BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3936

Length=784
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006344418.1|  PREDICTED: uncharacterized protein LOC102593974    288   2e-88   Solanum tuberosum [potatoes]
ref|XP_010316260.1|  PREDICTED: uncharacterized protein LOC101259498    285   2e-87   Solanum lycopersicum
ref|XP_009617498.1|  PREDICTED: uncharacterized protein LOC104109835    282   2e-86   Nicotiana tomentosiformis
ref|XP_009757080.1|  PREDICTED: uncharacterized protein LOC104209989    280   2e-85   Nicotiana sylvestris
ref|XP_002517475.1|  conserved hypothetical protein                     275   4e-84   
ref|XP_010034618.1|  PREDICTED: uncharacterized protein LOC104423879    271   2e-83   
emb|CDP02203.1|  unnamed protein product                                273   4e-83   Coffea canephora [robusta coffee]
gb|ACU17598.1|  unknown                                                 258   1e-82   Glycine max [soybeans]
ref|XP_002277137.1|  PREDICTED: uncharacterized protein LOC100249048    272   2e-82   Vitis vinifera
gb|KHN13239.1|  hypothetical protein glysoja_016416                     258   3e-82   Glycine soja [wild soybean]
emb|CAN79924.1|  hypothetical protein VITISV_042444                     269   5e-82   Vitis vinifera
gb|EYU34108.1|  hypothetical protein MIMGU_mgv1a0009451mg               265   7e-82   Erythranthe guttata [common monkey flower]
ref|XP_002324037.1|  hypothetical protein POPTR_0017s11480g             270   1e-81   Populus trichocarpa [western balsam poplar]
ref|XP_006431091.1|  hypothetical protein CICLE_v10011233mg             270   1e-81   Citrus clementina [clementine]
ref|XP_011005070.1|  PREDICTED: uncharacterized protein LOC105111424    270   1e-81   Populus euphratica
ref|XP_010112090.1|  hypothetical protein L484_001949                   269   2e-81   Morus notabilis
ref|XP_012082994.1|  PREDICTED: uncharacterized protein LOC105642693    268   5e-81   Jatropha curcas
ref|XP_006482546.1|  PREDICTED: uncharacterized protein LOC102622976    268   5e-81   Citrus sinensis [apfelsine]
ref|XP_011098578.1|  PREDICTED: uncharacterized protein LOC105177216    268   6e-81   Sesamum indicum [beniseed]
gb|KDO72497.1|  hypothetical protein CISIN_1g005854mg                   268   7e-81   Citrus sinensis [apfelsine]
ref|XP_002305369.2|  hypothetical protein POPTR_0004s12285g             264   2e-79   Populus trichocarpa [western balsam poplar]
ref|XP_010242378.1|  PREDICTED: uncharacterized protein LOC104586747    263   3e-79   Nelumbo nucifera [Indian lotus]
ref|XP_011009451.1|  PREDICTED: uncharacterized protein LOC105114573    263   4e-79   Populus euphratica
ref|XP_004489377.1|  PREDICTED: uncharacterized protein LOC101510315    260   9e-78   Cicer arietinum [garbanzo]
ref|XP_007032463.1|  Uncharacterized protein TCM_018393                 258   4e-77   
ref|XP_008443429.1|  PREDICTED: uncharacterized protein LOC103487020    256   1e-76   Cucumis melo [Oriental melon]
gb|KEH24982.1|  transmembrane protein, putative                         256   2e-76   Medicago truncatula
ref|XP_003554877.1|  PREDICTED: uncharacterized protein LOC100818221    254   1e-75   Glycine max [soybeans]
ref|XP_007151203.1|  hypothetical protein PHAVU_004G026600g             253   2e-75   Phaseolus vulgaris [French bean]
gb|KJB33671.1|  hypothetical protein B456_006G025500                    253   2e-75   Gossypium raimondii
gb|KGN59588.1|  hypothetical protein Csa_3G827300                       252   3e-75   
ref|XP_004147492.1|  PREDICTED: uncharacterized protein LOC101211026    252   5e-75   Cucumis sativus [cucumbers]
ref|XP_007215004.1|  hypothetical protein PRUPE_ppa002412mg             252   5e-75   Prunus persica
ref|XP_004304942.1|  PREDICTED: uncharacterized protein LOC101303053    249   6e-74   Fragaria vesca subsp. vesca
ref|XP_008230732.1|  PREDICTED: uncharacterized protein LOC103329974    249   6e-74   Prunus mume [ume]
ref|XP_009342868.1|  PREDICTED: uncharacterized protein LOC103934833    248   3e-73   Pyrus x bretschneideri [bai li]
ref|XP_009389928.1|  PREDICTED: uncharacterized protein LOC103976...    246   1e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001057949.2|  Os06g0585200                                       243   2e-72   
ref|XP_008809720.1|  PREDICTED: uncharacterized protein LOC103721331    244   3e-72   Phoenix dactylifera
ref|XP_006656187.1|  PREDICTED: uncharacterized protein LOC102704152    241   6e-72   
ref|XP_008341539.1|  PREDICTED: uncharacterized protein LOC103404413    244   6e-72   
dbj|BAD68736.1|  unknown protein                                        243   1e-71   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010528320.1|  PREDICTED: uncharacterized protein LOC104805448    243   2e-71   Tarenaya hassleriana [spider flower]
gb|EAZ01463.1|  hypothetical protein OsI_23499                          243   2e-71   Oryza sativa Indica Group [Indian rice]
ref|XP_009347072.1|  PREDICTED: uncharacterized protein LOC103938753    243   3e-71   Pyrus x bretschneideri [bai li]
ref|XP_010670317.1|  PREDICTED: uncharacterized protein LOC104887400    240   2e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002437205.1|  hypothetical protein SORBIDRAFT_10g022840          240   3e-70   Sorghum bicolor [broomcorn]
ref|XP_010915151.1|  PREDICTED: uncharacterized protein LOC105040362    239   3e-70   Elaeis guineensis
gb|ACN26663.1|  unknown                                                 239   5e-70   Zea mays [maize]
ref|XP_008348059.1|  PREDICTED: uncharacterized protein LOC103411189    239   6e-70   
ref|NP_001145995.1|  uncharacterized protein LOC100279525 precursor     239   6e-70   
ref|XP_008379334.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    237   2e-69   
ref|XP_004967214.1|  PREDICTED: uncharacterized protein LOC101771100    237   3e-69   Setaria italica
ref|XP_002875468.1|  predicted protein                                  229   6e-69   
ref|XP_009399781.1|  PREDICTED: uncharacterized protein LOC103984084    234   5e-68   
ref|XP_003560633.1|  PREDICTED: uncharacterized protein LOC100821666    233   1e-67   Brachypodium distachyon [annual false brome]
gb|EMT25422.1|  hypothetical protein F775_30246                         228   7e-67   
emb|CDX85216.1|  BnaC07g25270D                                          230   1e-66   
ref|XP_006290676.1|  hypothetical protein CARUB_v10016768mg             230   2e-66   Capsella rubella
ref|XP_009151854.1|  PREDICTED: uncharacterized protein LOC103875136    229   4e-66   Brassica rapa
gb|KFK33751.1|  hypothetical protein AALP_AA5G055400                    228   6e-66   Arabis alpina [alpine rockcress]
ref|NP_189514.1|  uncharacterized protein                               228   6e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010502941.1|  PREDICTED: uncharacterized protein LOC104780160    226   3e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010514583.1|  PREDICTED: uncharacterized protein LOC104790511    226   5e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010425653.1|  PREDICTED: uncharacterized protein LOC104710713    225   8e-65   Camelina sativa [gold-of-pleasure]
ref|XP_006842137.1|  PREDICTED: uncharacterized protein LOC18431963     225   1e-64   Amborella trichopoda
gb|EMS54330.1|  hypothetical protein TRIUR3_29153                       223   4e-64   Triticum urartu
gb|EPS64700.1|  hypothetical protein M569_10078                         219   8e-63   Genlisea aurea
ref|XP_001782502.1|  predicted protein                                  197   1e-55   
ref|XP_007224785.1|  hypothetical protein PRUPE_ppa023863mg             185   3e-53   
ref|XP_002991685.1|  hypothetical protein SELMODRAFT_236350             177   3e-47   Selaginella moellendorffii
gb|AFK47156.1|  unknown                                                 120   7e-31   Medicago truncatula
ref|XP_009389929.1|  PREDICTED: uncharacterized protein LOC103976...    127   7e-30   
ref|XP_002991053.1|  hypothetical protein SELMODRAFT_132777             126   4e-29   
ref|XP_002991052.1|  hypothetical protein SELMODRAFT_429443             113   3e-26   
ref|XP_002991050.1|  hypothetical protein SELMODRAFT_429438             113   3e-26   Selaginella moellendorffii
ref|XP_002994698.1|  hypothetical protein SELMODRAFT_449406             117   4e-26   
ref|XP_005826412.1|  hypothetical protein GUITHDRAFT_114391           86.3    2e-15   Guillardia theta CCMP2712
ref|XP_002501279.1|  predicted protein                                55.5    2e-05   Micromonas commoda
ref|XP_004334562.1|  hypothetical protein ACA1_329450                 52.4    2e-04   Acanthamoeba castellanii str. Neff



>ref|XP_006344418.1| PREDICTED: uncharacterized protein LOC102593974 [Solanum tuberosum]
Length=678

 Score =   288 bits (736),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 149/161 (93%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFSE+SSLSFVQKDAARRNVLLTSLN+S+ SA++V+ESI++HGGERKLLKHN
Sbjct  518  SVGQTPFGPFSEVSSLSFVQKDAARRNVLLTSLNFSISSALEVLESISAHGGERKLLKHN  577

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            QL EF+QRWNLFKYKLDK VSALSHFDFEMALYYLR+SDH IYAIHSLVYHASQ+LEASL
Sbjct  578  QLTEFMQRWNLFKYKLDKAVSALSHFDFEMALYYLRASDHDIYAIHSLVYHASQELEASL  637

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW SVSMS G+ I LVY+ AKRDK F NKRKQF
Sbjct  638  VCFKDPPFPWASVSMSAGVFIFLVYVWAKRDKFFSNKRKQF  678



>ref|XP_010316260.1| PREDICTED: uncharacterized protein LOC101259498 [Solanum lycopersicum]
Length=678

 Score =   285 bits (729),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFSE+SSLSFVQKDAARRNVLLTSLN+S+ SA++V ESI++HGGERKLLKHN
Sbjct  518  SVGQTPFGPFSEVSSLSFVQKDAARRNVLLTSLNFSISSALEVFESISAHGGERKLLKHN  577

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            QL EF+QRWNLFKYKLDK VSALSHFDFEMALYYLR+SDH IYAIHSLVYHASQ+LEASL
Sbjct  578  QLTEFMQRWNLFKYKLDKAVSALSHFDFEMALYYLRASDHDIYAIHSLVYHASQELEASL  637

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW SVSMS G+ I L+Y+ AKRDK F NKRKQF
Sbjct  638  VCFKDPPFPWASVSMSAGVFIFLLYVWAKRDKFFSNKRKQF  678



>ref|XP_009617498.1| PREDICTED: uncharacterized protein LOC104109835 [Nicotiana tomentosiformis]
Length=677

 Score =   282 bits (722),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFSE+SSLSFVQKDAARRNVLLTSLNYS+ SA++V+ SIA+HGGERKLLKHN
Sbjct  517  SVGQTPFGPFSEVSSLSFVQKDAARRNVLLTSLNYSITSALEVLGSIAAHGGERKLLKHN  576

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            QL EF+QRWNLFKYKLDK VSALSHFDFEMALYY+RSSDH IYAIHSLVYHASQ+LEASL
Sbjct  577  QLTEFMQRWNLFKYKLDKAVSALSHFDFEMALYYMRSSDHDIYAIHSLVYHASQELEASL  636

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
             CFKDPPFPW SVSM+ G++I L+Y+  KRDK F NKRKQF
Sbjct  637  DCFKDPPFPWASVSMTAGVIIFLLYVWVKRDKFFSNKRKQF  677



>ref|XP_009757080.1| PREDICTED: uncharacterized protein LOC104209989 [Nicotiana sylvestris]
Length=676

 Score =   280 bits (715),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFSE+SSLSFVQKDAARRNVLLTSLNYS+ SA++V+ SI +HGGERKLLKHN
Sbjct  516  SIGQTPFGPFSEVSSLSFVQKDAARRNVLLTSLNYSITSALEVLGSIDAHGGERKLLKHN  575

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            QL EF+QRWNLFKYKLDK VSALSHFDFEMALYY+RSSDH IYAIHSLVYHASQ+LEASL
Sbjct  576  QLTEFVQRWNLFKYKLDKAVSALSHFDFEMALYYMRSSDHDIYAIHSLVYHASQELEASL  635

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
             CFKDPPFPW SVSM+ G++I L+Y+  KRDK F NKRKQF
Sbjct  636  DCFKDPPFPWGSVSMTAGVIIFLLYVWVKRDKFFSNKRKQF  676



>ref|XP_002517475.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45017.1| conserved hypothetical protein [Ricinus communis]
Length=617

 Score =   275 bits (703),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFSE SSLSFVQKDAARRNVLLTSLNYS+ SAIDV+ESIA+HGG+RKLLK +
Sbjct  457  SVGQTPFGPFSETSSLSFVQKDAARRNVLLTSLNYSITSAIDVLESIAAHGGDRKLLKQS  516

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            Q  EFIQRWNLFKYKLDK VSA+SH DFEMALYY+RSSDH +YAIHSLVYHASQDLEASL
Sbjct  517  QHVEFIQRWNLFKYKLDKAVSAMSHLDFEMALYYMRSSDHDLYAIHSLVYHASQDLEASL  576

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            +CFKDPPFPW SVS+S      L Y+ AKRDKLFRNKRKQF
Sbjct  577  LCFKDPPFPWGSVSISAIGFFALFYVFAKRDKLFRNKRKQF  617



>ref|XP_010034618.1| PREDICTED: uncharacterized protein LOC104423879, partial [Eucalyptus 
grandis]
Length=535

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFSEISSLSFVQKDAARRNVLLTSLNYS+ SA+DV+ESI SHGG+R LLK N
Sbjct  375  SVGQTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSITSALDVLESIMSHGGDRNLLKLN  434

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EFIQRWNLFKYKLDK VSALSHFDFEMALYYLRSSDH +Y+IHSLVY ASQ+LEASL
Sbjct  435  RYAEFIQRWNLFKYKLDKAVSALSHFDFEMALYYLRSSDHDLYSIHSLVYQASQELEASL  494

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPP PW S+S S+G+++  +Y+  KRD++FRNKRKQF
Sbjct  495  VCFKDPPLPWGSISFSVGVVLAFLYVWTKRDRIFRNKRKQF  535



>emb|CDP02203.1| unnamed protein product [Coffea canephora]
Length=675

 Score =   273 bits (699),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFS+ISSLSFVQKDAARRNVLLTS NY++ SA+DV+ESI++HGGE+KLL+ N
Sbjct  515  SVGQTPFGPFSDISSLSFVQKDAARRNVLLTSFNYTIGSALDVLESISAHGGEKKLLRQN  574

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            Q  EF+QRWNLFKYKLDK +SALSHFD++MALYYLRSSDH +YA HSLVYHASQDLEASL
Sbjct  575  QQTEFLQRWNLFKYKLDKAISALSHFDYDMALYYLRSSDHDLYAFHSLVYHASQDLEASL  634

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
             CFKDPPFPW SVSM+ G+   LVYI AKR+ LF+NKRKQF
Sbjct  635  TCFKDPPFPWFSVSMAAGVFFTLVYIYAKRETLFQNKRKQF  675



>gb|ACU17598.1| unknown [Glycine max]
Length=202

 Score =   258 bits (659),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFSE+ SLSFVQKDAARRNVLLTSLNYS+ SAIDV++S+ +HGG + LLK  
Sbjct  42   SMGQTPFGPFSEMLSLSFVQKDAARRNVLLTSLNYSITSAIDVLQSVETHGGAKSLLKQK  101

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            Q  EF+QRWNLFKYKL+K VSALSH DF+MAL+YLRSSDH +YAIHS+VYHASQ++EASL
Sbjct  102  QHVEFVQRWNLFKYKLNKAVSALSHLDFDMALFYLRSSDHDLYAIHSIVYHASQEIEASL  161

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCF+DPPFPW SVS+S+   + + YI A+RDKLFRNKRKQF
Sbjct  162  VCFRDPPFPWGSVSISVSAFLAVSYIYARRDKLFRNKRKQF  202



>ref|XP_002277137.1| PREDICTED: uncharacterized protein LOC100249048 [Vitis vinifera]
Length=673

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFSE  SLSFVQKDAARRN+LLTSLNYSL SAIDV+ESIA+HGGER LLKHN
Sbjct  513  SVGQTPFGPFSETLSLSFVQKDAARRNILLTSLNYSLTSAIDVLESIAAHGGERNLLKHN  572

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EF+QRWNLFKYKLDK VS+LSHFDFEMALY+LRSSDH +YAIHSLVYHASQ++EASL
Sbjct  573  RHVEFVQRWNLFKYKLDKAVSSLSHFDFEMALYFLRSSDHDLYAIHSLVYHASQEMEASL  632

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW S S S+ ++  L Y+  KRDKLFRNKRKQF
Sbjct  633  VCFKDPPFPWASFSGSVVVVFALFYVYTKRDKLFRNKRKQF  673



>gb|KHN13239.1| hypothetical protein glysoja_016416 [Glycine soja]
Length=226

 Score =   258 bits (659),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFSE+ SLSFVQKDAARRNVLLTSLNYS+ SAIDV++S+ +HGG + LLK  
Sbjct  66   SMGQTPFGPFSEMLSLSFVQKDAARRNVLLTSLNYSITSAIDVLQSVETHGGAKNLLKQK  125

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            Q  EF+QRWNLFKYKL+K VSALSH DF+MAL+YLRSSDH +YAIHS+VYHASQ++EASL
Sbjct  126  QHVEFVQRWNLFKYKLNKAVSALSHLDFDMALFYLRSSDHDLYAIHSIVYHASQEIEASL  185

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCF+DPPFPW SVS+S    + + YI A+RDKLFRNKRKQF
Sbjct  186  VCFRDPPFPWGSVSISASAFLAVSYIYARRDKLFRNKRKQF  226



>emb|CAN79924.1| hypothetical protein VITISV_042444 [Vitis vinifera]
Length=615

 Score =   269 bits (688),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFSE  SLSFVQKDAARRN+LLTSLNYSL SAIDV+ESIA+ GGER LLKHN
Sbjct  455  SVGQTPFGPFSETLSLSFVQKDAARRNILLTSLNYSLTSAIDVLESIAAXGGERNLLKHN  514

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EF+QRWNLFKYKLDK VS+LSHFDFEMALY+LRSSDH +YAIHSLVYHASQ++EASL
Sbjct  515  RHVEFVQRWNLFKYKLDKAVSSLSHFDFEMALYFLRSSDHDLYAIHSLVYHASQEMEASL  574

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW S S S+ ++  L Y+  KRDKLFRNKRKQF
Sbjct  575  VCFKDPPFPWASFSGSVVVVFALFYVYTKRDKLFRNKRKQF  615



>gb|EYU34108.1| hypothetical protein MIMGU_mgv1a0009451mg, partial [Erythranthe 
guttata]
Length=472

 Score =   265 bits (677),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFSEISSLSFVQKDAARRNVLLT+LNY++ S IDV++SIA+HGG+RKLLKH 
Sbjct  312  SIGQTPFGPFSEISSLSFVQKDAARRNVLLTTLNYTITSGIDVLDSIAAHGGDRKLLKHT  371

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EF+QRWNLF+YKLD+++SA+SHFD+EMALYYLRSSDH +YAIH+LVY ASQ+LEASL
Sbjct  372  RHTEFVQRWNLFRYKLDRSISAMSHFDYEMALYYLRSSDHDLYAIHNLVYQASQELEASL  431

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW S  +S GIL    +  AKRDKLF+NKRKQF
Sbjct  432  VCFKDPPFPWTSFLLSAGILFAFFFAYAKRDKLFQNKRKQF  472



>ref|XP_002324037.1| hypothetical protein POPTR_0017s11480g [Populus trichocarpa]
 gb|EEF04170.1| hypothetical protein POPTR_0017s11480g [Populus trichocarpa]
Length=672

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFSEISSLSFVQKDAARRNVLLTSLNYS+ S IDV+ESI +HGG+RKLLK N
Sbjct  512  SVGQTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSISSVIDVLESIIAHGGDRKLLKQN  571

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            Q  +FIQRWNLFKYKLDK +SA+SH DF+MALYYLRSSDH +YAIHSLVYHASQ+LEASL
Sbjct  572  QHVQFIQRWNLFKYKLDKAISAMSHKDFDMALYYLRSSDHDMYAIHSLVYHASQELEASL  631

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW SVSMS  +   LVY+ +KR+ LFRNKRKQF
Sbjct  632  VCFKDPPFPWGSVSMSAVVFFALVYVYSKRESLFRNKRKQF  672



>ref|XP_006431091.1| hypothetical protein CICLE_v10011233mg [Citrus clementina]
 gb|ESR44331.1| hypothetical protein CICLE_v10011233mg [Citrus clementina]
Length=674

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFSEISSLSFVQKDAARRNVLLTSLNYS+ SA+DV+ESIA+HGGER+LLK N
Sbjct  514  SIGQTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSISSAVDVLESIAAHGGERRLLKQN  573

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  +F+QRWNLFKYKLDK V+ALSH DFEMALYYLRSSDH +Y +HSLVYHA+Q+LEASL
Sbjct  574  RYLDFVQRWNLFKYKLDKAVTALSHMDFEMALYYLRSSDHDLYTMHSLVYHATQELEASL  633

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPP PW S+SMS  + + L Y+  KRD+LFRNKRKQF
Sbjct  634  VCFKDPPVPWASISMSAVVFLALSYVYTKRDQLFRNKRKQF  674



>ref|XP_011005070.1| PREDICTED: uncharacterized protein LOC105111424 [Populus euphratica]
Length=672

 Score =   270 bits (689),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFSEISSLSFVQKDAARRNVLLTSLNYS+ S IDV+ESI +HGG+RKLLK N
Sbjct  512  SVGQTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSISSVIDVLESIIAHGGDRKLLKQN  571

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            Q  +FIQRWNLFKYKLDK +SA+SH DF+MALYYLRSSDH +YAIHSLVYHASQ+LEASL
Sbjct  572  QHVQFIQRWNLFKYKLDKAISAMSHKDFDMALYYLRSSDHDMYAIHSLVYHASQELEASL  631

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW SVSMS  +   LVY+ +KR+ LFRNKRKQF
Sbjct  632  VCFKDPPFPWGSVSMSAVVFFALVYVYSKRESLFRNKRKQF  672



>ref|XP_010112090.1| hypothetical protein L484_001949 [Morus notabilis]
 gb|EXC32623.1| hypothetical protein L484_001949 [Morus notabilis]
Length=676

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFSE SSLSFVQKDAARRNVLLTSLNYS+ SAIDV+ES+A+HGG+RKLLKHN
Sbjct  516  SIGQTPFGPFSESSSLSFVQKDAARRNVLLTSLNYSITSAIDVLESMAAHGGDRKLLKHN  575

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            Q  EFIQRWNLFKYKLDK VSALS  DFE ALYYLRSSDH +Y IHSLVY ASQ+LEASL
Sbjct  576  QHVEFIQRWNLFKYKLDKAVSALSRLDFETALYYLRSSDHDLYGIHSLVYTASQELEASL  635

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW+SVS+S+G      Y+ AKRD+LFRNKRKQF
Sbjct  636  VCFKDPPFPWVSVSISVGFFFVFFYLYAKRDELFRNKRKQF  676



>ref|XP_012082994.1| PREDICTED: uncharacterized protein LOC105642693 [Jatropha curcas]
 gb|KDP45479.1| hypothetical protein JCGZ_09728 [Jatropha curcas]
Length=678

 Score =   268 bits (685),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFSE SSLSFVQ+DAARRNV+LTS+NYS+ SAIDV+ESI  HGG+R LLK N
Sbjct  518  SVGQTPFGPFSETSSLSFVQRDAARRNVILTSMNYSITSAIDVLESIVGHGGDRNLLKQN  577

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            Q  EFIQRWNLFKYKLDK VSA+SHFDFEMALYYLRSSDH +YAIHSLVYHASQ+LEASL
Sbjct  578  QHAEFIQRWNLFKYKLDKAVSAMSHFDFEMALYYLRSSDHDLYAIHSLVYHASQELEASL  637

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
             CFKDPPFPW SVS+S      L Y+ +KRDKLFRNKRKQF
Sbjct  638  RCFKDPPFPWGSVSISAIGFFALFYVYSKRDKLFRNKRKQF  678



>ref|XP_006482546.1| PREDICTED: uncharacterized protein LOC102622976 [Citrus sinensis]
Length=673

 Score =   268 bits (685),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFSEISSLSFVQKDAARRNVLLTSLNYS+ SA+DV+ESIA+HGGER+LLK N
Sbjct  513  SIGQTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSISSAVDVLESIAAHGGERRLLKQN  572

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  +F+QRWNLFKYKLDK V+ALSH DFEMALYYLRSSDH +Y +HSLV+HA+Q+LEASL
Sbjct  573  RYLDFVQRWNLFKYKLDKAVTALSHMDFEMALYYLRSSDHDLYTMHSLVHHATQELEASL  632

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPP PW S+SMS  + + L Y+  KRD+LFRNKRKQF
Sbjct  633  VCFKDPPVPWASISMSAVVFLALSYVYTKRDQLFRNKRKQF  673



>ref|XP_011098578.1| PREDICTED: uncharacterized protein LOC105177216 [Sesamum indicum]
Length=671

 Score =   268 bits (685),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFSEISSLSFVQKDAARRNVLLTSLNYS+ S IDV+ESIA+HGG+RKLLK N
Sbjct  511  SVGQTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSITSGIDVLESIAAHGGDRKLLKQN  570

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EFIQRWNLF+YKLDK++SA+SHFD+EMALYYLRSSDH +YAIH+LVYHASQ+LEASL
Sbjct  571  RHYEFIQRWNLFRYKLDKSISAMSHFDYEMALYYLRSSDHDLYAIHTLVYHASQELEASL  630

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCF+DPP PW S+ +S G    L+Y+ AKR+KLFR+KRKQF
Sbjct  631  VCFRDPPLPWTSLLLSGGAFFALLYVYAKREKLFRSKRKQF  671



>gb|KDO72497.1| hypothetical protein CISIN_1g005854mg [Citrus sinensis]
Length=673

 Score =   268 bits (684),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFSEISSLSFVQKDAARRNVLLTSLNYS+ SA+DV+ESIA+HGGER+LLK N
Sbjct  513  SIGQTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSISSAVDVLESIAAHGGERRLLKQN  572

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  +F+QRWNLFKYKLDK V+ALSH DFEMALYYLRSSDH +Y +HSLV+HA+Q+LEASL
Sbjct  573  RYLDFVQRWNLFKYKLDKAVTALSHMDFEMALYYLRSSDHDLYTMHSLVHHATQELEASL  632

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPP PW S+SMS  + + L Y+  KRD+LFRNKRKQF
Sbjct  633  VCFKDPPVPWASISMSAVVFLALSYVYTKRDQLFRNKRKQF  673



>ref|XP_002305369.2| hypothetical protein POPTR_0004s12285g [Populus trichocarpa]
 gb|EEE85880.2| hypothetical protein POPTR_0004s12285g [Populus trichocarpa]
Length=681

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFSEISSLSFVQKD+ARRNVLLT LNYS+ S IDV+ESIA+HGG+R LLK N
Sbjct  521  SVGQTPFGPFSEISSLSFVQKDSARRNVLLTLLNYSITSVIDVLESIAAHGGDRNLLKQN  580

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EF+QRWNLFKYKLDK +SA+SH DF+MALYYLRSSDH +YAIHSLVYHASQ+LEASL
Sbjct  581  RHIEFVQRWNLFKYKLDKAISAISHLDFDMALYYLRSSDHDMYAIHSLVYHASQELEASL  640

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW SVSMS   +  L Y+ +KR++LFRNKRKQF
Sbjct  641  VCFKDPPFPWGSVSMSAVGVFALFYVYSKRERLFRNKRKQF  681



>ref|XP_010242378.1| PREDICTED: uncharacterized protein LOC104586747 [Nelumbo nucifera]
Length=668

 Score =   263 bits (673),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFSE+SSLSFVQKDAARRN+LLTSLNY++ SA+DV++SIASHGGER LLK N
Sbjct  508  SIGQTPFGPFSELSSLSFVQKDAARRNILLTSLNYTITSALDVLDSIASHGGERNLLKQN  567

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EF+QRWNL KYKLDK +S+LSH DF+MALY+LRSS+H +YAIHSLVYHASQ+LEASL
Sbjct  568  RHVEFVQRWNLLKYKLDKAISSLSHLDFDMALYFLRSSEHDLYAIHSLVYHASQELEASL  627

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW SVSM+       +Y+ AKRDK+FRNKRKQF
Sbjct  628  VCFKDPPFPWASVSMAGVAFFAFLYVYAKRDKIFRNKRKQF  668



>ref|XP_011009451.1| PREDICTED: uncharacterized protein LOC105114573 [Populus euphratica]
Length=679

 Score =   263 bits (672),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFSEISSLSFVQKD+ARRNVLLT LNYS+ S +DV+ESIA+HGG+R LLK N
Sbjct  519  SVGQTPFGPFSEISSLSFVQKDSARRNVLLTLLNYSVTSVVDVLESIAAHGGDRNLLKQN  578

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EF+QRWNLFKYKLDK +SA+SH DF+MALYYLRSSDH +YAIHSLVYHASQ+LEASL
Sbjct  579  RHIEFVQRWNLFKYKLDKAISAISHLDFDMALYYLRSSDHDMYAIHSLVYHASQELEASL  638

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW S+SMS   +  L+Y+ +KR++LFRNKRKQF
Sbjct  639  VCFKDPPFPWGSMSMSALGVFALIYVYSKRERLFRNKRKQF  679



>ref|XP_004489377.1| PREDICTED: uncharacterized protein LOC101510315 [Cicer arietinum]
Length=683

 Score =   260 bits (664),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFSEISSLSFVQKDAARRNVLLTSLNYS+ SAIDV++SI  HGG+R L++ N
Sbjct  523  SMGQTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSVTSAIDVLQSIEMHGGDRNLIRQN  582

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            Q  EF+QRWNLFKYKL+K VSALSH D+EM L+YLRSSDH ++AIHS+VYHASQ++EASL
Sbjct  583  QHDEFVQRWNLFKYKLNKAVSALSHLDYEMTLFYLRSSDHDLFAIHSMVYHASQEIEASL  642

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW+SVS S    + L Y+ AKR K+FRNKRKQF
Sbjct  643  VCFKDPPFPWVSVSTSAAAFLALSYVYAKRHKIFRNKRKQF  683



>ref|XP_007032463.1| Uncharacterized protein TCM_018393 [Theobroma cacao]
 gb|EOY03389.1| Uncharacterized protein TCM_018393 [Theobroma cacao]
Length=675

 Score =   258 bits (659),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFSEISSLSFVQKDAARRN LLTSLNYS+ SAIDV+ES+ +HGG+R LLK N
Sbjct  515  SVGQTPFGPFSEISSLSFVQKDAARRNFLLTSLNYSITSAIDVLESVYAHGGDRNLLKQN  574

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            Q  EFIQRW+LF+YKLDK VS+LSHFDFEMA YY+RSSDH +YA+H+LVY ASQ++EASL
Sbjct  575  QHVEFIQRWHLFRYKLDKAVSSLSHFDFEMAFYYIRSSDHDLYAMHNLVYTASQEIEASL  634

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW S+S      + L Y+ AKRDKLFRNKRKQF
Sbjct  635  VCFKDPPFPWASLSFCAVGFLALSYVYAKRDKLFRNKRKQF  675



>ref|XP_008443429.1| PREDICTED: uncharacterized protein LOC103487020 [Cucumis melo]
Length=673

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFSE+SSLSFVQKDAARRNV+LT+LN S+ SAIDV+ S+A+HGG+R LLK  
Sbjct  513  SIGQTPFGPFSELSSLSFVQKDAARRNVILTALNSSITSAIDVLNSVAAHGGDRSLLKPK  572

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            Q  EFIQRWNLFKYKLDK VS LSHFDFEMALYYLRSSDH +Y +HS+VY+ASQ+LEASL
Sbjct  573  QRTEFIQRWNLFKYKLDKAVSVLSHFDFEMALYYLRSSDHDLYTLHSIVYNASQELEASL  632

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW SVS+S+ +    +Y+  KRD++F+NKRKQF
Sbjct  633  VCFKDPPFPWGSVSVSVLLFFAFLYVYTKRDRIFKNKRKQF  673



>gb|KEH24982.1| transmembrane protein, putative [Medicago truncatula]
Length=673

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFS+ISSLSFVQKDAA+RNVLLTSLNYS+ SA DV++S+ +HGG+R LLK  
Sbjct  513  SMGQTPFGPFSQISSLSFVQKDAAKRNVLLTSLNYSVSSAHDVLQSLETHGGDRNLLKPK  572

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            Q  EF+QRWNLFKYKL+K VSALSH D+EMAL+YLRSSDH +YAIHS+VYHASQ++EASL
Sbjct  573  QHAEFVQRWNLFKYKLNKAVSALSHLDYEMALFYLRSSDHDLYAIHSIVYHASQEIEASL  632

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
             CFKDPPFPW SVS S    I + Y+ AKRDKLFRNKRKQF
Sbjct  633  TCFKDPPFPWFSVSTSAVAFIAISYVYAKRDKLFRNKRKQF  673



>ref|XP_003554877.1| PREDICTED: uncharacterized protein LOC100818221 [Glycine max]
Length=686

 Score =   254 bits (650),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFSE+ SLSFVQKDAARRNVLLTSLNYS+ SAIDV++S+ +HGG + LLK  
Sbjct  526  SMGQTPFGPFSEMLSLSFVQKDAARRNVLLTSLNYSITSAIDVLQSVETHGGAKNLLKQK  585

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            Q  EF+QRWNLFKYKL+K +SALSH DFEMAL+YLRSSDH +YAIHS+VYHASQ++EASL
Sbjct  586  QHVEFVQRWNLFKYKLNKAMSALSHLDFEMALFYLRSSDHDLYAIHSIVYHASQEIEASL  645

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCF+DPPFPW SV +S    + + YI A+RDKLFRNKRKQF
Sbjct  646  VCFRDPPFPWGSVLLSASAFLSVSYIYARRDKLFRNKRKQF  686



>ref|XP_007151203.1| hypothetical protein PHAVU_004G026600g [Phaseolus vulgaris]
 gb|ESW23197.1| hypothetical protein PHAVU_004G026600g [Phaseolus vulgaris]
Length=678

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFSE+ SLSFVQKDAARRNVLLTSLNYS+ SAIDV++SI +HGG + LLK  
Sbjct  518  SMGQTPFGPFSEMLSLSFVQKDAARRNVLLTSLNYSITSAIDVLQSIDTHGGAKNLLKQK  577

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            Q  EF+QRWN FKYKL+K VSA+SH DFEM+L+YLRSSDH +YAIHS+VYHASQ++EASL
Sbjct  578  QHVEFVQRWNFFKYKLNKAVSAMSHLDFEMSLFYLRSSDHDLYAIHSIVYHASQEIEASL  637

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCF DPPFPW SVS+S+     L Y+ A+RDKLFRNKRKQF
Sbjct  638  VCFNDPPFPWGSVSVSVSAFFALSYVYARRDKLFRNKRKQF  678



>gb|KJB33671.1| hypothetical protein B456_006G025500 [Gossypium raimondii]
Length=678

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFSE+ SLSFVQKDAARRN LLTSLNYSL SAIDV+ESI +HGG+R LLK  
Sbjct  518  SVGQTPFGPFSEVMSLSFVQKDAARRNFLLTSLNYSLTSAIDVLESIDAHGGDRNLLKQK  577

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            Q  EFIQRW+LF+YKLDK VSALSHF+FEMA YY++SSDH +YAIH LVY ASQ++EASL
Sbjct  578  QHVEFIQRWHLFRYKLDKAVSALSHFEFEMAFYYIKSSDHDLYAIHDLVYTASQEIEASL  637

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW ++S S    + L Y+ AKRDK+FRNKRKQF
Sbjct  638  VCFKDPPFPWAALSFSAVGFLALSYVYAKRDKIFRNKRKQF  678



>gb|KGN59588.1| hypothetical protein Csa_3G827300 [Cucumis sativus]
Length=636

 Score =   252 bits (644),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFSE+SSLSFVQKDAARRNV+LT+LN S+ SAIDV+ S+A+HGG+R LLK  
Sbjct  476  SIGQTPFGPFSEVSSLSFVQKDAARRNVILTALNSSITSAIDVLNSVAAHGGDRSLLKPK  535

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            Q  EFIQRWNLFKYKLDK +S +SHFDFEMALYY+RSSDH +Y +HS+VY+ASQ+LE SL
Sbjct  536  QRTEFIQRWNLFKYKLDKAMSVMSHFDFEMALYYIRSSDHDLYTLHSIVYNASQELEGSL  595

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW SVS+S+ +    +Y+  KRD++F+NKRKQF
Sbjct  596  VCFKDPPFPWGSVSVSVLLFFAFLYVYTKRDRIFKNKRKQF  636



>ref|XP_004147492.1| PREDICTED: uncharacterized protein LOC101211026 [Cucumis sativus]
Length=672

 Score =   252 bits (644),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFSE+SSLSFVQKDAARRNV+LT+LN S+ SAIDV+ S+A+HGG+R LLK  
Sbjct  512  SIGQTPFGPFSEVSSLSFVQKDAARRNVILTALNSSITSAIDVLNSVAAHGGDRSLLKPK  571

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            Q  EFIQRWNLFKYKLDK +S +SHFDFEMALYY+RSSDH +Y +HS+VY+ASQ+LE SL
Sbjct  572  QRTEFIQRWNLFKYKLDKAMSVMSHFDFEMALYYIRSSDHDLYTLHSIVYNASQELEGSL  631

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW SVS+S+ +    +Y+  KRD++F+NKRKQF
Sbjct  632  VCFKDPPFPWGSVSVSVLLFFAFLYVYTKRDRIFKNKRKQF  672



>ref|XP_007215004.1| hypothetical protein PRUPE_ppa002412mg [Prunus persica]
 gb|EMJ16203.1| hypothetical protein PRUPE_ppa002412mg [Prunus persica]
Length=675

 Score =   252 bits (644),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFSE+SSLSFVQKDAARRNVLLTSLNYS+ SA+DV+ESIA+HGGERKLLK +
Sbjct  516  SVGQTPFGPFSEVSSLSFVQKDAARRNVLLTSLNYSITSAVDVLESIAAHGGERKLLKSS  575

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EF+QRWNLFKYKLDK VSALSH DFEMALYYLRSSDH +YAIHSLVYHASQ++EASL
Sbjct  576  RHVEFVQRWNLFKYKLDKAVSALSHLDFEMALYYLRSSDHDLYAIHSLVYHASQEVEASL  635

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            +CFKDPP PW  + + + +    V+ ++K+ KLFRNK KQF
Sbjct  636  ICFKDPPVPWTGIWL-IALAFLFVFYLSKQQKLFRNKSKQF  675



>ref|XP_004304942.1| PREDICTED: uncharacterized protein LOC101303053 [Fragaria vesca 
subsp. vesca]
Length=678

 Score =   249 bits (637),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFSEISSLSFVQKDAARRNVLLTSLNYS+ SA+DV+ESIA+HGGERKLLK N
Sbjct  518  SVGQTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSISSAVDVLESIAAHGGERKLLKRN  577

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EF+QRWN FKYKLDK VSA+SH DFEMALYY+RSSDH +YAIHS+VYHASQ+LEASL
Sbjct  578  RHVEFVQRWNFFKYKLDKAVSAMSHLDFEMALYYIRSSDHDLYAIHSMVYHASQELEASL  637

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCF DPPFPW  V +   +L+   YI ++  KLFR+K KQF
Sbjct  638  VCFTDPPFPWSFVFLVAVLLLLGFYINSRGHKLFRSKSKQF  678



>ref|XP_008230732.1| PREDICTED: uncharacterized protein LOC103329974 [Prunus mume]
Length=675

 Score =   249 bits (637),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 139/161 (86%), Gaps = 1/161 (1%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFSE+SSLSFVQKDAARRNVLLTSLN S+ SA+DV+ESIA+HGGERKLLK +
Sbjct  516  SVGQTPFGPFSEVSSLSFVQKDAARRNVLLTSLNNSITSAVDVLESIAAHGGERKLLKSS  575

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EF+QRWNLFKYKLDK VSALSH DFEMALYYLRSSDH +YAIHSLVYHASQ++EASL
Sbjct  576  RHVEFVQRWNLFKYKLDKAVSALSHLDFEMALYYLRSSDHDLYAIHSLVYHASQEVEASL  635

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            +CFKDPP PW  + + + +    V+ ++K+ KLFRNK KQF
Sbjct  636  ICFKDPPVPWTGIWL-IALAFLFVFYLSKQQKLFRNKSKQF  675



>ref|XP_009342868.1| PREDICTED: uncharacterized protein LOC103934833 [Pyrus x bretschneideri]
Length=683

 Score =   248 bits (633),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFSEISSLSFVQKDAARRNVLLTS+NYS+ +A+DV+ES+A+HGGERKLLK +
Sbjct  523  SIGQTPFGPFSEISSLSFVQKDAARRNVLLTSMNYSISTAVDVLESLAAHGGERKLLKRS  582

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            Q  EFIQRWNLFKYKLDK+VSA+S  DFEMAL+YLR SDH +YA+ SLVY A+QD+EASL
Sbjct  583  QHVEFIQRWNLFKYKLDKSVSAMSLLDFEMALFYLRVSDHDLYAMQSLVYQATQDVEASL  642

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPP PW  + M   +++   Y+ +KRDK+FRNKRKQF
Sbjct  643  VCFKDPPVPWNGIIMVAFVIVFAFYLHSKRDKVFRNKRKQF  683



>ref|XP_009389928.1| PREDICTED: uncharacterized protein LOC103976452 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=670

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFSE SSLSF+Q+DAARRNVLLTSLNY++ S IDV++S+A+HGG+RKLLK  
Sbjct  510  SVGQTPFGPFSETSSLSFIQRDAARRNVLLTSLNYTITSVIDVLQSMAAHGGDRKLLKER  569

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EF+QRWNL KYKL+K VSA+SHFDFE A+Y+LRSSDH +YAIH+L+Y ASQ LEA L
Sbjct  570  KHVEFVQRWNLLKYKLEKVVSAISHFDFEKAMYFLRSSDHDLYAIHTLIYEASQKLEALL  629

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW SVS+    L G  Y+ AKRDK+ ++KRKQF
Sbjct  630  VCFKDPPFPWASVSLFGVFLFGFCYVYAKRDKILKSKRKQF  670



>ref|NP_001057949.2| Os06g0585200 [Oryza sativa Japonica Group]
 dbj|BAD68735.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEE65935.1| hypothetical protein OsJ_21804 [Oryza sativa Japonica Group]
 dbj|BAF19863.2| Os06g0585200 [Oryza sativa Japonica Group]
Length=551

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S GHTPFGPFSE  SLSFVQKDAARRNVLLT+LNY++ SAIDV+ES+A+HGGE  LL+  
Sbjct  391  STGHTPFGPFSETKSLSFVQKDAARRNVLLTTLNYTITSAIDVLESMAAHGGESILLRRK  450

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EFIQRWNL  YKL+K VSA+S  D+  A+Y+LRSSDH ++A+H+LVY ASQ+LEASL
Sbjct  451  RRVEFIQRWNLLTYKLEKVVSAMSRLDYNKAMYFLRSSDHDLFAVHTLVYQASQELEASL  510

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW+SVSMS   + G  Y+ +KRDKLFR+KRKQF
Sbjct  511  VCFKDPPFPWLSVSMSGIFVFGFFYVYSKRDKLFRSKRKQF  551



>ref|XP_008809720.1| PREDICTED: uncharacterized protein LOC103721331 [Phoenix dactylifera]
Length=668

 Score =   244 bits (624),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPF+E  SLSFVQ+DAARRNVLLT+LNYS+ SAIDV+ S+A+HGG+RKLLK N
Sbjct  508  SVGQTPFGPFAETLSLSFVQRDAARRNVLLTTLNYSITSAIDVLASMAAHGGDRKLLKKN  567

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +   F+QRWNLFKYKL+K VSALSH D+E A+Y+LRSSDH +YAIH+L+Y ASQ+LEASL
Sbjct  568  RHAVFVQRWNLFKYKLEKVVSALSHLDYEKAVYFLRSSDHDLYAIHTLIYEASQELEASL  627

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW SVS++   + G  Y+ ++R K+FR+KRKQF
Sbjct  628  VCFKDPPFPWASVSLAAVFVFGFFYVYSRRHKIFRSKRKQF  668



>ref|XP_006656187.1| PREDICTED: uncharacterized protein LOC102704152 [Oryza brachyantha]
Length=554

 Score =   241 bits (616),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S GHTPFGPFSE  SLSFVQKDAARRNVLLT+LNY++ SAIDV+ES+A+HGGE  LL+  
Sbjct  394  STGHTPFGPFSETKSLSFVQKDAARRNVLLTTLNYTITSAIDVLESLAAHGGESILLRRK  453

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EFIQRWNL  YKL+K VSA+S  D++ A+Y+LRSSDH +YAIH+LVY ASQ+LEASL
Sbjct  454  RHVEFIQRWNLLSYKLEKVVSAMSRLDYKKAMYFLRSSDHDLYAIHTLVYQASQELEASL  513

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW+SVSMS   +    Y+ +KRDKLFR+KRKQF
Sbjct  514  VCFKDPPFPWLSVSMSGIFVFSFFYVYSKRDKLFRSKRKQF  554



>ref|XP_008341539.1| PREDICTED: uncharacterized protein LOC103404413 [Malus domestica]
Length=679

 Score =   244 bits (623),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 140/162 (86%), Gaps = 2/162 (1%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFSEISSLSFVQKDAARRNVLLTSLNY++ SA+DV++SIA+HGGERKLLK +
Sbjct  519  SIGQTPFGPFSEISSLSFVQKDAARRNVLLTSLNYTISSAVDVLQSIAAHGGERKLLKRS  578

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EFIQRWNLF+YKLDK VSA+S  DF MAL+YLRSSDH +YAIHSLVY ASQ++E SL
Sbjct  579  RHVEFIQRWNLFRYKLDKAVSAMSLLDFGMALFYLRSSDHDLYAIHSLVYQASQEVEVSL  638

Query  422  VCFKDPPFPWMSVSMSLGILIGLV-YIVAKRDKLFRNKRKQF  300
            VCFKDPP PW  + M +G +I +  Y+ +KRDK+FRNKRKQF
Sbjct  639  VCFKDPPVPWNGIFM-VGFVIAVAFYLHSKRDKVFRNKRKQF  679



>dbj|BAD68736.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG90983.1| unnamed protein product [Oryza sativa Japonica Group]
Length=672

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S GHTPFGPFSE  SLSFVQKDAARRNVLLT+LNY++ SAIDV+ES+A+HGGE  LL+  
Sbjct  512  STGHTPFGPFSETKSLSFVQKDAARRNVLLTTLNYTITSAIDVLESMAAHGGESILLRRK  571

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EFIQRWNL  YKL+K VSA+S  D+  A+Y+LRSSDH ++A+H+LVY ASQ+LEASL
Sbjct  572  RRVEFIQRWNLLTYKLEKVVSAMSRLDYNKAMYFLRSSDHDLFAVHTLVYQASQELEASL  631

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW+SVSMS   + G  Y+ +KRDKLFR+KRKQF
Sbjct  632  VCFKDPPFPWLSVSMSGIFVFGFFYVYSKRDKLFRSKRKQF  672



>ref|XP_010528320.1| PREDICTED: uncharacterized protein LOC104805448 [Tarenaya hassleriana]
Length=689

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFS++SSLSFVQKDAA+RN+LLTSLN ++ SAID+++S+ +HGG+R LL+ N
Sbjct  529  SVGQTPFGPFSDVSSLSFVQKDAAKRNILLTSLNATISSAIDILDSVMAHGGDRNLLRQN  588

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EFIQRW+LFKYKL+KTVSALSHFDFEMAL+YLRS DH +Y++HS+VY ASQ++EASL
Sbjct  589  RNTEFIQRWSLFKYKLEKTVSALSHFDFEMALFYLRSLDHDLYSMHSIVYMASQEIEASL  648

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
             CFKDPPFPW  V++S   L+ LVY+ ++RDKLFR+KRKQF
Sbjct  649  NCFKDPPFPWGPVTVSGLGLMALVYVYSRRDKLFRSKRKQF  689



>gb|EAZ01463.1| hypothetical protein OsI_23499 [Oryza sativa Indica Group]
Length=673

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S GHTPFGPFSE  SLSFVQKDAARRNVLLT+LNY++ SAIDV+ES+A+HGGE  LL+  
Sbjct  513  STGHTPFGPFSETKSLSFVQKDAARRNVLLTTLNYTITSAIDVLESMAAHGGESILLRRK  572

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EFIQRWNL  YKL+K VSA+S  D+  A+Y+LRSSDH ++A+H+LVY ASQ+LEASL
Sbjct  573  RRVEFIQRWNLLTYKLEKVVSAMSRLDYNKAMYFLRSSDHDLFAVHTLVYQASQELEASL  632

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW+SVSMS   + G  Y+ +KRDKLFR+KRKQF
Sbjct  633  VCFKDPPFPWLSVSMSGIFVFGFFYVYSKRDKLFRSKRKQF  673



>ref|XP_009347072.1| PREDICTED: uncharacterized protein LOC103938753 [Pyrus x bretschneideri]
Length=682

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFSEISSLSFVQKDAARRNVLLTSLNY++ SA+DV++SIA+HGGERKLLK +
Sbjct  522  SIGQTPFGPFSEISSLSFVQKDAARRNVLLTSLNYTISSAVDVLQSIAAHGGERKLLKRS  581

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EFIQRWNLFKYKLDK VSA+S  DF MAL+YLRSSDH +YAIHSLVY ASQ++EASL
Sbjct  582  RHVEFIQRWNLFKYKLDKAVSAMSLLDFGMALFYLRSSDHDLYAIHSLVYQASQEVEASL  641

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPP PW  + M   +++   Y+ +KR K+FRNK KQF
Sbjct  642  VCFKDPPVPWNRIFMVGVVIVFAFYLHSKRGKIFRNKSKQF  682



>ref|XP_010670317.1| PREDICTED: uncharacterized protein LOC104887400 [Beta vulgaris 
subsp. vulgaris]
Length=676

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVGHTPFGPFSE+SSLSFVQKDAARRNVLLT+LNY++ SAI+V+ESI +HGG +K+LK +
Sbjct  516  SVGHTPFGPFSEVSSLSFVQKDAARRNVLLTTLNYTISSAIEVLESIKAHGGYQKILKGH  575

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            Q+ EF QRW LFKYKLDK + +LSH +FE+A YYLRSS+H +YA+HS++Y ASQDLEASL
Sbjct  576  QITEFSQRWFLFKYKLDKMIYSLSHLEFELASYYLRSSEHDLYAMHSVIYRASQDLEASL  635

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
             CF DPP PW SVSMS+ I   L Y+  KRDK F NK KQF
Sbjct  636  ACFTDPPVPWASVSMSVAIFFLLCYVYVKRDKFFTNKSKQF  676



>ref|XP_002437205.1| hypothetical protein SORBIDRAFT_10g022840 [Sorghum bicolor]
 gb|EER88572.1| hypothetical protein SORBIDRAFT_10g022840 [Sorghum bicolor]
Length=673

 Score =   240 bits (612),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S GHTPFGPFSE  SLSFVQKDAARRNVLLT+LNY++ S ID++ES+A+HGGE+ LL+  
Sbjct  513  STGHTPFGPFSETKSLSFVQKDAARRNVLLTTLNYTITSTIDILESMAAHGGEKILLRKK  572

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EF QRWNL  YKL+K +SA+S  D++ ALY+LRSSDH +Y IHSLVY ASQ+LEASL
Sbjct  573  RHVEFNQRWNLLTYKLEKVISAMSRLDYDKALYFLRSSDHDLYEIHSLVYQASQELEASL  632

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW+SVSMS   + G  Y+ +KRDKLFR+KRKQF
Sbjct  633  VCFKDPPFPWVSVSMSGVFVFGFFYVYSKRDKLFRSKRKQF  673



>ref|XP_010915151.1| PREDICTED: uncharacterized protein LOC105040362 [Elaeis guineensis]
Length=668

 Score =   239 bits (611),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPF+E  SLSFVQ+DAARRNVLLT+LNYS+ SAIDV+ S+A+HGG+RKLLK N
Sbjct  508  SVGQTPFGPFAETVSLSFVQRDAARRNVLLTTLNYSITSAIDVLASMAAHGGDRKLLKKN  567

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EF+QRWNLFK+KL+K +SALS  D+E A+Y+LRSSDH +YA+H+L+Y ASQ+LEASL
Sbjct  568  RHVEFVQRWNLFKHKLEKVISALSLLDYEKAVYFLRSSDHDLYAMHTLIYEASQELEASL  627

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW SVS++   + G  Y+ ++R K+FR+KRKQF
Sbjct  628  VCFKDPPFPWASVSLAAVFVFGFFYVYSRRHKIFRSKRKQF  668



>gb|ACN26663.1| unknown [Zea mays]
 gb|AFW87061.1| hypothetical protein ZEAMMB73_887138 [Zea mays]
Length=671

 Score =   239 bits (609),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 134/161 (83%), Gaps = 1/161 (1%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S GHTPFGPFSE  SLSFVQKDAARRNVLLT+LNY++ S IDV+ES+ +HGGE K+L+  
Sbjct  512  STGHTPFGPFSETKSLSFVQKDAARRNVLLTTLNYTITSTIDVLESMVAHGGE-KILRKK  570

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EFIQRWNL  YKL+K VSA+S  D++ A+YYLRSSDH +Y IHSLVY ASQ+LEASL
Sbjct  571  RHVEFIQRWNLLTYKLEKVVSAMSRLDYDKAMYYLRSSDHDLYEIHSLVYQASQELEASL  630

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW+SVSMS   + G  Y+ +KRDKLFR+KRKQF
Sbjct  631  VCFKDPPFPWVSVSMSGLFVFGFFYMYSKRDKLFRSKRKQF  671



>ref|XP_008348059.1| PREDICTED: uncharacterized protein LOC103411189 [Malus domestica]
Length=683

 Score =   239 bits (610),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFSEISSLSFVQKDAARRNVLLT++NYS+ +A+DV+ES+ +HGGERKLLK +
Sbjct  523  SIGQTPFGPFSEISSLSFVQKDAARRNVLLTTMNYSISTAVDVLESLVAHGGERKLLKRS  582

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
               EFIQRWNLFKYKLDK+VSA+S  DFEMAL+YL++SDH +YA+ SLVY A+QD+EASL
Sbjct  583  XHVEFIQRWNLFKYKLDKSVSAMSLLDFEMALFYLQASDHDLYAMQSLVYQATQDVEASL  642

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPP PW  + M   +++   Y+ +KRDK+FRNK KQF
Sbjct  643  VCFKDPPVPWNGIFMVAFVIVFAFYLHSKRDKVFRNKSKQF  683



>ref|NP_001145995.1| uncharacterized protein LOC100279525 precursor [Zea mays]
 gb|ACL53001.1| unknown [Zea mays]
Length=671

 Score =   239 bits (609),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 134/161 (83%), Gaps = 1/161 (1%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S GHTPFGPFSE  SLSFVQKDAARRNVLLT+LNY++ S IDV+ES+ +HGGE K+L+  
Sbjct  512  STGHTPFGPFSETKSLSFVQKDAARRNVLLTTLNYTITSTIDVLESMVAHGGE-KILRKK  570

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EFIQRWNL  YKL+K VSA+S  D++ A+YYLRSSDH +Y IHSLVY ASQ+LEASL
Sbjct  571  RHVEFIQRWNLLTYKLEKVVSAMSRLDYDKAMYYLRSSDHDLYEIHSLVYQASQELEASL  630

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW+SVSMS   + G  Y+ +KRDKLFR+KRKQF
Sbjct  631  VCFKDPPFPWVSVSMSGLFVFGFFYMYSKRDKLFRSKRKQF  671



>ref|XP_008379334.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103442331 
[Malus domestica]
Length=683

 Score =   237 bits (605),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFSEISSLSFVQKDAARRNVLLT++NYS+ +A+DV+ES+ +HGGERKLLK +
Sbjct  523  SIGQTPFGPFSEISSLSFVQKDAARRNVLLTTMNYSISTAVDVLESLVAHGGERKLLKRS  582

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
               EFIQRWNLFKYKLDK+VSA+S  DFEMAL+YL++SDH +YA+ SLVY A+QD+EASL
Sbjct  583  XHVEFIQRWNLFKYKLDKSVSAMSLLDFEMALFYLQASDHDLYAMQSLVYQATQDVEASL  642

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPP PW  + M   ++    Y+ +KRDK+FRNK KQF
Sbjct  643  VCFKDPPVPWNGIFMVAFVIXFAFYLHSKRDKVFRNKSKQF  683



>ref|XP_004967214.1| PREDICTED: uncharacterized protein LOC101771100 [Setaria italica]
Length=679

 Score =   237 bits (605),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S GHTPFGPFSE  SLSFVQKDAARRNVLLT+LN+++ S I+V+ES+A+HGGE  LL+  
Sbjct  519  STGHTPFGPFSETKSLSFVQKDAARRNVLLTTLNFTITSTINVLESMAAHGGENILLRKK  578

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EFIQRWNL  YKL+K VSA+S  D+E A+Y LRSSDH +Y IHSLVY ASQ+LEA+L
Sbjct  579  RHVEFIQRWNLLTYKLEKVVSAMSRLDYEKAMYLLRSSDHDLYEIHSLVYQASQELEATL  638

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW+SVSMS   + G  Y+ +KRD+LFR+KRKQF
Sbjct  639  VCFKDPPFPWVSVSMSGVFVFGFFYVYSKRDRLFRSKRKQF  679



>ref|XP_002875468.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51727.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=396

 Score =   229 bits (585),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFS+ISSLSFVQKDAA+RNVLLTSLN ++ SAIDV++S  ++GG+  L K N
Sbjct  236  SIGQTPFGPFSDISSLSFVQKDAAKRNVLLTSLNTTITSAIDVIDSAVAYGGDVILRKQN  295

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EF+QRWNL +YKLDKTVSALSH +FEMALYYLRS+ H +Y++HS+VY ASQ +EASL
Sbjct  296  RHSEFMQRWNLLQYKLDKTVSALSHNEFEMALYYLRSAAHDLYSVHSVVYLASQQVEASL  355

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
             CFKDPPFPW +VS+S   L+ L Y+ +KRD+LFR+KRKQF
Sbjct  356  NCFKDPPFPWGTVSVSGFGLMALGYVYSKRDRLFRSKRKQF  396



>ref|XP_009399781.1| PREDICTED: uncharacterized protein LOC103984084 [Musa acuminata 
subsp. malaccensis]
Length=669

 Score =   234 bits (596),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFS+  SLSFVQ+DAARRNVLLT+LNY++ SAID+++S+A+HGG +KLLK N
Sbjct  509  SVGQTPFGPFSDSLSLSFVQRDAARRNVLLTTLNYTITSAIDILQSMAAHGGVKKLLKEN  568

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EF+QRWNL  YKL+K VSA+SHFDFE A+++LRSSDH +YAIH+LVY ASQ LEAS+
Sbjct  569  KHVEFVQRWNLLNYKLEKVVSAVSHFDFEKAMHFLRSSDHDLYAIHTLVYEASQKLEASI  628

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
             CF DPPFPW SVS+   +L G  Y    RDK+F++KRKQF
Sbjct  629  TCFSDPPFPWASVSLFGVLLFGFCYFHGNRDKIFKSKRKQF  669



>ref|XP_003560633.1| PREDICTED: uncharacterized protein LOC100821666 [Brachypodium 
distachyon]
Length=688

 Score =   233 bits (594),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S GHTPFGPFSE  SLSFVQKDAARRNVLLT+LNY++ S IDV+ES+A+HGGE  LL+  
Sbjct  528  STGHTPFGPFSETKSLSFVQKDAARRNVLLTTLNYTITSTIDVLESMAAHGGENILLRKK  587

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EFIQRWNL  YKL+K VSA+S  D++ A+Y+LRSSDH +YA++ LVY ASQ+LEASL
Sbjct  588  RHVEFIQRWNLLTYKLEKVVSAMSRLDYKKAMYFLRSSDHDMYAVYMLVYQASQELEASL  647

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            +CFKD PFPW+ VSMS   + G  Y+ +KRDKLFR+KRKQF
Sbjct  648  ICFKDTPFPWLPVSMSGVFVFGFFYVYSKRDKLFRSKRKQF  688



>gb|EMT25422.1| hypothetical protein F775_30246 [Aegilops tauschii]
Length=568

 Score =   228 bits (582),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 130/161 (81%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S GHTPFGPFSE  SLSFVQKDAARRNVLLT+LNY++ S ++V+ES+A+HGGE  LL+  
Sbjct  408  STGHTPFGPFSETKSLSFVQKDAARRNVLLTTLNYTITSTVEVLESLAAHGGENILLRKK  467

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EFIQRWNL  YKL+K VSA+S  D+  A+Y LRSSDH +YAI+ LVY ASQ+LEASL
Sbjct  468  RHVEFIQRWNLLTYKLEKVVSAMSRLDYNKAMYLLRSSDHDMYAIYMLVYQASQELEASL  527

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW+SVS+S   + G   + +KRD LFR+KRKQF
Sbjct  528  VCFKDPPFPWLSVSLSGVFVFGFFLVYSKRDSLFRSKRKQF  568



>emb|CDX85216.1| BnaC07g25270D [Brassica napus]
Length=683

 Score =   230 bits (587),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFS+ISSLSFVQKDAA+RNV+LTSLN ++ SAIDVM+S  ++GGE  L+K +
Sbjct  523  SVGQTPFGPFSDISSLSFVQKDAAKRNVILTSLNTTISSAIDVMDSAVAYGGEAILVKQH  582

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EF+QRWNL KYK++K+VSALSH DFEMALYYLRS+ H +Y++HS+VY ASQ++EASL
Sbjct  583  RHSEFMQRWNLLKYKMEKSVSALSHNDFEMALYYLRSASHDLYSMHSVVYLASQEVEASL  642

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
             CFKDPPFPW +VS+S   L+ L Y+ AKRD+LF++KRKQF
Sbjct  643  NCFKDPPFPWGAVSVSGVGLVALSYVYAKRDRLFKSKRKQF  683



>ref|XP_006290676.1| hypothetical protein CARUB_v10016768mg [Capsella rubella]
 gb|EOA23574.1| hypothetical protein CARUB_v10016768mg [Capsella rubella]
Length=691

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFS++SSLSFVQKDAA+RNVLLTSLN ++ SAIDV++S  ++GG+  L K N
Sbjct  531  SIGQTPFGPFSDLSSLSFVQKDAAKRNVLLTSLNTTITSAIDVIDSAVAYGGDANLRKQN  590

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EF+QRWNL KYKLDKTVSALSH DFEMAL+YLRS+ H +Y++HS+VY ASQ +EASL
Sbjct  591  RHSEFMQRWNLMKYKLDKTVSALSHNDFEMALFYLRSASHDLYSVHSVVYLASQKVEASL  650

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
             CF+DPPFPW +VS+S   L+ L Y+ +KRD+L RNKRKQF
Sbjct  651  NCFQDPPFPWGTVSVSGFGLMALGYVYSKRDRLLRNKRKQF  691



>ref|XP_009151854.1| PREDICTED: uncharacterized protein LOC103875136 [Brassica rapa]
 emb|CDX86418.1| BnaA06g31350D [Brassica napus]
Length=684

 Score =   229 bits (583),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFS+ISSLSFVQKDAA+RNV+LTSLN ++ SAIDV++S  ++GGE  L+K +
Sbjct  524  SVGQTPFGPFSDISSLSFVQKDAAKRNVILTSLNTTISSAIDVIDSAVAYGGEAVLVKQH  583

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EF+QRWNL KYK++K+VSALSH DFEMALYYLRS+ H +Y++HS+VY ASQ++EASL
Sbjct  584  RHSEFMQRWNLLKYKMEKSVSALSHNDFEMALYYLRSASHDLYSMHSVVYLASQEVEASL  643

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
             CFKDPPFPW +VS+S   L+ L Y+ AKRD+LF++KRKQF
Sbjct  644  DCFKDPPFPWGAVSVSGVGLVALSYVYAKRDRLFKSKRKQF  684



>gb|KFK33751.1| hypothetical protein AALP_AA5G055400 [Arabis alpina]
Length=676

 Score =   228 bits (582),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFS++SSLSFVQKDAA+RNV+LT LN ++ SA+D+++S  ++GG+  LLK N
Sbjct  516  SVGQTPFGPFSDLSSLSFVQKDAAKRNVILTLLNTTITSAVDIIDSAVAYGGDVNLLKQN  575

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EF+QRWNL KYKL+K+VSALSH DFEMAL+Y+RSS H +Y++HS+VY ASQ++EASL
Sbjct  576  RHSEFMQRWNLLKYKLEKSVSALSHNDFEMALFYMRSSSHDLYSMHSVVYLASQEVEASL  635

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
             CFKDPPFPW +VS+S   L+ LVY+ +KRD+LFR+KRKQF
Sbjct  636  NCFKDPPFPWGTVSVSGVGLMALVYVYSKRDRLFRSKRKQF  676



>ref|NP_189514.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB03169.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE77483.1| uncharacterized protein AT3G28720 [Arabidopsis thaliana]
Length=687

 Score =   228 bits (582),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFS+ISSLSFVQKDAA+RNV+LTSLN ++ SAIDV++S  ++GG+  L K N
Sbjct  527  SIGQTPFGPFSDISSLSFVQKDAAKRNVILTSLNTTITSAIDVIDSAVAYGGDVILRKQN  586

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EF+QRWNL +YKLDKTVSALSH +FEMAL+YLRS+ H +Y++HS+VY ASQ +EASL
Sbjct  587  RHSEFMQRWNLMQYKLDKTVSALSHNEFEMALFYLRSASHDLYSVHSVVYLASQRVEASL  646

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
             CFKDPPFPW +VS+S   L+ + Y+ +KRD+LFRNKRKQF
Sbjct  647  NCFKDPPFPWGTVSVSGFGLMAVGYVFSKRDRLFRNKRKQF  687



>ref|XP_010502941.1| PREDICTED: uncharacterized protein LOC104780160 [Camelina sativa]
Length=685

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFS+ISSLSFVQKDAA+RNVLLTSLN ++ SAIDV++S  ++GG+  L K N
Sbjct  525  SIGQTPFGPFSDISSLSFVQKDAAKRNVLLTSLNTTMTSAIDVIDSAVAYGGDVNLRKQN  584

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EF+QRWNL KYK DKTVSALSH DFEMAL+YLRS+ H +Y++HS+VY  SQ +EASL
Sbjct  585  RHSEFMQRWNLMKYKFDKTVSALSHNDFEMALFYLRSASHDLYSVHSVVYLTSQKVEASL  644

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
             CFKDPPFPW +VS+S   L+ L Y+ +KRD+L R+KRKQF
Sbjct  645  NCFKDPPFPWGTVSVSGFGLMALGYVYSKRDRLLRSKRKQF  685



>ref|XP_010514583.1| PREDICTED: uncharacterized protein LOC104790511 [Camelina sativa]
Length=683

 Score =   226 bits (576),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFS+ISSLSFVQKDAA+RNVLLTSLN ++ SAIDV++S  ++GG+  L K N
Sbjct  523  SIGQTPFGPFSDISSLSFVQKDAAKRNVLLTSLNTTITSAIDVIDSAVAYGGDVNLRKQN  582

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EF+QRWNL KYK DKTVSALSH DFEMAL+YLRS+ H +Y++HS+VY  SQ +EASL
Sbjct  583  RHSEFMQRWNLMKYKFDKTVSALSHNDFEMALFYLRSASHDLYSVHSVVYLTSQKVEASL  642

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
             CFKDPPFPW +VS+S   L+ L Y+ +KRD+L R+KRKQF
Sbjct  643  NCFKDPPFPWGTVSVSGFGLMALGYVYSKRDRLLRSKRKQF  683



>ref|XP_010425653.1| PREDICTED: uncharacterized protein LOC104710713 [Camelina sativa]
Length=687

 Score =   225 bits (574),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFS+ISSLSFVQKDAA+RNV+LTSLN ++ SAIDV++S  ++GG+  L K N
Sbjct  527  SIGQTPFGPFSDISSLSFVQKDAAKRNVILTSLNTTITSAIDVIDSAVAYGGDVNLRKQN  586

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EF+QRWNL KYKL+KTVSALSH DFEMAL+YLRS+ H +Y++HS+VY  SQ +EASL
Sbjct  587  RHSEFMQRWNLMKYKLEKTVSALSHNDFEMALFYLRSASHDLYSVHSVVYLTSQKVEASL  646

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
             CFKDPPFPW +VS+S   L+ L Y+ +KRD+L R+KRKQF
Sbjct  647  NCFKDPPFPWGTVSVSGFGLMALGYVYSKRDRLLRSKRKQF  687



>ref|XP_006842137.1| PREDICTED: uncharacterized protein LOC18431963 [Amborella trichopoda]
 gb|ERN03812.1| hypothetical protein AMTR_s00078p00118850 [Amborella trichopoda]
Length=673

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G TPFGPFS + SLSFVQKDAA+RN++LT +NY++ S +D +ES+ SHGG +++LK  
Sbjct  513  SMGQTPFGPFSRLYSLSFVQKDAAKRNIVLTMMNYTITSLMDALESLESHGGYKEVLKPK  572

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EF QRWNL +YK+D+ VSA+SH DFE ALY++RS DH +YAIH+++Y ASQ+LE  L
Sbjct  573  RFVEFTQRWNLLRYKMDRAVSAMSHLDFETALYFVRSGDHDVYAIHTIIYLASQELEGIL  632

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCF+DPPFPW S SMSLG    L+Y+ +KRD++FR+KRKQF
Sbjct  633  VCFQDPPFPWASASMSLGAFAALLYVYSKRDQIFRSKRKQF  673



>gb|EMS54330.1| hypothetical protein TRIUR3_29153 [Triticum urartu]
Length=654

 Score =   223 bits (568),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S GHTPFGPFSE  SLSFVQKDAARRNVLLT+LNY++ S ++V+ES+A+HGGE  LL+  
Sbjct  494  STGHTPFGPFSETKSLSFVQKDAARRNVLLTTLNYTITSTVEVLESLAAHGGENILLRKK  553

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            +  EFIQRWNL  YKL+K VSA+S  D+  A+Y LRSSDH +YAI+ LVY ASQ+L+ASL
Sbjct  554  RHVEFIQRWNLLTYKLEKVVSAMSRLDYNKAMYLLRSSDHDMYAIYMLVYQASQELDASL  613

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            VCFKDPPFPW+SVS+S   + G  ++ +KRD LFR+KRKQF
Sbjct  614  VCFKDPPFPWLSVSLSGVFVFGFFFVYSKRDSLFRSKRKQF  654



>gb|EPS64700.1| hypothetical protein M569_10078, partial [Genlisea aurea]
Length=652

 Score =   219 bits (559),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 138/162 (85%), Gaps = 1/162 (1%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKH-  606
            SVG TPFGPFSE SSLSFVQ++AARRNV+LT+LN S+   +DV+ES+ ++GG+R+LLK  
Sbjct  491  SVGQTPFGPFSESSSLSFVQREAARRNVVLTALNDSITRGMDVLESVWAYGGDRRLLKDG  550

Query  605  NQLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEAS  426
            ++  EF+QRW LF+YKL+K+VSA+SHFD+E A+YY+RSSDH +YA+HS+VY A++++EAS
Sbjct  551  SRRSEFLQRWMLFRYKLEKSVSAMSHFDYEKAVYYVRSSDHDMYALHSVVYRATREMEAS  610

Query  425  LVCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            LVCFK+PPFPW  + +S+G+L   V   AKRDKLF++K+KQF
Sbjct  611  LVCFKEPPFPWGGLGVSVGVLGCFVLGYAKRDKLFQDKKKQF  652



>ref|XP_001782502.1| predicted protein [Physcomitrella patens]
 gb|EDQ52654.1| predicted protein, partial [Physcomitrella patens]
Length=503

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 121/161 (75%), Gaps = 0/161 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
             +GHTPFGPFSE SSLSF Q+DAARRN +LT LN ++ + +  +ESI ++GGE++LL   
Sbjct  343  GIGHTPFGPFSEGSSLSFSQRDAARRNTILTMLNATMSNVLHTLESIKNYGGEKELLGMK  402

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
               E+ QRWNLF YKL+K ++ALSHF+F+ ALY+L+SS+H IYAIH+  +  S +LEASL
Sbjct  403  HHMEYTQRWNLFVYKLNKVMTALSHFEFDTALYFLKSSEHDIYAIHAFAFQGSSELEASL  462

Query  422  VCFKDPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
             CF+DPPFPW S+   + +++ LVY   KRDK   NK+K+F
Sbjct  463  KCFEDPPFPWFSLCFGIVLIVLLVYAWNKRDKFLVNKKKRF  503



>ref|XP_007224785.1| hypothetical protein PRUPE_ppa023863mg, partial [Prunus persica]
 gb|EMJ25984.1| hypothetical protein PRUPE_ppa023863mg, partial [Prunus persica]
Length=271

 Score =   185 bits (470),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 111/157 (71%), Gaps = 23/157 (15%)
 Frame = -3

Query  770  TPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHNQLPE  591
            TPFG FS++SSLSFVQKDAA RNVLLTS NYS+ S +D                      
Sbjct  138  TPFGLFSKVSSLSFVQKDAAHRNVLLTSFNYSITSVVD----------------------  175

Query  590  FIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASLVCFK  411
            F+QRWNL KYKLDK VSALSH DFEMALYYLR +DH IYAIHSLVYHAS+++E SLVCFK
Sbjct  176  FMQRWNLLKYKLDKAVSALSHLDFEMALYYLRPTDHDIYAIHSLVYHASKEVEVSLVCFK  235

Query  410  DPPFPWMSVSMSLGILIGLVYIVAKRDKLFRNKRKQF  300
            DPP PW  + + + +    V+ ++K+ KLFRNK KQF
Sbjct  236  DPPVPWTGIWL-IALAFLKVFYLSKQQKLFRNKSKQF  271



>ref|XP_002991685.1| hypothetical protein SELMODRAFT_236350 [Selaginella moellendorffii]
 gb|EFJ07256.1| hypothetical protein SELMODRAFT_236350 [Selaginella moellendorffii]
Length=678

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 119/162 (73%), Gaps = 2/162 (1%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G+TPFGPFS++SSLSF Q+DAA RNVL T LN ++  AI+++E++   GGE+ +LK  
Sbjct  518  SLGNTPFGPFSKLSSLSFAQRDAAPRNVLHTMLNTTVWGAIEMLETLKGLGGEKAVLKSR  577

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            Q  E  QRWNL  YKL+K  SA+SHFDF +AL++L+S++H +Y  H L + AS  LEA++
Sbjct  578  QGTEMNQRWNLLLYKLNKATSAMSHFDFNLALFFLKSAEHDLYGAHHLAFEASSHLEAAI  637

Query  422  VCFKDPPFPWMSVSMSLGIL-IGLVYIVAKRDKLFRNKRKQF  300
            VCFKD PFPW  +   L I  IGL Y+  +R++LF +KRK+F
Sbjct  638  VCFKDAPFPWSWLVFVLAIAGIGL-YVWFRREQLFASKRKRF  678



>gb|AFK47156.1| unknown [Medicago truncatula]
Length=72

 Score =   120 bits (302),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -3

Query  515  MALYYLRSSDHXIYAIHSLVYHASQDLEASLVCFKDPPFPWMSVSMSLGILIGLVYIVAK  336
            MAL+YLRSSDH +YAIHS+VYHASQ++EASL CFKDPPFPW SVS S    I + Y+ AK
Sbjct  1    MALFYLRSSDHDLYAIHSIVYHASQEIEASLTCFKDPPFPWFSVSTSAVAFIAIFYVYAK  60

Query  335  RDKLFRNKRKQF  300
            RDKLFRNKRKQF
Sbjct  61   RDKLFRNKRKQF  72



>ref|XP_009389929.1| PREDICTED: uncharacterized protein LOC103976452 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=598

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            SVG TPFGPFSE SSLSF+Q+DAARRNVLLTSLNY++ S IDV++S+A+HGG+RKLLK  
Sbjct  510  SVGQTPFGPFSETSSLSFIQRDAARRNVLLTSLNYTITSVIDVLQSMAAHGGDRKLLKER  569

Query  602  QLPEFIQRWNLFKYKLDK  549
            +  EF+QRWNL KYKL+K
Sbjct  570  KHVEFVQRWNLLKYKLEK  587



>ref|XP_002991053.1| hypothetical protein SELMODRAFT_132777, partial [Selaginella 
moellendorffii]
 gb|EFJ07861.1| hypothetical protein SELMODRAFT_132777, partial [Selaginella 
moellendorffii]
Length=663

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 89/123 (72%), Gaps = 2/123 (2%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G+TPFGPFS++SSLSF Q+DAA RNVL T LN ++  AI+++E++   GGE+ +LK  
Sbjct  524  SLGNTPFGPFSKLSSLSFAQRDAAPRNVLHTMLNTTVWGAIEMLETLKGLGGEKAVLKSR  583

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEASL  423
            Q  E  QRWNL  YKL+K  SA+SHFDF +AL++L+S++H +Y   +L +   Q  ++S 
Sbjct  584  QGTEMNQRWNLLLYKLNKATSAMSHFDFNLALFFLKSAEHDLYG--ALGFANGQCYQSSF  641

Query  422  VCF  414
            + F
Sbjct  642  LFF  644



>ref|XP_002991052.1| hypothetical protein SELMODRAFT_429443 [Selaginella moellendorffii]
 gb|EFJ07860.1| hypothetical protein SELMODRAFT_429443 [Selaginella moellendorffii]
Length=250

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G+TPFGPFS++SSLSF Q+DAA RNVL T LN ++  AI+++E++   GGE+ +LK  
Sbjct  159  SLGNTPFGPFSKLSSLSFAQRDAAPRNVLHTMLNTTVWGAIEMLETLKGLGGEKAVLKSR  218

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMAL  507
            Q  E  QRWNL  YKL+K  SA+SHFDF +AL
Sbjct  219  QGTEMNQRWNLLLYKLNKATSAMSHFDFNLAL  250



>ref|XP_002991050.1| hypothetical protein SELMODRAFT_429438 [Selaginella moellendorffii]
 ref|XP_002991051.1| hypothetical protein SELMODRAFT_429441 [Selaginella moellendorffii]
 gb|EFJ07858.1| hypothetical protein SELMODRAFT_429438 [Selaginella moellendorffii]
 gb|EFJ07859.1| hypothetical protein SELMODRAFT_429441 [Selaginella moellendorffii]
Length=252

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G+TPFGPFS++SSLSF Q+DAA RNVL T LN ++  AI+++E++   GGE+ +LK  
Sbjct  161  SLGNTPFGPFSKLSSLSFAQRDAAPRNVLHTMLNTTVWGAIEMLETLKGLGGEKAVLKSR  220

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMAL  507
            Q  E  QRWNL  YKL+K  SA+SHFDF +AL
Sbjct  221  QGTEMNQRWNLLLYKLNKATSAMSHFDFNLAL  252



>ref|XP_002994698.1| hypothetical protein SELMODRAFT_449406 [Selaginella moellendorffii]
 gb|EFJ04236.1| hypothetical protein SELMODRAFT_449406 [Selaginella moellendorffii]
Length=654

 Score =   117 bits (293),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGERKLLKHN  603
            S+G+TPFGPFS++SSLSF  +DAA RNVL T LN ++  AI+++E++   GGE+ +LK  
Sbjct  518  SLGNTPFGPFSKLSSLSFAPRDAAPRNVLHTMLNTTVWGAIEMLETLKGLGGEKAVLKSR  577

Query  602  QLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDL  435
            Q  E  QRWNL  YKL+K  SA+SH  F +AL++L+S++H +Y      +    D+
Sbjct  578  QGTEMNQRWNLLLYKLNKATSAMSHVGFNLALFFLKSAEHDLYGALDRAFDMESDV  633



>ref|XP_005826412.1| hypothetical protein GUITHDRAFT_114391 [Guillardia theta CCMP2712]
 gb|EKX39432.1| hypothetical protein GUITHDRAFT_114391 [Guillardia theta CCMP2712]
Length=768

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 72/126 (57%), Gaps = 1/126 (1%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGE-RKLLKH  606
            S   TPFGPFS    L+F   DAARRN++ ++LN+S+      +E  +  G     +L  
Sbjct  601  SAAATPFGPFSTSEKLTFSLVDAARRNLVFSALNFSIAQVSLTLEQFSKFGKNMEDVLLP  660

Query  605  NQLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLEAS  426
            ++   F++RWN+ K+K+ +T + LS  +F  AL+Y RS+ H + AI + V HA + +   
Sbjct  661  SEHVHFVRRWNVLKFKILRTSTYLSLLNFNTALFYARSTRHDVKAIRNTVLHAGKFVHTY  720

Query  425  LVCFKD  408
            + C  D
Sbjct  721  IGCLHD  726



>ref|XP_002501279.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62537.1| predicted protein [Micromonas sp. RCC299]
Length=815

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 38/128 (30%), Positives = 68/128 (53%), Gaps = 5/128 (4%)
 Frame = -3

Query  779  VGHTPFGPFSEIS---SLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIA-SHGGERKLL  612
            VG++PFG  S +     +SF   DAA+R+ +L  +  +   A  V+ ++A S  G+  + 
Sbjct  648  VGNSPFGELSLVGRKGQISFAASDAAKRHAILAIVAETRHRASRVLAALARSRDGQGAMT  707

Query  611  KHNQLPEFIQRWNLFKYKLDKTVSALSHFDFEMALYYLRSSDHXIYAIHSLVYHASQDLE  432
                L EF  RW   + K ++ ++A +  D + A ++  S++  + A+  LV  A + LE
Sbjct  708  PTAGL-EFDGRWASMRRKHERALAAEAMHDHKRARHFAMSANVDLEALTKLVLDAGKKLE  766

Query  431  ASLVCFKD  408
            A L CF++
Sbjct  767  ARLECFEE  774



>ref|XP_004334562.1| hypothetical protein ACA1_329450, partial [Acanthamoeba castellanii 
str. Neff]
 gb|ELR12549.1| hypothetical protein ACA1_329450, partial [Acanthamoeba castellanii 
str. Neff]
Length=459

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 44/85 (52%), Gaps = 2/85 (2%)
 Frame = -3

Query  782  SVGHTPFGPFSEISSLSFVQKDAARRNVLLTSLNYSLMSAIDVMESIASHGGE-RKLLKH  606
            +VG TPFGPFS    L+F Q D ARR  L   +  +L     +  + A +  E    L  
Sbjct  375  AVGGTPFGPFSPSVRLTFAQTDPARRFRLYGYIERTLRRLTSLFRTYAEYDLELEDGLSP  434

Query  605  NQLPEFIQRWNLFKYKLDKTVSALS  531
                + +QRWNL ++K +K V ALS
Sbjct  435  EAYEQLMQRWNLLQFKFEK-VPALS  458



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1572839714856