosphate isomerase                      193   7e-53    
ref|WP_025942373.1|  MULTISPECIES: glucose-6-phosphate isomerase        193   7e-53    
ref|WP_025940655.1|  glucose-6-phosphate isomerase                      193   7e-53    
ref|WP_011132523.1|  glucose-6-phosphate isomerase                      192   8e-53    
ref|WP_032518904.1|  glucose-6-phosphate isomerase                      192   8e-53    
ref|WP_025972146.1|  glucose-6-phosphate isomerase                      192   9e-53    
ref|WP_025933523.1|  glucose-6-phosphate isomerase                      192   9e-53    
ref|WP_025939431.1|  glucose-6-phosphate isomerase                      192   9e-53    
ref|WP_025935882.1|  glucose-6-phosphate isomerase                      192   9e-53    
ref|WP_025935095.1|  glucose-6-phosphate isomerase                      192   1e-52    
ref|WP_032517098.1|  glucose-6-phosphate isomerase                      192   1e-52    
ref|WP_025891685.1|  MULTISPECIES: glucose-6-phosphate isomerase        192   1e-52    
ref|WP_025958943.1|  glucose-6-phosphate isomerase                      192   1e-52    
ref|WP_025890791.1|  glucose-6-phosphate isomerase                      192   1e-52    
ref|WP_025980463.1|  glucose-6-phosphate isomerase                      192   1e-52    
ref|WP_025969823.1|  glucose-6-phosphate isomerase                      192   1e-52    
ref|WP_025964817.1|  glucose-6-phosphate isomerase                      192   1e-52    
ref|WP_025939100.1|  glucose-6-phosphate isomerase                      192   1e-52    
ref|WP_025951955.1|  glucose-6-phosphate isomerase                      192   1e-52    
ref|WP_025894509.1|  MULTISPECIES: glucose-6-phosphate isomerase        192   1e-52    
ref|WP_025947343.1|  glucose-6-phosphate isomerase                      192   1e-52    
ref|WP_011862940.1|  glucose-6-phosphate isomerase                      192   1e-52    
ref|WP_025975056.1|  glucose-6-phosphate isomerase                      192   1e-52    
ref|WP_011818410.1|  glucose-6-phosphate isomerase                      192   1e-52    
ref|WP_025959855.1|  glucose-6-phosphate isomerase                      192   1e-52    
ref|WP_025970761.1|  glucose-6-phosphate isomerase                      192   1e-52    
ref|WP_025893271.1|  glucose-6-phosphate isomerase                      192   1e-52    
ref|WP_025973899.1|  glucose-6-phosphate isomerase                      192   1e-52    
ref|WP_025980942.1|  MULTISPECIES: glucose-6-phosphate isomerase        192   2e-52    
ref|WP_025945179.1|  MULTISPECIES: glucose-6-phosphate isomerase        192   2e-52    
ref|WP_025954624.1|  glucose-6-phosphate isomerase                      192   2e-52    
ref|WP_025900546.1|  MULTISPECIES: glucose-6-phosphate isomerase        192   2e-52    
ref|WP_042850366.1|  glucose-6-phosphate isomerase                      191   2e-52    
ref|WP_025941623.1|  glucose-6-phosphate isomerase                      191   2e-52    
ref|WP_025926493.1|  glucose-6-phosphate isomerase                      191   2e-52    
ref|WP_025929369.1|  glucose-6-phosphate isomerase                      191   3e-52    
ref|WP_025975820.1|  MULTISPECIES: glucose-6-phosphate isomerase        191   3e-52    
ref|WP_025946776.1|  glucose-6-phosphate isomerase                      191   3e-52    
ref|WP_006513696.1|  glucose-6-phosphate isomerase                      191   4e-52    
ref|WP_012007704.1|  glucose-6-phosphate isomerase                      191   4e-52    
ref|WP_002807326.1|  glucose-6-phosphate isomerase                      191   5e-52    
ref|WP_025962934.1|  glucose-6-phosphate isomerase                      191   5e-52    
ref|WP_011376464.1|  glucose-6-phosphate isomerase                      190   6e-52    
ref|WP_025968048.1|  glucose-6-phosphate isomerase                      190   6e-52    
ref|WP_025928411.1|  glucose-6-phosphate isomerase                      190   7e-52    
ref|WP_025944681.1|  glucose-6-phosphate isomerase                      190   7e-52    
ref|WP_032526193.1|  glucose-6-phosphate isomerase                      190   1e-51    
ref|WP_011820281.1|  glucose-6-phosphate isomerase                      189   1e-51    
ref|WP_025955711.1|  glucose-6-phosphate isomerase                      189   2e-51    
ref|WP_025921512.1|  glucose-6-phosphate isomerase                      189   2e-51    
gb|KJB64173.1|  hypothetical protein B456_010G035600                    187   5e-51    
ref|XP_006433854.1|  hypothetical protein CICLE_v10000603mg             186   1e-50    
ref|WP_033368186.1|  hypothetical protein                               186   2e-50    
ref|WP_025923171.1|  glucose-6-phosphate isomerase                      186   2e-50    
gb|ABD66390.1|  phosphoglucoisomerase                                   164   5e-46    
ref|WP_035217025.1|  glucose-6-phosphate isomerase                      171   6e-45    
ref|WP_021833731.1|  Glucose-6-phosphate isomerase                      154   7e-42    
gb|KJU83456.1|  glucose-6-phosphate isomerase                           148   2e-38    
gb|KCW44288.1|  hypothetical protein EUGRSUZ_L02270                     145   2e-37    
ref|XP_010040965.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    128   2e-32    
ref|XP_010058030.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    127   3e-32    
ref|WP_025974301.1|  hypothetical protein                               122   3e-29    
gb|EST47593.1|  Glucose-6-phosphate isomerase                           124   1e-28    
gb|AAL56572.1|AF425238_1  glucose-6-phosphate isomerase                 124   1e-28    
ref|XP_001323512.1|  glucose-6-phosphate isomerase family protein       125   2e-28    
gb|AAL56573.1|AF425240_1  glucose-6-phosphate isomerase                 124   2e-28    
gb|KJU86326.1|  glucose-6-phosphate isomerase                           111   4e-26    
ref|XP_006581482.1|  PREDICTED: glucose-6-phosphate isomerase 1, ...    105   2e-24    
gb|KJU84486.1|  Glucose-6-phosphate isomerase                           105   5e-24    
ref|XP_001708857.1|  Glucose-6-phosphate isomerase                      109   5e-23    
gb|ESU37941.1|  Glucose-6-phosphate isomerase                           107   2e-22    
gb|EFO62000.1|  Glucose-6-phosphate isomerase                           107   3e-22    
ref|XP_002680064.1|  predicted protein                                  106   4e-22    
ref|WP_029951413.1|  glucose-6-phosphate isomerase                    99.8    5e-22    
gb|ESU45332.1|  Glucose-6-phosphate isomerase                           106   7e-22    
gb|EET01281.1|  Glucose-6-phosphate isomerase                           106   7e-22    
ref|XP_007137642.1|  hypothetical protein PHAVU_009G143500g             105   3e-21    
ref|WP_029977084.1|  glucose-6-phosphate isomerase                    95.1    2e-20    
ref|WP_029951354.1|  glucose-6-phosphate isomerase                    95.5    3e-20    
ref|WP_041334873.1|  glucose-6-phosphate isomerase                    98.6    2e-19    
ref|WP_023004149.1|  glucose-6-phosphate isomerase                    98.2    3e-19    
ref|WP_013333999.1|  glucose-6-phosphate isomerase                    96.7    1e-18    
gb|EKD44973.1|  hypothetical protein ACD_70C00133G0003                92.0    1e-18    
ref|WP_010625746.1|  glucose-6-phosphate isomerase                    95.9    2e-18    
ref|WP_018917444.1|  glucose-6-phosphate isomerase                    95.9    2e-18    
ref|WP_019020139.1|  glucose-6-phosphate isomerase                    95.9    2e-18    
ref|WP_036149402.1|  glucose-6-phosphate isomerase                    94.4    5e-18    
ref|WP_040244451.1|  glucose-6-phosphate isomerase                    94.4    6e-18    
emb|CDQ33553.1|  Glucose-6-phosphate isomerase                        94.4    6e-18    
ref|WP_009723689.1|  glucose-6-phosphate isomerase                    94.4    7e-18    
ref|WP_035557034.1|  glucose-6-phosphate isomerase                    94.0    7e-18    
ref|WP_030068990.1|  glucose-6-phosphate isomerase                    94.0    7e-18    
ref|WP_016417875.1|  glucose-6-phosphate isomerase                    94.0    7e-18    
ref|WP_038483223.1|  glucose-6-phosphate isomerase                    94.0    8e-18    
ref|WP_022523007.1|  Glucose-6-phosphate isomerase 1                  94.0    8e-18    
ref|WP_008956995.1|  glucose-6-phosphate isomerase                    94.0    8e-18    



>gb|KHN26125.1| Glucose-6-phosphate isomerase, partial [Glycine soja]
Length=441

 Score =   467 bits (1201),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 222/231 (96%), Positives = 229/231 (99%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDL+GNRVNQGI+VYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  211  SRYLQQLVMESLGKEFDLNGNRVNQGISVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  270

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN+RESITVTVQEVTPRSVGALVALYE
Sbjct  271  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANNRESITVTVQEVTPRSVGALVALYE  330

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEE+AD
Sbjct  331  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEVAD  390

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA EDIEMIYKIIAHMAANDRALIAEGNCGSPRS+KVFLGECN+DELYA
Sbjct  391  RCHAPEDIEMIYKIIAHMAANDRALIAEGNCGSPRSIKVFLGECNLDELYA  441



>emb|CDP11483.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   464 bits (1195),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 220/231 (95%), Positives = 228/231 (99%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQGI+VYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  249  SRYLQQLVMESLGKEFDLDGNRVNQGISVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  308

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGML GTRSALYANDRESI+VTVQEVTPRSVGALVALYE
Sbjct  309  RDRPPGHDWELEPGVTCGDYLFGMLHGTRSALYANDRESISVTVQEVTPRSVGALVALYE  368

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEE+AD
Sbjct  369  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEVAD  428

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA EDIEMI+KIIAHMAANDRA+IAEG+CGSPRS+KVFLGECNVDELYA
Sbjct  429  RCHASEDIEMIFKIIAHMAANDRAIIAEGSCGSPRSIKVFLGECNVDELYA  479



>ref|XP_003519196.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
[Glycine max]
Length=613

 Score =   468 bits (1205),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 222/231 (96%), Positives = 229/231 (99%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDL+GNRVNQGI+VYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  383  SRYLQQLVMESLGKEFDLNGNRVNQGISVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  442

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN+RESITVTVQEVTPRSVGALVALYE
Sbjct  443  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANNRESITVTVQEVTPRSVGALVALYE  502

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEE+AD
Sbjct  503  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEVAD  562

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA EDIEMIYKIIAHMAANDRALIAEGNCGSPRS+KVFLGECN+DELYA
Sbjct  563  RCHAPEDIEMIYKIIAHMAANDRALIAEGNCGSPRSIKVFLGECNLDELYA  613



>gb|KHN09015.1| Glucose-6-phosphate isomerase [Glycine soja]
Length=615

 Score =   465 bits (1197),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 220/231 (95%), Positives = 228/231 (99%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQGI+VYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  385  SRYLQQLVMESLGKEFDLDGNRVNQGISVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  444

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN+RESITVTVQEVTPR+VGAL+ LYE
Sbjct  445  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANNRESITVTVQEVTPRTVGALIGLYE  504

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD
Sbjct  505  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  564

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA EDIEMIYKIIAHMAANDRALIAEG+CGSPRS+KVFLGECN+DELYA
Sbjct  565  RCHAPEDIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNIDELYA  615



>ref|XP_003526535.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
[Glycine max]
Length=615

 Score =   465 bits (1197),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 220/231 (95%), Positives = 228/231 (99%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQGI+VYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  385  SRYLQQLVMESLGKEFDLDGNRVNQGISVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  444

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN+RESITVTVQEVTPR+VGAL+ LYE
Sbjct  445  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANNRESITVTVQEVTPRTVGALIGLYE  504

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD
Sbjct  505  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  564

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA EDIEMIYKIIAHMAANDRALIAEG+CGSPRS+KVFLGECN+DELYA
Sbjct  565  RCHAPEDIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNIDELYA  615



>ref|XP_008219393.1| PREDICTED: LOW QUALITY PROTEIN: glucose-6-phosphate isomerase 
1, chloroplastic [Prunus mume]
Length=616

 Score =   465 bits (1196),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 218/231 (94%), Positives = 227/231 (98%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MES+GKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  386  SRYLQQLVMESIGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  445

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALY NDRESITVTVQEVTPRSVGAL+ALYE
Sbjct  446  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYGNDRESITVTVQEVTPRSVGALIALYE  505

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEE+AD
Sbjct  506  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEVAD  565

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCH+ E+IEMIYKIIAHMAANDRALIAEG+CGSPRS+KVFLGECNVD LYA
Sbjct  566  RCHSPEEIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDALYA  616



>ref|XP_007222012.1| hypothetical protein PRUPE_ppa002932mg [Prunus persica]
 gb|EMJ23211.1| hypothetical protein PRUPE_ppa002932mg [Prunus persica]
Length=620

 Score =   464 bits (1194),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 218/231 (94%), Positives = 226/231 (98%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MES+GKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  390  SRYLQQLVMESIGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  449

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALY NDRESITVTVQEVTPRSVGAL+ALYE
Sbjct  450  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYGNDRESITVTVQEVTPRSVGALIALYE  509

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEE+AD
Sbjct  510  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEVAD  569

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCH+ E IEMIYKIIAHMAANDRALIAEG+CGSPRS+KVFLGECNVD LYA
Sbjct  570  RCHSPEQIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDALYA  620



>ref|XP_002301084.1| hypothetical protein POPTR_0002s10420g [Populus trichocarpa]
 gb|EEE80357.1| hypothetical protein POPTR_0002s10420g [Populus trichocarpa]
Length=616

 Score =   463 bits (1192),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 218/231 (94%), Positives = 227/231 (98%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  386  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  445

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYA DRESITVTVQEVTPRSVGAL+ LYE
Sbjct  446  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAKDRESITVTVQEVTPRSVGALIGLYE  505

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCK+PVEPLT+EE+AD
Sbjct  506  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKQPVEPLTIEEVAD  565

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA EDIEMIYKIIAHMAANDRALIAEG+CGSPRS+KVFLGECNVDEL+A
Sbjct  566  RCHATEDIEMIYKIIAHMAANDRALIAEGSCGSPRSLKVFLGECNVDELFA  616



>gb|AES98218.2| glucose-6-phosphate isomerase [Medicago truncatula]
Length=617

 Score =   463 bits (1192),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 219/231 (95%), Positives = 228/231 (99%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE+DLDGNRVNQGI+VYGNKGSTDQHA+IQQLREGVHNFF TFIEVL
Sbjct  387  SRYLQQLVMESLGKEYDLDGNRVNQGISVYGNKGSTDQHAYIQQLREGVHNFFATFIEVL  446

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALY+NDRESITVTVQEVTPRSVGALVALYE
Sbjct  447  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYSNDRESITVTVQEVTPRSVGALVALYE  506

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLT+EE+A+
Sbjct  507  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTIEEVAE  566

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA EDIE+IYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDE+YA
Sbjct  567  RCHAPEDIEVIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDEMYA  617



>ref|XP_003615260.1| Glucose-6-phosphate isomerase [Medicago truncatula]
Length=622

 Score =   464 bits (1193),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 219/231 (95%), Positives = 228/231 (99%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE+DLDGNRVNQGI+VYGNKGSTDQHA+IQQLREGVHNFF TFIEVL
Sbjct  392  SRYLQQLVMESLGKEYDLDGNRVNQGISVYGNKGSTDQHAYIQQLREGVHNFFATFIEVL  451

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALY+NDRESITVTVQEVTPRSVGALVALYE
Sbjct  452  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYSNDRESITVTVQEVTPRSVGALVALYE  511

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLT+EE+A+
Sbjct  512  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTIEEVAE  571

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA EDIE+IYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDE+YA
Sbjct  572  RCHAPEDIEVIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDEMYA  622



>ref|XP_009770115.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic [Nicotiana 
sylvestris]
Length=615

 Score =   462 bits (1190),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 221/231 (96%), Positives = 227/231 (98%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQGI+VYGNKGSTDQHA+IQQLREGVHNFF TFIEVL
Sbjct  385  SRYLQQLVMESLGKEFDLDGNRVNQGISVYGNKGSTDQHAYIQQLREGVHNFFATFIEVL  444

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE
Sbjct  445  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  504

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTL+EIA+
Sbjct  505  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLDEIAE  564

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCH  EDIEMIYKIIAHMAANDRALIAEG+CGSPRSVKV+LGECNVDELYA
Sbjct  565  RCHCEEDIEMIYKIIAHMAANDRALIAEGSCGSPRSVKVYLGECNVDELYA  615



>ref|XP_008378564.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
isoform X2 [Malus domestica]
Length=482

 Score =   458 bits (1178),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 214/230 (93%), Positives = 227/230 (99%), Gaps = 0/230 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MES+GKEFDL+GNRVNQG+TVYGNKGSTDQHA+IQQLR+GVHNFFVTFIEVL
Sbjct  252  SRYLQQLVMESIGKEFDLNGNRVNQGLTVYGNKGSTDQHAYIQQLRDGVHNFFVTFIEVL  311

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALY+N+RESITVTV+EVTPRSVGAL+ALYE
Sbjct  312  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYSNERESITVTVEEVTPRSVGALIALYE  371

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCK+PVEPLTLEE+AD
Sbjct  372  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKDPVEPLTLEEVAD  431

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELY  294
            RCHA EDIEMIYKIIAHMAANDRA+IAEGNCGSPRS+KVFLGECNVD LY
Sbjct  432  RCHAXEDIEMIYKIIAHMAANDRAIIAEGNCGSPRSIKVFLGECNVDALY  481



>gb|KHN08244.1| Glucose-6-phosphate isomerase [Glycine soja]
Length=615

 Score =   462 bits (1189),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 218/231 (94%), Positives = 227/231 (98%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQGI+VYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  385  SRYLQQLVMESLGKEFDLDGNRVNQGISVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  444

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN+RESITVTVQEVTPR+VGAL+ALYE
Sbjct  445  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANNRESITVTVQEVTPRTVGALIALYE  504

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEE+AD
Sbjct  505  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEVAD  564

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA EDIEMIYKIIAHMAANDRALI EG+CGSPRS+KVFLGECN+D LYA
Sbjct  565  RCHAPEDIEMIYKIIAHMAANDRALIVEGSCGSPRSIKVFLGECNIDGLYA  615



>ref|XP_003522754.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
[Glycine max]
Length=615

 Score =   462 bits (1189),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 218/231 (94%), Positives = 227/231 (98%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQGI+VYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  385  SRYLQQLVMESLGKEFDLDGNRVNQGISVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  444

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN+RESITVTVQEVTPR+VGAL+ALYE
Sbjct  445  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANNRESITVTVQEVTPRTVGALIALYE  504

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEE+AD
Sbjct  505  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEVAD  564

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA EDIEMIYKIIAHMAANDRALI EG+CGSPRS+KVFLGECN+D LYA
Sbjct  565  RCHAPEDIEMIYKIIAHMAANDRALIVEGSCGSPRSIKVFLGECNIDGLYA  615



>ref|XP_008444947.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic [Cucumis 
melo]
Length=624

 Score =   462 bits (1190),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 216/231 (94%), Positives = 228/231 (99%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  394  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  453

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESI+VTVQEVTPRSVGA+VALYE
Sbjct  454  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESISVTVQEVTPRSVGAMVALYE  513

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YAS++NINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTL+E+A+
Sbjct  514  RAVGLYASIININAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLDEVAE  573

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA EDIEMIYKIIAHMAANDRALIAEG CGSPRS+KVFLGECNVD+LYA
Sbjct  574  RCHAPEDIEMIYKIIAHMAANDRALIAEGTCGSPRSIKVFLGECNVDDLYA  624



>ref|XP_007141251.1| hypothetical protein PHAVU_008G180200g [Phaseolus vulgaris]
 gb|ESW13245.1| hypothetical protein PHAVU_008G180200g [Phaseolus vulgaris]
Length=609

 Score =   461 bits (1187),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 219/231 (95%), Positives = 227/231 (98%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQGI+VYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  379  SRYLQQLVMESLGKEFDLDGNRVNQGISVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  438

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN+RES+TVTVQEV PRSVGAL+ALYE
Sbjct  439  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANNRESLTVTVQEVNPRSVGALIALYE  498

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYAS+VNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKE VEPLTLEEIAD
Sbjct  499  RAVGIYASIVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKESVEPLTLEEIAD  558

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA EDIEMIYKIIAHMAANDRALIAEGNCGSPRS+KVFLGECN+DELYA
Sbjct  559  RCHAPEDIEMIYKIIAHMAANDRALIAEGNCGSPRSIKVFLGECNLDELYA  609



>ref|XP_002514018.1| glucose-6-phosphate isomerase, putative [Ricinus communis]
 gb|EEF48601.1| glucose-6-phosphate isomerase, putative [Ricinus communis]
Length=618

 Score =   462 bits (1188),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 219/231 (95%), Positives = 226/231 (98%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  388  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  447

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPR+VGALVALYE
Sbjct  448  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRTVGALVALYE  507

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEE+A+
Sbjct  508  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEVAE  567

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA EDIEMIYKII HMAANDRALIAEGNCGSPRS+KVFLGECNV+  YA
Sbjct  568  RCHAEEDIEMIYKIILHMAANDRALIAEGNCGSPRSIKVFLGECNVEASYA  618



>ref|XP_011074228.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic [Sesamum 
indicum]
Length=623

 Score =   462 bits (1188),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 218/230 (95%), Positives = 226/230 (98%), Gaps = 0/230 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQGITVYGNKGSTDQHA+IQQLR+GVHNFFVTFIEVL
Sbjct  393  SRYLQQLVMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAYIQQLRDGVHNFFVTFIEVL  452

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFG LQGTRSALYANDRESITVTVQEVTPRSVGALVALYE
Sbjct  453  RDRPPGHDWELEPGVTCGDYLFGFLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  512

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASL+NINAYHQPGVEAGKKAAGE+LALQKRVLAVLNEASCKEPVEPLTLEEIA 
Sbjct  513  RAVGIYASLININAYHQPGVEAGKKAAGEILALQKRVLAVLNEASCKEPVEPLTLEEIAY  572

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELY  294
            RCHA +DIEMIYKIIAHMAANDRALIAEG+CGSPRS+KVFLGECNVDE+Y
Sbjct  573  RCHASDDIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDEMY  622



>ref|XP_009342567.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009342568.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=618

 Score =   461 bits (1185),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 214/230 (93%), Positives = 227/230 (99%), Gaps = 0/230 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MES+GKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLR+GVHNFFVTFIEVL
Sbjct  388  SRYLQQLVMESIGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLRDGVHNFFVTFIEVL  447

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALY+NDRESITVTV+EVTPRSVGAL+ALYE
Sbjct  448  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYSNDRESITVTVEEVTPRSVGALIALYE  507

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCK+PVEPLTLEE+AD
Sbjct  508  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKDPVEPLTLEEVAD  567

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELY  294
            RCHA EDIEMIYKI+AH+AANDRA+IAEGNCGSPRS+KVFLGECNVD LY
Sbjct  568  RCHATEDIEMIYKIVAHVAANDRAIIAEGNCGSPRSIKVFLGECNVDALY  617



>ref|XP_004148412.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic [Cucumis 
sativus]
 gb|KGN62766.1| hypothetical protein Csa_2G372130 [Cucumis sativus]
Length=624

 Score =   461 bits (1185),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 215/231 (93%), Positives = 228/231 (99%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  394  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  453

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESI+VTVQEVTPRSVG +VALYE
Sbjct  454  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESISVTVQEVTPRSVGGMVALYE  513

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YAS++NINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTL+E+A+
Sbjct  514  RAVGLYASIININAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLDEVAE  573

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA EDIEMIYKIIAHMAANDRALIAEG+CGSPRS+KVFLGECNVD+LYA
Sbjct  574  RCHAPEDIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDDLYA  624



>ref|XP_006433853.1| hypothetical protein CICLE_v10000603mg [Citrus clementina]
 gb|ESR47093.1| hypothetical protein CICLE_v10000603mg [Citrus clementina]
Length=619

 Score =   460 bits (1184),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 216/231 (94%), Positives = 226/231 (98%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFF TFIEVL
Sbjct  389  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFATFIEVL  448

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRES+TVTVQEVTPRSVGALVALYE
Sbjct  449  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESVTVTVQEVTPRSVGALVALYE  508

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLT++E+A+
Sbjct  509  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTIDEVAE  568

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCH  EDIEMIYKIIAHMAANDRALIAEG+CGSPRS+KV+LGECNVD LYA
Sbjct  569  RCHTPEDIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVYLGECNVDGLYA  619



>gb|KJB58924.1| hypothetical protein B456_009G230800 [Gossypium raimondii]
Length=616

 Score =   460 bits (1183),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 218/231 (94%), Positives = 227/231 (98%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQGI+VYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  386  SRYLQQLVMESLGKEFDLDGNRVNQGISVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  445

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRES+TVTVQEVTPRSVGALVALYE
Sbjct  446  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESVTVTVQEVTPRSVGALVALYE  505

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEE+A+
Sbjct  506  RAVGLYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEVAE  565

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA EDIEMIYKII HMAANDRALIAEG+CGSP S+KVFLGECN+DELYA
Sbjct  566  RCHAPEDIEMIYKIIEHMAANDRALIAEGDCGSPNSLKVFLGECNLDELYA  616



>gb|KDO81122.1| hypothetical protein CISIN_1g007074mg [Citrus sinensis]
Length=619

 Score =   460 bits (1183),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 216/231 (94%), Positives = 226/231 (98%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFF TFIEVL
Sbjct  389  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFATFIEVL  448

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRES+TVTVQEVTPRSVGALVALYE
Sbjct  449  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESVTVTVQEVTPRSVGALVALYE  508

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLT++E+A+
Sbjct  509  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTIDEVAE  568

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCH  EDIEMIYKIIAHMAANDRALIAEG+CGSPRS+KV+LGECNVD LYA
Sbjct  569  RCHTPEDIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVYLGECNVDGLYA  619



>ref|XP_009417608.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=624

 Score =   459 bits (1182),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 218/230 (95%), Positives = 226/230 (98%), Gaps = 0/230 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQGITVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  394  SRYLQQLVMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  453

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE
Sbjct  454  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  513

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYA L+NINAYHQPGVEAGKKAAG+VLALQKRVL++LNEASCKEPVEPLTL+EIA+
Sbjct  514  RAVGIYACLININAYHQPGVEAGKKAAGDVLALQKRVLSILNEASCKEPVEPLTLDEIAE  573

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELY  294
            RCHA E IEMIYKIIAH+AANDRALIAEGNCGSPRSVKVFLGECNVDELY
Sbjct  574  RCHAPEQIEMIYKIIAHVAANDRALIAEGNCGSPRSVKVFLGECNVDELY  623



>ref|XP_008378562.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
isoform X1 [Malus domestica]
Length=617

 Score =   459 bits (1181),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 214/230 (93%), Positives = 227/230 (99%), Gaps = 0/230 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MES+GKEFDL+GNRVNQG+TVYGNKGSTDQHA+IQQLR+GVHNFFVTFIEVL
Sbjct  387  SRYLQQLVMESIGKEFDLNGNRVNQGLTVYGNKGSTDQHAYIQQLRDGVHNFFVTFIEVL  446

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALY+N+RESITVTV+EVTPRSVGAL+ALYE
Sbjct  447  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYSNERESITVTVEEVTPRSVGALIALYE  506

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCK+PVEPLTLEE+AD
Sbjct  507  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKDPVEPLTLEEVAD  566

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELY  294
            RCHA EDIEMIYKIIAHMAANDRA+IAEGNCGSPRS+KVFLGECNVD LY
Sbjct  567  RCHAXEDIEMIYKIIAHMAANDRAIIAEGNCGSPRSIKVFLGECNVDALY  616



>gb|KHG25467.1| Glucose-6-phosphate isomerase [Gossypium arboreum]
Length=607

 Score =   459 bits (1180),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 217/231 (94%), Positives = 227/231 (98%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQGI+VYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  377  SRYLQQLVMESLGKEFDLDGNRVNQGISVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  436

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRES+TVTVQEVTPRSVGALVALYE
Sbjct  437  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESVTVTVQEVTPRSVGALVALYE  496

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCK+PVEPLTLEE+A+
Sbjct  497  RAVGLYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKDPVEPLTLEEVAE  556

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA EDIEMIYKII HMAANDRALIAEG+CGSP S+KVFLGECN+DELYA
Sbjct  557  RCHAPEDIEMIYKIIEHMAANDRALIAEGDCGSPNSLKVFLGECNLDELYA  607



>emb|CBI19242.3| unnamed protein product [Vitis vinifera]
Length=480

 Score =   454 bits (1168),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 214/231 (93%), Positives = 226/231 (98%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MES+GKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  250  SRYLQQLVMESIGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  309

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYA DRES+TVTVQEVT RSVGA++ALYE
Sbjct  310  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAKDRESVTVTVQEVTARSVGAMIALYE  369

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTL+E+A+
Sbjct  370  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLDEVAE  429

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA EDIEMIYKIIAHMAANDRALIAEG+CGSPRS+KVFLGEC VD+LYA
Sbjct  430  RCHAPEDIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECYVDDLYA  480



>ref|XP_008338925.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
[Malus domestica]
Length=618

 Score =   459 bits (1180),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 214/230 (93%), Positives = 225/230 (98%), Gaps = 0/230 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MES+GKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLR+GVHNFF TFIEVL
Sbjct  388  SRYLQQLVMESIGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLRDGVHNFFATFIEVL  447

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALY+NDRESITVTV+EVTPRSVGAL+ALYE
Sbjct  448  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYSNDRESITVTVEEVTPRSVGALIALYE  507

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCK+PVEPLTLEE+AD
Sbjct  508  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKDPVEPLTLEEVAD  567

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELY  294
            RCHA EDIEMIYKIIAHMAANDRA+IAEGNCGSPRS+KVF GECNVD LY
Sbjct  568  RCHATEDIEMIYKIIAHMAANDRAIIAEGNCGSPRSIKVFGGECNVDALY  617



>ref|XP_012067970.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic [Jatropha 
curcas]
 gb|KDP41461.1| hypothetical protein JCGZ_15868 [Jatropha curcas]
Length=618

 Score =   458 bits (1179),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 216/230 (94%), Positives = 225/230 (98%), Gaps = 0/230 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQGITVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  388  SRYLQQLVMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  447

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALY NDRESITVTVQEVTPR+VGALVALYE
Sbjct  448  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYGNDRESITVTVQEVTPRTVGALVALYE  507

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTL+E+A+
Sbjct  508  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLQEVAE  567

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELY  294
            RCHA ED+EMIYKIIAHMAANDRA+IAEG+CGSP S+KVFLGECNVD LY
Sbjct  568  RCHAEEDVEMIYKIIAHMAANDRAIIAEGSCGSPLSIKVFLGECNVDALY  617



>ref|XP_004299713.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=623

 Score =   459 bits (1180),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 213/231 (92%), Positives = 227/231 (98%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MES+GKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLR+GVHNFFVTFIEVL
Sbjct  393  SRYLQQLVMESIGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLRDGVHNFFVTFIEVL  452

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALY+NDRESITV+V+EVTPRSVGAL+ALYE
Sbjct  453  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYSNDRESITVSVEEVTPRSVGALIALYE  512

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVL VLNEASCKEPVEPLTLEE+AD
Sbjct  513  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLQVLNEASCKEPVEPLTLEEVAD  572

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCH+L+DIEMIYKIIAHMAANDR LIAEG+CGSPRS+KVFLGECNVD LY+
Sbjct  573  RCHSLDDIEMIYKIIAHMAANDRVLIAEGSCGSPRSIKVFLGECNVDALYS  623



>ref|XP_011016894.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic [Populus 
euphratica]
Length=616

 Score =   458 bits (1179),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 216/231 (94%), Positives = 225/231 (97%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  386  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  445

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGAL+ LYE
Sbjct  446  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALIGLYE  505

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCK+PVE LT+EE+AD
Sbjct  506  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKQPVESLTIEEVAD  565

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA ED EMIYKIIAHMAANDRALIAEG+CGSPRS+KVFLGEC VDEL+A
Sbjct  566  RCHATEDTEMIYKIIAHMAANDRALIAEGSCGSPRSLKVFLGECKVDELFA  616



>ref|XP_010061514.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic [Eucalyptus 
grandis]
 gb|KCW68479.1| hypothetical protein EUGRSUZ_F02133 [Eucalyptus grandis]
Length=626

 Score =   458 bits (1179),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 214/231 (93%), Positives = 227/231 (98%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MES+GKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFF TF+EVL
Sbjct  396  SRYLQQLVMESIGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFATFVEVL  455

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTV+EVTPRSVGAL+ALYE
Sbjct  456  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVEEVTPRSVGALIALYE  515

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYAS+VNINAYHQPGVEAGKKAA EVLALQKRVLAVLNEASCKEPVEPLTLEE+A+
Sbjct  516  RAVGIYASIVNINAYHQPGVEAGKKAAAEVLALQKRVLAVLNEASCKEPVEPLTLEEVAE  575

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA E+IEMIYKIIAHMAANDRA+IAEG+CGSPRS+KVFLGECNVDELYA
Sbjct  576  RCHAPEEIEMIYKIIAHMAANDRAIIAEGSCGSPRSIKVFLGECNVDELYA  626



>ref|XP_006472503.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
[Citrus sinensis]
Length=619

 Score =   458 bits (1178),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 215/231 (93%), Positives = 226/231 (98%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRV+QG+TVYGNKGSTDQHA+IQQLREGVHNFF TFIEVL
Sbjct  389  SRYLQQLVMESLGKEFDLDGNRVSQGLTVYGNKGSTDQHAYIQQLREGVHNFFATFIEVL  448

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRES+TVTVQEVTPRSVGALVALYE
Sbjct  449  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESVTVTVQEVTPRSVGALVALYE  508

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLT++E+A+
Sbjct  509  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTIDEVAE  568

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCH  EDIEMIYKIIAHMAANDRALIAEG+CGSPRS+KV+LGECNVD LYA
Sbjct  569  RCHTPEDIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVYLGECNVDGLYA  619



>ref|XP_004490428.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=619

 Score =   457 bits (1177),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 214/231 (93%), Positives = 228/231 (99%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE+DLDGNRVNQGI+VYGNKGSTDQHA+IQQLREGVHNFF TFIEVL
Sbjct  389  SRYLQQLVMESLGKEYDLDGNRVNQGISVYGNKGSTDQHAYIQQLREGVHNFFATFIEVL  448

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALY+NDRESITVTVQEVTPRSVGALVALYE
Sbjct  449  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYSNDRESITVTVQEVTPRSVGALVALYE  508

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCK+PVEPLT+EE+A+
Sbjct  509  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKDPVEPLTIEEVAE  568

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA EDIE+IYKIIAHMAANDRA++AEG+CGSPRS+KVFLGECNVD+LYA
Sbjct  569  RCHAPEDIEVIYKIIAHMAANDRAILAEGSCGSPRSIKVFLGECNVDDLYA  619



>ref|XP_004490427.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=614

 Score =   457 bits (1176),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 214/231 (93%), Positives = 228/231 (99%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE+DLDGNRVNQGI+VYGNKGSTDQHA+IQQLREGVHNFF TFIEVL
Sbjct  384  SRYLQQLVMESLGKEYDLDGNRVNQGISVYGNKGSTDQHAYIQQLREGVHNFFATFIEVL  443

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALY+NDRESITVTVQEVTPRSVGALVALYE
Sbjct  444  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYSNDRESITVTVQEVTPRSVGALVALYE  503

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCK+PVEPLT+EE+A+
Sbjct  504  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKDPVEPLTIEEVAE  563

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA EDIE+IYKIIAHMAANDRA++AEG+CGSPRS+KVFLGECNVD+LYA
Sbjct  564  RCHAPEDIEVIYKIIAHMAANDRAILAEGSCGSPRSIKVFLGECNVDDLYA  614



>ref|XP_008811018.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic [Phoenix 
dactylifera]
Length=620

 Score =   456 bits (1174),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 214/230 (93%), Positives = 226/230 (98%), Gaps = 0/230 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  390  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  449

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN+RESI+VTVQEV PRSVGAL+ALYE
Sbjct  450  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANNRESISVTVQEVNPRSVGALIALYE  509

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAA EVLALQKRVLAVLNEASCKEPVEPLT++EIAD
Sbjct  510  RAVGIYASLVNINAYHQPGVEAGKKAAAEVLALQKRVLAVLNEASCKEPVEPLTIDEIAD  569

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELY  294
            RCHA E+IEMIYKI+AHMAANDRA+IAEG+CGSPRS+KVFLGECNVDELY
Sbjct  570  RCHAPEEIEMIYKIVAHMAANDRAIIAEGSCGSPRSIKVFLGECNVDELY  619



>ref|XP_010939741.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic [Elaeis 
guineensis]
Length=620

 Score =   456 bits (1172),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 215/230 (93%), Positives = 224/230 (97%), Gaps = 0/230 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  390  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  449

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN+RESI+VTVQEV PRSVGAL+ALYE
Sbjct  450  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANNRESISVTVQEVNPRSVGALIALYE  509

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAA EVLALQKRVLAVLNEASCKEPVEPLT++EIAD
Sbjct  510  RAVGIYASLVNINAYHQPGVEAGKKAAAEVLALQKRVLAVLNEASCKEPVEPLTIDEIAD  569

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELY  294
            RCH  E IEMIYKIIAHMAANDRALIAEG+CGSPRS+KVFLGECNVDELY
Sbjct  570  RCHEPEQIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECNVDELY  619



>ref|XP_002285696.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic [Vitis 
vinifera]
Length=623

 Score =   455 bits (1171),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 214/231 (93%), Positives = 226/231 (98%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MES+GKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  393  SRYLQQLVMESIGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  452

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYA DRES+TVTVQEVT RSVGA++ALYE
Sbjct  453  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAKDRESVTVTVQEVTARSVGAMIALYE  512

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTL+E+A+
Sbjct  513  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLDEVAE  572

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA EDIEMIYKIIAHMAANDRALIAEG+CGSPRS+KVFLGEC VD+LYA
Sbjct  573  RCHAPEDIEMIYKIIAHMAANDRALIAEGSCGSPRSIKVFLGECYVDDLYA  623



>gb|KJB64170.1| hypothetical protein B456_010G035600 [Gossypium raimondii]
Length=616

 Score =   455 bits (1170),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 216/231 (94%), Positives = 225/231 (97%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQGI+VYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  386  SRYLQQLVMESLGKEFDLDGNRVNQGISVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  445

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGAL+ALYE
Sbjct  446  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALIALYE  505

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASC++P E LTL+EIAD
Sbjct  506  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCEDPAESLTLQEIAD  565

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA +DIEMIYKII HMAANDRALIAEG+CGSP S+KVFLGECNVDELYA
Sbjct  566  RCHAPDDIEMIYKIIEHMAANDRALIAEGDCGSPYSLKVFLGECNVDELYA  616



>gb|KJB64171.1| hypothetical protein B456_010G035600 [Gossypium raimondii]
Length=616

 Score =   454 bits (1169),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 216/231 (94%), Positives = 225/231 (97%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQGI+VYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  386  SRYLQQLVMESLGKEFDLDGNRVNQGISVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  445

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGAL+ALYE
Sbjct  446  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALIALYE  505

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASC++P E LTL+EIAD
Sbjct  506  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCEDPAESLTLQEIAD  565

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA +DIEMIYKII HMAANDRALIAEG+CGSP S+KVFLGECNVDELYA
Sbjct  566  RCHAPDDIEMIYKIIEHMAANDRALIAEGDCGSPYSLKVFLGECNVDELYA  616



>ref|XP_006338083.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
[Solanum tuberosum]
Length=616

 Score =   454 bits (1169),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 214/231 (93%), Positives = 226/231 (98%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQGI+VYGNKGSTDQHA+IQQLREGVHNFF TFIEVL
Sbjct  386  SRYLQQLVMESLGKEFDLDGNRVNQGISVYGNKGSTDQHAYIQQLREGVHNFFATFIEVL  445

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALY+NDRESITVTVQEVTPRSVGALVALYE
Sbjct  446  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYSNDRESITVTVQEVTPRSVGALVALYE  505

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVL VLNEASCK+PVEPLTL+EIA+
Sbjct  506  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLQVLNEASCKQPVEPLTLDEIAE  565

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCH  +DIEMIYKIIAHMAANDRALIAEGNCG+P+S++V+LGECNVDELYA
Sbjct  566  RCHCEDDIEMIYKIIAHMAANDRALIAEGNCGTPQSIRVYLGECNVDELYA  616



>ref|XP_010266267.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
[Nelumbo nucifera]
Length=637

 Score =   454 bits (1169),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 213/229 (93%), Positives = 224/229 (98%), Gaps = 0/229 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  409  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  468

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN+RESITVTVQEVTPRSVGAL+ALYE
Sbjct  469  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANNRESITVTVQEVTPRSVGALIALYE  528

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASL+NINAYHQPGVEAGKKAAGEVLALQKRVL VLNEASCKEPVEPLT EEIAD
Sbjct  529  RAVGIYASLININAYHQPGVEAGKKAAGEVLALQKRVLTVLNEASCKEPVEPLTPEEIAD  588

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDEL  297
            RCH  EDIEMIYKI+AHMAANDRA+IAEG+CGSPRS+K++LGECNVDEL
Sbjct  589  RCHVPEDIEMIYKIVAHMAANDRAIIAEGSCGSPRSIKIYLGECNVDEL  637



>gb|AFC88848.1| glucose-6-phosphate isomerase, partial [Tetragonia tetragonioides]
Length=496

 Score =   449 bits (1156),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 210/231 (91%), Positives = 224/231 (97%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG++VYGNKGSTDQHA+IQQLR+GVHNFF TFIEVL
Sbjct  266  SRYLQQLVMESLGKEFDLDGNRVNQGLSVYGNKGSTDQHAYIQQLRDGVHNFFATFIEVL  325

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGA+VALYE
Sbjct  326  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGAMVALYE  385

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVN+NAYHQPGVEAGKKAA EVLALQKRVLAVLNEASCKEP+EPLT+EE+A+
Sbjct  386  RAVGLYASLVNVNAYHQPGVEAGKKAAAEVLALQKRVLAVLNEASCKEPMEPLTVEEVAE  445

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCH  EDIEMIYKIIAHMAANDRALIAEG+CGSPRS+K FL ECNVDE+YA
Sbjct  446  RCHCPEDIEMIYKIIAHMAANDRALIAEGSCGSPRSIKAFLQECNVDEMYA  496



>ref|NP_001234583.1| glucose-6-phosphate isomerase [Solanum lycopersicum]
 gb|AAU00727.1| glucose-6-phosphate isomerase [Solanum lycopersicum]
Length=617

 Score =   454 bits (1167),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 214/231 (93%), Positives = 225/231 (97%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQGI+VYGNKGSTDQHA+IQQLREGVHNFF TFIEVL
Sbjct  387  SRYLQQLVMESLGKEFDLDGNRVNQGISVYGNKGSTDQHAYIQQLREGVHNFFATFIEVL  446

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALY+NDRESITVTVQEVTPRSVGALVALYE
Sbjct  447  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYSNDRESITVTVQEVTPRSVGALVALYE  506

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVL VLNEASCK+PVEPLTL+EIA+
Sbjct  507  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLQVLNEASCKQPVEPLTLDEIAE  566

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCH  +DIEMIYKIIAHMAANDRALIAEGNCG+P S+KV+LGECNVD+LYA
Sbjct  567  RCHCEDDIEMIYKIIAHMAANDRALIAEGNCGTPHSIKVYLGECNVDDLYA  617



>ref|XP_010521052.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=631

 Score =   454 bits (1168),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 212/231 (92%), Positives = 223/231 (97%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFF TFIEVL
Sbjct  401  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFATFIEVL  460

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDW+LEPGVTCGDYLFGMLQGTRSALYANDRESI+VT+QEV PRSVGAL+ALYE
Sbjct  461  RDRPPGHDWDLEPGVTCGDYLFGMLQGTRSALYANDRESISVTIQEVNPRSVGALIALYE  520

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG YASLVNINAYHQPGVEAGKKAA EVLALQKRVLAVLNEASCK+PVEPLTL+EIAD
Sbjct  521  RAVGFYASLVNINAYHQPGVEAGKKAAAEVLALQKRVLAVLNEASCKDPVEPLTLDEIAD  580

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
             CHA E+IEMIYKIIAHMAANDR LIAEGNCGSPRS+KV+LGECNVDELYA
Sbjct  581  HCHAPEEIEMIYKIIAHMAANDRVLIAEGNCGSPRSIKVYLGECNVDELYA  631



>gb|KHG02611.1| Glucose-6-phosphate isomerase [Gossypium arboreum]
Length=617

 Score =   452 bits (1164),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 214/231 (93%), Positives = 225/231 (97%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQGI+VYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  387  SRYLQQLVMESLGKEFDLDGNRVNQGISVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  446

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN+RESITVTVQEVTPRSVGAL+ALYE
Sbjct  447  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANNRESITVTVQEVTPRSVGALIALYE  506

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASC++P E LTL+EIAD
Sbjct  507  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCEDPAESLTLQEIAD  566

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCH+ +DIEMIYKII HMAANDRALIAEG+CGSP S+KVFLGECNVDELYA
Sbjct  567  RCHSPDDIEMIYKIIEHMAANDRALIAEGDCGSPYSLKVFLGECNVDELYA  617



>ref|XP_009373815.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=618

 Score =   452 bits (1163),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 211/230 (92%), Positives = 225/230 (98%), Gaps = 0/230 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MES+GKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLR+GVHNFFVTFIEVL
Sbjct  388  SRYLQQLVMESIGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLRDGVHNFFVTFIEVL  447

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALY+NDRESITVTV+EVTPRSVGAL+ALYE
Sbjct  448  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYSNDRESITVTVEEVTPRSVGALIALYE  507

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCK+PVEPLTLEE+AD
Sbjct  508  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKDPVEPLTLEEVAD  567

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELY  294
            RCHA EDIEMIYKI+AH+AANDRA+IAEG+CGS RS+KVFLGEC VD LY
Sbjct  568  RCHATEDIEMIYKIVAHVAANDRAIIAEGDCGSLRSIKVFLGECTVDALY  617



>ref|XP_006841224.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic [Amborella 
trichopoda]
 gb|ERN02899.1| hypothetical protein AMTR_s00135p00052570 [Amborella trichopoda]
Length=624

 Score =   452 bits (1163),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 211/231 (91%), Positives = 226/231 (98%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE+DLDGNRVNQG+TVYGNKGSTDQHA+IQQLR+GVHNFFVTFIEVL
Sbjct  394  SRYLQQLVMESLGKEYDLDGNRVNQGLTVYGNKGSTDQHAYIQQLRDGVHNFFVTFIEVL  453

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN+RESI+VTVQEVTPRSVGAL+ALYE
Sbjct  454  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANNRESISVTVQEVTPRSVGALIALYE  513

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYA+L+NINAYHQPGVEAGKKAAGEVL LQKR+L+VLNEASCKEPVEPLTL+EIA 
Sbjct  514  RAVGIYANLININAYHQPGVEAGKKAAGEVLGLQKRILSVLNEASCKEPVEPLTLDEIAQ  573

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA E IEMIYKI+AHMAANDRALIAEG+CGSPRS+KVFLGECNVDELYA
Sbjct  574  RCHAPEQIEMIYKIVAHMAANDRALIAEGSCGSPRSIKVFLGECNVDELYA  624



>ref|XP_009373819.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=622

 Score =   452 bits (1163),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 211/230 (92%), Positives = 225/230 (98%), Gaps = 0/230 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MES+GKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLR+GVHNFFVTFIEVL
Sbjct  392  SRYLQQLVMESIGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLRDGVHNFFVTFIEVL  451

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALY+NDRESITVTV+EVTPRSVGAL+ALYE
Sbjct  452  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYSNDRESITVTVEEVTPRSVGALIALYE  511

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCK+PVEPLTLEE+AD
Sbjct  512  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKDPVEPLTLEEVAD  571

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELY  294
            RCHA EDIEMIYKI+AH+AANDRA+IAEG+CGS RS+KVFLGEC VD LY
Sbjct  572  RCHATEDIEMIYKIVAHVAANDRAIIAEGDCGSLRSIKVFLGECTVDALY  621



>ref|XP_003578256.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic [Brachypodium 
distachyon]
Length=623

 Score =   452 bits (1163),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 214/229 (93%), Positives = 223/229 (97%), Gaps = 0/229 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  395  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  454

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESI+VTVQEVTPR+VGALVALYE
Sbjct  455  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESISVTVQEVTPRAVGALVALYE  514

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVL VLNEASCK+P EPLTLEEIAD
Sbjct  515  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLTVLNEASCKDPAEPLTLEEIAD  574

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDEL  297
            RCH  EDIEMIYKII HMAANDRALIAEG+CGSPRSVKV+LGECNVD++
Sbjct  575  RCHCPEDIEMIYKIIQHMAANDRALIAEGSCGSPRSVKVYLGECNVDDI  623



>gb|AIU34465.1| putative glucose-6-phosphate isomerase, partial [Taraxacum brevicorniculatum]
Length=630

 Score =   451 bits (1160),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 208/230 (90%), Positives = 227/230 (99%), Gaps = 0/230 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLR+GVHNFFVTFIEVL
Sbjct  401  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLRDGVHNFFVTFIEVL  460

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALY+N RESITVTVQEVTPRSVGAL+ALYE
Sbjct  461  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYSNARESITVTVQEVTPRSVGALIALYE  520

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYAS+VNINAYHQPGVEAGKKAAGEVLALQKRVL+VLNEASCK+PVEPL++E++AD
Sbjct  521  RAVGIYASIVNINAYHQPGVEAGKKAAGEVLALQKRVLSVLNEASCKDPVEPLSIEQVAD  580

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELY  294
            RCH+ EDIEMIYKIIAHMAANDRA+I+EG+CGSPRS+KVFLGECNV++LY
Sbjct  581  RCHSPEDIEMIYKIIAHMAANDRAVISEGHCGSPRSIKVFLGECNVEDLY  630



>ref|XP_010675347.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=619

 Score =   450 bits (1158),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 209/231 (90%), Positives = 223/231 (97%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLR+GVHNFF TFIEVL
Sbjct  389  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLRDGVHNFFATFIEVL  448

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN+RESI+VTVQEVTPRSVGA+VALYE
Sbjct  449  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANNRESISVTVQEVTPRSVGAMVALYE  508

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA EVLALQKRVLAVLNEASCKEPVEPLT+EE+A+
Sbjct  509  RAVGLYASLVNINAYHQPGVEAGKKAAAEVLALQKRVLAVLNEASCKEPVEPLTIEEVAE  568

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
             CH  +DIEMIYKIIAHMAANDR ++AEGNCGSPRS+K FLGECNVDELYA
Sbjct  569  HCHCPDDIEMIYKIIAHMAANDRVVLAEGNCGSPRSIKAFLGECNVDELYA  619



>ref|XP_010433744.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
[Camelina sativa]
Length=615

 Score =   449 bits (1155),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 208/231 (90%), Positives = 224/231 (97%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGN VNQG+TVYGNKGSTDQHA+IQQLREGVHNFF TFIEVL
Sbjct  385  SRYLQQLVMESLGKEFDLDGNTVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFATFIEVL  444

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN RESI+VT++EVTPRSVGAL+ALYE
Sbjct  445  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANGRESISVTIEEVTPRSVGALIALYE  504

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YAS+VNINAYHQPGVEAGKKAA EVLALQKRVL+VLNEA+CK+PVEPLTLEEIAD
Sbjct  505  RAVGLYASIVNINAYHQPGVEAGKKAAAEVLALQKRVLSVLNEATCKDPVEPLTLEEIAD  564

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA E+IEMIYKIIAHM+ANDR LIAEGNCGSPRS+KV+LGECNVD+LYA
Sbjct  565  RCHAPEEIEMIYKIIAHMSANDRVLIAEGNCGSPRSIKVYLGECNVDDLYA  615



>ref|XP_010272935.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
isoform X1 [Nelumbo nucifera]
Length=636

 Score =   449 bits (1156),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 211/230 (92%), Positives = 224/230 (97%), Gaps = 0/230 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDL+GNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  406  SRYLQQLVMESLGKEFDLNGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  465

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN+RESITVTVQEV PRSVGAL+ALYE
Sbjct  466  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANNRESITVTVQEVNPRSVGALIALYE  525

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAA EVLALQKRVLAVLNEASCKEPVEPLT+EEIAD
Sbjct  526  RAVGIYASLVNINAYHQPGVEAGKKAAAEVLALQKRVLAVLNEASCKEPVEPLTVEEIAD  585

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELY  294
             CHA  DIEMI+KI+AH+AANDRALIAEGNCGSP+S+KVFLGECN++ELY
Sbjct  586  LCHAPADIEMIFKIVAHVAANDRALIAEGNCGSPKSIKVFLGECNIEELY  635



>emb|CDY03434.1| BnaC01g16480D [Brassica napus]
Length=615

 Score =   449 bits (1154),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 208/231 (90%), Positives = 224/231 (97%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGN VNQG+TVYGNKGSTDQHA+IQQLREGVHNFF TFIEVL
Sbjct  384  SRYLQQLVMESLGKEFDLDGNTVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFATFIEVL  443

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDW+LEPGVTCGDYLFGMLQGTRSALYAN RESI+VT++EVTPRSVGAL+ALYE
Sbjct  444  RDRPPGHDWDLEPGVTCGDYLFGMLQGTRSALYANGRESISVTIEEVTPRSVGALIALYE  503

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA EVLALQKRVL+VLNEASCK+PVEPLTL+EIAD
Sbjct  504  RAVGLYASLVNINAYHQPGVEAGKKAAAEVLALQKRVLSVLNEASCKDPVEPLTLDEIAD  563

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA E+IEMIYKIIAHM+ANDR LIAEG+CGSPRSVKVFLGECNVD++YA
Sbjct  564  RCHAPEEIEMIYKIIAHMSANDRVLIAEGSCGSPRSVKVFLGECNVDDMYA  614



>emb|CAA03982.1| glucose-6-phosphate isomerase [Spinacia oleracea]
Length=618

 Score =   448 bits (1153),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 207/231 (90%), Positives = 223/231 (97%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGN+VNQG+TVYGNKGSTDQHA+IQQLR+GVHNFF TFIEVL
Sbjct  388  SRYLQQLVMESLGKEFDLDGNKVNQGLTVYGNKGSTDQHAYIQQLRDGVHNFFATFIEVL  447

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN+RESI+VTVQEVTPRSVGA+VALYE
Sbjct  448  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANNRESISVTVQEVTPRSVGAMVALYE  507

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA EVLALQKRVLAVLNEASCK+PVEPLT+EE+AD
Sbjct  508  RAVGLYASLVNINAYHQPGVEAGKKAAAEVLALQKRVLAVLNEASCKDPVEPLTIEEVAD  567

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
             CH  +DIEMIYKIIAHMAANDR ++AEG+CGSPRS+K FLGECNVDELYA
Sbjct  568  HCHCPDDIEMIYKIIAHMAANDRVILAEGDCGSPRSIKAFLGECNVDELYA  618



>ref|XP_006283347.1| hypothetical protein CARUB_v10004391mg [Capsella rubella]
 gb|EOA16245.1| hypothetical protein CARUB_v10004391mg [Capsella rubella]
Length=614

 Score =   448 bits (1152),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 207/231 (90%), Positives = 224/231 (97%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGN VNQG+TVYGNKGSTDQHA+IQQLREGVHNFF TFIEVL
Sbjct  384  SRYLQQLVMESLGKEFDLDGNTVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFATFIEVL  443

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN RESI+VT++EVTPRSVGA++ALYE
Sbjct  444  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANGRESISVTIEEVTPRSVGAIIALYE  503

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YAS+VNINAYHQPGVEAGKKAA EVLALQKRVL+VLNEA+CK+PVEPLTLEEIAD
Sbjct  504  RAVGLYASIVNINAYHQPGVEAGKKAAAEVLALQKRVLSVLNEATCKDPVEPLTLEEIAD  563

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA E+IEMIYKIIAHM+ANDR LIAEGNCGSPRS+KV+LGECNVD+LYA
Sbjct  564  RCHAPEEIEMIYKIIAHMSANDRVLIAEGNCGSPRSIKVYLGECNVDDLYA  614



>ref|XP_010448542.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic [Camelina 
sativa]
Length=617

 Score =   448 bits (1153),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 207/231 (90%), Positives = 224/231 (97%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGN VNQG+TVYGNKGSTDQHA+IQQLR+GVHNFF TFIEVL
Sbjct  387  SRYLQQLVMESLGKEFDLDGNTVNQGLTVYGNKGSTDQHAYIQQLRDGVHNFFATFIEVL  446

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN RESI+VT++EVTPRSVGAL+ALYE
Sbjct  447  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANGRESISVTIEEVTPRSVGALIALYE  506

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YAS+VNINAYHQPGVEAGKKAA EVLALQKRVL+VLNEA+CK+PVEPLTLEEIAD
Sbjct  507  RAVGLYASIVNINAYHQPGVEAGKKAAAEVLALQKRVLSVLNEATCKDPVEPLTLEEIAD  566

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA E+IEMIYKIIAHM+ANDR LIAEGNCGSPRS+KV+LGECNVD+LYA
Sbjct  567  RCHAPEEIEMIYKIIAHMSANDRVLIAEGNCGSPRSIKVYLGECNVDDLYA  617



>ref|XP_009138293.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic [Brassica 
rapa]
Length=616

 Score =   448 bits (1152),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 208/231 (90%), Positives = 224/231 (97%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGN VNQG+TVYGNKGSTDQHA+IQQLREGVHNFF TFIEVL
Sbjct  386  SRYLQQLVMESLGKEFDLDGNTVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFATFIEVL  445

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDW+LEPGVTCGDYLFGMLQGTRSALYAN RESI+VT++EVTPRSVGAL+ALYE
Sbjct  446  RDRPPGHDWDLEPGVTCGDYLFGMLQGTRSALYANGRESISVTIEEVTPRSVGALIALYE  505

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA EVLALQKRVL+VLNEASCK+PVEPLTL+EIAD
Sbjct  506  RAVGLYASLVNINAYHQPGVEAGKKAAAEVLALQKRVLSVLNEASCKDPVEPLTLDEIAD  565

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA E+IEMIYKIIAHM+ANDR LIAEG+CGSPRSVKVFLGECNVD++YA
Sbjct  566  RCHAPEEIEMIYKIIAHMSANDRVLIAEGSCGSPRSVKVFLGECNVDDMYA  616



>emb|CDY34296.1| BnaA01g13990D [Brassica napus]
Length=616

 Score =   448 bits (1152),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 208/231 (90%), Positives = 224/231 (97%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGN VNQG+TVYGNKGSTDQHA+IQQLREGVHNFF TFIEVL
Sbjct  386  SRYLQQLVMESLGKEFDLDGNTVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFATFIEVL  445

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDW+LEPGVTCGDYLFGMLQGTRSALYAN RESI+VT++EVTPRSVGAL+ALYE
Sbjct  446  RDRPPGHDWDLEPGVTCGDYLFGMLQGTRSALYANGRESISVTIEEVTPRSVGALIALYE  505

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA EVLALQKRVL+VLNEASCK+PVEPLTL+EIAD
Sbjct  506  RAVGLYASLVNINAYHQPGVEAGKKAAAEVLALQKRVLSVLNEASCKDPVEPLTLDEIAD  565

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA E+IEMIYKIIAHM+ANDR LIAEG+CGSPRSVKVFLGECNVD++YA
Sbjct  566  RCHAPEEIEMIYKIIAHMSANDRVLIAEGSCGSPRSVKVFLGECNVDDMYA  616



>ref|XP_002867655.1| hypothetical protein ARALYDRAFT_492381 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43914.1| hypothetical protein ARALYDRAFT_492381 [Arabidopsis lyrata subsp. 
lyrata]
Length=613

 Score =   448 bits (1152),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 207/231 (90%), Positives = 224/231 (97%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGN VNQG+TVYGNKGSTDQHA+IQQLR+GVHNFF TFIEVL
Sbjct  383  SRYLQQLVMESLGKEFDLDGNTVNQGLTVYGNKGSTDQHAYIQQLRDGVHNFFATFIEVL  442

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN RESI+VT++EVTPRSVGAL+ALYE
Sbjct  443  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANGRESISVTIEEVTPRSVGALIALYE  502

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YAS+VNINAYHQPGVEAGKKAA EVLALQKRVL+VLNEA+CK+PVEPLTLEEIAD
Sbjct  503  RAVGLYASIVNINAYHQPGVEAGKKAAAEVLALQKRVLSVLNEATCKDPVEPLTLEEIAD  562

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA E+IEMIYKIIAHM+ANDR LIAEGNCGSPRS+KV+LGECNVD+LYA
Sbjct  563  RCHAPEEIEMIYKIIAHMSANDRVLIAEGNCGSPRSIKVYLGECNVDDLYA  613



>ref|XP_009380895.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=611

 Score =   447 bits (1151),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 210/231 (91%), Positives = 224/231 (97%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  381  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  440

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DRP GHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQ+VTPRSVGAL+ALYE
Sbjct  441  HDRPSGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQQVTPRSVGALIALYE  500

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYA L+NINAYHQPGVEAGKKAAGEVLALQKR+LAVLNEASCKEP+EPL+LEEIA+
Sbjct  501  RAVGIYACLININAYHQPGVEAGKKAAGEVLALQKRILAVLNEASCKEPIEPLSLEEIAE  560

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCH  E IEMIYKI+AH+AAN+RALIAEG+CGSPRS+KVFLGECNVDELYA
Sbjct  561  RCHVPEQIEMIYKIVAHLAANNRALIAEGSCGSPRSIKVFLGECNVDELYA  611



>emb|CDX92647.1| BnaC07g39050D [Brassica napus]
Length=614

 Score =   447 bits (1149),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 207/231 (90%), Positives = 224/231 (97%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGN VNQG+TVYGNKGSTDQHA+IQQLREGVHNFF TFIEVL
Sbjct  384  SRYLQQLVMESLGKEFDLDGNTVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFATFIEVL  443

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN RESI+VT++EVTPRSVGA++ALYE
Sbjct  444  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANGRESISVTIEEVTPRSVGAIIALYE  503

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA EVLALQKRVL+VLNEASCK+PVEPLTL+EIAD
Sbjct  504  RAVGLYASLVNINAYHQPGVEAGKKAAAEVLALQKRVLSVLNEASCKDPVEPLTLDEIAD  563

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA E+IEMIYKIIAHM+ANDR LIAEG+CGSPRSVKV+LGECNVD++YA
Sbjct  564  RCHAPEEIEMIYKIIAHMSANDRVLIAEGSCGSPRSVKVYLGECNVDDMYA  614



>ref|NP_001063415.1| Os09g0465600 [Oryza sativa Japonica Group]
 dbj|BAD17509.1| putative glucose-6-phosphate isomerase [Oryza sativa Japonica 
Group]
 dbj|BAF25329.1| Os09g0465600 [Oryza sativa Japonica Group]
 gb|EEE69866.1| hypothetical protein OsJ_29674 [Oryza sativa Japonica Group]
Length=625

 Score =   447 bits (1150),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  393  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  452

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALY+NDRESI+VTVQEVTPR+VGALVALYE
Sbjct  453  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYSNDRESISVTVQEVTPRAVGALVALYE  512

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVL VLNEASCK+P EPLTL++IA+
Sbjct  513  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLTVLNEASCKDPAEPLTLDQIAE  572

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDE  300
            RCH  EDIEMIYKII HMAANDRALIAEG+CGSPRS+KV+LGECNVDE
Sbjct  573  RCHCPEDIEMIYKIIQHMAANDRALIAEGSCGSPRSIKVYLGECNVDE  620



>dbj|BAD08451.1| glucose-6-phosphate isomerase [Oryza sativa Japonica Group]
Length=624

 Score =   447 bits (1150),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  392  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  451

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALY+NDRESI+VTVQEVTPR+VGALVALYE
Sbjct  452  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYSNDRESISVTVQEVTPRAVGALVALYE  511

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVL VLNEASCK+P EPLTL++IA+
Sbjct  512  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLTVLNEASCKDPAEPLTLDQIAE  571

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDE  300
            RCH  EDIEMIYKII HMAANDRALIAEG+CGSPRS+KV+LGECNVDE
Sbjct  572  RCHCPEDIEMIYKIIQHMAANDRALIAEGSCGSPRSIKVYLGECNVDE  619



>gb|EEC84721.1| hypothetical protein OsI_31689 [Oryza sativa Indica Group]
Length=625

 Score =   447 bits (1150),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  393  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  452

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALY+NDRESI+VTVQEVTPR+VGALVALYE
Sbjct  453  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYSNDRESISVTVQEVTPRAVGALVALYE  512

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVL VLNEASCK+P EPLTL++IA+
Sbjct  513  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLTVLNEASCKDPAEPLTLDQIAE  572

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDE  300
            RCH  EDIEMIYKII HMAANDRALIAEG+CGSPRS+KV+LGECNVDE
Sbjct  573  RCHCPEDIEMIYKIIQHMAANDRALIAEGSCGSPRSIKVYLGECNVDE  620



>emb|CDY11024.1| BnaA03g46830D [Brassica napus]
Length=613

 Score =   446 bits (1148),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 207/231 (90%), Positives = 224/231 (97%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGN VNQG+TVYGNKGSTDQHA+IQQLREGVHNFF TFIEVL
Sbjct  383  SRYLQQLVMESLGKEFDLDGNTVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFATFIEVL  442

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN RESI+VT++EVTPRSVGA++ALYE
Sbjct  443  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANGRESISVTIEEVTPRSVGAIIALYE  502

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA EVLALQKRVL+VLNEASCK+PVEPLTL+EIAD
Sbjct  503  RAVGLYASLVNINAYHQPGVEAGKKAAAEVLALQKRVLSVLNEASCKDPVEPLTLDEIAD  562

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA E+IEMIYKIIAHM+ANDR LIAEG+CGSPRSVKV+LGECNVD++YA
Sbjct  563  RCHAPEEIEMIYKIIAHMSANDRVLIAEGSCGSPRSVKVYLGECNVDDMYA  613



>gb|EYU36464.1| hypothetical protein MIMGU_mgv1a002902mg [Erythranthe guttata]
Length=627

 Score =   447 bits (1150),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 212/230 (92%), Positives = 222/230 (97%), Gaps = 0/230 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLR+GVHNFF TFIEVL
Sbjct  397  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLRDGVHNFFATFIEVL  456

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVT GDYLFG LQGTRSALYANDRESITVTV+EVTP+SVGALVALYE
Sbjct  457  RDRPPGHDWELEPGVTSGDYLFGFLQGTRSALYANDRESITVTVEEVTPKSVGALVALYE  516

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAA EVLALQKRVLAVLNEASCK+PVEPLTLEEIAD
Sbjct  517  RAVGIYASLVNINAYHQPGVEAGKKAAIEVLALQKRVLAVLNEASCKDPVEPLTLEEIAD  576

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELY  294
            RCH+  DIEMIYKIIAHMAANDRALIAEG+CGSPRSVKV+LGECNV E+Y
Sbjct  577  RCHSPNDIEMIYKIIAHMAANDRALIAEGSCGSPRSVKVYLGECNVGEMY  626



>ref|NP_194193.2| phosphoglucose isomerase 1 [Arabidopsis thaliana]
 sp|Q8H103.1|G6PIP_ARATH RecName: Full=Glucose-6-phosphate isomerase 1, chloroplastic; 
Short=GPI 1; AltName: Full=Phosphoglucose isomerase 1; Short=PGI 
1; AltName: Full=Phosphohexose isomerase; Short=PHI; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAN41353.1| putative glucose-6-phosphate isomerase [Arabidopsis thaliana]
 dbj|BAE99162.1| glucose-6-phosphate isomerase [Arabidopsis thaliana]
 gb|AEE84933.1| phosphoglucose isomerase 1 [Arabidopsis thaliana]
Length=613

 Score =   446 bits (1147),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 206/231 (89%), Positives = 223/231 (97%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGN VNQG+TVYGNKGSTDQHA+IQQLR+GVHNFF TFIEVL
Sbjct  383  SRYLQQLVMESLGKEFDLDGNTVNQGLTVYGNKGSTDQHAYIQQLRDGVHNFFATFIEVL  442

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN RESI+VT+QEVTP SVGA++ALYE
Sbjct  443  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANGRESISVTIQEVTPTSVGAIIALYE  502

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YAS+VNINAYHQPGVEAGKKAA EVLALQKRVL+VLNEA+CK+PVEPLTLEEIAD
Sbjct  503  RAVGLYASIVNINAYHQPGVEAGKKAAAEVLALQKRVLSVLNEATCKDPVEPLTLEEIAD  562

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA E+IEMIYKIIAHM+ANDR LIAEGNCGSPRS+KV+LGECNVD+LYA
Sbjct  563  RCHAPEEIEMIYKIIAHMSANDRVLIAEGNCGSPRSIKVYLGECNVDDLYA  613



>emb|CEF52500.1| Cs92274 plastidic phosphoglucose isomerase [Arabidopsis thaliana]
Length=611

 Score =   446 bits (1146),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 206/231 (89%), Positives = 223/231 (97%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGN VNQG+TVYGNKGSTDQHA+IQQLR+GVHNFF TFIEVL
Sbjct  381  SRYLQQLVMESLGKEFDLDGNTVNQGLTVYGNKGSTDQHAYIQQLRDGVHNFFATFIEVL  440

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN RESI+VT+QEVTP SVGA++ALYE
Sbjct  441  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANGRESISVTIQEVTPTSVGAIIALYE  500

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YAS+VNINAYHQPGVEAGKKAA EVLALQKRVL+VLNEA+CK+PVEPLTLEEIAD
Sbjct  501  RAVGLYASIVNINAYHQPGVEAGKKAAAEVLALQKRVLSVLNEATCKDPVEPLTLEEIAD  560

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA E+IEMIYKIIAHM+ANDR LIAEGNCGSPRS+KV+LGECNVD+LYA
Sbjct  561  RCHAPEEIEMIYKIIAHMSANDRVLIAEGNCGSPRSIKVYLGECNVDDLYA  611



>emb|CAA23001.1| glucose-6-phosphate isomerase [Arabidopsis thaliana]
 emb|CAB79372.1| glucose-6-phosphate isomerase [Arabidopsis thaliana]
Length=611

 Score =   446 bits (1146),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 206/231 (89%), Positives = 223/231 (97%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGN VNQG+TVYGNKGSTDQHA+IQQLR+GVHNFF TFIEVL
Sbjct  381  SRYLQQLVMESLGKEFDLDGNTVNQGLTVYGNKGSTDQHAYIQQLRDGVHNFFATFIEVL  440

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN RESI+VT+QEVTP SVGA++ALYE
Sbjct  441  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANGRESISVTIQEVTPTSVGAIIALYE  500

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YAS+VNINAYHQPGVEAGKKAA EVLALQKRVL+VLNEA+CK+PVEPLTLEEIAD
Sbjct  501  RAVGLYASIVNINAYHQPGVEAGKKAAAEVLALQKRVLSVLNEATCKDPVEPLTLEEIAD  560

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA E+IEMIYKIIAHM+ANDR LIAEGNCGSPRS+KV+LGECNVD+LYA
Sbjct  561  RCHAPEEIEMIYKIIAHMSANDRVLIAEGNCGSPRSIKVYLGECNVDDLYA  611



>ref|XP_010439004.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
[Camelina sativa]
Length=616

 Score =   445 bits (1145),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 207/231 (90%), Positives = 223/231 (97%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGN VNQG+TVYGNKGSTDQHA+IQQLREGV NFF TFIEVL
Sbjct  386  SRYLQQLVMESLGKEFDLDGNTVNQGLTVYGNKGSTDQHAYIQQLREGVPNFFATFIEVL  445

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN RESI+VT++EVTPRSVGAL+ALYE
Sbjct  446  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANGRESISVTIEEVTPRSVGALIALYE  505

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YAS+VNINAYHQPGVEAGKKAA EVLALQKRVL+VLNEA+CK+PVEPLTLEEIAD
Sbjct  506  RAVGLYASIVNINAYHQPGVEAGKKAAAEVLALQKRVLSVLNEATCKDPVEPLTLEEIAD  565

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA E+IEMIYKIIAHM+ANDR LIAEGNCGSPRS+KV+LGECNVD+LYA
Sbjct  566  RCHAPEEIEMIYKIIAHMSANDRVLIAEGNCGSPRSIKVYLGECNVDDLYA  616



>ref|XP_002462509.1| hypothetical protein SORBIDRAFT_02g027000 [Sorghum bicolor]
 gb|EER99030.1| hypothetical protein SORBIDRAFT_02g027000 [Sorghum bicolor]
Length=615

 Score =   445 bits (1145),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 221/228 (97%), Gaps = 0/228 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  383  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  442

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESI+VTVQEVTPR+VGALVALYE
Sbjct  443  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESISVTVQEVTPRAVGALVALYE  502

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVL VLNEA+C+ P EPL+++EIAD
Sbjct  503  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLTVLNEATCENPGEPLSIDEIAD  562

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDE  300
            RCH  EDIEMIYKII HMAANDRALIAEG+CGSPRSVKV+LGECNVDE
Sbjct  563  RCHCPEDIEMIYKIIQHMAANDRALIAEGSCGSPRSVKVYLGECNVDE  610



>ref|XP_006660715.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
[Oryza brachyantha]
Length=622

 Score =   445 bits (1145),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 209/228 (92%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  390  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  449

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN+RESI+VTVQEVTPR+VGALVALYE
Sbjct  450  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANERESISVTVQEVTPRAVGALVALYE  509

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASL+NINAYHQPGVEAGKKAAGEVLALQKRVL VLNEASCK+P EPLTL++IA+
Sbjct  510  RAVGIYASLININAYHQPGVEAGKKAAGEVLALQKRVLTVLNEASCKDPAEPLTLDQIAE  569

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDE  300
            RCH  EDIEMIYKII HMAANDRALIAEG+CGSPRS+KV+LGECNVDE
Sbjct  570  RCHCPEDIEMIYKIIQHMAANDRALIAEGSCGSPRSIKVYLGECNVDE  617



>ref|XP_004957064.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
[Setaria italica]
Length=618

 Score =   445 bits (1145),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 221/228 (97%), Gaps = 0/228 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  386  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  445

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESI+VTVQEVTPR+VGALVALYE
Sbjct  446  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESISVTVQEVTPRAVGALVALYE  505

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVL VLNEA+CK+P EPLTL+EIAD
Sbjct  506  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLIVLNEATCKDPAEPLTLDEIAD  565

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDE  300
            RCH  EDIEMIYKII HMAANDRA+IAEG+CGSPRSVKV+LGEC VDE
Sbjct  566  RCHCPEDIEMIYKIIQHMAANDRAIIAEGSCGSPRSVKVYLGECIVDE  613



>ref|XP_010530225.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic [Tarenaya 
hassleriana]
Length=628

 Score =   445 bits (1145),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 207/229 (90%), Positives = 221/229 (97%), Gaps = 0/229 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFF TFIEVL
Sbjct  398  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFATFIEVL  457

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDW+LEPGVTCGDYLFGMLQGTRSALY NDRESI+VT+QEV PRSVGALVALYE
Sbjct  458  RDRPPGHDWDLEPGVTCGDYLFGMLQGTRSALYGNDRESISVTIQEVNPRSVGALVALYE  517

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLV+INAYHQPGVEAGKKAA EVLALQKRVLAVLNEASCKEPVEPLTL+E+AD
Sbjct  518  RAVGLYASLVHINAYHQPGVEAGKKAAAEVLALQKRVLAVLNEASCKEPVEPLTLDEVAD  577

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDEL  297
            RCH+  +IEMIYKIIAHMAANDR LIAEGNCGSPRSVKV+LGECN+D+L
Sbjct  578  RCHSPGEIEMIYKIIAHMAANDRVLIAEGNCGSPRSVKVYLGECNLDQL  626



>ref|XP_009137464.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic [Brassica 
rapa]
Length=613

 Score =   443 bits (1139),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 206/231 (89%), Positives = 223/231 (97%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGN VNQG+TVYGNKGSTDQHA+IQQLREGV NFF TFIEVL
Sbjct  383  SRYLQQLVMESLGKEFDLDGNTVNQGLTVYGNKGSTDQHAYIQQLREGVPNFFATFIEVL  442

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN RESI+VT++EVTPRSVGA++ALYE
Sbjct  443  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANGRESISVTIEEVTPRSVGAIIALYE  502

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA EVLALQKRVL+VLNEASCK+PVEPLTL+EIAD
Sbjct  503  RAVGLYASLVNINAYHQPGVEAGKKAAAEVLALQKRVLSVLNEASCKDPVEPLTLDEIAD  562

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA E+IEMIYKIIAHM+ANDR LIAEG+CGSPRSVKV+LGECNVD++YA
Sbjct  563  RCHAPEEIEMIYKIIAHMSANDRVLIAEGSCGSPRSVKVYLGECNVDDMYA  613



>ref|XP_010107702.1| Glucose-6-phosphate isomerase [Morus notabilis]
 gb|EXC16675.1| Glucose-6-phosphate isomerase [Morus notabilis]
Length=645

 Score =   444 bits (1141),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 217/251 (86%), Positives = 225/251 (90%), Gaps = 20/251 (8%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLG EFDLDGNRV QG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  395  SRYLQQLVMESLGNEFDLDGNRVKQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  454

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN+RESITVTVQEVTPRSVGAL+ALYE
Sbjct  455  CDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANNRESITVTVQEVTPRSVGALIALYE  514

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEE+A+
Sbjct  515  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEVAE  574

Query  443  RCHALED--------------------IEMIYKIIAHMAANDRALIAEGNCGSPRSVKVF  324
            RCHA ED                    IEMIYKIIAHMA+NDRALIAEG+CGSPRS KVF
Sbjct  575  RCHAPEDVHILISCVFRNHFAFIWHVNIEMIYKIIAHMASNDRALIAEGSCGSPRSFKVF  634

Query  323  LGECNVDELYA  291
            LGECNVDELYA
Sbjct  635  LGECNVDELYA  645



>ref|NP_001147983.1| glucose-6-phosphate isomerase [Zea mays]
 gb|ACG29317.1| glucose-6-phosphate isomerase [Zea mays]
Length=616

 Score =   441 bits (1135),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 207/228 (91%), Positives = 221/228 (97%), Gaps = 0/228 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG++VYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  384  SRYLQQLVMESLGKEFDLDGNRVNQGLSVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  443

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRP GHDWELEPGVTCGDYLFGMLQGTRSALYANDRESI+VTVQEVTPR+VGALVALYE
Sbjct  444  RDRPAGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESISVTVQEVTPRAVGALVALYE  503

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAAGEVLALQKRVL VLNEA+CK+P EPLT++EIAD
Sbjct  504  RAVGLYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLTVLNEATCKDPCEPLTIDEIAD  563

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDE  300
            RCH  EDIEMIYKI+ HMAANDRA+IAEG+CGSPRSVKV+LGECNVDE
Sbjct  564  RCHCPEDIEMIYKIVQHMAANDRAIIAEGSCGSPRSVKVYLGECNVDE  611



>gb|ACF84319.1| unknown [Zea mays]
 tpg|DAA61834.1| TPA: glucose-6-phosphate isomerase [Zea mays]
Length=617

 Score =   441 bits (1135),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 207/228 (91%), Positives = 221/228 (97%), Gaps = 0/228 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG++VYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  385  SRYLQQLVMESLGKEFDLDGNRVNQGLSVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  444

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRP GHDWELEPGVTCGDYLFGMLQGTRSALYANDRESI+VTVQEVTPR+VGALVALYE
Sbjct  445  RDRPAGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESISVTVQEVTPRAVGALVALYE  504

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAAGEVLALQKRVL VLNEA+CK+P EPLT++EIAD
Sbjct  505  RAVGLYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLTVLNEATCKDPCEPLTIDEIAD  564

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDE  300
            RCH  EDIEMIYKI+ HMAANDRA+IAEG+CGSPRSVKV+LGECNVDE
Sbjct  565  RCHCPEDIEMIYKIVQHMAANDRAIIAEGSCGSPRSVKVYLGECNVDE  612



>gb|AAF24124.1|AF120494_1 phosphoglucose isomerase precursor [Arabidopsis thaliana]
Length=612

 Score =   441 bits (1133),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 204/231 (88%), Positives = 221/231 (96%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGN VNQG+TVYGNKGSTDQH +IQQLR+GVHNFF TFIEVL
Sbjct  382  SRYLQQLVMESLGKEFDLDGNTVNQGLTVYGNKGSTDQHPYIQQLRDGVHNFFATFIEVL  441

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            R RPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN RESI+VT+QEVTP SVGA++ALYE
Sbjct  442  RYRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANGRESISVTIQEVTPTSVGAIIALYE  501

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YAS+VNINAYHQPGVEAGKKAA EVLALQKRVL+VLNEA+CK+PVEPLTLEEIAD
Sbjct  502  RAVGLYASIVNINAYHQPGVEAGKKAAAEVLALQKRVLSVLNEATCKDPVEPLTLEEIAD  561

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCHA E+IEMIYKIIAHM+ANDR LIAEGNCGSPRS+KV+LGECNVD+LYA
Sbjct  562  RCHAPEEIEMIYKIIAHMSANDRVLIAEGNCGSPRSIKVYLGECNVDDLYA  612



>ref|XP_006413409.1| hypothetical protein EUTSA_v10024695mg [Eutrema salsugineum]
 dbj|BAJ34119.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ54862.1| hypothetical protein EUTSA_v10024695mg [Eutrema salsugineum]
Length=613

 Score =   439 bits (1128),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 204/231 (88%), Positives = 221/231 (96%), Gaps = 0/231 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGN VNQG+TVYGNKGSTDQHA+IQQLREGVHNFF TFIEV 
Sbjct  383  SRYLQQLVMESLGKEFDLDGNTVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFATFIEVQ  442

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDW+LEPGVTCGDYLFGMLQGTRSALYAN RESI+VT++EVTPRSVGAL+ALYE
Sbjct  443  RDRPPGHDWDLEPGVTCGDYLFGMLQGTRSALYANGRESISVTIEEVTPRSVGALIALYE  502

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YA +VNINAYHQPGVEAGKKAA EVLALQKRVL+VLNEASCK+PVEPLTL+EIAD
Sbjct  503  RAVGLYAFIVNINAYHQPGVEAGKKAAAEVLALQKRVLSVLNEASCKDPVEPLTLDEIAD  562

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
            RCH  E+IEMIYKIIAHM+ANDR LIAEG+CGSPRSVKV+LGECNVD+LYA
Sbjct  563  RCHCPEEIEMIYKIIAHMSANDRVLIAEGSCGSPRSVKVYLGECNVDDLYA  613



>gb|EPS64968.1| glucose-6-phosphate isomerase, partial [Genlisea aurea]
Length=542

 Score =   435 bits (1118),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 219/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDL GNRVNQGITVYGNKGSTDQHA+IQQLR+GVHNFFVTFIEVL
Sbjct  315  SRYLQQLVMESLGKEFDLAGNRVNQGITVYGNKGSTDQHAYIQQLRDGVHNFFVTFIEVL  374

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFG LQGTR+ALY+NDRESITVTVQEVTP S+GAL+ALYE
Sbjct  375  RDRPPGHDWELEPGVTCGDYLFGFLQGTRAALYSNDRESITVTVQEVTPSSIGALIALYE  434

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVE LT+EEIA+
Sbjct  435  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEALTVEEIAE  494

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDE  300
            +CH+ + IEMIYKI+ HMAANDRA+I EG+CGSPRS+KVFLGECNVDE
Sbjct  495  QCHSTDHIEMIYKIVVHMAANDRAVIVEGSCGSPRSIKVFLGECNVDE  542



>gb|ABR16270.1| unknown [Picea sitchensis]
Length=634

 Score =   437 bits (1125),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 201/230 (87%), Positives = 223/230 (97%), Gaps = 0/230 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG++VYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  402  SRYLQQLVMESLGKEFDLDGNRVNQGLSVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  461

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYA +RES+TVTVQEVTPRSVGA++ALYE
Sbjct  462  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAKNRESLTVTVQEVTPRSVGAMIALYE  521

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASL+N+NAYHQPGVEAGKKAAGEVLALQKRVL+VLNEASCKEP+EPLTL +IA+
Sbjct  522  RAVGLYASLINVNAYHQPGVEAGKKAAGEVLALQKRVLSVLNEASCKEPIEPLTLAQIAE  581

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELY  294
            RCHA+E IEMIYKI++H+AANDRALIAEG+CGSP S+KVF  ECNV++LY
Sbjct  582  RCHAVEQIEMIYKIVSHIAANDRALIAEGSCGSPSSIKVFSEECNVEDLY  631



>ref|NP_001168977.1| uncharacterized protein LOC100382805 [Zea mays]
 gb|ACN31292.1| unknown [Zea mays]
Length=616

 Score =   437 bits (1123),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 207/228 (91%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGV NFFVTFIEVL
Sbjct  384  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVQNFFVTFIEVL  443

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRP GHDWELEPGVTCGDYLFGMLQGTRSALYANDRESI+VTVQEVTPR+VGAL+ALYE
Sbjct  444  RDRPAGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESISVTVQEVTPRAVGALIALYE  503

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVL VL EA C+ P EPLTL+EIAD
Sbjct  504  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLTVLKEAICENPTEPLTLDEIAD  563

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDE  300
            RCH  EDIEMIYKII HMAANDRALIAEG+CGSPRSVKV+LGEC+VDE
Sbjct  564  RCHCPEDIEMIYKIIQHMAANDRALIAEGSCGSPRSVKVYLGECSVDE  611



>gb|EAZ07365.1| hypothetical protein OsI_29615 [Oryza sativa Indica Group]
Length=623

 Score =   437 bits (1123),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  392  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  451

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGH+WELEP VTCGDYLFGML GTRSALYANDRESITVTVQEV PR+VGALVALYE
Sbjct  452  RDRPPGHEWELEPSVTCGDYLFGMLHGTRSALYANDRESITVTVQEVNPRAVGALVALYE  511

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YA L+NINAYHQPGVEAGKKAAGEVLALQKR+L VLNEASCK+P EPLTL++IAD
Sbjct  512  RAVGLYAYLININAYHQPGVEAGKKAAGEVLALQKRILLVLNEASCKDPAEPLTLDQIAD  571

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDE  300
            RCH  E+IEMIYKII HMAANDRALIAEGNCGSPRS+KV+LGECNVD+
Sbjct  572  RCHCPEEIEMIYKIIQHMAANDRALIAEGNCGSPRSIKVYLGECNVDD  619



>ref|XP_006660218.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
[Oryza brachyantha]
Length=568

 Score =   434 bits (1117),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 219/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGN+VNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  338  SRYLQQLVMESLGKEFDLDGNQVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  397

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGH+WELEP VTCGDYLFGML GTRSALYANDRESITVTVQEV PR+VGALVALYE
Sbjct  398  RDRPPGHEWELEPSVTCGDYLFGMLHGTRSALYANDRESITVTVQEVNPRAVGALVALYE  457

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YA L+NINAYHQPGVEAGKKAAGEVLALQKR+L VLNEASCK+PVEPLTL++IAD
Sbjct  458  RAVGLYAYLININAYHQPGVEAGKKAAGEVLALQKRILLVLNEASCKDPVEPLTLDQIAD  517

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDE  300
            RCH  E+IEMIYKII HMAANDRALIAEGNCGSPRS+KV+LGEC+VD+
Sbjct  518  RCHCPEEIEMIYKIIQHMAANDRALIAEGNCGSPRSIKVYLGECDVDD  565



>ref|NP_001062053.1| Os08g0478800 [Oryza sativa Japonica Group]
 dbj|BAD09746.1| putative glucose-6-phosphate isomerase precursor [Oryza sativa 
Japonica Group]
 dbj|BAF23967.1| Os08g0478800 [Oryza sativa Japonica Group]
 dbj|BAG98064.1| unnamed protein product [Oryza sativa Japonica Group]
Length=615

 Score =   436 bits (1121),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  384  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  443

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGH+WELEP VTCGDYLFGML GTRSALYANDRESITVTVQEV PR+VGALVALYE
Sbjct  444  RDRPPGHEWELEPSVTCGDYLFGMLHGTRSALYANDRESITVTVQEVNPRAVGALVALYE  503

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YA L+NINAYHQPGVEAGKKAAGEVLALQKR+L VLNEASCK+P EPLTL++IAD
Sbjct  504  RAVGLYAYLININAYHQPGVEAGKKAAGEVLALQKRILLVLNEASCKDPAEPLTLDQIAD  563

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDE  300
            RCH  E+IEMIYKII HMAANDRALIAEGNCGSPRS+KV+LGECNVD+
Sbjct  564  RCHCPEEIEMIYKIIQHMAANDRALIAEGNCGSPRSIKVYLGECNVDD  611



>gb|EAZ43091.1| hypothetical protein OsJ_27683 [Oryza sativa Japonica Group]
Length=615

 Score =   436 bits (1121),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  384  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  443

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGH+WELEP VTCGDYLFGML GTRSALYANDRESITVTVQEV PR+VGALVALYE
Sbjct  444  RDRPPGHEWELEPSVTCGDYLFGMLHGTRSALYANDRESITVTVQEVNPRAVGALVALYE  503

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YA L+NINAYHQPGVEAGKKAAGEVLALQKR+L VLNEASCK+P EPLTL++IAD
Sbjct  504  RAVGLYAYLININAYHQPGVEAGKKAAGEVLALQKRILLVLNEASCKDPAEPLTLDQIAD  563

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDE  300
            RCH  E+IEMIYKII HMAANDRALIAEGNCGSPRS+KV+LGECNVD+
Sbjct  564  RCHCPEEIEMIYKIIQHMAANDRALIAEGNCGSPRSIKVYLGECNVDD  611



>ref|XP_008651420.1| PREDICTED: glucose-6-phosphate isomerase isoform X1 [Zea mays]
 tpg|DAA61835.1| TPA: hypothetical protein ZEAMMB73_302983 [Zea mays]
Length=635

 Score =   431 bits (1107),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 207/246 (84%), Positives = 221/246 (90%), Gaps = 18/246 (7%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG++VYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  385  SRYLQQLVMESLGKEFDLDGNRVNQGLSVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  444

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRP GHDWELEPGVTCGDYLFGMLQGTRSALYANDRESI+VTVQEVTPR+VGALVALYE
Sbjct  445  RDRPAGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESISVTVQEVTPRAVGALVALYE  504

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAAGEVLALQKRVL VLNEA+CK+P EPLT++EIAD
Sbjct  505  RAVGLYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLTVLNEATCKDPCEPLTIDEIAD  564

Query  443  RCHALED------------------IEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLG  318
            RCH  ED                  IEMIYKI+ HMAANDRA+IAEG+CGSPRSVKV+LG
Sbjct  565  RCHCPEDKHNAFPPSITHAQRLLPQIEMIYKIVQHMAANDRAIIAEGSCGSPRSVKVYLG  624

Query  317  ECNVDE  300
            ECNVDE
Sbjct  625  ECNVDE  630



>ref|XP_007018186.1| Glucose-6-phosphate isomerase isoform 1 [Theobroma cacao]
 gb|EOY15411.1| Glucose-6-phosphate isomerase isoform 1 [Theobroma cacao]
Length=656

 Score =   415 bits (1066),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 199/209 (95%), Positives = 203/209 (97%), Gaps = 0/209 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQGITVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  392  SRYLQQLVMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  451

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN+RESITVTVQEVTPRSVGAL+ALYE
Sbjct  452  LDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANNRESITVTVQEVTPRSVGALIALYE  511

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASL NINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEE+AD
Sbjct  512  RAVGIYASLTNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEVAD  571

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEG  357
            RCHA E IEMIYKII HMAANDRALIAEG
Sbjct  572  RCHAPEHIEMIYKIIEHMAANDRALIAEG  600



>ref|XP_001762355.1| predicted protein [Physcomitrella patens]
 gb|EDQ72822.1| predicted protein [Physcomitrella patens]
Length=553

 Score =   409 bits (1051),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 188/230 (82%), Positives = 212/230 (92%), Gaps = 0/230 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MES+GKEFDLDGN+VNQGI+VYGNKGSTDQHA+IQQLREGV NFF TFIEVL
Sbjct  322  SRYLQQLVMESIGKEFDLDGNKVNQGISVYGNKGSTDQHAYIQQLREGVPNFFATFIEVL  381

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN R+SIT+TV+EV P++VGA+VALYE
Sbjct  382  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANKRQSITLTVEEVDPKTVGAMVALYE  441

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG YASLVNINAYHQPGVEAGKKAA EVLALQKRVLAVLN+ASC++PVE LT+EE+A 
Sbjct  442  RAVGFYASLVNINAYHQPGVEAGKKAAAEVLALQKRVLAVLNDASCRDPVEALTVEEVAK  501

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELY  294
            RC   + +EM+YKII+HMAANDRA+ AEG+CG+PRS  V+ GEC VD+LY
Sbjct  502  RCQVPQQVEMVYKIISHMAANDRAVFAEGDCGTPRSATVYSGECGVDDLY  551



>ref|XP_002970310.1| hypothetical protein SELMODRAFT_147101 [Selaginella moellendorffii]
 gb|EFJ28440.1| hypothetical protein SELMODRAFT_147101 [Selaginella moellendorffii]
Length=545

 Score =   408 bits (1048),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 193/230 (84%), Positives = 208/230 (90%), Gaps = 0/230 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN VNQG++VYGNKGSTDQHA+IQQLREGV NFF TFIEVL
Sbjct  315  SRYLQQLVMESLGKELDLDGNLVNQGLSVYGNKGSTDQHAYIQQLREGVSNFFATFIEVL  374

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN RESITVTVQEV  R++GAL+ALYE
Sbjct  375  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANKRESITVTVQEVNARTIGALIALYE  434

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA +VLALQKRVLAVLNEASCKEP EPL +E IA 
Sbjct  435  RAVGLYASLVNINAYHQPGVEAGKKAAADVLALQKRVLAVLNEASCKEPAEPLAVETIAQ  494

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELY  294
             C A   +EMIYKI+ HMAANDRAL AEG+ GSPRS+KV+ GECNV+ELY
Sbjct  495  LCQAPNQVEMIYKIVLHMAANDRALFAEGSRGSPRSLKVYTGECNVEELY  544



>ref|XP_002978474.1| hypothetical protein SELMODRAFT_108783 [Selaginella moellendorffii]
 gb|EFJ20460.1| hypothetical protein SELMODRAFT_108783 [Selaginella moellendorffii]
Length=552

 Score =   408 bits (1048),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 193/230 (84%), Positives = 208/230 (90%), Gaps = 0/230 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN VNQG++VYGNKGSTDQHA+IQQLREGV NFF TFIEVL
Sbjct  322  SRYLQQLVMESLGKELDLDGNLVNQGLSVYGNKGSTDQHAYIQQLREGVSNFFATFIEVL  381

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN RESITVTVQEV  R++GAL+ALYE
Sbjct  382  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANKRESITVTVQEVNARTIGALIALYE  441

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA +VLALQKRVLAVLNEASCKEP EPL +E IA 
Sbjct  442  RAVGLYASLVNINAYHQPGVEAGKKAAADVLALQKRVLAVLNEASCKEPAEPLAVETIAQ  501

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELY  294
             C A   +EMIYKI+ HMAANDRAL AEG+ GSPRS+KV+ GECNV+ELY
Sbjct  502  LCQAPNQVEMIYKIVLHMAANDRALFAEGSRGSPRSLKVYTGECNVEELY  551



>gb|EMT13737.1| Glucose-6-phosphate isomerase [Aegilops tauschii]
Length=616

 Score =   400 bits (1029),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 199/254 (78%), Positives = 213/254 (84%), Gaps = 25/254 (10%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE+DLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  363  SRYLQQLVMESLGKEYDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  422

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALY+NDRESI+VTV+EVTPR+VGALVALYE
Sbjct  423  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYSNDRESISVTVEEVTPRAVGALVALYE  482

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLE----  456
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVL VLNEA    P+ P+  +    
Sbjct  483  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLTVLNEARRFSPIRPIIPDNACI  542

Query  455  ---------EIAD------------RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPR  339
                     E+AD            R      IEMIYKII HMAANDRALIAEG+CGSPR
Sbjct  543  LCLTTAAGTELADAYSSDTVIVSSPRKEVDRPIEMIYKIIQHMAANDRALIAEGSCGSPR  602

Query  338  SVKVFLGECNVDEL  297
            SVKV+LGECNVD+L
Sbjct  603  SVKVYLGECNVDDL  616



>ref|NP_001078444.1| phosphoglucose isomerase 1 [Arabidopsis thaliana]
 gb|AEE84934.1| phosphoglucose isomerase 1 [Arabidopsis thaliana]
Length=570

 Score =   361 bits (927),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGN VNQG+TVYGNKGSTDQHA+IQQLR+GVHNFF TFIEVL
Sbjct  383  SRYLQQLVMESLGKEFDLDGNTVNQGLTVYGNKGSTDQHAYIQQLRDGVHNFFATFIEVL  442

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN RESI+VT+QEVTP SVGA++ALYE
Sbjct  443  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANGRESISVTIQEVTPTSVGAIIALYE  502

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YAS+VNINAYHQPGVEAGKKAA EVLALQKRVL+VLNEA+CK+PVEPLTLEEIAD
Sbjct  503  RAVGLYASIVNINAYHQPGVEAGKKAAAEVLALQKRVLSVLNEATCKDPVEPLTLEEIAD  562

Query  443  RCHALED  423
            RCHA E+
Sbjct  563  RCHAPEE  569



>gb|KHN25059.1| Glucose-6-phosphate isomerase [Glycine soja]
Length=196

 Score =   328 bits (842),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 172/231 (74%), Positives = 178/231 (77%), Gaps = 48/231 (21%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQGI+VYGNKGSTDQHA+IQQLREGVHNFFVTFIE  
Sbjct  14   SRYLQQLVMESLGKEFDLDGNRVNQGISVYGNKGSTDQHAYIQQLREGVHNFFVTFIE--  71

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
                                      GTRSALYAN+RESITVTVQEVTPRSVG L+ALYE
Sbjct  72   --------------------------GTRSALYANNRESITVTVQEVTPRSVGTLIALYE  105

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEA                
Sbjct  106  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEARY--------------  151

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDELYA  291
                   IEMIYKIIAHMAANDRALIAEGNCGSPRS+KVFLGECN+DELYA
Sbjct  152  ------SIEMIYKIIAHMAANDRALIAEGNCGSPRSIKVFLGECNLDELYA  196



>gb|KJB64172.1| hypothetical protein B456_010G035600 [Gossypium raimondii]
Length=556

 Score =   336 bits (862),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 160/164 (98%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQGI+VYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  386  SRYLQQLVMESLGKEFDLDGNRVNQGISVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  445

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGAL+ALYE
Sbjct  446  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALIALYE  505

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEA  492
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEA
Sbjct  506  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEA  549



>ref|XP_010272936.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
isoform X2 [Nelumbo nucifera]
Length=596

 Score =   328 bits (842),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDL+GNRVNQG+TVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  406  SRYLQQLVMESLGKEFDLNGNRVNQGLTVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  465

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN+RESITVTVQEV PRSVGAL+ALYE
Sbjct  466  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANNRESITVTVQEVNPRSVGALIALYE  525

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEA  492
            RAVGIYASLVNINAYHQPGVEAGKKAA EVLALQKRVLAVLNEA
Sbjct  526  RAVGIYASLVNINAYHQPGVEAGKKAAAEVLALQKRVLAVLNEA  569



>tpg|DAA40277.1| TPA: hypothetical protein ZEAMMB73_545188 [Zea mays]
Length=562

 Score =   323 bits (829),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQG+TVYGNKGSTDQHA+IQQLREGV NFFVTFIEVL
Sbjct  384  SRYLQQLVMESLGKEFDLDGNRVNQGLTVYGNKGSTDQHAYIQQLREGVQNFFVTFIEVL  443

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRP GHDWELEPGVTCGDYLFGMLQGTRSALYANDRESI+VTVQEVTPR+VGAL+ALYE
Sbjct  444  RDRPAGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESISVTVQEVTPRAVGALIALYE  503

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEA  492
            RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVL VL EA
Sbjct  504  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLTVLKEA  547



>ref|XP_007018187.1| Glucose-6-phosphate isomerase isoform 2, partial [Theobroma cacao]
 gb|EOY15412.1| Glucose-6-phosphate isomerase isoform 2, partial [Theobroma cacao]
Length=438

 Score =   304 bits (778),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 158/209 (76%), Gaps = 46/209 (22%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGNRVNQGITVYGNKGSTDQHA+IQQLREGVHNFFVTFIEVL
Sbjct  220  SRYLQQLVMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAYIQQLREGVHNFFVTFIEVL  279

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DRPPGHDWELEPGVTCGDYLFGMLQGTRSALYAN+RESITVT                 
Sbjct  280  LDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANNRESITVT-----------------  322

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
                                         VLALQKRVLAVLNEASCKEPVEPLTLEE+AD
Sbjct  323  -----------------------------VLALQKRVLAVLNEASCKEPVEPLTLEEVAD  353

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEG  357
            RCHA E IEMIYKII HMAANDRALIAEG
Sbjct  354  RCHAPEHIEMIYKIIEHMAANDRALIAEG  382



>ref|XP_009604867.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=148

 Score =   290 bits (742),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 143/148 (97%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = -2

Query  734  MLQGTRSALYANDRESITVTVQEVTPRSVGALVALYERAVGIYASLVNINAYHQPGVEAG  555
            MLQGTRSALYANDRESITVTVQEVTPRSVGALVALYERAVGIYASLVNINAYHQPGVEAG
Sbjct  1    MLQGTRSALYANDRESITVTVQEVTPRSVGALVALYERAVGIYASLVNINAYHQPGVEAG  60

Query  554  KKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIADRCHALEDIEMIYKIIAHMAANDR  375
            KKAAGEVLALQKRVL+VLNEASCKEPVEPLTLEEIADRCH  EDIEMIYKIIAHMAANDR
Sbjct  61   KKAAGEVLALQKRVLSVLNEASCKEPVEPLTLEEIADRCHCEEDIEMIYKIIAHMAANDR  120

Query  374  ALIAEGNCGSPRSVKVFLGECNVDELYA  291
            ALIAEG+CGSPRSVKV+LGECNVDELYA
Sbjct  121  ALIAEGSCGSPRSVKVYLGECNVDELYA  148



>ref|WP_009554363.1| glucose-6-phosphate isomerase [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ70075.1| glucose-6-phosphate isomerase [Oscillatoriales cyanobacterium 
JSC-12]
Length=527

 Score =   295 bits (756),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 144/221 (65%), Positives = 173/221 (78%), Gaps = 6/221 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG RVNQGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  312  SRYLQQLVMESLGKELDLDGKRVNQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  371

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  GH  E+EPG T GD+L G LQGTR ALY N R+SIT+TV EVTP +VGAL+ALYE
Sbjct  372  KDRN-GHSIEVEPGATSGDFLSGFLQGTRQALYDNHRDSITITVSEVTPYTVGALIALYE  430

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA  VL LQ+RV+  L  A      +PL+L ++A 
Sbjct  431  RAVGLYASLVNINAYHQPGVEAGKKAAASVLDLQRRVVETLKTAE-----KPLSLADLAK  485

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFL  321
              +A +++E +YKI+ H+ ANDR +  +G+   P S+++ L
Sbjct  486  TANAPDEVETVYKIVRHLEANDRGITIQGDRAKPSSLQITL  526



>ref|WP_017322014.1| glucose-6-phosphate isomerase [cyanobacterium PCC 7702]
Length=528

 Score =   295 bits (755),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 145/219 (66%), Positives = 172/219 (79%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V+QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNIVHQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G  +E+EPG+T GDYL G LQGTR ALY N R+SITVT+ +V+PR+VGAL+ALYE
Sbjct  373  EDRK-GSSFEIEPGITSGDYLSGFLQGTRQALYENHRDSITVTIPQVSPRTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASL+N+NAYHQPGVEAGKKAA  +L LQK+V+ VL          PL+LEEIA 
Sbjct  432  RAVGLYASLINVNAYHQPGVEAGKKAAAAILELQKKVVEVLQTTKT-----PLSLEEIAQ  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A E IE IY I+ H+ AN R ++ +GN G P ++KV
Sbjct  487  KAGASEQIECIYTIVRHLYANQRGVVLQGNLGQPSNLKV  525



>ref|WP_006106108.1| glucose-6-phosphate isomerase [Coleofasciculus chthonoplastes]
 gb|EDX71011.1| glucose-6-phosphate isomerase [Coleofasciculus chthonoplastes 
PCC 7420]
Length=528

 Score =   295 bits (755),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 173/219 (79%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V+QGI VYGNKGSTDQHA++QQLREGV NFFVTFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNTVHQGIAVYGNKGSTDQHAYVQQLREGVPNFFVTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDR  GH  ++E GVT GDYL G+LQGTR ALY N R+SITVT+ +V PR+VGAL+ALY+
Sbjct  373  RDRE-GHSPQVEAGVTSGDYLSGLLQGTRKALYDNQRDSITVTIPQVNPRTVGALIALYD  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA  +L LQKRV+ VL +       EP++L ++A 
Sbjct  432  RAVGLYASLVNINAYHQPGVEAGKKAASAILDLQKRVIQVLQDQG-----EPMSLSQLAQ  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + IE IYKI+ H+  N R ++ EG  G P S+KV
Sbjct  487  KAGATDQIEAIYKILRHLHTNQRGVVLEGKLGEPSSLKV  525



>ref|WP_019489916.1| glucose-6-phosphate isomerase [Calothrix sp. PCC 7103]
Length=528

 Score =   293 bits (750),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 145/222 (65%), Positives = 174/222 (78%), Gaps = 6/222 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V+QGI VYGNKGSTDQHA++QQLREGV NFF+TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNIVHQGIAVYGNKGSTDQHAYVQQLREGVPNFFLTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E EPG+T GDYL G LQG+R+ALY N R+SITVT+ EV PR+VGAL+ALY+
Sbjct  373  KDRE-GASPEFEPGITSGDYLSGFLQGSRTALYENHRDSITVTIPEVNPRTVGALIALYD  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG YASLVNINAYHQPGVEAGKKAA  +L LQ +V+ VL          PLTL +IAD
Sbjct  432  RAVGYYASLVNINAYHQPGVEAGKKAAAVILDLQTKVINVLQSEKA-----PLTLAQIAD  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLG  318
            +  A +++E IY I+ HM+AN+R ++ +GN G P S+ V +G
Sbjct  487  KAGASDNVESIYIILRHMSANNRGVVMQGNLGEPNSLTVSMG  528



>ref|WP_044290801.1| glucose-6-phosphate isomerase [Rivularia sp. PCC 7116]
Length=501

 Score =   290 bits (743),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/223 (64%), Positives = 174/223 (78%), Gaps = 6/223 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V+QGI VYGNKGSTDQHA++QQLR+GV NFF+TFIEVL
Sbjct  285  SRYLQQLVMESLGKEKDLDGNTVHQGIAVYGNKGSTDQHAYVQQLRDGVANFFLTFIEVL  344

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+EPG+T GDYL G LQGTR ALY N R+S+TVT+ +V PR+VGAL+ALYE
Sbjct  345  EDRK-GSSLEIEPGITSGDYLSGFLQGTRKALYENQRDSVTVTIPQVNPRTVGALIALYE  403

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVN+NAYHQPGVEAGKKAA  +L LQ+++++VL          P++LEEIA 
Sbjct  404  RAVGLYASLVNVNAYHQPGVEAGKKAAAAILELQQQIVSVLQTEE-----NPISLEEIAS  458

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGE  315
            +  A E IE IY I+ H+ AN R ++ +GN G P S+K  +G+
Sbjct  459  KAGASEQIESIYIILRHLNANGRGVLIDGNFGQPSSLKFSIGK  501



>ref|WP_039737191.1| glucose-6-phosphate isomerase [Hassallia byssoidea]
 gb|KIF37625.1| glucose-6-phosphate isomerase [Hassallia byssoidea VB512170]
Length=528

 Score =   291 bits (744),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 172/221 (78%), Gaps = 6/221 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGVANFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E++PGVT GDYL G LQGTR ALY N R+SITVT+ +V PR+VGAL+ALYE
Sbjct  373  EDRN-GASPEIDPGVTSGDYLSGFLQGTRQALYENHRDSITVTIPQVNPRTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG YASLVNINAYHQPGVEAGKKAA  +L LQK+V+ VL          PL+L+EIA+
Sbjct  432  RAVGFYASLVNINAYHQPGVEAGKKAAATILDLQKQVVEVLQTEKT-----PLSLQEIAE  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFL  321
            + +A + IE IYKI+ H+AAN R ++  G+ G P S+K+ L
Sbjct  487  KANASDQIEPIYKIVRHLAANQRGVVLHGHPGEPGSLKISL  527



>ref|WP_015227550.1| glucose-6-phosphate isomerase [Halothece sp. PCC 7418]
 gb|AFZ45678.1| glucose-6-phosphate isomerase [Halothece sp. PCC 7418]
Length=527

 Score =   290 bits (743),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 148/219 (68%), Positives = 172/219 (79%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+E G T GD+L G+LQGTR ALY N R+SIT+TV EVTPR++GAL+ALYE
Sbjct  373  KDRE-GTSPEVEAGATAGDFLSGLLQGTRLALYENHRDSITITVDEVTPRTIGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA  VL LQ+ V+AVL   S       L+L EIA+
Sbjct  432  RAVGLYASLVNINAYHQPGVEAGKKAAASVLDLQRDVVAVLQAESGS-----LSLSEIAE  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            + +A E +E+IYKII H+ +N R +  EGN G P S+KV
Sbjct  487  KVNAEEKVEVIYKIIRHLHSNGRGVKVEGNWGQPSSLKV  525



>ref|WP_040938053.1| glucose-6-phosphate isomerase [Prochloron didemni]
Length=537

 Score =   291 bits (744),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 170/219 (78%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFF T IEVL
Sbjct  321  SRYLQQLVMESLGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATLIEVL  380

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+EPG+T GDYL G+LQGTR ALY N R+SITVT+ EV  R+VGAL+ALYE
Sbjct  381  GDRH-GDSPEVEPGITAGDYLSGLLQGTRQALYENQRDSITVTISEVNARNVGALIALYE  439

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV  YASLVNINAYHQPGVEAGKKAA  VLALQ RV+ VL +A       PL+L E+A+
Sbjct  440  RAVSFYASLVNINAYHQPGVEAGKKAAASVLALQNRVVQVLAKAKV-----PLSLSELAE  494

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  + E+IE IYKI+ H+ AN + ++ +GN G P S+KV
Sbjct  495  KAESGEEIETIYKIVRHLNANGKGVVLQGNLGKPSSLKV  533



>gb|AFY54049.1| glucose-6-phosphate isomerase [Rivularia sp. PCC 7116]
Length=529

 Score =   290 bits (741),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/223 (64%), Positives = 174/223 (78%), Gaps = 6/223 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V+QGI VYGNKGSTDQHA++QQLR+GV NFF+TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNTVHQGIAVYGNKGSTDQHAYVQQLRDGVANFFLTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+EPG+T GDYL G LQGTR ALY N R+S+TVT+ +V PR+VGAL+ALYE
Sbjct  373  EDRK-GSSLEIEPGITSGDYLSGFLQGTRKALYENQRDSVTVTIPQVNPRTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVN+NAYHQPGVEAGKKAA  +L LQ+++++VL          P++LEEIA 
Sbjct  432  RAVGLYASLVNVNAYHQPGVEAGKKAAAAILELQQQIVSVLQTEE-----NPISLEEIAS  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGE  315
            +  A E IE IY I+ H+ AN R ++ +GN G P S+K  +G+
Sbjct  487  KAGASEQIESIYIILRHLNANGRGVLIDGNFGQPSSLKFSIGK  529



>ref|WP_035121197.1| glucose-6-phosphate isomerase [Fischerella sp. PCC 9431]
Length=501

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 144/222 (65%), Positives = 171/222 (77%), Gaps = 6/222 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V+QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  285  SRYLQQLVMESLGKEKDLDGNVVHQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  344

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR      E+EPG+T GDYL G LQGTR ALY   R+S+TVT+ +V  R+VGAL+ALYE
Sbjct  345  EDRQSPSP-EIEPGITSGDYLSGFLQGTREALYEKHRDSVTVTIPQVNSRTVGALIALYE  403

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASL+NINAYHQPGVEAGKKAA E+L LQK+V+AVL +        PLTLE+I+ 
Sbjct  404  RAVGLYASLININAYHQPGVEAGKKAAAEILELQKKVVAVLQKEKT-----PLTLEQISQ  458

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLG  318
            +  A + IE IY I+ H+ AN+R +  EGN G P S+K  +G
Sbjct  459  KAGATDKIESIYMILRHLHANNRGVALEGNLGQPNSLKFSIG  500



>ref|WP_036531294.1| glucose-6-phosphate isomerase [Neosynechococcus sphagnicola]
 gb|KGF73551.1| glucose-6-phosphate isomerase [Neosynechococcus sphagnicola sy1]
Length=528

 Score =   288 bits (737),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 171/219 (78%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V+QGI VYGNKGSTDQHA++QQLREGV NFF+TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNIVHQGIAVYGNKGSTDQHAYVQQLREGVLNFFMTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+EPGVT GDYL G+LQGTR ALY NDR+SITVT+ +VTPRSVGAL+ALYE
Sbjct  373  ADRQ-GPSVEVEPGVTSGDYLSGLLQGTRQALYENDRDSITVTIPQVTPRSVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+Y  LVN+NAYHQPGVEAGKKAA  +L LQ++V+ VL +         LTL ++A+
Sbjct  432  RAVGLYGFLVNVNAYHQPGVEAGKKAAAAILDLQRQVMQVLQQTPTS-----LTLADLAE  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            R  A +  E IYKI+ H+ AN R +  EGN G P S+KV
Sbjct  487  RLAAPDQQETIYKILRHLQANQRGIKLEGNPGHPTSLKV  525



>ref|WP_029634654.1| glucose-6-phosphate isomerase [[Scytonema hofmanni] UTEX B 1581]
Length=528

 Score =   288 bits (736),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 145/222 (65%), Positives = 172/222 (77%), Gaps = 6/222 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLR+GV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLRDGVANFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E++PGVT GDYL G LQGTR ALY N R+SITVT+ +V PR+VGAL+ALYE
Sbjct  373  EDRN-GASPEIDPGVTSGDYLSGFLQGTRQALYENQRDSITVTIPQVNPRTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG Y +LVNINAYHQPGVEAGKKAA  +L LQK+++ VL          PL+LEEIA+
Sbjct  432  RAVGFYGNLVNINAYHQPGVEAGKKAAATILDLQKQIVEVLQTEK-----NPLSLEEIAE  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLG  318
            + +A + IE I+KI+ H+AAN R ++  G+ G P S+KV LG
Sbjct  487  KANASDQIEPIFKIVRHLAANQRGVVLHGHPGEPGSLKVSLG  528



>ref|WP_018400182.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=528

 Score =   287 bits (735),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 145/218 (67%), Positives = 167/218 (77%), Gaps = 6/218 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFF+TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFLTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+EPG T GDYL G LQGTR ALY NDR+SITVT+  V  R++GAL+ALYE
Sbjct  373  EDRE-GRSIEVEPGATSGDYLSGFLQGTRQALYENDRDSITVTIPTVNERNIGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA  VL LQ + +A L +A      +PL L EI+D
Sbjct  432  RAVGLYASLVNINAYHQPGVEAGKKAAAAVLTLQDKAIATLKQAD-----KPLNLAEISD  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVK  330
            R    + IE +YKI+ H+ ANDR L+ EGN   P ++K
Sbjct  487  RMGEGDRIEDVYKILRHLHANDRGLVLEGNFAQPSTLK  524



>ref|WP_017310420.1| glucose-6-phosphate isomerase [Fischerella sp. PCC 9339]
Length=529

 Score =   287 bits (735),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 144/222 (65%), Positives = 170/222 (77%), Gaps = 6/222 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V+QGI VYGNKGSTDQHA++QQLREGV NFF T IEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNIVHQGIAVYGNKGSTDQHAYVQQLREGVPNFFATLIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR      E+EPG+T GDYL G LQGTR ALY   R+S+TVT+ +V  R+VGAL+ALYE
Sbjct  373  EDRQSPSP-EIEPGITSGDYLSGFLQGTREALYEKHRDSVTVTIPQVNSRTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASL+NINAYHQPGVEAGKKAA E+L LQK+V+AVL E        PLTLE+I+ 
Sbjct  432  RAVGLYASLININAYHQPGVEAGKKAAAEILELQKKVVAVLQEEKT-----PLTLEQISQ  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLG  318
            +  A + IE IY I+ H+ AN R ++ EGN G P S+K  +G
Sbjct  487  KIGATDKIESIYMILRHLHANSRGVVLEGNLGQPDSLKFSIG  528



>gb|EAW46724.1| glucose-6-phosphate isomerase [Nodularia spumigena CCY9414]
Length=500

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 171/222 (77%), Gaps = 6/222 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MES+GKE DLDGN V QGI VYGNKGSTDQHA++QQLREG+ NFF TFIEVL
Sbjct  285  SRYLQQLVMESIGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGIPNFFATFIEVL  344

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+EPGVT GD+L G L GTR ALY N R+SITVT+ +V P++VGAL+ALYE
Sbjct  345  EDRE-GKSLEIEPGVTSGDFLSGFLLGTRQALYENQRDSITVTIPQVNPKTVGALIALYE  403

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVN+NAYHQPGVEAGKKAA  +L LQ +V+AVL +         L+LEE+A 
Sbjct  404  RAVGLYASLVNVNAYHQPGVEAGKKAAAVILELQSKVMAVLQKEKTA-----LSLEEVAQ  458

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLG  318
            +  A E++E IYKI+ H+ AN R ++ +G  G P S+KV +G
Sbjct  459  KAGAAEEVEAIYKILRHLHANGRGVVLQGELGKPGSLKVSVG  500



>ref|WP_040931879.1| glucose-6-phosphate isomerase [Prochloron didemni]
Length=537

 Score =   287 bits (734),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/219 (66%), Positives = 169/219 (77%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFF T IEVL
Sbjct  321  SRYLQQLVMESLGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATLIEVL  380

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+E G+T GDYL G+LQGTR ALY N R+SITVT+ EV  R+VGAL+ALYE
Sbjct  381  GDRH-GDSPEVESGITSGDYLSGLLQGTRQALYENQRDSITVTISEVNARNVGALIALYE  439

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV  YASLVNINAYHQPGVEAGKKAA  VLALQ RV+ VL +A       PL+L E+A+
Sbjct  440  RAVSFYASLVNINAYHQPGVEAGKKAAASVLALQNRVVQVLAKAKV-----PLSLSELAE  494

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  + E+IE IYKI+ H+ AN + ++ +GN G P S+KV
Sbjct  495  KAESGEEIETIYKIVRHLNANGKGVVLQGNLGKPSSLKV  533



>ref|WP_015140444.1| glucose-6-phosphate isomerase [Nostoc sp. PCC 7524]
 gb|AFY50031.1| glucose-6-phosphate isomerase [Nostoc sp. PCC 7524]
Length=528

 Score =   286 bits (733),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 169/222 (76%), Gaps = 6/222 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFF T IEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATLIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+EPGVT GDYL G LQGTR ALY N R+SITVTV +V PR VGAL+ALYE
Sbjct  373  EDRQ-GPSPEIEPGVTSGDYLSGFLQGTRQALYENQRDSITVTVPQVNPRIVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA  +L LQ +V+ +L           L++E+IA+
Sbjct  432  RAVGLYASLVNINAYHQPGVEAGKKAAAAILDLQTKVVGLLQTEKTA-----LSVEQIAE  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLG  318
            +  A + +E IYKI+ H+ AN R ++ +GN G P SVKV LG
Sbjct  487  KVGAADQVEAIYKILRHLHANQRGVVFQGNLGQPGSVKVSLG  528



>ref|WP_015229719.1| glucose-6-phosphate isomerase [Dactylococcopsis salina]
 gb|AFZ50726.1| glucose-6-phosphate isomerase [Dactylococcopsis salina PCC 8305]
Length=529

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 173/219 (79%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QG+ VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNTVYQGLAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+E GVT GDYL G+LQGTR ALY N R+SIT+TV++VTPR VGAL+ALY+
Sbjct  373  KDRD-GKSPEVENGVTSGDYLSGLLQGTRLALYDNHRDSITITVEDVTPRHVGALIALYD  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA  VL LQ+ V+++L + +      PL++ EIA 
Sbjct  432  RAVGLYASLVNINAYHQPGVEAGKKAAASVLDLQREVVSLLQQENT-----PLSVPEIAQ  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            + +A E +E+IYKII H+ +N R +  EGN G P  ++V
Sbjct  487  KLNAAEKVEIIYKIIRHLYSNGRGIKVEGNLGEPSRLQV  525



>ref|WP_017661233.1| glucose-6-phosphate isomerase [Geitlerinema sp. PCC 7105]
Length=528

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 170/219 (78%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREG+ NFFVTFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNVVRQGIAVYGNKGSTDQHAYVQQLREGIPNFFVTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   ELEPG+T GDYL G LQGTR AL+ N R SITVTV  V+PRSVGAL+ALYE
Sbjct  373  EDRE-GDSPELEPGITSGDYLSGFLQGTRKALFENGRGSITVTVPRVSPRSVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASL+N+NAYHQPGVEAGKKAA  VL LQK+V+ +L  +      +P+TLEEIA+
Sbjct  432  RAVGLYASLINVNAYHQPGVEAGKKAAAVVLDLQKQVVELLQSSG-----KPMTLEEIAE  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +    ++IE IYKI+ H+ AN R +   GN G P S +V
Sbjct  487  QVGCPQEIETIYKILRHLHANQRGITLVGNLGRPSSWQV  525



>ref|WP_017315368.1| glucose-6-phosphate isomerase [Mastigocladopsis repens]
Length=530

 Score =   286 bits (732),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 145/219 (66%), Positives = 167/219 (76%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DL+GN V QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLEGNTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+EPG+T GDYL G LQGTR ALY N R+SITVT+ +V  R+VGAL+ALYE
Sbjct  373  EDRN-GPSTEIEPGITAGDYLSGFLQGTRQALYENQRDSITVTIPQVNARTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG YASLVNINAYHQPGVEAGKKAA  +L LQKRV+ VL           L+LE++A 
Sbjct  432  RAVGFYASLVNINAYHQPGVEAGKKAAAVILDLQKRVVEVLQTEKTA-----LSLEQVAQ  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A E IE IYKI+ H+ AN R ++ +GN G P S+KV
Sbjct  487  KAGATEQIEAIYKILRHLHANQRGVVLQGNLGEPSSLKV  525



>ref|WP_015190580.1| glucose-6-phosphate isomerase [Gloeocapsa sp. PCC 7428]
 gb|AFZ32713.1| glucose-6-phosphate isomerase [Gloeocapsa sp. PCC 7428]
Length=528

 Score =   286 bits (731),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 168/219 (77%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN VNQGI VYGNKGSTDQHA++QQLREGV NFFVTFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNVVNQGIAVYGNKGSTDQHAYVQQLREGVPNFFVTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   ELEPG T GDYL G LQGTR ALY N R+SITVT+ +V PR+VGAL+ALY+
Sbjct  373  EDRQ-GASPELEPGTTSGDYLSGFLQGTRQALYDNHRDSITVTILQVNPRTVGALIALYD  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+Y SLVN+NAYHQPGVEAGKKAA  VL LQKRVL +L + S       +++ ++A+
Sbjct  432  RAVGLYGSLVNVNAYHQPGVEAGKKAAAAVLDLQKRVLQILEDES-----RSISIAQLAE  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + +E IYKI+ H+ AN R +   GN G P S+ V
Sbjct  487  KAQATDQVETIYKILRHLHANKRGVTLNGNFGDPSSLTV  525



>ref|WP_017803973.1| glucose-6-phosphate isomerase [Nodularia spumigena]
 gb|AHJ28161.1| Glucose-6-phosphate isomerase [Nodularia spumigena CCY9414]
Length=528

 Score =   285 bits (730),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 171/222 (77%), Gaps = 6/222 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MES+GKE DLDGN V QGI VYGNKGSTDQHA++QQLREG+ NFF TFIEVL
Sbjct  313  SRYLQQLVMESIGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGIPNFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+EPGVT GD+L G L GTR ALY N R+SITVT+ +V P++VGAL+ALYE
Sbjct  373  EDRE-GKSLEIEPGVTSGDFLSGFLLGTRQALYENQRDSITVTIPQVNPKTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVN+NAYHQPGVEAGKKAA  +L LQ +V+AVL +         L+LEE+A 
Sbjct  432  RAVGLYASLVNVNAYHQPGVEAGKKAAAVILELQSKVMAVLQKEKTA-----LSLEEVAQ  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLG  318
            +  A E++E IYKI+ H+ AN R ++ +G  G P S+KV +G
Sbjct  487  KAGAAEEVEAIYKILRHLHANGRGVVLQGELGKPGSLKVSVG  528



>ref|WP_016868155.1| glucose-6-phosphate isomerase [Fischerella muscicola]
Length=501

 Score =   285 bits (728),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 142/222 (64%), Positives = 170/222 (77%), Gaps = 6/222 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V+QGI VYGNKGSTDQHA++QQLREG+ NFF TFIEVL
Sbjct  285  SRYLQQLVMESLGKEKDLDGNIVHQGIAVYGNKGSTDQHAYVQQLREGIPNFFATFIEVL  344

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR      E+EPG+T GDYL G LQGTR ALY N R+S+TVT+ +V  R+VGAL+ALY+
Sbjct  345  EDRH-SPSPEIEPGITSGDYLSGFLQGTRQALYENHRDSVTVTIPQVNSRTVGALIALYD  403

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASL+NINAYHQPGVEAGKKAA E+L LQK+V+ VL +        PLTLEE+A 
Sbjct  404  RAVGLYASLININAYHQPGVEAGKKAAAEILELQKQVVEVLQKEKT-----PLTLEEVAQ  458

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLG  318
            +  A + IE IY I+ H+ AN R +  +GN G P S+K  +G
Sbjct  459  KTGATDKIESIYLILRHLHANGRGVTLQGNLGQPSSLKFSIG  500



>ref|WP_008180763.1| glucose-6-phosphate isomerase [Moorea producens]
 gb|EGJ33850.1| glucose-6-phosphate isomerase [Moorea producens 3L]
Length=528

 Score =   285 bits (730),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 173/219 (79%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFFVTFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFVTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+E GVT GDYL G+LQGTR ALY N R+SITV++++V  R+VGAL+ALYE
Sbjct  373  EDRQ-GKSPEVEAGVTAGDYLSGLLQGTRQALYENQRDSITVSIRQVNARTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA  +L LQK+V+ VL++ S       +++ E+A+
Sbjct  432  RAVGLYASLVNINAYHQPGVEAGKKAAAAILDLQKQVMEVLHQESAA-----ISISELAE  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + IE IYK++ H+A N R ++ EGN G P S+KV
Sbjct  487  KAGAPDQIEGIYKLLRHLAYNQRGIVLEGNLGQPSSLKV  525



>ref|WP_036482868.1| glucose-6-phosphate isomerase [Myxosarcina sp. GI1]
Length=529

 Score =   285 bits (729),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 142/220 (65%), Positives = 168/220 (76%), Gaps = 6/220 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN VNQGI VYGNKGSTDQHA++QQLREGV+NFF+TF+EVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNVVNQGIAVYGNKGSTDQHAYVQQLREGVNNFFLTFVEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+EPG+T GDYL G L GTR AL+   R+SIT+T+  V   +VGAL+ALYE
Sbjct  373  EDRE-GKPVEIEPGITSGDYLLGFLLGTRQALFDKQRDSITITISRVDEFNVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            R V IYASL+NINAYHQPGVEAGKKAA  VL LQ RV+ +L  A       PL+L E+A+
Sbjct  432  RTVTIYASLININAYHQPGVEAGKKAANSVLKLQDRVVDILKHARS-----PLSLLELAE  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVF  324
            +  + + IE IYKII H+ ANDR LI +GN G P S++VF
Sbjct  487  KAKSTDQIETIYKIIRHLNANDRGLILKGNLGQPDSLEVF  526



>ref|WP_015220786.1| glucose-6-phosphate isomerase [Cyanobacterium aponinum]
 gb|AFZ55067.1| glucose-6-phosphate isomerase [Cyanobacterium aponinum PCC 10605]
Length=531

 Score =   285 bits (729),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 170/219 (78%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREG+ NFFVTFIEVL
Sbjct  315  SRYLQQLVMESLGKEKDLDGNSVYQGIAVYGNKGSTDQHAYVQQLREGISNFFVTFIEVL  374

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR      ELE  VT GDYL G LQGTR ALY N R+SITVTV EVTP +VGAL+ALYE
Sbjct  375  KDRET-KSIELEKNVTSGDYLSGFLQGTRQALYDNGRDSITVTVNEVTPYTVGALIALYE  433

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV IYA LVNINAYHQPGVEAGKKAA  +LALQK VL ++   S     + LT++EIAD
Sbjct  434  RAVSIYAYLVNINAYHQPGVEAGKKAAASILALQKEVLDLIQNNS-----QSLTIQEIAD  488

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +    +DIE IYKI+ H++AN+R +  EG+  SP +++V
Sbjct  489  KIDKSQDIEAIYKILRHLSANNRGIHLEGDRISPSNLQV  527



>ref|WP_015143167.1| glucose-6-phosphate isomerase [Pleurocapsa minor]
 gb|AFY76861.1| glucose-6-phosphate isomerase [Pleurocapsa sp. PCC 7327]
Length=528

 Score =   285 bits (728),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 142/222 (64%), Positives = 170/222 (77%), Gaps = 6/222 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFFVTFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFVTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G+  EL+PG+T GDYL   +QGTR+ALY N R+SIT+T+ EV PR+VGA +ALYE
Sbjct  373  KDRQ-GNSIELDPGITSGDYLSAFIQGTRAALYENHRDSITITIPEVNPRTVGAAIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKK A  +L LQK+++  L  AS     EPL L  +A 
Sbjct  432  RAVGLYASLVNINAYHQPGVEAGKKMAASILELQKQIMQTLQSAS-----EPLDLATLAQ  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLG  318
            +  +  +IE IYKI+ H+ AN R +I  G+  +P S+KV  G
Sbjct  487  KAGSPNEIEAIYKIVRHLEANRRGVIMSGDRANPGSLKVSAG  528



>ref|WP_039726011.1| MULTISPECIES: glucose-6-phosphate isomerase [Oscillatoriophycideae]
 gb|KIF14288.1| glucose-6-phosphate isomerase [Aphanocapsa montana BDHKU210001]
 gb|KIF39222.1| glucose-6-phosphate isomerase [Lyngbya confervoides BDU141951]
Length=532

 Score =   285 bits (728),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/219 (64%), Positives = 170/219 (78%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V+QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  312  SRYLQQLVMESLGKEKDLDGNVVHQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  371

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+EP  T GD+L G LQGTR+ALY N RESIT+T+ EVTPR+VGAL+ALYE
Sbjct  372  KDRE-GPSIEVEPDATSGDFLNGFLQGTRAALYDNQRESITITINEVTPRTVGALIALYE  430

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA  ++ LQ+RVL V+         +PL L  +AD
Sbjct  431  RAVGLYASLVNINAYHQPGVEAGKKAAASIIDLQRRVLTVVRSLD-----QPLPLATVAD  485

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + +E +YKI+ H+AAN+R +  +G+  +P  + V
Sbjct  486  KAGATDQVESVYKILRHLAANNRGITLQGDRRTPSKLNV  524



>ref|WP_037220824.1| glucose-6-phosphate isomerase [Richelia intracellularis]
 emb|CDN13776.1| Glucose-6-phosphate isomerase [Richelia intracellularis]
Length=529

 Score =   284 bits (727),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 145/219 (66%), Positives = 165/219 (75%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+EPGVT GDYL G LQGTR ALY N R+SITVT+ +V PR+VGAL+ALY+
Sbjct  373  EDRS-GKSLEIEPGVTSGDYLSGFLQGTRQALYENHRDSITVTIPQVNPRTVGALIALYD  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG YAS VNINAYHQPGVEAGKKAA  +L LQ +++ VL     K+   P++LE +A 
Sbjct  432  RAVGFYASFVNINAYHQPGVEAGKKAAAAILELQTQIMEVL-----KKEKAPISLETLAQ  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +    E IE IY II H+ AN R LI EG  G P S+KV
Sbjct  487  KVGTPEKIESIYIIIRHLHANQRGLILEGKLGQPASLKV  525



>gb|KIJ81304.1| glucose-6-phosphate isomerase [Scytonema tolypothrichoides VB-61278]
Length=528

 Score =   284 bits (727),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/219 (66%), Positives = 166/219 (76%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DL GN V+QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLQGNVVHQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   ELEPGVT GDYL G LQGTR ALY N R+SITVT+ +V  R+VGAL+ALY+
Sbjct  373  EDRN-GPSSELEPGVTMGDYLSGFLQGTRQALYENQRDSITVTIPQVNSRTVGALIALYD  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG YASLVNINAYHQPGVEAGKKAA  +L LQK+V+ VL           L++EEIA 
Sbjct  432  RAVGFYASLVNINAYHQPGVEAGKKAAAAILDLQKQVVKVLQTEKTA-----LSIEEIAQ  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + IE IYKI+ H+ AN R  + +GN G P S+K+
Sbjct  487  KAGATDKIEAIYKIVRHLYANQRGFVLQGNLGQPSSLKI  525



>ref|WP_015955750.1| glucose-6-phosphate isomerase [Cyanothece sp. PCC 7424]
 sp|B7KJ74.1|G6PI_CYAP7 RecName: Full=Glucose-6-phosphate isomerase; Short=GPI; AltName: 
Full=Phosphoglucose isomerase; Short=PGI; AltName: Full=Phosphohexose 
isomerase; Short=PHI [Cyanothece sp. PCC 7424]
 gb|ACK72158.1| Glucose-6-phosphate isomerase [Cyanothece sp. PCC 7424]
Length=526

 Score =   284 bits (726),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 168/222 (76%), Gaps = 6/222 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFFVTFIEVL
Sbjct  311  SRYLQQLVMESLGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFVTFIEVL  370

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   ELEPGVT GDYL G +QGTR ALY N R+SIT+T+ EV PR+VGALVALYE
Sbjct  371  EDRQ-GSSIELEPGVTSGDYLAGFIQGTRQALYENHRDSITITIPEVNPRTVGALVALYE  429

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV  Y SLVN+NAYHQPGVEAGKKAA  +L LQ+ V+  L EA  +     L LE ++ 
Sbjct  430  RAVSFYGSLVNVNAYHQPGVEAGKKAAASILELQQNVMKALKEAGTE-----LDLETLSQ  484

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLG  318
            +    + +E +YKI+ H+AAN+R ++ +G+ G P ++KV  G
Sbjct  485  KAGHPDKVEAVYKIVRHLAANNRGVMLKGDLGKPTTLKVSFG  526



>ref|WP_012410277.1| glucose-6-phosphate isomerase [Nostoc punctiforme]
 sp|B2J5F1.1|G6PI_NOSP7 RecName: Full=Glucose-6-phosphate isomerase; Short=GPI; AltName: 
Full=Phosphoglucose isomerase; Short=PGI; AltName: Full=Phosphohexose 
isomerase; Short=PHI [Nostoc punctiforme PCC 73102]
 gb|ACC82308.1| phosphoglucose isomerase (PGI) [Nostoc punctiforme PCC 73102]
Length=528

 Score =   283 bits (725),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 170/219 (78%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V+QGI VYGNKGSTDQHA++QQLREGV NFF TF+EVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNVVHQGIAVYGNKGSTDQHAYVQQLREGVANFFATFVEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E++PGVT GDYL G LQGTR ALY N R+SITVT+ +V PR+VGAL+ALYE
Sbjct  373  EDRQ-GPSTEIDPGVTSGDYLSGFLQGTRQALYENHRDSITVTIPQVNPRTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVN+NAYHQPGVEAGKKAA  +L LQ RV+AVL +        P++L+E+A 
Sbjct  432  RAVGLYASLVNVNAYHQPGVEAGKKAAASILDLQTRVVAVLQKEKT-----PISLDELAK  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + IE IYKI+ H+ AN R ++ +G+   P S+ V
Sbjct  487  KAGASDQIEAIYKILRHIHANQRGVVLQGDLHKPGSLTV  525



>gb|KIE07545.1| glucose-6-phosphate isomerase [Tolypothrix bouteillei VB521301]
Length=528

 Score =   283 bits (725),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 145/222 (65%), Positives = 171/222 (77%), Gaps = 8/222 (4%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DL+GN V+QGI VYGNKGSTDQHA++QQLR+GV NFFVTFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLEGNVVHQGIAVYGNKGSTDQHAYVQQLRDGVPNFFVTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   ELEPG+T GDYL G LQGTR ALY N R+SITVT+ +V  R+VGAL+ALY+
Sbjct  373  EDRK-GSSPELEPGITAGDYLSGFLQGTRQALYENQRDSITVTIPQVNSRTVGALIALYD  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVL-NEASCKEPVEPLTLEEIA  447
            RA+G YASLV INAYHQPGVEAGKKAA  +L LQKRV+ VL NE +       L++EEIA
Sbjct  432  RAIGYYASLVGINAYHQPGVEAGKKAAATILELQKRVVEVLQNETAA------LSVEEIA  485

Query  446  DRCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFL  321
             +  A + +E IYKI+ H+  N R ++ EGN G P S+KV L
Sbjct  486  AKAGASDQVEAIYKILRHLHTNQRGVVLEGNLGQPSSLKVSL  527



>ref|WP_045873392.1| glucose-6-phosphate isomerase [Tolypothrix sp. PCC 7601]
 gb|EKE98493.1| glucose-6-phosphate isomerase [Tolypothrix sp. PCC 7601]
Length=528

 Score =   283 bits (725),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/219 (66%), Positives = 166/219 (76%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFF T IEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATLIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR      E++PGVT GDYL G L GTR ALY N R+SITVT+ +V  R+VGAL+ALYE
Sbjct  373  EDRKSPSP-EIDPGVTSGDYLSGFLLGTRQALYENQRDSITVTIPQVNARTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA  +L LQKRVL VL           LTL+EIA+
Sbjct  432  RAVGLYASLVNINAYHQPGVEAGKKAAAAILDLQKRVLEVLQSTKSA-----LTLDEIAE  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A ++IE IYKI+ H+ AN R ++ +GN   P S+KV
Sbjct  487  KAGASQEIESIYKILRHLQANQRGVVFQGNLAQPSSLKV  525



>ref|WP_015183178.1| glucose-6-phosphate isomerase [Microcoleus sp. PCC 7113]
 gb|AFZ19035.1| glucose-6-phosphate isomerase [Microcoleus sp. PCC 7113]
Length=528

 Score =   283 bits (724),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/219 (66%), Positives = 169/219 (77%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DL+GN V+QGI VYGNKGSTDQHA++QQLREGV NFFVTFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLEGNVVHQGIAVYGNKGSTDQHAYVQQLREGVANFFVTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+EPGVT GDYL G+LQGTR ALY N R+SITVT+ +V PR+VGAL+ALYE
Sbjct  373  EDRQ-GISPEVEPGVTSGDYLSGLLQGTRQALYENLRDSITVTIPQVNPRTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+Y  LVNINAYHQPGVEAGKKAA  VL LQK+V+ VL          PL+L E+A+
Sbjct  432  RAVGLYGFLVNINAYHQPGVEAGKKAAAAVLDLQKQVMQVLQAEGA-----PLSLSELAE  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +    E +E IY ++ H+ AN R ++ EGN G P S+KV
Sbjct  487  KIGTPERVESIYMLLRHLQANQRGVVLEGNPGQPSSLKV  525



>ref|WP_011613372.1| glucose-6-phosphate isomerase [Trichodesmium erythraeum]
 gb|ABG53042.1| glucose-6-phosphate isomerase [Trichodesmium erythraeum IMS101]
Length=528

 Score =   283 bits (724),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 168/219 (77%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  VNQGI VYGNKGSTDQHA++QQLR+GV NFFVT IEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGKVVNQGIAVYGNKGSTDQHAYVQQLRDGVLNFFVTLIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+EPGVT GDYL G +QGTR ALY NDR+SITVT+ +V P ++GAL+ALYE
Sbjct  373  EDRE-GTSPEVEPGVTSGDYLSGFIQGTRQALYENDRDSITVTIPKVNPYNLGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG Y SLVNINAYHQPGVEAGKKAA  VL LQ +V+ +L     K+   PL+LEE+++
Sbjct  432  RAVGFYGSLVNINAYHQPGVEAGKKAAAAVLELQHKVINIL-----KQEKSPLSLEELSE  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + IE IYKI+ H+AAN R ++  GN G P  + V
Sbjct  487  KAGAGDQIETIYKILRHLAANKRGIVFHGNVGQPDKLGV  525



>ref|WP_015203112.1| glucose-6-phosphate isomerase [Crinalium epipsammum]
 gb|AFZ12996.1| glucose-6-phosphate isomerase [Crinalium epipsammum PCC 9333]
Length=528

 Score =   283 bits (723),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 168/221 (76%), Gaps = 7/221 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFF+TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNIVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFMTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E++PGVT GDYL G LQGTR ALY   R+SITVT+ +V PR+VGAL+ALYE
Sbjct  373  EDRQ-GSSVEIDPGVTSGDYLSGFLQGTRQALYEKKRDSITVTIPQVNPRTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG Y  +VNINAYHQPGVEAGKKAA E+L LQK+V+ VL E +       L+L EIA+
Sbjct  432  RAVGFYGFMVNINAYHQPGVEAGKKAAAEILDLQKKVMEVLKENAS------LSLSEIAE  485

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFL  321
            +    + +E IYK++ H++ NDR +I +GN   P S+K  L
Sbjct  486  KAGQPDQVEAIYKLLRHLSNNDRGVILQGNLAQPSSLKASL  526



>ref|WP_016871330.1| MULTISPECIES: glucose-6-phosphate isomerase [Fischerella]
Length=501

 Score =   281 bits (719),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 142/222 (64%), Positives = 168/222 (76%), Gaps = 6/222 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE D  GN V+QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  285  SRYLQQLVMESLGKEKDKTGNIVHQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  344

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR      E+EPG+T GDYL G LQGTR ALY N R+S+TVT+ +V  R+VGAL+ALY+
Sbjct  345  EDRQ-NPSPEIEPGITSGDYLSGFLQGTRQALYENHRDSVTVTIPQVNSRTVGALIALYD  403

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASL+NINAYHQPGVEAGKKAA E+L LQK+V+ VL +        PLTLEE+A 
Sbjct  404  RAVGLYASLININAYHQPGVEAGKKAAAEILELQKQVVEVLRKEKT-----PLTLEEVAQ  458

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLG  318
            +  A E IE IY I+ H+ AN R +  +GN G P S+K  +G
Sbjct  459  KIGATEKIESIYLILRHLHANGRGITLQGNLGQPSSLKFSIG  500



>ref|WP_017653850.1| glucose-6-phosphate isomerase [Microchaete sp. PCC 7126]
Length=528

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/219 (66%), Positives = 165/219 (75%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  V QGI VYGNKGSTDQHA++QQLREGV NFF T IEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGKTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATLIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E++PGVT GDYL G LQGTR ALY N R+SITVT+ +V  R+VGAL+ALYE
Sbjct  373  EDRQ-GPSPEIDPGVTSGDYLSGFLQGTRQALYENQRDSITVTIPQVNARTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA  +L LQKRV+ VL           LTL EIA+
Sbjct  432  RAVGLYASLVNINAYHQPGVEAGKKAAAVILDLQKRVVEVLQTQKTA-----LTLAEIAE  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + IE IYKI+ H+ AN R ++ +GN   P S+KV
Sbjct  487  KASATDQIEAIYKILRHLHANQRGVVLQGNLAQPDSLKV  525



>ref|WP_015171468.1| glucose-6-phosphate isomerase [Geitlerinema sp. PCC 7407]
 gb|AFY65901.1| glucose-6-phosphate isomerase [Geitlerinema sp. PCC 7407]
Length=528

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 145/219 (66%), Positives = 169/219 (77%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG +V QGI VYGNKGSTDQHA++QQLREGV NFF+TFIEVL
Sbjct  313  SRYLQQLVMESLGKELDLDGKQVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFMTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDRP G   E+EP VT GDYL G+LQGTR ALY N R+SITVT+ EV  + VGAL+ALY+
Sbjct  373  RDRP-GAAVEVEPNVTSGDYLSGLLQGTRQALYENHRDSITVTIGEVDAQRVGALIALYD  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA  VL LQ++VL  +  A       PL+L E+A+
Sbjct  432  RAVGLYASLVNINAYHQPGVEAGKKAAAAVLDLQRQVLQAIQSAG-----RPLSLGELAE  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
               A + IE IY  + H+AANDR +  EG+ G P S+KV
Sbjct  487  SLGAGDRIESIYLTLRHLAANDRGIRLEGDPGQPASLKV  525



>ref|WP_009782694.1| glucose-6-phosphate isomerase [Lyngbya sp. PCC 8106]
 gb|EAW38719.1| glucose-6-phosphate isomerase [Lyngbya sp. PCC 8106]
Length=529

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 166/219 (76%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN VNQGI VYGNKGSTDQHA++QQLR+GV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNVVNQGIAVYGNKGSTDQHAYVQQLRDGVPNFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+EP VT GDYL G LQGTR ALY N R+SIT+T+ EVTPR VGAL+ALYE
Sbjct  373  QDRL-GPSPEVEPNVTAGDYLSGFLQGTRQALYENQRDSITITIPEVTPRHVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV +Y  LVNINAYHQPGVEAGKKAA  VL LQ+ +L VL           L+LE + +
Sbjct  432  RAVSLYGFLVNINAYHQPGVEAGKKAAATVLNLQQELLKVLKAEKAG-----LSLEALMN  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A E+IE  YKI+ H+AANDR ++ +GN   P S+KV
Sbjct  487  KAGASENIEQAYKILRHLAANDRGIVLQGNLAQPASLKV  525



>ref|WP_016860819.1| glucose-6-phosphate isomerase [Fischerella muscicola]
Length=529

 Score =   281 bits (719),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 168/222 (76%), Gaps = 6/222 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE D  GN V+QGI VYGNKGSTDQHA++QQLREGV NFF T IEVL
Sbjct  313  SRYLQQLVMESLGKEKDKTGNIVHQGIAVYGNKGSTDQHAYVQQLREGVPNFFATLIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR      E+EPG+T GDYL G LQGTR ALY   R+S+TVT+ +V  R+VGAL+ALYE
Sbjct  373  EDRQSPSP-EIEPGITSGDYLSGFLQGTREALYEKHRDSVTVTIPQVNSRTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASL+NINAYHQPGVEAGKKAA E+L LQK+V+AVL +        PLTLE+I+ 
Sbjct  432  RAVGLYASLININAYHQPGVEAGKKAAAEILELQKKVVAVLQQEKT-----PLTLEQISQ  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLG  318
            +  A + IE IY I+ H+ AN R ++ EGN G P S+K  +G
Sbjct  487  KVGATDKIESIYMILRHLHANSRGVVLEGNLGQPDSLKFSIG  528



>gb|EPF24002.1| Glucose-6-phosphate isomerase [Microcystis aeruginosa SPC777]
Length=229

 Score =   271 bits (693),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 161/219 (74%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  V QGI VYGNKGSTDQHA++QQLREG+ NFF TFIEVL
Sbjct  14   SRYLQQLVMESLGKEKDLDGKTVYQGIAVYGNKGSTDQHAYVQQLREGIPNFFATFIEVL  73

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+E G T GD+L G+LQGTR ALY N R SIT+T+ EVTPR VGAL+ALYE
Sbjct  74   KDRQ-GDSIEVETGSTAGDFLSGLLQGTRQALYENSRHSITITIPEVTPRQVGALIALYE  132

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV  YASLVNINAYHQPGVEAGKKAA  +L LQ++++ V+ E         L L  +A 
Sbjct  133  RAVSFYASLVNINAYHQPGVEAGKKAAASILDLQRKIVQVVRETGTS-----LDLATLAA  187

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + +E IYKI+ H+ AN R+L   G+   P ++++
Sbjct  188  KIGASDQVEAIYKIVRHLNANRRSLTITGDLSKPETIQI  226



>gb|EHC15954.1| Glucose-6-phosphate isomerase [Fischerella sp. JSC-11]
Length=529

 Score =   281 bits (718),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/222 (64%), Positives = 168/222 (76%), Gaps = 6/222 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE D  GN V+QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDKTGNIVHQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR      E+EPG+T GDYL G LQGTR ALY N R+S+TVT+ +V  R+VGAL+ALY+
Sbjct  373  EDRQ-NPSPEIEPGITSGDYLSGFLQGTRQALYENHRDSVTVTIPQVNSRTVGALIALYD  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASL+NINAYHQPGVEAGKKAA E+L LQK+V+ VL +        PLTLEE+A 
Sbjct  432  RAVGLYASLININAYHQPGVEAGKKAAAEILELQKQVVEVLRKEKT-----PLTLEEVAQ  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLG  318
            +  A E IE IY I+ H+ AN R +  +GN G P S+K  +G
Sbjct  487  KIGATEKIESIYLILRHLHANGRGITLQGNLGQPSSLKFSIG  528



>ref|WP_019507243.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=529

 Score =   281 bits (718),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 171/220 (78%), Gaps = 8/220 (4%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN VNQGI VYGNKGSTDQHA++QQLREGV+NFF+TFIEVL
Sbjct  313  SRYLQQLIMESLGKEKDLDGNVVNQGIAVYGNKGSTDQHAYVQQLREGVNNFFLTFIEVL  372

Query  803  RDRPPGHDW-ELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALY  627
             DR    D+ E+EPG+T GDYL G L GTR+AL    R+SIT+T+ +V  + VGAL+ALY
Sbjct  373  EDRT--RDFVEIEPGITSGDYLKGFLLGTRTALNDKQRDSITITIPKVNEQIVGALIALY  430

Query  626  ERAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIA  447
            ERAV IYASLVNINAYHQPGVEAGKKAA  VL LQK+V+  L + S      PL+LEE+A
Sbjct  431  ERAVSIYASLVNINAYHQPGVEAGKKAAASVLNLQKQVVEALKQTSS-----PLSLEELA  485

Query  446  DRCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            D+    E++E +YKI+ H+ AN R +I +G+ G P ++K+
Sbjct  486  DKAQVREEVETVYKIVRHLNANKRGVIIQGDIGKPDTMKI  525



>ref|WP_006634277.1| glucose-6-phosphate isomerase [Microcoleus vaginatus]
 gb|EGK86143.1| Glucose-6-phosphate isomerase [Microcoleus vaginatus FGP-2]
Length=530

 Score =   281 bits (718),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 168/217 (77%), Gaps = 6/217 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGK+ DLDGN V+QGI VYGNKG+TDQHA++QQLR+GV NFF+TFIEVL
Sbjct  313  SRYLQQLVMESLGKQEDLDGNTVHQGIAVYGNKGTTDQHAYVQQLRDGVPNFFLTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+E GVT GDYL G+LQGTR ALY N R+SITVT+ +V PR+VGAL+ALYE
Sbjct  373  QDRQ-GISPEVETGVTSGDYLSGLLQGTRQALYENHRDSITVTIPQVNPRTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG Y SLVN+NAYHQPGVEAGKKAA  VL LQ+RVL VL +A       PL++EE+A 
Sbjct  432  RAVGFYGSLVNVNAYHQPGVEAGKKAAAAVLDLQQRVLQVLKDAQT-----PLSIEELAK  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSV  333
            +    E IE IYK + H+AAN R +  EG  G P ++
Sbjct  487  KAGIPEQIETIYKTLRHLAANGRGVALEGKLGQPATL  523



>ref|WP_026087390.1| glucose-6-phosphate isomerase [Chlorogloeopsis fritschii]
Length=528

 Score =   280 bits (717),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/221 (65%), Positives = 168/221 (76%), Gaps = 6/221 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V+QGI VYGNKGSTDQHA++QQLREGV NFFVTFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNVVHQGIAVYGNKGSTDQHAYVQQLREGVANFFVTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR      E+E G+T GDYL G LQGTR ALY N R+SITVT+ +V  R+VGAL+ALY+
Sbjct  373  EDRKSPSP-EIEAGITSGDYLSGFLQGTRQALYENHRDSITVTIPQVNSRTVGALIALYD  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA  +L LQKRV+ VL  A       PL+LEEIA 
Sbjct  432  RAVGLYASLVNINAYHQPGVEAGKKAAAAILELQKRVVEVLQSAKT-----PLSLEEIAQ  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFL  321
            +    + IE IY I+ H+ AN R ++ +GN G   ++KV L
Sbjct  487  KSGCADQIESIYMIVRHLHANGRGVVLQGNLGQLDTLKVVL  527



>ref|WP_015193169.1| glucose-6-phosphate isomerase [Stanieria cyanosphaera]
 gb|AFZ35498.1| glucose-6-phosphate isomerase [Stanieria cyanosphaera PCC 7437]
Length=530

 Score =   280 bits (717),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 168/219 (77%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN VNQGI VYGNKGSTDQHA++QQLREGV+NFF+TFIEVL
Sbjct  313  SRYLQQLIMESLGKEKDLDGNIVNQGIAVYGNKGSTDQHAYVQQLREGVNNFFLTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR      E+EPG+T GDYL G L GTR ALY   R+SIT+T+ +V   +VGAL+ALYE
Sbjct  373  KDRN-APSVEIEPGITSGDYLIGFLLGTRQALYEKQRDSITITIPDVNETTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV +YASL+NINAYHQPGVEAGKKAA  +L+LQ+RV+ VL ++        L+L E+A 
Sbjct  432  RAVSLYASLININAYHQPGVEAGKKAAASILSLQERVVEVLQKSQ-----RALSLSELAT  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A E IE +YKI+ H+ AN R +I  GN G P S+K+
Sbjct  487  QAEAPEQIETVYKIVRHLYANQRGIILTGNLGQPSSLKI  525



>ref|WP_007358100.1| MULTISPECIES: glucose-6-phosphate isomerase [Kamptonema]
 emb|CBN58929.1| glucose-6-phosphate isomerase [ [[Oscillatoria] sp. PCC 6506]
Length=530

 Score =   280 bits (717),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 169/219 (77%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V+QGI VYGNKGSTDQHA++QQLR+GV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNIVHQGIAVYGNKGSTDQHAYVQQLRDGVPNFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E++PG+T GDYL G LQGTR ALY N R+SITVTV +V  R+VGAL+ALYE
Sbjct  373  EDRQ-GVSPEIDPGITSGDYLSGFLQGTRQALYENHRDSITVTVSQVNARTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+Y  LVN+NAYHQPGVEAGKKAA  VL LQ+RVLAVL     KE  +PL+LE +A 
Sbjct  432  RAVGLYGFLVNVNAYHQPGVEAGKKAAAVVLDLQQRVLAVL-----KEEGKPLSLEALAK  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  + + IE IYK + H+AAN R ++ +GN   P S+ V
Sbjct  487  KAGSPDQIETIYKSLRHLAANGRGVVLQGNLAQPGSIAV  525



>ref|WP_041036461.1| glucose-6-phosphate isomerase [Tolypothrix campylonemoides]
 gb|KIJ76049.1| glucose-6-phosphate isomerase [Tolypothrix campylonemoides VB511288]
Length=528

 Score =   280 bits (716),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 167/219 (76%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DL+GN V+QGI VYGNKGSTDQHA++QQLREGV NFFVTFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLEGNIVHQGIAVYGNKGSTDQHAYVQQLREGVANFFVTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+EPG+T GDYL G LQGTR ALY N R+SITVT+ +V  R+VGAL+ALY+
Sbjct  373  EDRN-GPSTEIEPGITAGDYLSGFLQGTRQALYENLRDSITVTIPQVNARTVGALIALYD  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG Y +LVNINAYHQPGVEAGKKAA  +L LQKRV+ VL           L++EE+A 
Sbjct  432  RAVGFYGNLVNINAYHQPGVEAGKKAAAAILELQKRVVDVLQTEKTA-----LSIEEVAQ  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + IE IYKI+ H+ AN R ++ EGN   P S+KV
Sbjct  487  KAGATDQIEPIYKILRHLHANQRGIVLEGNLAQPSSLKV  525



>ref|WP_027841326.1| glucose-6-phosphate isomerase [Mastigocoleus testarum]
Length=528

 Score =   280 bits (715),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 166/221 (75%), Gaps = 6/221 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN  +QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNIAHQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+E G+T GDYL G LQGTR ALY N R+SI VT+ +V P +VGAL+ALYE
Sbjct  373  EDRK-GTSVEVEAGITSGDYLSGFLQGTRQALYENQRDSIVVTIPQVNPLTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG YASLVNINAYHQPGVEAGKKAA  VL LQK+V+ +L   S      PL+LEE+A 
Sbjct  432  RAVGFYASLVNINAYHQPGVEAGKKAAAAVLELQKKVVEILQAQS-----NPLSLEELAQ  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFL  321
            + +  + +E IY I+ H+ AN R ++ EGN   P S+KV L
Sbjct  487  KANESDKVESIYAILRHLHANGRGVVLEGNFAQPNSLKVSL  527



>ref|WP_035984938.1| glucose-6-phosphate isomerase [Leptolyngbya sp. KIOST-1]
Length=529

 Score =   280 bits (715),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 169/221 (76%), Gaps = 6/221 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV +FFVTFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNLVYQGIAVYGNKGSTDQHAYVQQLREGVASFFVTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+EPG T GD+LFG LQGTR ALY N R+SIT+T+ EV   +VGAL+ALYE
Sbjct  373  KDRA-GDSVEMEPGATSGDFLFGFLQGTRKALYENQRQSITLTIPEVNAHTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG YASLVNINAYHQPGVEAGK+AA  VL LQ+ +++ L ++      +PL+L ++A 
Sbjct  432  RAVGFYASLVNINAYHQPGVEAGKQAAAGVLDLQQAIVSTLAQSD-----QPLSLSDLAT  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFL  321
            R  A + IE IY I  H+ AN R+L+  GN G P ++K+ L
Sbjct  487  RAGAPDQIETIYAIARHLHANQRSLVIHGNPGHPEAIKIAL  527



>ref|WP_026730901.1| glucose-6-phosphate isomerase [Fischerella sp. PCC 9605]
Length=528

 Score =   280 bits (715),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 165/218 (76%), Gaps = 6/218 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DL+GN V+QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLEGNIVHQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR      E+EPG+T GDYL G LQGTR ALY N R SITVT+ +V  R+VGAL+ALYE
Sbjct  373  EDRKSPSP-EIEPGITSGDYLSGFLQGTRQALYENHRYSITVTIPQVNSRTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASL+NINAYHQPGVEAGKKAA  +L LQK+V+ VL          PLTLEEIA 
Sbjct  432  RAVGLYASLININAYHQPGVEAGKKAAAAILDLQKQVVEVLQTEKA-----PLTLEEIAQ  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVK  330
            +  A + IE IY I+ H+ AN R ++ +GN   P S+K
Sbjct  487  KAGATDRIESIYIILRHLQANQRGVVLQGNLAQPSSLK  524



>ref|WP_008232649.1| Glucose-6-phosphate isomerase [Richelia intracellularis]
 emb|CCH66800.1| Glucose-6-phosphate isomerase [Richelia intracellularis HH01]
Length=529

 Score =   279 bits (714),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 169/219 (77%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFF T +EVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNTVCQGIAVYGNKGSTDQHAYVQQLREGVPNFFATIVEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+EPG+T GDYL G LQGTR ALY N+R+SIT+T+ +V+PR+VGAL+ALYE
Sbjct  373  EDRC-GKSMEVEPGITSGDYLSGFLQGTRQALYENNRDSITLTIAQVSPRTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YA+LVNINAYHQPGVEAGKKAA  +L LQ  ++ VL     KE V P++LE +A 
Sbjct  432  RAVGLYANLVNINAYHQPGVEAGKKAAAAILELQSSIMKVLE----KEKV-PISLELLAQ  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +    E IE +Y I+ H+ AN R ++ EGN G P S+KV
Sbjct  487  KVGMPEKIESMYMIVRHLHANQRGVVLEGNLGKPSSLKV  525



>ref|WP_015146974.1| glucose-6-phosphate isomerase [Oscillatoria acuminata]
 gb|AFY80324.1| glucose-6-phosphate isomerase [Oscillatoria acuminata PCC 6304]
Length=528

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 168/219 (77%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DL GN V QGI VYGNKGSTDQHA++QQLREGV NFF+TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLAGNTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFLTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  GH  ++EPG+T GDYL G L GTR A+Y N R+SI+VT+ +V PR VGAL+ALY+
Sbjct  373  EDRQ-GHSPDVEPGITTGDYLLGFLYGTREAVYDNQRDSISVTIPQVNPRIVGALIALYD  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASL+N+NAYHQPGVEAGKKAA E+L LQ R++ V+         +PL+LEE+A+
Sbjct  432  RAVGLYASLINVNAYHQPGVEAGKKAASEILNLQTRIMEVIAAEG-----KPLSLEELAE  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + IEMIYKI+ H+ AN R +   GN   P S+ V
Sbjct  487  KADAGDRIEMIYKILRHLHANGRQVTLSGNLAQPASLSV  525



>ref|WP_008228780.1| Glucose-6-phosphate isomerase [Richelia intracellularis]
 emb|CCH65447.1| Glucose-6-phosphate isomerase [Richelia intracellularis HM01]
Length=529

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/219 (64%), Positives = 169/219 (77%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFF T +EVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNTVCQGIAVYGNKGSTDQHAYVQQLREGVPNFFATIVEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+EPG+T GDYL G LQGTR ALY N+R+SIT+T+ +V+PR+VGAL+ALYE
Sbjct  373  EDRC-GKSMEVEPGITSGDYLSGFLQGTRQALYENNRDSITLTIAQVSPRTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YA+LVNINAYHQPGVEAGKKAA  +L LQ  ++ VL     KE + P++LE +A 
Sbjct  432  RAVGLYANLVNINAYHQPGVEAGKKAAAAILELQASIMEVLE----KEKI-PISLELLAQ  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +    E IE +Y I+ H+ AN R ++ EGN G P S+KV
Sbjct  487  KVGMPEKIESMYMIVRHLHANQRGVVLEGNLGKPSSLKV  525



>ref|WP_017746118.1| glucose-6-phosphate isomerase [Scytonema hofmanni]
Length=528

 Score =   278 bits (711),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 144/222 (65%), Positives = 170/222 (77%), Gaps = 8/222 (4%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DL+GN V+QGI VYGNKGSTDQHA++QQLR+GV NFFVTFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLEGNIVHQGIAVYGNKGSTDQHAYVQQLRDGVPNFFVTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   ELEPG+T GDYL G LQGTR AL+ N R+SIT+T+ +V  R+VGAL+ALY+
Sbjct  373  EDRK-GSSPELEPGITAGDYLSGFLQGTRQALHENQRDSITITIPQVNARTVGALIALYD  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVL-NEASCKEPVEPLTLEEIA  447
            RAVG YASLV INAYHQPGVEAGKKAA  +L LQKRV+ VL NE +       L++EEIA
Sbjct  432  RAVGYYASLVGINAYHQPGVEAGKKAAATILELQKRVVEVLQNEKAA------LSVEEIA  485

Query  446  DRCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFL  321
                A + +E IYKI+ H+  N R ++ EGN G P S+KV L
Sbjct  486  RLAGASDQVEAIYKILRHLHMNQRGVVLEGNLGEPSSLKVSL  527



>dbj|BAQ65381.1| glucose-6-phosphate isomerase [Geminocystis sp. NIES-3709]
Length=536

 Score =   278 bits (712),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 144/219 (66%), Positives = 165/219 (75%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  V QGI VYGNKGSTDQHA++QQLREG+ NFFVTFIEVL
Sbjct  320  SRYLQQLVMESLGKEKDLDGKTVYQGIAVYGNKGSTDQHAYVQQLREGIANFFVTFIEVL  379

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   ELE  +T GDYL G+LQGTR ALY N R+SITVTV EVTPR VGAL+ALYE
Sbjct  380  KDRE-GKSLELEMDITSGDYLSGLLQGTRKALYDNGRDSITVTVSEVTPRIVGALIALYE  438

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV IYA LVNINAYHQPGVEAGKKAA  +L+LQ  VL +L     K   + L++ EIA 
Sbjct  439  RAVSIYAYLVNINAYHQPGVEAGKKAAASILSLQTEVLNLL-----KNTDKSLSIAEIAT  493

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
                 EDIE IYKI+ H+ ANDR ++  G+   P ++KV
Sbjct  494  NTGKSEDIESIYKILRHLEANDRGVVLTGDRKLPNTLKV  532



>ref|WP_023067352.1| phosphoglucose isomerase family protein [Lyngbya aestuarii]
 gb|ERT06382.1| phosphoglucose isomerase family protein [Lyngbya aestuarii BL 
J]
Length=529

 Score =   278 bits (711),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 166/219 (76%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN VNQGI VYGNKGSTDQHA++QQLR+GV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNVVNQGIAVYGNKGSTDQHAYVQQLRDGVPNFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+EP VT GDYL G LQGTR ALY N R+SIT+T+ EVTPR VGAL+ALYE
Sbjct  373  QDRL-GPSPEVEPNVTAGDYLSGFLQGTRQALYENQRDSITITIPEVTPRHVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV +Y  LVNINAYHQPGVEAGKKAA  VL LQ+ +L VL     K     L+LE + +
Sbjct  432  RAVSLYGFLVNINAYHQPGVEAGKKAAATVLNLQQDLLKVL-----KAERTALSLEALVN  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A E++E  YKI+ H+AANDR ++ +GN   P S+ +
Sbjct  487  KAGASENVEQAYKILRHLAANDRGVVLQGNLAQPASLTI  525



>ref|WP_015156915.1| glucose-6-phosphate isomerase [Chroococcidiopsis thermalis]
 gb|AFY90377.1| glucose-6-phosphate isomerase [Chroococcidiopsis thermalis PCC 
7203]
Length=528

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 165/221 (75%), Gaps = 6/221 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V+QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNIVHQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   +++PG T GDYL G LQGTR ALY   R+SIT+T+ +V P +VGAL+ALYE
Sbjct  373  EDRS-GSSPDIDPGATAGDYLSGFLQGTRQALYEKQRDSITITIPQVNPHTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG Y SLVNINAYHQPGVEAGKKAA  VL LQK+VL VL EA       PL+L +IA+
Sbjct  432  RAVGFYGSLVNINAYHQPGVEAGKKAAAVVLDLQKQVLQVLQEAKT-----PLSLAQIAE  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFL  321
            +  A + IE IYKI+ H+ AN R +  +G+   P S+   L
Sbjct  487  KAAATDQIEAIYKILRHLQANRRGVAMQGDPAHPESLTFSL  527



>ref|WP_013324389.1| glucose-6-phosphate isomerase [Cyanothece sp. PCC 7822]
 gb|ADN16326.1| phosphoglucose isomerase (PGI) [Cyanothece sp. PCC 7822]
Length=526

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/222 (63%), Positives = 169/222 (76%), Gaps = 6/222 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V+QGI VYGNKGSTDQHA++QQLR+GV NFFVTFIEVL
Sbjct  311  SRYLQQLVMESLGKEKDLDGNIVHQGIAVYGNKGSTDQHAYVQQLRDGVPNFFVTFIEVL  370

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   +LEPGVT GDYL G +QGTR ALY N+R+SIT+T+ +V PR+VGAL+ALYE
Sbjct  371  EDRQ-GPSIDLEPGVTSGDYLSGFIQGTRQALYENNRDSITITIPQVNPRTVGALIALYE  429

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV  Y  LVNINAYHQPGVEAGKKAA  +L LQ+ V+ VL +A        L L  +A+
Sbjct  430  RAVTYYGFLVNINAYHQPGVEAGKKAAASILELQQGVVNVLKDAGTG-----LDLTTLAE  484

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLG  318
            +    E +E +YKI+ H+AAN+R ++  G+ G P S+KV LG
Sbjct  485  KAGHPESVEAVYKIVRHLAANNRGVVLTGDFGKPASLKVSLG  526



>ref|WP_039713129.1| glucose-6-phosphate isomerase [Scytonema millei]
 gb|KIF20777.1| glucose-6-phosphate isomerase [Scytonema millei VB511283]
Length=528

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 163/217 (75%), Gaps = 6/217 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V+QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNIVHQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E++PG T GDYL G LQGTR ALY   R+SIT+T+ +V P +VGAL+ALYE
Sbjct  373  EDRS-GSSPEIDPGATAGDYLSGFLQGTRQALYEKQRDSITITIPQVNPHTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG Y SLVNINAYHQPGVEAGKKAA  VL LQK+VL VL EA       PL L +IA+
Sbjct  432  RAVGFYGSLVNINAYHQPGVEAGKKAAAVVLDLQKQVLQVLQEAKT-----PLPLAQIAE  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSV  333
            +  A + IE IYKI+ H+ AN R +  +G+   P S+
Sbjct  487  KAAATDQIEAIYKILRHLQANRRGVTMQGDPAHPDSL  523



>ref|WP_026102112.1| glucose-6-phosphate isomerase [Geminocystis herdmanii]
Length=531

 Score =   277 bits (709),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 168/220 (76%), Gaps = 6/220 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DL+GN V QGI VYGNKGSTDQHA++QQLREG+ NFF TFIEVL
Sbjct  315  SRYLQQLVMESLGKEKDLNGNTVYQGIAVYGNKGSTDQHAYVQQLREGIPNFFATFIEVL  374

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   ELE  +T GDYL G+LQGTR ALY N R+SITVTV EVTP+ VGAL+ALYE
Sbjct  375  KDRE-GKSLELETNITSGDYLSGLLQGTRKALYDNGRDSITVTVNEVTPKIVGALIALYE  433

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV IYA LVNINAYHQPGVEAGKKAA  +L+LQ  +L +L + S       LT+ EI  
Sbjct  434  RAVSIYAYLVNINAYHQPGVEAGKKAAASILSLQTEILTLLEKTS-----NSLTIAEITS  488

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVF  324
            +    +DIE IYKI+ H++ANDR ++ +G+  SP +++V 
Sbjct  489  QLGKNDDIESIYKILRHLSANDRGVMLKGDRISPNTLQVI  528



>ref|WP_015178388.1| glucose-6-phosphate isomerase [Oscillatoria nigro-viridis]
 gb|AFZ09156.1| glucose-6-phosphate isomerase [Oscillatoria nigro-viridis PCC 
7112]
Length=530

 Score =   277 bits (708),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 167/217 (77%), Gaps = 6/217 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V+QGI VYGNKG+TDQHA++QQLR+GV NFF+TFIEVL
Sbjct  313  SRYLQQLVMESLGKEQDLDGNTVHQGIAVYGNKGTTDQHAYVQQLRDGVPNFFLTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+E GVT GDYL G+LQGTR ALY N R+SITVT+ +V P +VGAL+ALYE
Sbjct  373  QDRQ-GISPEVETGVTSGDYLSGLLQGTRQALYENHRDSITVTIPQVNPETVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG Y SLVN+NAYHQPGVEAGKKAA  VL LQ+RVL VL +A      +PL++ E+A 
Sbjct  432  RAVGFYGSLVNVNAYHQPGVEAGKKAAAAVLDLQQRVLQVLKDAQ-----KPLSVAELAK  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSV  333
            +    E IE IYK + H+AAN R +  EG  G P ++
Sbjct  487  KAGRPEQIETIYKTLRHLAANGRGVALEGKLGQPATL  523



>ref|WP_010995224.1| glucose-6-phosphate isomerase [Nostoc sp. PCC 7120]
 sp|Q8YY05.1|G6PI_NOSS1 RecName: Full=Glucose-6-phosphate isomerase; Short=GPI; AltName: 
Full=Phosphoglucose isomerase; Short=PGI; AltName: Full=Phosphohexose 
isomerase; Short=PHI [Nostoc sp. PCC 7120]
 dbj|BAB73007.1| glucose-6-phosphate isomerase [Nostoc sp. PCC 7120]
Length=528

 Score =   277 bits (708),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 167/221 (76%), Gaps = 6/221 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFF T IEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATLIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E++PGVT GDYL G L GTR ALY N R+SITVT+ +V  R+VGALVALYE
Sbjct  373  EDRH-GASPEIDPGVTSGDYLSGFLLGTRQALYENQRDSITVTIPQVNARTVGALVALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            R VG+YASLVNINAYHQPGVEAGKKAA  +L LQ +V+ +L +         L+LE+IA+
Sbjct  432  RTVGLYASLVNINAYHQPGVEAGKKAAAVILDLQTKVVGLLQKEKTA-----LSLEQIAE  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFL  321
            +  A + +E IYKI+ H+ AN R ++ +GN G P S+K+ L
Sbjct  487  KIGAADQVEAIYKILRHLQANQRGVVFQGNLGQPSSLKISL  527



>ref|WP_017298730.1| hypothetical protein [Nodosilinea nodulosa]
Length=528

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 166/219 (76%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV +FFVTFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNLVYQGIAVYGNKGSTDQHAYVQQLREGVASFFVTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+EPG T GD+LFG LQGTR ALY N R SIT+T+ EV   +VGAL+ALYE
Sbjct  373  KDRE-GDSVEMEPGATSGDFLFGFLQGTRKALYENRRGSITLTLPEVNAHTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG YASLVNINAYHQPGVEAGK+AA  VL LQ  V+  L +++     EPL+L E+A 
Sbjct  432  RAVGFYASLVNINAYHQPGVEAGKQAAAGVLELQHAVVNALAQSA-----EPLSLSELAA  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            R  A + +E IY I  H+ AN R+L+  GN G P ++K+
Sbjct  487  RAGAPDQVETIYAIARHLHANQRSLVIHGNPGHPEAIKI  525



>ref|WP_024544497.1| glucose-6-phosphate isomerase [Synechococcus sp. NKBG15041c]
Length=528

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 169/219 (77%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN+V QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  313  SRYLQQLIMESLGKEEDLDGNKVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G+  ++E G T GD+L G L GTR ALY N R+SIT+TV +V  R+VGAL+ALYE
Sbjct  373  GDRQ-GNSIDIENGATSGDFLSGFLLGTREALYDNGRDSITITVPDVDARTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV IYASLVNINAYHQPGVEAGKKAA  VL LQK+   V+N  +  E   PLTL+ +A 
Sbjct  432  RAVTIYASLVNINAYHQPGVEAGKKAAASVLDLQKK---VVNAVTTSE--SPLTLDSLAI  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A+E IE+IYKI+ H++AN RAL  EGN   P ++K+
Sbjct  487  KVGAVEQIEVIYKIVRHLSANGRALKLEGNPAQPSALKI  525



>ref|WP_045054403.1| glucose-6-phosphate isomerase [Chroococcales cyanobacterium CENA595]
 gb|KJH71934.1| glucose-6-phosphate isomerase [Chroococcales cyanobacterium CENA595]
Length=528

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/219 (64%), Positives = 170/219 (78%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  V QGI VYGNKGSTDQHA++QQLREGV NFF+TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGKTVYQGIAVYGNKGSTDQHAYVQQLREGVANFFMTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+EPGVTCGDYL G+LQGTR ALY N R+SITVT+ +V PR+VGAL+ALYE
Sbjct  373  EDRQ-GASPEVEPGVTCGDYLSGLLQGTRLALYENHRDSITVTIPQVNPRTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+Y  LVN+NAYHQPGVEAGKKAA  +L LQ++V  VL   S     +PL+L ++A+
Sbjct  432  RAVGLYGFLVNVNAYHQPGVEAGKKAAAVILDLQRQVCQVLANES-----KPLSLTQLAE  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + IE IYKI+ H+ AN R++  +GN G   S+++
Sbjct  487  KVGASDRIEAIYKIVRHLYANGRSVKLQGNLGDLNSLQI  525



>ref|WP_002766618.1| glucose-6-phosphate isomerase [Microcystis aeruginosa]
 emb|CCI01362.1| Glucose-6-phosphate isomerase [Microcystis aeruginosa PCC 9443]
Length=528

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/223 (63%), Positives = 169/223 (76%), Gaps = 6/223 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  V QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  312  SRYLQQLVMESLGKEKDLDGKTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  371

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+EP  T GD+L G LQGTR ALY N R+SITVT+ +V PR+VGAL+ALYE
Sbjct  372  EDRK-GTSIEVEPEATTGDFLSGFLQGTREALYENHRDSITVTIPQVNPRTVGALIALYE  430

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVN+NAYHQPGVEAGKKAA  VL LQ+++LAVL  AS     EP+ L  +A+
Sbjct  431  RAVGLYASLVNVNAYHQPGVEAGKKAAASVLNLQRQLLAVLKLAS-----EPMPLTTLAE  485

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGE  315
            +  A + +E +YKI+ H+AAN R +  +G+   P ++ V L +
Sbjct  486  KAGAADQLETVYKILRHLAANHRGITLQGDRAKPSNLLVSLDQ  528



>ref|WP_030007267.1| glucose-6-phosphate isomerase [Synechococcus sp. NKBG042902]
Length=528

 Score =   276 bits (706),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 167/219 (76%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN+V QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  313  SRYLQQLIMESLGKEEDLDGNKVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   ++E G T GD+L G L GTR ALY N R+SIT+TV +V  R+VGAL+ALYE
Sbjct  373  GDRQ-GDSIDIENGATSGDFLSGFLLGTREALYDNGRDSITITVPDVDARTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV IYASLVNINAYHQPGVEAGKKAA  VL LQK+V+  +  +       PLTL+ +A 
Sbjct  432  RAVTIYASLVNINAYHQPGVEAGKKAAASVLDLQKKVVDAVTTSES-----PLTLDSLAI  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A+E IE+IYKI+ H+AAN RAL  EGN   P ++K+
Sbjct  487  KVGAVEQIEVIYKIVRHLAANGRALKLEGNPAQPSALKI  525



>dbj|BAQ60104.1| glucose-6-phosphate isomerase [Geminocystis sp. NIES-3708]
Length=530

 Score =   276 bits (706),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 166/219 (76%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLD N V QGI VYGNKGSTDQHA++QQLREG+ NFFVTFIEVL
Sbjct  315  SRYLQQLVMESLGKEKDLDDNTVYQGIAVYGNKGSTDQHAYVQQLREGIANFFVTFIEVL  374

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   ELE  VT GDYL G+LQGTR ALY N R+SITVT+ EVTP+ VGAL+ALYE
Sbjct  375  KDRE-GKSLELETDVTSGDYLSGLLQGTRKALYENGRDSITVTINEVTPKIVGALIALYE  433

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV IYA LVNINAYHQPGVEAGKKAA  +L+LQ  VL +      K   E  T+ +IA 
Sbjct  434  RAVSIYAYLVNINAYHQPGVEAGKKAAASILSLQTEVLNL-----VKNSNESFTISDIAT  488

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +    E+IE IYKI+ H++AN+R +I +G+  S  S++V
Sbjct  489  KLDKSEEIEAIYKILRHLSANNRGIILKGDHTSLDSLQV  527



>ref|WP_006519785.1| glucose-6-phosphate isomerase [Leptolyngbya sp. PCC 7375]
 gb|EKU98642.1| glucose-6-phosphate isomerase [Leptolyngbya sp. PCC 7375]
Length=528

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/220 (63%), Positives = 168/220 (76%), Gaps = 6/220 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN+V QGI VYGNKGSTDQHA++QQLREGV+NFFVT IEVL
Sbjct  313  SRYLQQLIMESLGKETDLDGNKVFQGIAVYGNKGSTDQHAYVQQLREGVNNFFVTLIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E++PGVT GDYL G LQGTR AL+ N R+SIT+T+ EVTP  VG+L+ALYE
Sbjct  373  TDRE-GSSTEIDPGVTAGDYLSGFLQGTRKALFENKRQSITITIPEVTPVIVGSLIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV +YA++VNINAYHQPGVEAGKKAA  +L LQ  V+ VL++         LTL E+AD
Sbjct  432  RAVSLYAAVVNINAYHQPGVEAGKKAAASILNLQNMVVDVLSKTGGS-----LTLAEVAD  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVF  324
            +    + IE IYKII H+ AN R +  +GN G+P +++V 
Sbjct  487  KVGRPDAIEDIYKIIRHLDANGRMVAIDGNAGNPGTMRVM  526



>ref|WP_009633959.1| glucose-6-phosphate isomerase [Synechocystis sp. PCC 7509]
Length=528

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 168/219 (77%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGK+ DLD   VNQGI VYGNKGSTDQHA++QQLREG+ NFF+TF+EVL
Sbjct  313  SRYLQQLVMESLGKQKDLDNQTVNQGIAVYGNKGSTDQHAYVQQLREGIANFFMTFVEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+EPGVT GDYL G+LQGTR ALY N R+SITVT+ ++ PR VGAL+ALYE
Sbjct  373  EDRL-GPSSEVEPGVTSGDYLSGLLQGTRQALYENQRDSITVTISQLNPRMVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+Y  L+N+NAYHQPGVEAGKKAA  VL LQ+++  V+ +        PL+L E+A+
Sbjct  432  RAVGLYGFLINVNAYHQPGVEAGKKAAAAVLDLQRKICQVIEQEKT-----PLSLMELAE  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +   ++ +E+IYKI+ H+  N R ++ +GN G P S+K+
Sbjct  487  KAGEVDQVEVIYKILRHLHTNKRDIVLQGNLGEPNSLKI  525



>ref|WP_002788681.1| glucose-6-phosphate isomerase [Microcystis aeruginosa]
 emb|CCI18652.1| Glucose-6-phosphate isomerase [Microcystis aeruginosa PCC 9807]
Length=528

 Score =   276 bits (705),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 140/223 (63%), Positives = 168/223 (75%), Gaps = 6/223 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  V QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  312  SRYLQQLVMESLGKEKDLDGKTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  371

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+EP  T GD+L G LQGTR ALY N R+SITVT+ +V PR+VGAL+ALYE
Sbjct  372  EDRK-GTSIEVEPEATTGDFLSGFLQGTREALYENHRDSITVTIPQVNPRTVGALIALYE  430

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVN+NAYHQPGVEAGKKAA  VL LQ+++LAVL  AS     EP+ L  +A+
Sbjct  431  RAVGLYASLVNVNAYHQPGVEAGKKAAASVLNLQRQLLAVLKLAS-----EPMPLTTLAE  485

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGE  315
            +  A + +E +YKI+ H+AAN R +  +G+   P  + V L +
Sbjct  486  KAGAADQLETVYKILRHLAANHRGITLQGDRAKPSRLLVSLDQ  528



>emb|CCE20320.1| Glucose-6-phosphate isomerase [Arthrospira sp. PCC 8005]
 emb|CDM92770.1| Glucose-6-phosphate isomerase [Arthrospira sp. PCC 8005]
Length=528

 Score =   275 bits (704),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 164/214 (77%), Gaps = 6/214 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN VNQGI+VYGNKGSTDQHA++QQLR+GV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNIVNQGISVYGNKGSTDQHAYVQQLRDGVPNFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDR  G   E+EPGVT GDYL G LQGTR ALY N R+SITVT+ EV P +VGALVALYE
Sbjct  373  RDRQ-GQSPEIEPGVTAGDYLSGFLQGTREALYDNQRDSITVTITEVNPYTVGALVALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV +YASLVNINAYHQPGVEAGKKAA +VL LQ + L  L   S     + +++ ++A 
Sbjct  432  RAVSLYASLVNINAYHQPGVEAGKKAAAQVLELQHQSLQALRSHS-----QGISISDLAT  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSP  342
            +  A E +E +YKI+ H+AANDR +   G+   P
Sbjct  487  KIDAQEQVETLYKILRHLAANDRGVELSGDPSKP  520



>ref|WP_010872791.1| glucose-6-phosphate isomerase [Synechocystis sp. PCC 6803]
 sp|P52983.1|G6PI_SYNY3 RecName: Full=Glucose-6-phosphate isomerase; Short=GPI; AltName: 
Full=Phosphoglucose isomerase; Short=PGI; AltName: Full=Phosphohexose 
isomerase; Short=PHI [Synechocystis sp. PCC 6803 
substr. Kazusa]
 dbj|BAA02920.1| glucose-6-phosphate isomerase [Synechocystis sp. PCC 6803]
 dbj|BAA18168.1| glucose-6-phosphate isomerase [Synechocystis sp. PCC 6803]
 dbj|BAK50341.1| glucose-6-phosphate isomerase [Synechocystis sp. PCC 6803]
 dbj|BAL29340.1| glucose-6-phosphate isomerase [Synechocystis sp. PCC 6803 substr. 
GT-I]
 dbj|BAL32509.1| glucose-6-phosphate isomerase [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 dbj|BAL35678.1| glucose-6-phosphate isomerase [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 dbj|BAM51919.1| glucose-6-phosphate isomerase [Synechocystis sp. PCC 6803] [Synechocystis 
sp. PCC 6803]
 gb|AGF51856.1| glucose-6-phosphate isomerase [Synechocystis sp. PCC 6803]
Length=531

 Score =   275 bits (704),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 164/219 (75%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V+QGI VYGNKGSTDQHA++QQLR+GV NFF TFIEVL
Sbjct  315  SRYLQQLVMESLGKERDLDGNVVHQGIAVYGNKGSTDQHAYVQQLRDGVPNFFATFIEVL  374

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   ELEPGVT GDYL G LQGTR AL+ N R+SITVT+ EV   SVGAL+ALYE
Sbjct  375  HDRQ-GPSLELEPGVTSGDYLSGFLQGTRQALFENQRDSITVTIPEVDATSVGALIALYE  433

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV  Y SLVN+NAYHQPGVEAGKKAA  +L LQK +L+ L   S      P+ LE +A 
Sbjct  434  RAVSFYGSLVNVNAYHQPGVEAGKKAAASILELQKAILSTLQNESG-----PIALEALAT  488

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A E +E +YKI+ H+AANDR +  +G+   P+ +++
Sbjct  489  KVQAPEQVETVYKIVRHLAANDRGVTLQGDRQFPQRLQI  527



>ref|WP_006621857.1| glucose-6-phosphate isomerase [Arthrospira platensis]
 gb|EKD10044.1| glucose-6-phosphate isomerase [Arthrospira platensis C1]
Length=528

 Score =   275 bits (703),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 164/214 (77%), Gaps = 6/214 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN VNQGI+VYGNKGSTDQHA++QQLR+GV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNIVNQGISVYGNKGSTDQHAYVQQLRDGVPNFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDR  G   E+EPGVT GDYL G LQGTR ALY N R+SITVT+ EV P +VGALVALYE
Sbjct  373  RDRQ-GPSSEIEPGVTAGDYLSGFLQGTREALYDNQRDSITVTITEVNPYTVGALVALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV +YASLVNINAYHQPGVEAGKKAA +VL LQ + L  L   S     + +++ ++A 
Sbjct  432  RAVSLYASLVNINAYHQPGVEAGKKAAAQVLELQHQSLQALRSHS-----QGISISDLAT  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSP  342
            +  A E +E +YKI+ H+AANDR +   G+   P
Sbjct  487  KIDAQEQVETLYKILRHLAANDRGVELSGDPSKP  520



>ref|WP_035153545.1| glucose-6-phosphate isomerase [Calothrix sp. 336/3]
 gb|KFB83699.1| glucose-6-phosphate isomerase [Calothrix sp. 336/3]
Length=528

 Score =   275 bits (703),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 139/222 (63%), Positives = 166/222 (75%), Gaps = 6/222 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFF T IEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATLIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR      E+EPG+T GDYL G LQGTR ALY N R+SIT+T+ +V PR+VGAL+ALY+
Sbjct  373  EDRK-NPSPEIEPGITAGDYLSGFLQGTRQALYENHRDSITLTIPQVNPRTVGALIALYD  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA E+L LQ +V+  L++         L+LE+IA 
Sbjct  432  RAVGLYASLVNINAYHQPGVEAGKKAAAEILDLQTQVVEALHKEKTA-----LSLEQIAQ  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLG  318
            +    E +E IY I+ H++AN R ++  GN   P S+ V LG
Sbjct  487  KIGKPEQVEAIYIILRHLSANQRGIVFHGNPSVPSSLTVALG  528



>ref|WP_006668847.1| glucose-6-phosphate isomerase [Arthrospira maxima]
 gb|EDZ95446.1| Glucose-6-phosphate isomerase [Arthrospira maxima CS-328]
Length=528

 Score =   275 bits (703),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 164/214 (77%), Gaps = 6/214 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN VNQGI+VYGNKGSTDQHA++QQLR+GV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNIVNQGISVYGNKGSTDQHAYVQQLRDGVPNFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDR  G   E+EPGVT GDYL G LQGTR ALY N R+SITVT+ EV P +VGALVALYE
Sbjct  373  RDRQ-GPSSEIEPGVTAGDYLSGFLQGTREALYDNQRDSITVTITEVNPYTVGALVALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV +YASLVNINAYHQPGVEAGKKAA +VL LQ + L  L   S     + +++ ++A 
Sbjct  432  RAVSLYASLVNINAYHQPGVEAGKKAAAQVLELQHQSLQALRSHS-----QGISISDLAT  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSP  342
            +  A E +E +YKI+ H+AANDR +   G+   P
Sbjct  487  KIDAQEQVETLYKILRHLAANDRGVELSGDPSKP  520



>ref|WP_015111823.1| glucose-6-phosphate isomerase [Nostoc sp. PCC 7107]
 gb|AFY41585.1| glucose-6-phosphate isomerase [Nostoc sp. PCC 7107]
Length=528

 Score =   275 bits (703),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 165/221 (75%), Gaps = 6/221 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V+QGI VYGNKGSTDQHA++QQLR+GV NFF T IEVL
Sbjct  313  SRYLQQLVMESLGKEQDLDGNIVHQGIAVYGNKGSTDQHAYVQQLRDGVPNFFATLIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E++PGVT GDYL G LQGTR ALY N R+SIT+T+ +V  R+VGAL+ALY+
Sbjct  373  EDRH-GQSPEIDPGVTSGDYLSGFLQGTRKALYENQRDSITITIPQVNARTVGALIALYD  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG Y +LVN+NAYHQPGVEAGKKAA  +L LQ +V+AVL          PL+L EIA 
Sbjct  432  RAVGFYGNLVNVNAYHQPGVEAGKKAAAAILDLQTKVVAVLQAEKT-----PLSLAEIAK  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFL  321
            +  A E++E IYKI+ H+  N R ++ +GN G P  +K  L
Sbjct  487  KAGAAEEVEAIYKILRHLNVNQRGVVLQGNLGEPGRLKASL  527



>ref|WP_023070461.1| glucose-6-phosphate isomerase [Leptolyngbya sp. Heron Island 
J]
 gb|ESA38864.1| glucose-6-phosphate isomerase [Leptolyngbya sp. Heron Island 
J]
Length=528

 Score =   275 bits (702),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 139/220 (63%), Positives = 168/220 (76%), Gaps = 6/220 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGNRV QGI VYGNKGSTDQHA++QQLREGV+NFFVT IEVL
Sbjct  313  SRYLQQLIMESLGKETDLDGNRVCQGIAVYGNKGSTDQHAYVQQLREGVNNFFVTLIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E++PGVT GDYL G LQGTR AL+ N+R+SIT+T+ EVTP  VGAL+ALYE
Sbjct  373  KDRE-GTSTEIDPGVTAGDYLSGFLQGTRKALFENNRQSITITIPEVTPTIVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV +YA++VNINAYHQPGVEAGKKAA  VL LQ  V+ VL++         L+L E+A 
Sbjct  432  RAVSLYAAVVNINAYHQPGVEAGKKAAASVLNLQNMVVDVLSKTGGS-----LSLAEVAA  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVF  324
            +    +  E IYKI+ H+ AN R +  +GN G+P ++KV 
Sbjct  487  KVGRPDAAEDIYKIVRHLDANGRLVAIDGNAGNPATMKVM  526



>ref|WP_006455302.1| glucose-6-phosphate isomerase [Synechococcus sp. PCC 7335]
 gb|EDX85555.1| glucose-6-phosphate isomerase [Synechococcus sp. PCC 7335]
Length=528

 Score =   275 bits (702),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 166/219 (76%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREG+ NFF T IEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGIPNFFATLIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   ++EPGVT GDYL G+LQGTR AL  NDR+SIT+T+ EV+P+ VGAL+ALYE
Sbjct  373  KDRE-GPSVDVEPGVTSGDYLSGLLQGTRRALSENDRDSITITIPEVSPKMVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV +YASLVNINAYHQPGVEAGKKAA +VL+LQ +V  V+  +        L+L EI +
Sbjct  432  RAVSLYASLVNINAYHQPGVEAGKKAAADVLSLQTKVKEVVKASDSA-----LSLNEIVE  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            R  A + IE +YKI+ H+ AN R L  EG+   P  +KV
Sbjct  487  RMDAQDKIENVYKIVRHLDANGRELKIEGSPSEPAKLKV  525



>ref|WP_011320408.1| glucose-6-phosphate isomerase [Anabaena variabilis]
 sp|Q3M6S3.1|G6PI_ANAVT RecName: Full=Glucose-6-phosphate isomerase; Short=GPI; AltName: 
Full=Phosphoglucose isomerase; Short=PGI; AltName: Full=Phosphohexose 
isomerase; Short=PHI [Anabaena variabilis ATCC 
29413]
 gb|ABA23313.1| glucose-6-phosphate isomerase [Anabaena variabilis ATCC 29413]
Length=528

 Score =   274 bits (701),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 165/219 (75%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  V QGI VYGNKGSTDQHA++QQLREGV NFF T IEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGKTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATLIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E++PGVT GDYL G L GTR ALY N R+SITVT+ +V  R+VGAL+ALYE
Sbjct  373  EDRN-GASPEIDPGVTSGDYLSGFLLGTRQALYENQRDSITVTIPQVNARTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            R VG+YASLVNINAYHQPGVEAGKKAA  +L LQ +V+ +L +         L+LE+IA+
Sbjct  432  RTVGLYASLVNINAYHQPGVEAGKKAAAVILDLQTKVVGLLQKEKTA-----LSLEQIAE  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + +E IYKI+ H+ AN R ++ +GN G P S+KV
Sbjct  487  KIGAADQVEAIYKILRHLQANQRGVVFQGNLGQPSSLKV  525



>ref|WP_012306591.1| glucose-6-phosphate isomerase [Synechococcus sp. PCC 7002]
 gb|ACA98967.1| glucose-6-phosphate isomerase [Synechococcus sp. PCC 7002]
Length=528

 Score =   274 bits (701),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 167/219 (76%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN+V QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  313  SRYLQQLIMESLGKEEDLDGNKVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G+  ++E G T GD+L G L GTR ALY N R+SIT+TV +V  R+VGAL+ALYE
Sbjct  373  GDRQ-GNSIDIENGATSGDFLSGFLLGTREALYDNGRDSITITVPDVDARTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV IYASLVNINAYHQPGVEAGKKAA  VL LQK+V+  +  +        LTL+ +A 
Sbjct  432  RAVTIYASLVNINAYHQPGVEAGKKAAASVLDLQKKVVDAVTTSESS-----LTLDSLAI  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A+E IE+IYKI+ H+AAN RAL  EGN   P ++K+
Sbjct  487  KVGAIEQIEVIYKIVRHLAANGRALKLEGNPAQPSALKI  525



>ref|WP_015161306.1| glucose-6-phosphate isomerase [Chamaesiphon minutus]
 gb|AFY95197.1| glucose-6-phosphate isomerase [Chamaesiphon minutus PCC 6605]
Length=533

 Score =   274 bits (701),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 165/219 (75%), Gaps = 4/219 (2%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN+V QGI VYGNKGSTDQHA++QQLREG+ NFF+TFIEVL
Sbjct  314  SRYLQQLVMESLGKETDLDGNKVYQGIAVYGNKGSTDQHAYVQQLREGIPNFFLTFIEVL  373

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E++PGVT GDYL G LQGTR ALY N R+S+TVT+  VT ++VGAL+ALYE
Sbjct  374  HDRE-GISPEIDPGVTSGDYLSGFLQGTRQALYDNHRDSLTVTIPSVTAQTVGALIALYE  432

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YAS+VNINAYHQPGVEAGKKAA  +L LQ  V+  L   +   PV   T+ E+A 
Sbjct  433  RAVGLYASIVNINAYHQPGVEAGKKAAAVILKLQTDVVKALQGMTISAPV---TIAELAA  489

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
                 E +E IYKI+ H+ ANDR ++  GN   P S++V
Sbjct  490  TIGEPEQVESIYKILRHLQANDRGVVLTGNLSQPGSLRV  528



>ref|WP_015127110.1| glucose-6-phosphate isomerase [Calothrix sp. PCC 7507]
 gb|AFY31287.1| glucose-6-phosphate isomerase [Calothrix sp. PCC 7507]
Length=528

 Score =   274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 164/219 (75%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  V QGI VYGNKGSTDQHA++QQLREGV NFF T IEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGKTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATLIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E++PGVT GDYL G L G+R ALY N R+SITVT+ +V   +VGAL+ALYE
Sbjct  373  IDRQ-GPSPEIDPGVTSGDYLSGFLLGSRQALYENQRDSITVTIPQVNALTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASL+N+NAYHQPGVEAGKKAA  +L LQKRV+ VL          PLTL E+AD
Sbjct  432  RAVGLYASLINVNAYHQPGVEAGKKAASVILDLQKRVVEVLQTEKT-----PLTLAEVAD  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + IE IYKI+ H+ AN R ++ EGN   P ++K+
Sbjct  487  KAGASDQIEAIYKILRHLHANQRGVVLEGNPAQPSNLKI  525



>ref|WP_017718111.1| glucose-6-phosphate isomerase [Oscillatoria sp. PCC 10802]
Length=529

 Score =   273 bits (699),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 166/220 (75%), Gaps = 7/220 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DL+GN V QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLEGNTVCQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  372

Query  803  RDRPPGHDWELEPG-VTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALY  627
             DR  G   E+E G +T GDYL G LQGTR AL+ N R+SITVTV +V P +VGAL+ALY
Sbjct  373  EDRN-GPSPEVEAGGITSGDYLSGFLQGTREALFENLRDSITVTVGQVNPGTVGALIALY  431

Query  626  ERAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIA  447
            ERAVG YASLVNINAYHQPGVEAGKKAA  +L LQKRVL VL          P+TLE +A
Sbjct  432  ERAVGFYASLVNINAYHQPGVEAGKKAAAAILDLQKRVLQVLKAEGA-----PMTLEALA  486

Query  446  DRCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +R    + +E IYKI+ H+AAN R ++ +GN   P S++V
Sbjct  487  ERAGVPDRVESIYKIVRHLAANRRGVVLQGNLAEPASLRV  526



>ref|WP_015214525.1| glucose-6-phosphate isomerase [Anabaena cylindrica]
 gb|AFZ57889.1| glucose-6-phosphate isomerase [Anabaena cylindrica PCC 7122]
Length=528

 Score =   273 bits (699),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/222 (63%), Positives = 168/222 (76%), Gaps = 6/222 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  V QGI VYGNKGSTDQHA++QQLREGV NFF T IEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGKTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATLIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E++PGVT GDYL G L GTR ALY N+R+SITV++ +V  R+VGAL+ALYE
Sbjct  373  EDRQ-GKSTEVDPGVTSGDYLSGFLLGTRQALYENNRDSITVSIPQVNARTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVN+NAYHQPGVEAGKKAA  +L LQKRVL VL     KE  + L++ E+AD
Sbjct  432  RAVGLYASLVNVNAYHQPGVEAGKKAAAVILDLQKRVLEVL----AKEK-KALSITEVAD  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLG  318
            +     ++E IYKI+ H+ AN+R ++  G+   P S+ V LG
Sbjct  487  KAGVANEVEAIYKILRHLHANNRGVVLTGDLAKPGSLTVSLG  528



>ref|WP_028947160.1| glucose-6-phosphate isomerase [Synechocystis sp. PCC 6714]
 gb|AIE75481.1| Glucose-6-phosphate isomerase [Synechocystis sp. PCC 6714]
Length=531

 Score =   273 bits (699),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 165/219 (75%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  V+QGI VYGNKGSTDQHA++QQLR+GV NFF TFIEVL
Sbjct  315  SRYLQQLVMESLGKERDLDGKIVHQGIAVYGNKGSTDQHAYVQQLRDGVPNFFATFIEVL  374

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   ELEPGVT GDYL G LQGTR AL+ N R+SITVT+ +V   S+GAL+ALYE
Sbjct  375  HDRH-GKSIELEPGVTSGDYLSGFLQGTRQALFENQRDSITVTIPQVDATSIGALIALYE  433

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV  Y SLVN+NAYHQPGVEAGKKAA  +L LQK +LA +   S      P+TLE +A 
Sbjct  434  RAVSFYGSLVNVNAYHQPGVEAGKKAAASILELQKAILATVQTESS-----PITLEALAA  488

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + +E +YKI+ H+AANDR ++ +G+   P+ ++V
Sbjct  489  KVQAPDKVETVYKIVRHLAANDRGVLLQGDRQFPQRLQV  527



>ref|WP_039203444.1| glucose-6-phosphate isomerase, partial [Aphanizomenon flos-aquae]
 gb|KHG40137.1| glucose-6-phosphate isomerase, partial [Aphanizomenon flos-aquae 
2012/KM1/D3]
Length=212

 Score =   263 bits (672),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 161/218 (74%), Gaps = 6/218 (3%)
 Frame = -2

Query  971  QQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVLRDRP  792
            QQL MESLGKE DLDG  V QGI VYGNKGSTDQHA++QQLREGV NFF T IEVL DR 
Sbjct  1    QQLIMESLGKEKDLDGKTVFQGIAVYGNKGSTDQHAYVQQLREGVPNFFATLIEVLEDRR  60

Query  791  PGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYERAVG  612
             G   E++PGVT GDYL G L GTR ALY N+R+SITV++ +V  R+VGAL+ALYERAV 
Sbjct  61   -GKSIEVDPGVTSGDYLCGFLLGTRQALYENNRDSITVSIPQVNARTVGALIALYERAVS  119

Query  611  IYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIADRCHA  432
            +YASLVN+NAYHQPGVEAGKKAA  +L LQKRVL VL         + L++ E+AD   A
Sbjct  120  LYASLVNVNAYHQPGVEAGKKAAAVILDLQKRVLEVLQTQK-----KALSISELADMSGA  174

Query  431  LEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLG  318
             E++E IYKI+ H+  N+R ++  G+   P S+ V LG
Sbjct  175  AEEVEAIYKILRHLHTNNRGVVLTGDFAKPGSLTVSLG  212



>ref|WP_016950192.1| glucose-6-phosphate isomerase [Anabaena sp. PCC 7108]
Length=527

 Score =   273 bits (697),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 138/222 (62%), Positives = 166/222 (75%), Gaps = 6/222 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  V QGI VYGNKGSTDQHA++QQLREGV NFF T IEVL
Sbjct  312  SRYLQQLVMESLGKEKDLDGKTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATLIEVL  371

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E++PGVT GDYL G L GTR ALY N+R+SITVT+ +V  R+VGAL+ALYE
Sbjct  372  EDRQ-GASPEIDPGVTAGDYLAGFLLGTRQALYENNRDSITVTIPQVNARTVGALIALYE  430

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVN+NAYHQPGVEAGKKAA  +L LQ++V+ VL         + L+L EIAD
Sbjct  431  RAVGLYASLVNVNAYHQPGVEAGKKAAAVILDLQQKVMTVLQTEK-----KALSLSEIAD  485

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLG  318
            +     ++E IYKI+ H+ AN+R ++  G+   P S+ V LG
Sbjct  486  KAGVANEVEAIYKILRHLHANNRGVVLTGDLAKPGSLTVSLG  527



>ref|WP_008317107.1| glucose-6-phosphate isomerase [Leptolyngbya sp. PCC 6406]
Length=529

 Score =   273 bits (697),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 166/219 (76%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V+QGI VYGNKGSTDQHA++QQLREGV+NFFVTFIEVL
Sbjct  313  SRYLQQLVMESLGKETDLDGNVVHQGIAVYGNKGSTDQHAYVQQLREGVNNFFVTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+EPGVT GDYL G+LQGTR ALY N R+SITVT+  VTP  +GAL+ALYE
Sbjct  373  QDRQ-GPSLEMEPGVTAGDYLSGLLQGTRQALYDNQRDSITVTIPAVTPPIIGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV +YA LVNINAYHQPGVEAGKKA   +LALQ ++L+VL  +        L+L E+  
Sbjct  432  RAVSLYACLVNINAYHQPGVEAGKKAGASILALQNQILSVLQASQGS-----LSLGELVT  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + IE +Y+I+ H+ ANDR +  +G    P ++ V
Sbjct  487  QAQAQDQIETVYRILRHLEANDRGVQLQGERQRPMTITV  525



>ref|WP_002757376.1| glucose-6-phosphate isomerase [Microcystis aeruginosa]
 emb|CCI00129.1| Glucose-6-phosphate isomerase [Microcystis aeruginosa PCC 9717]
Length=524

 Score =   273 bits (697),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 163/219 (74%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN+V QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  309  SRYLQQLVMESLGKEKDLDGNKVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  368

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+E G T GD+L G+LQGTR ALY N R SIT+T+ EVTPR VGAL+ALYE
Sbjct  369  KDRQ-GDSLEVETGSTAGDFLSGLLQGTRQALYENSRHSITITIPEVTPRQVGALIALYE  427

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV  YASLVNINAYHQPGVEAGKKAA  +L LQ++++ V+ E         L L  +A 
Sbjct  428  RAVSFYASLVNINAYHQPGVEAGKKAAASILDLQRKIVQVVRETGTS-----LDLATLAA  482

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + +E IYKI+ H+ AN R+L   G+   P ++++
Sbjct  483  KIGASDQVEAIYKIVRHLNANRRSLTITGDLSKPETIQI  521



>ref|WP_041234628.1| glucose-6-phosphate isomerase [Cyanobacterium stanieri]
Length=530

 Score =   273 bits (697),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 168/219 (77%), Gaps = 7/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN+V QGI VYGNKGSTDQHA++QQLREGV NFFVTFIEVL
Sbjct  315  SRYLQQLVMESLGKEEDLDGNKVYQGIAVYGNKGSTDQHAYVQQLREGVANFFVTFIEVL  374

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G+  ELEP  T GDYL G+LQGTR ALY N R+SITVTV EV+P+ VGAL+ALYE
Sbjct  375  KDRA-GNSLELEPNTTSGDYLSGLLQGTRKALYDNGRDSITVTVNEVSPKIVGALIALYE  433

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV IYA L+N+NAYHQPGVEAGKKAA  +L LQ++VL V+  ++       LT+ +IA 
Sbjct  434  RAVSIYAYLINVNAYHQPGVEAGKKAAASILDLQQKVLEVVKSSN-----NSLTITDIAS  488

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +    ++IE IYKI+ H+ AN+R +  +G+   P  + V
Sbjct  489  KVDG-QEIEAIYKILRHLEANNRGITLKGDRTMPSKLIV  526



>gb|AFZ48680.1| glucose-6-phosphate isomerase [Cyanobacterium stanieri PCC 7202]
Length=531

 Score =   272 bits (696),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 168/219 (77%), Gaps = 7/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN+V QGI VYGNKGSTDQHA++QQLREGV NFFVTFIEVL
Sbjct  316  SRYLQQLVMESLGKEEDLDGNKVYQGIAVYGNKGSTDQHAYVQQLREGVANFFVTFIEVL  375

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G+  ELEP  T GDYL G+LQGTR ALY N R+SITVTV EV+P+ VGAL+ALYE
Sbjct  376  KDRA-GNSLELEPNTTSGDYLSGLLQGTRKALYDNGRDSITVTVNEVSPKIVGALIALYE  434

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV IYA L+N+NAYHQPGVEAGKKAA  +L LQ++VL V+  ++       LT+ +IA 
Sbjct  435  RAVSIYAYLINVNAYHQPGVEAGKKAAASILDLQQKVLEVVKSSN-----NSLTITDIAS  489

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +    ++IE IYKI+ H+ AN+R +  +G+   P  + V
Sbjct  490  KVDG-QEIEAIYKILRHLEANNRGITLKGDRTMPSKLIV  527



>ref|WP_041643098.1| glucose-6-phosphate isomerase [Trichormus azollae]
Length=527

 Score =   272 bits (696),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 165/221 (75%), Gaps = 6/221 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  V QGI VYGNKGSTDQHA++QQLREGV NFF T IEVL
Sbjct  312  SRYLQQLVMESLGKEKDLDGKIVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATLIEVL  371

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR      E++PGVT GDYL G L GTR ALY N+R+SITVT+ +V PR+VGAL+ALYE
Sbjct  372  EDRQRKSP-EIDPGVTSGDYLCGFLLGTRQALYENNRDSITVTIHQVNPRTVGALIALYE  430

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA  +L LQ++V+ VL         + L++ EIAD
Sbjct  431  RAVGLYASLVNINAYHQPGVEAGKKAAAVILDLQQKVMTVLQTER-----KALSISEIAD  485

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFL  321
            +  A E IE IYKI+ H+  N+R ++  G+   P S+ V L
Sbjct  486  KAGASEQIEAIYKILRHLHTNNRGVVLTGDLAKPGSLTVSL  526



>ref|WP_023171410.1| glucose-6-phosphate isomerase [Gloeobacter kilaueensis]
 gb|AGY56410.1| glucose-6-phosphate isomerase [Gloeobacter kilaueensis JS1]
Length=526

 Score =   272 bits (696),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 140/222 (63%), Positives = 163/222 (73%), Gaps = 6/222 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE D DG  V QGI VYGNKGSTDQHA++QQLREGV NFF+TFIEVL
Sbjct  311  SRYLQQLVMESLGKEKDRDGQLVRQGIAVYGNKGSTDQHAYVQQLREGVPNFFLTFIEVL  370

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   ELEPGVT GDYL G+LQGTR ALY N R+SIT+T+  V PRSVGA++ALYE
Sbjct  371  EDRQ-GPSIELEPGVTSGDYLSGLLQGTRQALYENRRDSITLTISRVDPRSVGAIIALYE  429

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG Y SLVNINAY QPGVEAGKKAA  +L LQKR+L VL  ++     +P+ L  +A 
Sbjct  430  RAVGFYGSLVNINAYDQPGVEAGKKAAASILELQKRILQVLQSSA-----QPMPLATLAQ  484

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLG  318
            +    E IE IYKI+ H+ AN R +   G+   P S+ V +G
Sbjct  485  KAGTPEQIEAIYKIVRHLEANRRGVALAGDRSRPDSLLVSVG  526



>gb|ADI64627.1| Glucose-6-phosphate isomerase ['Nostoc azollae' 0708]
Length=528

 Score =   272 bits (696),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 165/221 (75%), Gaps = 6/221 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  V QGI VYGNKGSTDQHA++QQLREGV NFF T IEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGKIVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATLIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR      E++PGVT GDYL G L GTR ALY N+R+SITVT+ +V PR+VGAL+ALYE
Sbjct  373  EDRQRKSP-EIDPGVTSGDYLCGFLLGTRQALYENNRDSITVTIHQVNPRTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA  +L LQ++V+ VL         + L++ EIAD
Sbjct  432  RAVGLYASLVNINAYHQPGVEAGKKAAAVILDLQQKVMTVLQTER-----KALSISEIAD  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFL  321
            +  A E IE IYKI+ H+  N+R ++  G+   P S+ V L
Sbjct  487  KAGASEQIEAIYKILRHLHTNNRGVVLTGDLAKPGSLTVSL  527



>ref|WP_004161559.1| glucose-6-phosphate isomerase [Microcystis aeruginosa]
 emb|CCI17417.1| Glucose-6-phosphate isomerase [Microcystis aeruginosa PCC 9807]
Length=524

 Score =   272 bits (695),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 163/219 (74%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN+V QGI VYGNKGSTDQHA++QQLREG+ NFF TFIEVL
Sbjct  309  SRYLQQLVMESLGKEKDLDGNKVYQGIAVYGNKGSTDQHAYVQQLREGIPNFFATFIEVL  368

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+E G T GD+L G+LQGTR ALY N R SIT+T+ EVTPR VGAL+ALYE
Sbjct  369  KDRQ-GDSMEVETGSTAGDFLSGLLQGTRQALYENSRHSITITIPEVTPRQVGALIALYE  427

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV  YASLVNINAYHQPGVEAGKKAA  +L LQ++++ V+ E         L L  +A 
Sbjct  428  RAVSFYASLVNINAYHQPGVEAGKKAAASILDLQRKIVQVVRETGTS-----LDLATLAA  482

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + +E IYKI+ H+ AN R+L   G+   P ++++
Sbjct  483  KIGASDQVEAIYKIVRHLNANRRSLTITGDLSKPETIQI  521



>ref|WP_026787654.1| glucose-6-phosphate isomerase [Planktothrix rubescens]
Length=529

 Score =   272 bits (695),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 141/218 (65%), Positives = 165/218 (76%), Gaps = 8/218 (4%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLD N V QGI VYGNKGSTDQHA++QQLR+GV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDSNIVYQGIAVYGNKGSTDQHAYVQQLRDGVPNFFATFIEVL  372

Query  803  RDRP-PGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALY  627
            +DR  P    E+EPGVT GDYL G L GTR ALY N R+SIT+TV EV P  VGAL+ALY
Sbjct  373  QDRSLPSI--EVEPGVTSGDYLSGFLLGTRQALYENHRDSITITVPEVNPEIVGALIALY  430

Query  626  ERAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIA  447
            ERAVG+YASLVNINAYHQPGVEAGKKAA EVL LQ +++ VL +A      + L+LE +A
Sbjct  431  ERAVGLYASLVNINAYHQPGVEAGKKAAAEVLELQHKIIQVLQDAG-----KALSLETLA  485

Query  446  DRCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSV  333
            ++    + IE IYKI+ H+A N R ++  GN G P S+
Sbjct  486  EKAGVPDQIEAIYKILRHLATNQRGVLLVGNPGKPASL  523



>ref|WP_015164239.1| glucose-6-phosphate isomerase [Pseudanabaena sp. PCC 7367]
 gb|AFY69266.1| glucose-6-phosphate isomerase [Pseudanabaena sp. PCC 7367]
Length=534

 Score =   272 bits (695),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 167/220 (76%), Gaps = 4/220 (2%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV+NFF TFIEVL
Sbjct  314  SRYLQQLVMESLGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGVNNFFATFIEVL  373

Query  803  RDRPPGHDW-ELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALY  627
             DR PG+   ELEPG+  GD+L G  QGTR ALY N R SITV++ EV+PR +GAL+ALY
Sbjct  374  SDRAPGNKGPELEPGIFAGDFLSGFWQGTRKALYENGRGSITVSIPEVSPRMIGALIALY  433

Query  626  ERAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIA  447
            ERAVG+Y  LVN+NAYHQPGVEAGKKAA  +L LQK+V+AVL+  +       L++ ++A
Sbjct  434  ERAVGLYGFLVNVNAYHQPGVEAGKKAAAVILDLQKKVMAVLDAETAGSA--SLSIADLA  491

Query  446  DRCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
             +    E IE +Y I+ H+ AN R +  EGN G+P S++V
Sbjct  492  HKVGQPEAIETVYLIVRHLDANSR-INLEGNTGNPSSLRV  530



>ref|WP_006529689.1| glucose-6-phosphate isomerase [Gloeocapsa sp. PCC 73106]
 gb|ELR97505.1| glucose-6-phosphate isomerase [Gloeocapsa sp. PCC 73106]
Length=527

 Score =   271 bits (694),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 168/219 (77%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  312  SRYLQQLVMESLGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  371

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+E   T GD+L G+LQGTR+ALY N+R+S+T+TV  V  R VGAL+ALYE
Sbjct  372  EDRN-GPSIEVETQATSGDFLSGLLQGTRAALYENNRDSVTITVPRVNARIVGALIALYE  430

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA  VL LQ+++L  + ++S      PL+L ++A 
Sbjct  431  RAVGLYASLVNINAYHQPGVEAGKKAAASVLDLQRQILEAIKQSSA-----PLSLADLAA  485

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A E++E +YKI+ H+AAN+R +  +G+   P S+ V
Sbjct  486  KTGAPEEVETVYKIVRHLAANNRGVSLKGDHSQPSSLTV  524



>ref|WP_015201010.1| glucose-6-phosphate isomerase [Calothrix parietina]
 gb|AFZ04402.1| glucose-6-phosphate isomerase [Calothrix sp. PCC 6303]
Length=528

 Score =   271 bits (694),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 164/220 (75%), Gaps = 8/220 (4%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFF T IEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNIVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATLIEVL  372

Query  803  RDRP-PGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALY  627
             DR  P    E+EPG+T GDYL G LQGTR ALY N R+SITVT+ +V PR+VGAL+ALY
Sbjct  373  EDRSCPSP--EVEPGITTGDYLSGFLQGTRQALYENQRDSITVTIPQVNPRTVGALIALY  430

Query  626  ERAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIA  447
            ERAVG+YASLVN+NAYHQPGVEAGKKAA  +L LQ +++ VL +         LTL +IA
Sbjct  431  ERAVGLYASLVNVNAYHQPGVEAGKKAAATILELQTQIVDVLRKEKAA-----LTLAQIA  485

Query  446  DRCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            ++  + + IE IY II H+ AN R +  EGN   P S+ V
Sbjct  486  EKLGSPDKIESIYIIIRHLHANQREITIEGNPSEPSSLTV  525



>ref|WP_002798750.1| glucose-6-phosphate isomerase [Microcystis aeruginosa]
 sp|B0JVE7.1|G6PI_MICAN RecName: Full=Glucose-6-phosphate isomerase; Short=GPI; AltName: 
Full=Phosphoglucose isomerase; Short=PGI; AltName: Full=Phosphohexose 
isomerase; Short=PHI [Microcystis aeruginosa NIES-843]
 dbj|BAG01481.1| glucose-6-phosphate isomerase [Microcystis aeruginosa NIES-843]
 emb|CCI28200.1| Glucose-6-phosphate isomerase [Microcystis aeruginosa PCC 9809]
Length=524

 Score =   271 bits (694),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 163/219 (74%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN+V QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  309  SRYLQQLVMESLGKEKDLDGNKVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  368

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+E G T GD+L G+LQGTR ALY N R SIT+T+ EVTPR VGAL+ALYE
Sbjct  369  KDRQ-GDSIEVETGSTAGDFLSGLLQGTRQALYENSRHSITITIPEVTPRQVGALIALYE  427

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV  YASLVNINAYHQPGVEAGKKAA  +L LQ++++ V+ E         L L  +A 
Sbjct  428  RAVSFYASLVNINAYHQPGVEAGKKAAASILDLQRKIVQVVRETGTS-----LDLATLAA  482

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + +E IYKI+ H+ AN R+L   G+   P ++++
Sbjct  483  KIGASDQVEAIYKIVRHLNANRRSLTITGDLSKPETLQI  521



>ref|WP_026796492.1| glucose-6-phosphate isomerase [Planktothrix prolifica]
Length=529

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 141/218 (65%), Positives = 164/218 (75%), Gaps = 8/218 (4%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLD N V QGI VYGNKGSTDQHA++QQLR+GV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDSNIVYQGIAVYGNKGSTDQHAYVQQLRDGVPNFFATFIEVL  372

Query  803  RDRP-PGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALY  627
            +DR  P    E+EPGVT GDYL G L GTR ALY N R+SIT+TV EV P  VGAL+ALY
Sbjct  373  QDRSLPSI--EVEPGVTSGDYLSGFLLGTRQALYENHRDSITITVPEVNPEIVGALIALY  430

Query  626  ERAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIA  447
            ERAVG+YASLVNINAYHQPGVEAGKKAA EVL LQ +++ VL +A      + L+LE +A
Sbjct  431  ERAVGLYASLVNINAYHQPGVEAGKKAAAEVLELQHKIIQVLQDAG-----KALSLETLA  485

Query  446  DRCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSV  333
             +    + IE IYKI+ H+A N R ++  GN G P S+
Sbjct  486  QKAGVPDQIEAIYKILRHLATNQRGVLLVGNPGKPASL  523



>ref|WP_002802157.1| glucose-6-phosphate isomerase [Microcystis aeruginosa]
 emb|CCI35813.1| Glucose-6-phosphate isomerase [Microcystis aeruginosa PCC 9701]
Length=524

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 163/219 (74%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN+V QGI VYGNKGSTDQHA++QQLREG+ NFF TFIEVL
Sbjct  309  SRYLQQLVMESLGKEKDLDGNKVYQGIAVYGNKGSTDQHAYVQQLREGIPNFFATFIEVL  368

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+E G T GD+L G+LQGTR ALY N R SIT+T+ EVTPR VGAL+ALYE
Sbjct  369  KDRQ-GDSMEVETGSTAGDFLSGLLQGTRQALYENSRHSITITIPEVTPRQVGALIALYE  427

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV  YASLVNINAYHQPGVEAGKKAA  +L LQ++++ V+ E         L L  +A 
Sbjct  428  RAVSFYASLVNINAYHQPGVEAGKKAAASILDLQRKIVQVVRETGTA-----LDLTTLAA  482

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + +E IYKI+ H+ AN R+L   G+   P ++++
Sbjct  483  KIGASDQVEAIYKIVRHLNANRRSLTITGDLSKPETLQI  521



>ref|WP_045362683.1| glucose-6-phosphate isomerase [Microcystis aeruginosa]
 dbj|GAL95769.1| glucose-6-phosphate isomerase [Microcystis aeruginosa NIES-44]
Length=524

 Score =   271 bits (693),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 163/219 (74%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN+V QGI VYGNKGSTDQHA++QQLREG+ NFF TFIEVL
Sbjct  309  SRYLQQLVMESLGKEKDLDGNKVYQGIAVYGNKGSTDQHAYVQQLREGIPNFFATFIEVL  368

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+E G T GD+L G+LQGTR ALY N R SIT+T+ EVTPR VGAL+ALYE
Sbjct  369  KDRQ-GDSMEVETGSTAGDFLSGLLQGTRQALYENSRHSITITIPEVTPRQVGALIALYE  427

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV  YASLVNINAYHQPGVEAGKKAA  +L LQ++++ V+ E         L L  +A 
Sbjct  428  RAVSFYASLVNINAYHQPGVEAGKKAAASILDLQRKIVQVVRETGTA-----LDLTTLAA  482

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  + + +E IYKI+ H+ AN R+L   G+   P ++++
Sbjct  483  KIGSSDQVEAIYKIVRHLHANQRSLTITGDLSKPETIQI  521



>ref|WP_008203131.1| glucose-6-phosphate isomerase [Microcystis sp. T1-4]
 emb|CCI33060.1| Glucose-6-phosphate isomerase [Microcystis sp. T1-4]
Length=524

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 163/219 (74%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DL+GN+V QGI VYGNKGSTDQHA++QQLREG+ NFF TFIEVL
Sbjct  309  SRYLQQLVMESLGKEKDLEGNKVYQGIAVYGNKGSTDQHAYVQQLREGIPNFFATFIEVL  368

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+E G T GD+L G+LQGTR ALY N R SIT+T+ EVTPR VGAL+ALYE
Sbjct  369  KDRQ-GDSMEVETGSTAGDFLSGLLQGTRQALYENSRHSITITIPEVTPRQVGALIALYE  427

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV  YASLVNINAYHQPGVEAGKKAA  +L LQ++++ V+ E         L L  +A 
Sbjct  428  RAVSFYASLVNINAYHQPGVEAGKKAAASILDLQRKIVQVVRETGTA-----LDLATLAA  482

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + +E IYKI+ H+ AN R+L   G+   P ++++
Sbjct  483  KISASDQVEAIYKIVRHLHANQRSLTITGDLSKPETIQI  521



>ref|WP_027402980.1| glucose-6-phosphate isomerase [Aphanizomenon flos-aquae]
Length=528

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/222 (62%), Positives = 166/222 (75%), Gaps = 6/222 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  V QGI VYGNKGSTDQHA++QQLREGV NFF T IEVL
Sbjct  313  SRYLQQLIMESLGKEKDLDGKTVFQGIAVYGNKGSTDQHAYVQQLREGVPNFFATLIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E++PGVT GDYL G L GTR ALY N+R+SITV++ +V  R+VGAL+ALYE
Sbjct  373  EDRQ-GTSVEVDPGVTSGDYLCGFLLGTRQALYENNRDSITVSIPQVNARTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASL+N+NAYHQPGVEAGKKAA  +L LQKRVL VL         + L++ E+AD
Sbjct  432  RAVGLYASLINVNAYHQPGVEAGKKAAAVILDLQKRVLEVLQTQK-----KALSISELAD  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLG  318
               A E++E IYKI+ H+  N+R ++  G+   P S+ V LG
Sbjct  487  MSGAAEEVEAIYKILRHLHTNNRGVVLTGDFAKPGSLTVSLG  528



>gb|ESS73728.1| glucose-6-phosphate isomerase Pgi [Methyloglobulus morosus KoM1]
Length=543

 Score =   271 bits (693),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/228 (61%), Positives = 166/228 (73%), Gaps = 6/228 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE D DG  V++GITVYGNKGSTDQHA++QQLREG+ +FF TFIEVL
Sbjct  313  SRYLQQLVMESLGKELDRDGKVVHEGITVYGNKGSTDQHAYVQQLREGLPDFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+EP  T GD+L G+LQGTR ALY N RESIT+TV  V  R VGAL+ALYE
Sbjct  373  EDRK-GPSIEIEPDFTSGDFLSGLLQGTRQALYDNQRESITITVPRVDTRCVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG YASLVNINAYHQPGVEAGKKAA + L LQK +LAVL     K   +PLTL  +A+
Sbjct  432  RAVGFYASLVNINAYHQPGVEAGKKAAADFLLLQKNILAVL-----KTTRQPLTLSALAE  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLGECNVDE  300
            +    + +E IYK++ H++ N R ++  GN   P  + V LG  N +E
Sbjct  487  KIGVPDQVETIYKVVRHLSMNPRQIVLHGNLAKPVELSVSLGRQNNEE  534



>ref|WP_042154237.1| glucose-6-phosphate isomerase [Planktothrix agardhii]
 gb|KEI67204.1| Pgi [Planktothrix agardhii NIVA-CYA 126/8]
Length=529

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 164/218 (75%), Gaps = 8/218 (4%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLD N V QGI VYGNKGSTDQHA++QQLR+GV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDSNIVYQGIAVYGNKGSTDQHAYVQQLRDGVPNFFATFIEVL  372

Query  803  RDRP-PGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALY  627
            +DR  P    E+EPGVT GDYL G L GTR ALY N R+SIT+TV EV P  VGAL+ALY
Sbjct  373  QDRSLPSI--EVEPGVTSGDYLSGFLLGTRQALYENHRDSITITVPEVNPEIVGALIALY  430

Query  626  ERAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIA  447
            ERAVG+YASLVNINAYHQPGVEAGKKAA EVL LQ +++ VL +A      + L+LE +A
Sbjct  431  ERAVGLYASLVNINAYHQPGVEAGKKAAAEVLELQHKIIQVLQDAG-----QALSLETLA  485

Query  446  DRCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSV  333
            ++    + IE IYKI+ H+A N R ++  GN   P S+
Sbjct  486  EKAGVPDQIEAIYKILRHLATNQRGVLLVGNLAKPASL  523



>ref|WP_006618634.1| glucose-6-phosphate isomerase [Arthrospira platensis]
 dbj|BAI94067.1| glucose-6-phosphate isomerase [Arthrospira platensis NIES-39]
 gb|KDR54882.1| glucose-6-phosphate isomerase [Arthrospira platensis str. Paraca]
Length=528

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 164/214 (77%), Gaps = 6/214 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DL+GN VNQGI+VYGNKGSTDQHA++QQLR+GV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLEGNIVNQGISVYGNKGSTDQHAYVQQLRDGVPNFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            RDR      E+EPGVT GDYL G LQGTR ALY N R+SITVT+ EV P +VGALVALYE
Sbjct  373  RDRQKPSP-EIEPGVTAGDYLSGFLQGTREALYDNQRDSITVTITEVNPYTVGALVALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV +YASLVNINAYHQPGVEAGKKAA +VL LQ + L VL   S     + +++ ++A 
Sbjct  432  RAVSLYASLVNINAYHQPGVEAGKKAAAQVLELQHQGLQVLRGHS-----QGISISDLAA  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSP  342
            +  A E +E +YKI+ H+AANDR +   G+   P
Sbjct  487  KIDAQEQVETLYKILRHLAANDRGVELSGDPSKP  520



>ref|WP_017285984.1| glucose-6-phosphate isomerase [Leptolyngbya boryana]
Length=528

 Score =   270 bits (691),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 166/219 (76%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V+QGI VYGNKG+TDQHA++QQLREGV NFF+TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNVVHQGIAVYGNKGTTDQHAYVQQLREGVPNFFLTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR      E+EPGVT GDYL G+LQGTR ALY N+R+SIT+T+ EVTPR VGAL+ALY+
Sbjct  373  KDRSSA-SIEVEPGVTSGDYLSGLLQGTRKALYENERDSITLTIPEVTPRMVGALIALYD  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+Y  LVNIN+YHQPGVEAGKKAA  VL +Q +V+  L + +      P+ L  +A 
Sbjct  432  RAVGLYGFLVNINSYHQPGVEAGKKAAAVVLDVQSKVMEALKKENT-----PIPLATLAL  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
                 +D+E +YKI+ H+AAN+R +   G+   P S+ V
Sbjct  487  NAGVPDDVESVYKIVRHLAANNRGITLHGDPAKPGSLTV  525



>ref|WP_013044065.1| glucose-6-phosphate isomerase [Coraliomargarita akajimensis]
 gb|ADE55343.1| Glucose-6-phosphate isomerase [Coraliomargarita akajimensis DSM 
45221]
Length=523

 Score =   270 bits (689),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 162/208 (78%), Gaps = 6/208 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            S+YLQQL MESLGKEFDLDG  VNQGI VYGNKGSTDQHA++QQLREGVHNFFVTFIEVL
Sbjct  309  SKYLQQLVMESLGKEFDLDGKTVNQGIAVYGNKGSTDQHAYVQQLREGVHNFFVTFIEVL  368

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E++PG T GDYL G   GTR ALY N R+SIT+T++EVTP +VG L+AL+E
Sbjct  369  KDRA-GPSIEVDPGTTTGDYLQGFYLGTRDALYENGRQSITITIKEVTPAAVGQLIALFE  427

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASL+NINAYHQPGVEAGKKAA  VLAL+  V+A + E+S     E LT + IA 
Sbjct  428  RAVGLYASLININAYHQPGVEAGKKAAAGVLALEASVIAAVKESS-----ESLTADGIAT  482

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAE  360
            +       E+I+K++  +AAN+R + AE
Sbjct  483  KLGLEAQTELIFKLLIRLAANNRGISAE  510



>ref|WP_028090636.1| glucose-6-phosphate isomerase [Dolichospermum circinale]
Length=528

 Score =   270 bits (689),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 138/222 (62%), Positives = 166/222 (75%), Gaps = 6/222 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  V QG+ VYGNKGSTDQHA++QQLREGV NFF T IEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGKTVYQGLAVYGNKGSTDQHAYVQQLREGVPNFFATLIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E++PGVT GDYL G L GTR ALY N+R+SITVT+ +V  R+VGAL+ALYE
Sbjct  373  EDRQ-GKSPEVDPGVTAGDYLSGFLLGTRQALYENNRDSITVTIPQVNARTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASL+N+NAYHQPGVEAGKKAA  +L LQKRVL VL         + L++ E+A+
Sbjct  432  RAVGLYASLINVNAYHQPGVEAGKKAAAVILDLQKRVLEVLQTQR-----KALSIAELAN  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLG  318
               A E+IE IYKI+ H+ +N R ++  G+   P S+ V LG
Sbjct  487  IAGATEEIEAIYKILRHLHSNHRGVVLTGDLAKPGSLTVSLG  528



>ref|WP_026795511.1| MULTISPECIES: glucose-6-phosphate isomerase [Planktothrix]
Length=529

 Score =   270 bits (689),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 164/218 (75%), Gaps = 8/218 (4%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLD N V QGI VYGNKGSTDQHA++QQLR+GV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDSNIVYQGIAVYGNKGSTDQHAYVQQLRDGVPNFFATFIEVL  372

Query  803  RDRP-PGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALY  627
            +DR  P    E+EPGVT GDYL G L GTR ALY N R+SIT+TV EV P  VGAL+ALY
Sbjct  373  QDRSLPSI--EVEPGVTSGDYLSGFLLGTRQALYENHRDSITITVPEVNPEIVGALIALY  430

Query  626  ERAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIA  447
            ERAVG+YASLVNINAYHQPGVEAGKKAA EVL LQ +++ VL +A      + L+LE +A
Sbjct  431  ERAVGLYASLVNINAYHQPGVEAGKKAAAEVLELQHKIIQVLQDAG-----QALSLETLA  485

Query  446  DRCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSV  333
            ++    + IE IYKI+ H+A N R ++  GN   P S+
Sbjct  486  EKAGVPDQIEAIYKILRHLATNQRGVLLVGNPAKPASL  523



>ref|WP_012164582.1| glucose-6-phosphate isomerase [Acaryochloris marina]
 sp|B0CCT9.1|G6PI_ACAM1 RecName: Full=Glucose-6-phosphate isomerase; Short=GPI; AltName: 
Full=Phosphoglucose isomerase; Short=PGI; AltName: Full=Phosphohexose 
isomerase; Short=PHI [Acaryochloris marina MBIC11017]
 gb|ABW29251.1| glucose-6-phosphate isomerase [Acaryochloris marina MBIC11017]
Length=529

 Score =   270 bits (689),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 168/221 (76%), Gaps = 6/221 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLD   V+QGI VYGNKGSTDQHA++Q+LREG+ NFF+TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDDKIVHQGIAVYGNKGSTDQHAYVQELREGIPNFFLTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G  +E+EPGVT GDYL G L GTR ALY   R+SITVT+ EVT + VGAL+ALYE
Sbjct  373  KDRD-GTRFEVEPGVTSGDYLSGFLLGTREALYEKRRDSITVTLPEVTSKQVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASL+N+NAYHQPGVEAGKKAA + +ALQ +++ +L     +  + PL +  +AD
Sbjct  432  RAVGLYASLINVNAYHQPGVEAGKKAATDTIALQNKIVQIL-----RNTLTPLPITSLAD  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFL  321
            +  A + IE +YKI+ H+AAN R +   GN   P S++V L
Sbjct  487  KAEAPDKIETVYKIVRHLAANKRGVELYGNPAEPGSLQVTL  527



>ref|WP_015210240.1| glucose-6-phosphate isomerase [Cylindrospermum stagnale]
 gb|AFZ27003.1| glucose-6-phosphate isomerase [Cylindrospermum stagnale PCC 7417]
Length=528

 Score =   270 bits (689),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 166/219 (76%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFF T IEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNIVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATLIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E++PGVT GDYL G L GTR ALY N R+SITVT+ +V  R+VGAL+ALYE
Sbjct  373  EDRQ-GPSPEIDPGVTAGDYLSGFLLGTRQALYENHRDSITVTIPQVNSRTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASL+N+NAYHQPGVEAGKKAA  +L LQKRV+ VL +         L+L E+A+
Sbjct  432  RAVGLYASLINVNAYHQPGVEAGKKAAAVILDLQKRVVDVLQKEKSA-----LSLAEVAE  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  + +++E IYKI+ H+ +N R ++ +G+   P S+ V
Sbjct  487  KAGSPDEVEAIYKILRHLHSNQRGVVLKGDLAQPSSLTV  525



>ref|WP_013817364.1| glucose-6-phosphate isomerase [Methylomonas methanica]
 gb|AEF99093.1| Glucose-6-phosphate isomerase [Methylomonas methanica MC09]
Length=531

 Score =   270 bits (689),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 167/219 (76%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKEFDLDGN V+QGITVYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  312  SRYLQQLVMESLGKEFDLDGNTVHQGITVYGNKGSTDQHAYVQQLREGVGNFFATFIEVL  371

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+EP  T GD+LFG LQGTR ALY N R S+T+T++ V   ++GAL+ALYE
Sbjct  372  EDRA-GSSIEIEPDATSGDFLFGCLQGTREALYENGRASLTITLERVDALNIGALIALYE  430

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASL+NINAY+QPGVEAGKKAA + L LQ+ ++ +L         EPL+L+ +A+
Sbjct  431  RAVGLYASLININAYNQPGVEAGKKAATQFLLLQQTIVKLLRHTP-----EPLSLKALAE  485

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            + +  +++E +YKI+ HMA N R L+ +G+   P  + V
Sbjct  486  KVNTPDEVETVYKIVRHMAINHRGLVLQGDLHKPSDILV  524



>ref|WP_012593812.1| MULTISPECIES: glucose-6-phosphate isomerase [Cyanothece]
 sp|B7JUF5.1|G6PI_CYAP8 RecName: Full=Glucose-6-phosphate isomerase; Short=GPI; AltName: 
Full=Phosphoglucose isomerase; Short=PGI; AltName: Full=Phosphohexose 
isomerase; Short=PHI [Cyanothece sp. PCC 8801]
 gb|ACK64535.1| Glucose-6-phosphate isomerase [Cyanothece sp. PCC 8801]
 gb|ACU99408.1| Glucose-6-phosphate isomerase [Cyanothece sp. PCC 8802]
Length=526

 Score =   270 bits (689),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 134/222 (60%), Positives = 163/222 (73%), Gaps = 6/222 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  311  SRYLQQLVMESLGKETDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  370

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   EL+PG+T GDYL G +QGTR ALY N+R+S+T+T+ +V PR VGAL+ALYE
Sbjct  371  EDRQ-GESIELDPGITSGDYLSGFIQGTRQALYENNRDSVTITIPQVNPRIVGALIALYE  429

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            R V  Y SLVN+NAYHQPGVEAGKK A  +L+LQ  +  V+     KE V  L L  +A+
Sbjct  430  RTVSFYGSLVNVNAYHQPGVEAGKKMAASILSLQTEIQKVI-----KESVGSLDLVTLAE  484

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLG  318
            +    E +E +YKI+ H+AAN R +  +G+  +P S+KV  G
Sbjct  485  KAGDPEAVEAVYKIVRHLAANGRGVTLDGDLANPSSLKVSAG  526



>ref|WP_002784921.1| Glucose-6-phosphate isomerase [Microcystis aeruginosa]
 emb|CCI14305.1| Glucose-6-phosphate isomerase [Microcystis aeruginosa PCC 9806]
Length=524

 Score =   269 bits (688),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 162/219 (74%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREG+ NFF TFIEVL
Sbjct  309  SRYLQQLVMESLGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGIPNFFATFIEVL  368

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+E G T GD+L G+LQGTR ALY N R SIT+T+ EVTPR VGAL+ALYE
Sbjct  369  KDRQ-GDSMEVETGSTAGDFLSGLLQGTRQALYENSRHSITITIPEVTPRQVGALIALYE  427

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV  YASLVNINAYHQPGVEAGKKAA  +L LQ++++ V+ E         L L  +A 
Sbjct  428  RAVSFYASLVNINAYHQPGVEAGKKAAASILDLQRKIVQVVRETGTA-----LDLTTLAA  482

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  + + +E IYKI+ H+ AN R+L   G+   P ++++
Sbjct  483  KIGSSDQVEAIYKIVRHLHANGRSLTITGDLSKPETIQI  521



>ref|WP_010470262.1| glucose-6-phosphate isomerase [Acaryochloris sp. CCMEE 5410]
Length=529

 Score =   269 bits (688),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 168/221 (76%), Gaps = 6/221 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLD   V+QGI VYGNKGSTDQHA++Q+LREG+ NFF+TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDDKIVHQGIAVYGNKGSTDQHAYVQELREGIPNFFLTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G  +E+EPGVT GDYL G L GTR ALY   R+SITVT+ EVT + VGAL+ALYE
Sbjct  373  KDRD-GPRFEVEPGVTSGDYLSGFLLGTREALYEKRRDSITVTLPEVTSKQVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASL+N+NAYHQPGVEAGKKAA + +ALQ +++ +L     +  + PL +  +AD
Sbjct  432  RAVGLYASLINVNAYHQPGVEAGKKAATDTIALQNKIVQIL-----RNTLTPLPITSLAD  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFL  321
            +  A + IE +YKI+ H+AAN R +   GN   P S++V L
Sbjct  487  KAEAPDKIETVYKIVRHLAANKRGVELYGNPAEPGSLQVTL  527



>ref|WP_009545914.1| MULTISPECIES: glucose-6-phosphate isomerase [Cyanothece]
Length=526

 Score =   269 bits (687),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 164/219 (75%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  311  SRYLQQLVMESLGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  370

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             D    H +E+EPGVT GD+L G LQGTR AL+ N+R+SIT+T+ +V PR+VGAL+ALYE
Sbjct  371  EDGRDTH-FEIEPGVTSGDFLSGFLQGTRQALFENNRDSITITIPQVNPRTVGALIALYE  429

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            R V  YASLVNINAYHQPGVEAGK  +  +L LQ +V  V+ E S     E L +E +A 
Sbjct  430  RTVSFYASLVNINAYHQPGVEAGKTMSASILDLQTKVQTVIQETS-----EALDIETLAA  484

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  + +++E +YKI+ H+AAN R +  EGN    +++KV
Sbjct  485  KAGSPDEVEFVYKIVRHLAANGRGVALEGNLTDLKTLKV  523



>ref|WP_028082099.1| glucose-6-phosphate isomerase [Dolichospermum circinale]
Length=528

 Score =   269 bits (687),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/222 (62%), Positives = 166/222 (75%), Gaps = 6/222 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  V QG+ VYGNKGSTDQHA++QQLREGV NFF T IEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGKTVYQGLAVYGNKGSTDQHAYVQQLREGVPNFFATLIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E++PGVT GDYL G L GTR ALY N+R+SITVT+ +V  R+VGAL+ALYE
Sbjct  373  ADRQ-GKSPEVDPGVTAGDYLSGFLLGTRQALYENNRDSITVTIPQVNARTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASL+N+NAYHQPGVEAGKKAA  +L LQKRVL VL         + L++ E+A+
Sbjct  432  RAVGLYASLINVNAYHQPGVEAGKKAAAVILDLQKRVLEVLQTQR-----KALSIAELAN  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLG  318
               A E+IE IYKI+ H+ +N R ++  G+   P S+ V LG
Sbjct  487  IAGATEEIEAIYKILRHLHSNHRGVVLTGDLAKPGSLTVSLG  528



>ref|WP_002768243.1| glucose-6-phosphate isomerase [Microcystis aeruginosa]
 emb|CCI02527.1| Glucose-6-phosphate isomerase [Microcystis aeruginosa PCC 9443]
Length=524

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 162/219 (74%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN+V QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  309  SRYLQQLVMESLGKEKDLDGNKVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  368

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+E G T GD+L G+LQGTR ALY N R SIT+T+ EVT R VGAL+ALYE
Sbjct  369  KDRQ-GDSIEVETGSTAGDFLSGLLQGTRQALYENSRHSITITIPEVTSRQVGALIALYE  427

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV  YASLVNINAYHQPGVEAGKKAA  +L LQ++++ V+ E         L L  +A 
Sbjct  428  RAVSFYASLVNINAYHQPGVEAGKKAAASILDLQRKIVQVVRETGTS-----LDLATLAA  482

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + +E IYKI+ H+ AN R+L   G+   P ++++
Sbjct  483  KIGASDQVEAIYKIVRHLNANRRSLTITGDLSKPETIQI  521



>gb|ACB50017.1| glucose-6-phosphate isomerase [Cyanothece sp. ATCC 51142]
Length=531

 Score =   269 bits (687),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 164/219 (75%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  316  SRYLQQLVMESLGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  375

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             D    H +E+EPGVT GD+L G LQGTR AL+ N+R+SIT+T+ +V PR+VGAL+ALYE
Sbjct  376  EDGRDTH-FEIEPGVTSGDFLSGFLQGTRQALFENNRDSITITIPQVNPRTVGALIALYE  434

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            R V  YASLVNINAYHQPGVEAGK  +  +L LQ +V  V+ E S     E L +E +A 
Sbjct  435  RTVSFYASLVNINAYHQPGVEAGKTMSASILDLQTKVQTVIQETS-----EALDIETLAA  489

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  + +++E +YKI+ H+AAN R +  EGN    +++KV
Sbjct  490  KAGSPDEVEFVYKIVRHLAANGRGVALEGNLTDLKTLKV  528



>ref|WP_015078659.1| glucose-6-phosphate isomerase (PGI) [Anabaena sp. 90]
 gb|AFW93495.1| glucose-6-phosphate isomerase (PGI) [Anabaena sp. 90]
Length=528

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/222 (62%), Positives = 164/222 (74%), Gaps = 6/222 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  V QGI VYGNKGSTDQHA++QQLREGV NFF T IEVL
Sbjct  313  SRYLQQLIMESLGKEKDLDGKTVFQGIAVYGNKGSTDQHAYVQQLREGVPNFFATLIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E++PGVT GDYL G L GTR ALY N R+SITVT+ +V  R+VGAL+ALYE
Sbjct  373  EDRQ-GKSVEVDPGVTSGDYLCGFLLGTRQALYENHRDSITVTIPQVNARTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV +YASL+N+NAYHQPGVEAGKKAA  +L LQ RVL VL     K   + L++ E+AD
Sbjct  432  RAVSLYASLINVNAYHQPGVEAGKKAAAVILDLQNRVLEVL-----KTQKKALSISELAD  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFLG  318
               A E++E IYKI+ H+  N+R ++  G+   P S+ V LG
Sbjct  487  MSGAAEEVEAIYKILRHLHTNNRGVVLTGDLAKPGSLTVSLG  528



>ref|WP_009342721.1| glucose-6-phosphate isomerase [Raphidiopsis brookii]
 gb|EFA73320.1| Glucose-6-phosphate isomerase (GPI) (Phosphoglucose isomerase) 
(PGI) (Phosphohexose isomerase) (PHI) [Raphidiopsis brookii 
D9]
Length=528

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 168/221 (76%), Gaps = 6/221 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  V+QGI VYGNKGSTDQHA++QQLREGV NFF T IEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGKTVHQGIAVYGNKGSTDQHAYVQQLREGVPNFFATLIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E++PGVT GDYL G L GTR ALY N R+SITVT+ +V  ++VGAL+ALYE
Sbjct  373  EDRQ-GASSEIDPGVTAGDYLSGFLLGTRQALYENHRDSITVTIPQVNAQTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA  +L LQ++V+ VL E+  K     LT+ EIAD
Sbjct  432  RAVGLYASLVNINAYHQPGVEAGKKAAAVILDLQQKVIKVL-ESERKG----LTIGEIAD  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFL  321
            +  A E +E IYKI+ H+ AN+R ++  G+   P ++ V L
Sbjct  487  KAGASEQVEPIYKILRHLHANNRGVVLTGDLSRPGTLTVTL  527



>ref|WP_015135901.1| glucose-6-phosphate isomerase [Leptolyngbya sp. PCC 7376]
 gb|AFY40178.1| glucose-6-phosphate isomerase [Leptolyngbya sp. PCC 7376]
Length=528

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 163/219 (74%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN+V QGI VYGNKGSTDQHA++QQLREG+ NFF T IEVL
Sbjct  313  SRYLQQLVMESLGKEEDLDGNKVYQGIAVYGNKGSTDQHAYVQQLREGIPNFFATLIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G    +E G T GD+L G L GTR AL+ N+R+SIT+T+QEV PR+VGA++ALYE
Sbjct  373  GDRQ-GESINIENGATAGDFLSGFLLGTREALFENNRDSITLTIQEVNPRTVGAMIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV IYASLVNINAYHQPGVEAGKKAA  VL LQK+V+      + K     LTL+ +A 
Sbjct  432  RAVTIYASLVNINAYHQPGVEAGKKAAASVLDLQKKVV-----DAVKANESALTLDSLAS  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +    E IE+IYKI+ H+AAN R++  EGN   P  + +
Sbjct  487  KVGEQEQIEVIYKIVRHLAANGRSIKLEGNPAKPAELSI  525



>ref|WP_002744648.1| glucose-6-phosphate isomerase [Microcystis aeruginosa]
 emb|CAO87074.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS47454.1| glucose-6-phosphate isomerase [Microcystis aeruginosa DIANCHI905]
Length=524

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 161/219 (74%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  V QGI VYGNKGSTDQHA++QQLREG+ NFF TFIEVL
Sbjct  309  SRYLQQLVMESLGKEKDLDGKTVYQGIAVYGNKGSTDQHAYVQQLREGIPNFFATFIEVL  368

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+E G T GD+L G+LQGTR ALY N R SIT+T+ EVTPR VGAL+ALYE
Sbjct  369  KDRQ-GDSIEVETGSTAGDFLSGLLQGTRQALYENSRHSITITIPEVTPRQVGALIALYE  427

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV  YASLVNINAYHQPGVEAGKKAA  +L LQ++++ V+ E         L L  +A 
Sbjct  428  RAVSFYASLVNINAYHQPGVEAGKKAAASILDLQRKIVQVVRETGTS-----LDLATLAA  482

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + +E IYKI+ H+ AN R+L   G+   P ++++
Sbjct  483  KIGASDQVEAIYKIVRHLNANRRSLTITGDLSKPETIQI  521



>ref|WP_008274806.1| glucose-6-phosphate isomerase [Cyanothece sp. CCY0110]
 gb|EAZ92019.1| glucose-6-phosphate isomerase [Cyanothece sp. CCY0110]
Length=526

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 164/219 (75%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  311  SRYLQQLVMESLGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  370

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             D    H +E+EPGVT GD+L G LQGTR AL+ N R+SIT+T+ +V PR+VGAL+ALYE
Sbjct  371  EDGRDTH-FEIEPGVTSGDFLSGFLQGTRQALFENSRDSITITIPQVNPRTVGALIALYE  429

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV  YASLVNINAYHQPGVEAGKK +  +L LQ +V  V+ E S     E L +E +A 
Sbjct  430  RAVSFYASLVNINAYHQPGVEAGKKMSASILDLQTKVQTVIQETS-----EALDIETLAA  484

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  + +++E +YKI+ H+AAN R +   G+    +++KV
Sbjct  485  KAGSPDEVEFVYKIVRHLAANGRGVALAGDLTDLKTLKV  523



>ref|WP_002737763.1| glucose-6-phosphate isomerase [Microcystis aeruginosa]
 gb|ELP55015.1| glucose-6-phosphate isomerase [Microcystis aeruginosa TAIHU98]
Length=524

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 161/219 (74%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  V QGI VYGNKGSTDQHA++QQLREG+ NFF TFIEVL
Sbjct  309  SRYLQQLVMESLGKEKDLDGKTVYQGIAVYGNKGSTDQHAYVQQLREGIPNFFATFIEVL  368

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+E G T GD+L G+LQGTR ALY N R SIT+T+ EVTPR VGAL+ALYE
Sbjct  369  KDRQ-GDSIEVETGSTAGDFLSGLLQGTRQALYENSRHSITITIPEVTPRQVGALIALYE  427

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV  YASLVNINAYHQPGVEAGKKAA  +L LQ++++ V+ E         L L  +A 
Sbjct  428  RAVSFYASLVNINAYHQPGVEAGKKAAASILDLQRKIVQVVRETGTS-----LDLATLAA  482

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + +E IYKI+ H+ AN R+L   G+   P ++++
Sbjct  483  KIGASDQVEAIYKIVRHLNANRRSLTITGDLSKPETIQI  521



>ref|WP_002752368.1| glucose-6-phosphate isomerase [Microcystis aeruginosa]
 emb|CCH91247.1| Glucose-6-phosphate isomerase [Microcystis aeruginosa PCC 9432]
Length=524

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 161/219 (74%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  V QGI VYGNKGSTDQHA++QQLREG+ NFF TFIEVL
Sbjct  309  SRYLQQLVMESLGKEKDLDGKTVYQGIAVYGNKGSTDQHAYVQQLREGIPNFFATFIEVL  368

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+E G T GD+L G+LQGTR ALY N R SIT+T+ EVTPR VGAL+ALYE
Sbjct  369  KDRQ-GDSIEVETGSTAGDFLSGLLQGTRQALYENSRHSITITIPEVTPRQVGALIALYE  427

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV  YASLVNINAYHQPGVEAGKKAA  +L LQ++++ V+ E         L L  +A 
Sbjct  428  RAVSFYASLVNINAYHQPGVEAGKKAAASILDLQRKIVQVVRETGTS-----LDLATLAA  482

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + +E IYKI+ H+ AN R+L   G+   P ++++
Sbjct  483  KIGASDQVEAIYKIVRHLNANRRSLTITGDLSKPETIQI  521



>ref|WP_002776042.1| glucose-6-phosphate isomerase [Microcystis aeruginosa]
 emb|CCI06467.1| Glucose-6-phosphate isomerase [Microcystis aeruginosa PCC 7941]
Length=524

 Score =   268 bits (684),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 161/219 (74%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  V QGI VYGNKGSTDQHA++QQLREG+ NFF TFIEVL
Sbjct  309  SRYLQQLVMESLGKEKDLDGKTVYQGIAVYGNKGSTDQHAYVQQLREGIPNFFATFIEVL  368

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+E G T GD+L G+LQGTR ALY N R SIT+T+ EVTPR VGAL+ALYE
Sbjct  369  KDRQ-GDSIEVETGSTAGDFLSGLLQGTRQALYENSRHSITITIPEVTPRQVGALIALYE  427

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV  YASLVNINAYHQPGVEAGKKAA  +L LQ++++ V+ E         L L  +A 
Sbjct  428  RAVSFYASLVNINAYHQPGVEAGKKAAASILDLQRKIVQVVRETGTS-----LDLATLAA  482

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + +E IYKI+ H+ AN R+L   G+   P ++++
Sbjct  483  KIGASDQVEAIYKIVRHLNANRRSLTITGDLSKPETIQI  521



>ref|WP_002792485.1| glucose-6-phosphate isomerase [Microcystis aeruginosa]
 emb|CCI22270.1| Glucose-6-phosphate isomerase [Microcystis aeruginosa PCC 9808]
Length=524

 Score =   268 bits (684),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 161/219 (74%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  V QGI VYGNKGSTDQHA++QQLREG+ NFF TFIEVL
Sbjct  309  SRYLQQLVMESLGKEKDLDGKTVYQGIAVYGNKGSTDQHAYVQQLREGIPNFFATFIEVL  368

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+E G T GD+L G+LQGTR ALY N R SIT+T+ EVTPR VGAL+ALYE
Sbjct  369  KDRQ-GDSIEVETGSTAGDFLSGLLQGTRQALYENSRHSITITIPEVTPRQVGALIALYE  427

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV  YASLVNINAYHQPGVEAGKKAA  +L LQ++++ V+ E         L L  +A 
Sbjct  428  RAVSFYASLVNINAYHQPGVEAGKKAAASILDLQRKIVQVVRETGTS-----LDLATLAA  482

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + +E IYKI+ H+ AN R+L   G+   P ++++
Sbjct  483  KIGASDQVEAIYKIVRHLNANRRSLTITGDLSKPETIQI  521



>ref|WP_024971160.1| glucose-6-phosphate isomerase [Microcystis aeruginosa]
Length=524

 Score =   268 bits (684),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 161/219 (74%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  V QGI VYGNKGSTDQHA++QQLREG+ NFF TFIEVL
Sbjct  309  SRYLQQLVMESLGKEKDLDGKTVYQGIAVYGNKGSTDQHAYVQQLREGIPNFFATFIEVL  368

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+E G T GD+L G+LQGTR ALY N R SIT+T+ EVTPR VGAL+ALYE
Sbjct  369  KDRQ-GDSIEVETGSTAGDFLSGLLQGTRQALYENSRHSITITIPEVTPRQVGALIALYE  427

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV  YASLVNINAYHQPGVEAGKKAA  +L LQ++++ V+ E         L L  +A 
Sbjct  428  RAVSFYASLVNINAYHQPGVEAGKKAAASILDLQRKIVQVVRETGTS-----LDLATLAA  482

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A + +E IYKI+ H+ AN R+L   G+   P ++++
Sbjct  483  KIGASDQVEAIYKIVRHLNANRRSLTITGDLSKPETIQI  521



>ref|WP_006510266.1| glucose-6-phosphate isomerase [Xenococcus sp. PCC 7305]
 gb|ELS02616.1| glucose-6-phosphate isomerase [Xenococcus sp. PCC 7305]
Length=531

 Score =   268 bits (684),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 165/219 (75%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN VNQGI VYGNKGSTDQHA++QQLREGV+NFF+TFIEVL
Sbjct  313  SRYLQQLIMESLGKEKDLDGNIVNQGIAVYGNKGSTDQHAYVQQLREGVNNFFITFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+EPG+T GDYL G L GTR AL    R+S+T+T+ +V   +VGA++ALYE
Sbjct  373  EDRE-GAPVEVEPGITSGDYLLGFLLGTREALNEKQRDSVTITISQVNEITVGAMIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV +YASLVNINAYHQPGVEAGKKAA  VL LQ RV+  L+  +       +++ ++A 
Sbjct  432  RAVSLYASLVNINAYHQPGVEAGKKAAASVLQLQTRVIEELSHTASG-----ISIADLAQ  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A  DIE+IYKI+ H+ AN R ++ EG+   P S+KV
Sbjct  487  KAQASNDIEVIYKILRHLHANKRNVLLEGDFSKPDSLKV  525



>ref|WP_006277122.1| glucose-6-phosphate isomerase [Cylindrospermopsis raciborskii]
 gb|EFA69935.1| Phosphoglucose isomerase (PGI) [Cylindrospermopsis raciborskii 
CS-505]
Length=528

 Score =   267 bits (682),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 164/221 (74%), Gaps = 6/221 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDG  V QGI VYGNKGSTDQHA++QQLREGV NFF T IEVL
Sbjct  313  SRYLQQLVMESLGKERDLDGKTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATLIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E++PGVT GDYL G L GTR ALY N R+SITVT+ +V  ++VGAL+ALYE
Sbjct  373  EDRQ-GASSEIDPGVTAGDYLSGFLLGTRQALYENHRDSITVTIPQVNAQTVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVN+NAYHQPGVEAGKKAA  +L LQ +V+ VL         + LT+ EIAD
Sbjct  432  RAVGLYASLVNVNAYHQPGVEAGKKAAAVILDLQNKVIKVLQSEK-----KGLTIGEIAD  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFL  321
            +  A E +E IYKI+ H+ AN+R ++  G+   P ++ V L
Sbjct  487  KAGASEQVEPIYKILRHLHANNRGVVLTGDLSKPGTLTVSL  527



>ref|WP_022609225.1| glucose-6-phosphate isomerase [Rubidibacter lacunae]
 gb|ERN39900.1| glucose-6-phosphate isomerase [Rubidibacter lacunae KORDI 51-2]
Length=531

 Score =   266 bits (681),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 166/218 (76%), Gaps = 6/218 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V+QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKESDLDGNIVHQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+EPG T GDYL G LQGTRSALY N R+SIT+T+ +V P+ VGA++ALYE
Sbjct  373  VDRV-GDSPEIEPGATAGDYLSGFLQGTRSALYENGRDSITITLPDVNPQVVGAILALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV  YASL NINAYHQPGVEAGKKAA  +L LQK+++  L  AS      PL+L ++A 
Sbjct  432  RAVSFYASLTNINAYHQPGVEAGKKAAASILTLQKQLVEALKSASG-----PLSLAKVAA  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVK  330
               A +D+E  Y I+ H++AN+R ++ EG+ G P +++
Sbjct  487  AAGAPDDVEAAYIILRHLSANERGVVLEGDLGKPSTLR  524



>ref|WP_009547551.1| MULTISPECIES: glucose-6-phosphate isomerase [Cyanothece]
 gb|ACB54524.1| glucose-6-phosphate isomerase [Cyanothece sp. ATCC 51142]
Length=524

 Score =   266 bits (680),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 163/219 (74%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE D DGN V+QG+ VYGNKGSTDQHA++QQLREG+ NFF TFIEVL
Sbjct  309  SRYLQQLVMESLGKEQDRDGNIVHQGLAVYGNKGSTDQHAYVQQLREGIPNFFATFIEVL  368

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DRP G   E+EP  T GD+L G L GTR ALY N R+SIT+T+ +V PR+VGAL+ALYE
Sbjct  369  EDRP-GKSLEVEPEATSGDFLSGFLLGTRLALYDNHRDSITITIPQVNPRTVGALIALYE  427

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVNINAYHQPGVEAGKKAA  +L LQ+ VL VL  +S      PL + +++ 
Sbjct  428  RAVGLYASLVNINAYHQPGVEAGKKAAASILDLQRDVLGVLKASST-----PLNITDLSA  482

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +  A E  E +Y+I+ H+AAN R +   G+   P ++ +
Sbjct  483  KAGASEQCETVYQIVRHLAANQRGVTLTGDRAKPANLTI  521



>ref|WP_036306529.1| glucose-6-phosphate isomerase, partial [Methyloglobulus morosus]
Length=526

 Score =   266 bits (680),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 161/219 (74%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE D DG  V++GITVYGNKGSTDQHA++QQLREG+ +FF TFIEVL
Sbjct  313  SRYLQQLVMESLGKELDRDGKVVHEGITVYGNKGSTDQHAYVQQLREGLPDFFATFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
             DR  G   E+EP  T GD+L G+LQGTR ALY N RESIT+TV  V  R VGAL+ALYE
Sbjct  373  EDRK-GPSIEIEPDFTSGDFLSGLLQGTRQALYDNQRESITITVPRVDTRCVGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG YASLVNINAYHQPGVEAGKKAA + L LQK +LAVL     K   +PLTL  +A+
Sbjct  432  RAVGFYASLVNINAYHQPGVEAGKKAAADFLLLQKNILAVL-----KTTRQPLTLSALAE  486

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            +    + +E IYK++ H++ N R ++  GN   P  + V
Sbjct  487  KIGVPDQVETIYKVVRHLSMNPRQIVLHGNLAKPVELSV  525



>ref|WP_015838689.1| glucose-6-phosphate isomerase [Geobacter sp. M21]
 sp|C6E5H7.1|G6PI_GEOSM RecName: Full=Glucose-6-phosphate isomerase; Short=GPI; AltName: 
Full=Phosphoglucose isomerase; Short=PGI; AltName: Full=Phosphohexose 
isomerase; Short=PHI [Geobacter sp. M21]
 gb|ACT19501.1| Glucose-6-phosphate isomerase [Geobacter sp. M21]
Length=530

 Score =   266 bits (680),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/201 (66%), Positives = 158/201 (79%), Gaps = 5/201 (2%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE D DGNRV QGI VYGNKGSTDQHA++QQLREGVHNFFVTFIEVL
Sbjct  313  SRYLQQLIMESLGKELDRDGNRVLQGIAVYGNKGSTDQHAYVQQLREGVHNFFVTFIEVL  372

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +DR  G   E+EPG T GDYL G  QGTR+ALY   RES+T+TV+E++P S+GAL+ALYE
Sbjct  373  KDRE-GPSLEVEPGATSGDYLSGFFQGTRAALYEKGRESVTITVRELSPVSIGALIALYE  431

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAVG+YASLVN+NAYHQPGVEAGKKAAG VL LQ  ++ +L     ++P    T EE+A 
Sbjct  432  RAVGLYASLVNVNAYHQPGVEAGKKAAGAVLKLQGEIVEMLR----RQPNREFTGEEMAL  487

Query  443  RCHALEDIEMIYKIIAHMAAN  381
                 E++E ++ I+ H+AAN
Sbjct  488  ALARPEEVETVFMILRHLAAN  508



>ref|WP_011429295.1| glucose-6-phosphate isomerase [Synechococcus sp. JA-3-3Ab]
 sp|Q2JX86.1|G6PI_SYNJA RecName: Full=Glucose-6-phosphate isomerase; Short=GPI; AltName: 
Full=Phosphoglucose isomerase; Short=PGI; AltName: Full=Phosphohexose 
isomerase; Short=PHI [Synechococcus sp. JA-3-3Ab]
 gb|ABC98606.1| glucose-6-phosphate isomerase [Synechococcus sp. JA-3-3Ab]
Length=532

 Score =   265 bits (676),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 165/220 (75%), Gaps = 6/220 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGK  DL GNRV QG+TVYGNKG+TDQHA++QQLR+G++NFFVTFIEVL
Sbjct  313  SRYLQQLVMESLGKSHDLQGNRVEQGLTVYGNKGTTDQHAYVQQLRDGLNNFFVTFIEVL  372

Query  803  RDRPPGHDWEL-EPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALY  627
            +DR PG      EP VT GDYL G+LQGTR ALY N R+S+T+T+  V  RSVGAL+ALY
Sbjct  373  QDREPGIPSPFVEPEVTSGDYLDGLLQGTRQALYENGRDSVTITLPRVDARSVGALIALY  432

Query  626  ERAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIA  447
            ERAVG+YASL+ +NAYHQPGVEAGKKAA  VL LQ++VL V+ E         LTL ++A
Sbjct  433  ERAVGLYASLIQVNAYHQPGVEAGKKAASAVLQLQRQVLEVMREQKGS-----LTLPQLA  487

Query  446  DRCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            ++    E IE +Y I+ H+ AN R+L+  G+ G P  + +
Sbjct  488  EKLSCPERIETLYWIVRHLQANGRSLVLVGDPGRPLELSI  527



>ref|WP_019500287.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=531

 Score =   265 bits (676),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 166/220 (75%), Gaps = 7/220 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREG+ NFF+TFIEVL
Sbjct  314  SRYLQQLVMESLGKEKDLDGNVVYQGIAVYGNKGSTDQHAYVQQLREGIPNFFLTFIEVL  373

Query  803  RDRPP-GHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALY  627
             D        ELEPGVT GDYL G+LQG+R ALY N R+SITVT+  V+  +VGAL+ALY
Sbjct  374  ADTTDNSFHPELEPGVTSGDYLSGLLQGSRQALYDNGRDSITVTIPTVSGVTVGALIALY  433

Query  626  ERAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIA  447
            ERAV  YASLVNINAYHQPGVEAGKKAA +VL LQKRV+  L   +     +P+++ ++A
Sbjct  434  ERAVSFYASLVNINAYHQPGVEAGKKAAAQVLELQKRVVRALTTEA-----QPISIYQLA  488

Query  446  DRCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
             +  A+ D E IY+I+ H+AAN +  + EG+ G P S+ V
Sbjct  489  AKIDAISDTETIYRILRHLAANGKVHL-EGSMGKPSSLLV  527



>ref|WP_007305399.1| glucose-6-phosphate isomerase [Crocosphaera watsonii]
 gb|EAM50962.1| Glucose-6-phosphate isomerase [Crocosphaera watsonii WH 8501]
Length=528

 Score =   264 bits (675),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 164/221 (74%), Gaps = 10/221 (5%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  372

Query  803  RDRPPGHD--WELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVAL  630
             D   G D  +E+EPGVT GD+L G LQGTR AL+ N+R+SIT+T+ +V PR VGAL+AL
Sbjct  373  ED---GRDTLFEIEPGVTSGDFLSGFLQGTRQALFENNRDSITITIPQVNPRIVGALIAL  429

Query  629  YERAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEI  450
            YER V  YASLVNINAYHQPGVEAGKK A  +L LQ +V  V+ E S     E L +  +
Sbjct  430  YERTVSFYASLVNINAYHQPGVEAGKKMAASILDLQTKVQTVIKETS-----EVLDMATL  484

Query  449  ADRCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            A++  + +++E +YKI+ H+AAN R +  EG     +++KV
Sbjct  485  AEKAGSPDEVESVYKIVRHLAANGRGVSLEGELTDLKTLKV  525



>ref|WP_007310646.1| glucose-6-phosphate isomerase [Crocosphaera watsonii]
 gb|EHJ12892.1| Glucose-6-phosphate isomerase [Crocosphaera watsonii WH 0003]
 emb|CCQ63424.1| Glucose-6-phosphate isomerase [Crocosphaera watsonii WH 0401]
 emb|CCQ48884.1| Glucose-6-phosphate isomerase [Crocosphaera watsonii WH 8502]
Length=528

 Score =   264 bits (675),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 164/221 (74%), Gaps = 10/221 (5%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  313  SRYLQQLVMESLGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  372

Query  803  RDRPPGHD--WELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVAL  630
             D   G D  +E+EPGVT GD+L G LQGTR AL+ N+R+SIT+T+ +V PR VGAL+AL
Sbjct  373  ED---GRDTLFEIEPGVTSGDFLSGFLQGTRQALFENNRDSITITIPQVNPRIVGALIAL  429

Query  629  YERAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEI  450
            YER V  YASLVNINAYHQPGVEAGKK A  +L LQ +V  V+ E S     E L +  +
Sbjct  430  YERTVSFYASLVNINAYHQPGVEAGKKMAASILDLQTKVQTVIKETS-----EVLDMATL  484

Query  449  ADRCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
            A++  + +++E +YKI+ H+AAN R +  EG     +++KV
Sbjct  485  AEKAGSPDEVESVYKIVRHLAANGRGVSLEGELTDLKTLKV  525



>ref|WP_040054149.1| glucose-6-phosphate isomerase [Candidatus Atelocyanobacterium 
thalassa]
 gb|KFF41987.1| glucose-6-phosphate isomerase [Candidatus Atelocyanobacterium 
thalassa isolate SIO64986]
Length=526

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 163/219 (74%), Gaps = 6/219 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V+QGI VYGNKGSTDQHA++QQLR+GV NFF TFIEVL
Sbjct  311  SRYLQQLVMESLGKEKDLDGNIVHQGIAVYGNKGSTDQHAYVQQLRDGVSNFFATFIEVL  370

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +D    H  ELEPGVT GDYL   LQGTR ALY N R+SIT+T+ EV PR++GAL+A+YE
Sbjct  371  KDGQ-NHPLELEPGVTSGDYLSVFLQGTRQALYENKRDSITITIPEVKPRTIGALIAMYE  429

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            R +  YASLVNINAYHQPGVEAGK+ A  +L LQ +V  V+ + + K  +E L L+    
Sbjct  430  RTISFYASLVNINAYHQPGVEAGKQMAASILDLQTKVQTVMKQTTGKINIETLALQ----  485

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKV  327
                 E++E +YKI+ H+AAN+R ++ EG+     S++V
Sbjct  486  -TGYPEEVEAVYKIVRHLAANNRNIVLEGDFSDLLSLEV  523



>ref|WP_009625633.1| Glucose-6-phosphate isomerase [Pseudanabaena biceps]
 gb|ELS34232.1| Glucose-6-phosphate isomerase [Pseudanabaena biceps PCC 7429]
Length=530

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/221 (62%), Positives = 165/221 (75%), Gaps = 7/221 (3%)
 Frame = -2

Query  983  SRYLQQLXMESLGKEFDLDGNRVNQGITVYGNKGSTDQHAFIQQLREGVHNFFVTFIEVL  804
            SRYLQQL MESLGKE DLDGN V QGI VYGNKGSTDQHA++QQLREGV NFF TFIEVL
Sbjct  314  SRYLQQLVMESLGKEKDLDGNTVYQGIAVYGNKGSTDQHAYVQQLREGVPNFFATFIEVL  373

Query  803  RDRPPGHDWELEPGVTCGDYLFGMLQGTRSALYANDRESITVTVQEVTPRSVGALVALYE  624
            +D    H  E+E GV  GDYL G LQGTRSALY N R+SITVT+  V+  +VGAL+ALYE
Sbjct  374  QDSAKTHP-EVEEGVVTGDYLLGFLQGTRSALYDNGRDSITVTIPVVSELTVGALIALYE  432

Query  623  RAVGIYASLVNINAYHQPGVEAGKKAAGEVLALQKRVLAVLNEASCKEPVEPLTLEEIAD  444
            RAV  YASLVNINAYHQPGVEAGKKA  +VLALQK+++  L  ++       L+L+EIA 
Sbjct  433  RAVSFYASLVNINAYHQPGVEAGKKAGAKVLALQKKLVDTLRSSTVS-----LSLQEIAV  487

Query  443  RCHALEDIEMIYKIIAHMAANDRALIAEGNCGSPRSVKVFL  321
            +  AL++IE +Y I  H+ AN + L  EG+   P ++K+ L
Sbjct  488  KIDALDEIESLYHIARHLHANCKILF-EGDLSKPMTLKLML  527



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2420966944598