BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3926

Length=751
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006363022.1|  PREDICTED: scarecrow-like transcription fact...    162   3e-42   Solanum tuberosum [potatoes]
ref|XP_002272334.1|  PREDICTED: scarecrow-like transcription fact...    157   8e-41   Vitis vinifera
ref|XP_004243547.1|  PREDICTED: scarecrow-like transcription fact...    156   2e-40   Solanum lycopersicum
ref|XP_009784447.1|  PREDICTED: scarecrow-like transcription fact...    155   5e-40   Nicotiana sylvestris
ref|XP_007215518.1|  hypothetical protein PRUPE_ppa003702mg             154   1e-39   Prunus persica
ref|XP_008229882.1|  PREDICTED: scarecrow-like transcription fact...    151   1e-38   
ref|XP_002533870.1|  Chitin-inducible gibberellin-responsive prot...    146   9e-37   
ref|XP_009590821.1|  PREDICTED: scarecrow-like transcription fact...    145   1e-36   Nicotiana tomentosiformis
ref|XP_009761823.1|  PREDICTED: scarecrow-like transcription fact...    143   8e-36   Nicotiana sylvestris
ref|XP_009605526.1|  PREDICTED: scarecrow-like transcription fact...    142   1e-35   Nicotiana tomentosiformis
ref|XP_007142502.1|  hypothetical protein PHAVU_008G286000g             140   7e-35   Phaseolus vulgaris [French bean]
ref|XP_003617966.1|  Chitin-inducible gibberellin-responsive protein    138   6e-34   Medicago truncatula
ref|XP_006447746.1|  hypothetical protein CICLE_v10014845mg             137   2e-33   Citrus clementina [clementine]
ref|XP_007049285.1|  GRAS family transcription factor isoform 1         136   2e-33   
ref|NP_001280993.1|  scarecrow-like transcription factor PAT1           135   4e-33   Malus domestica [apple tree]
gb|KDO58435.1|  hypothetical protein CISIN_1g009376mg                   135   7e-33   Citrus sinensis [apfelsine]
ref|XP_002321179.1|  hypothetical protein POPTR_0014s16230g             135   7e-33   
ref|XP_011048955.1|  PREDICTED: scarecrow-like transcription fact...    135   7e-33   Populus euphratica
ref|XP_008379979.1|  PREDICTED: scarecrow-like transcription fact...    134   1e-32   
ref|XP_012081427.1|  PREDICTED: scarecrow-like transcription fact...    134   1e-32   
emb|CBI28413.3|  unnamed protein product                                133   2e-32   Vitis vinifera
ref|XP_011100624.1|  PREDICTED: scarecrow-like protein 21               131   1e-31   Sesamum indicum [beniseed]
ref|XP_009365203.1|  PREDICTED: scarecrow-like transcription fact...    130   3e-31   Pyrus x bretschneideri [bai li]
ref|XP_003544277.1|  PREDICTED: scarecrow-like transcription fact...    128   2e-30   Glycine max [soybeans]
ref|XP_010252695.1|  PREDICTED: scarecrow-like protein 21               127   6e-30   Nelumbo nucifera [Indian lotus]
ref|XP_007049286.1|  GRAS family transcription factor isoform 2         126   8e-30   Theobroma cacao [chocolate]
ref|XP_004140012.1|  PREDICTED: scarecrow-like transcription fact...    125   1e-29   Cucumis sativus [cucumbers]
ref|XP_003519666.1|  PREDICTED: scarecrow-like transcription fact...    125   2e-29   Glycine max [soybeans]
ref|XP_010112792.1|  hypothetical protein L484_020023                   124   4e-29   
emb|CDP18907.1|  unnamed protein product                                122   2e-28   Coffea canephora [robusta coffee]
ref|XP_004491586.1|  PREDICTED: scarecrow-like transcription fact...    122   2e-28   Cicer arietinum [garbanzo]
ref|XP_004293455.1|  PREDICTED: scarecrow-like transcription fact...    121   6e-28   Fragaria vesca subsp. vesca
ref|XP_008464182.1|  PREDICTED: scarecrow-like transcription fact...    120   1e-27   Cucumis melo [Oriental melon]
gb|KDP29900.1|  hypothetical protein JCGZ_18469                         120   2e-27   Jatropha curcas
ref|XP_010270168.1|  PREDICTED: scarecrow-like protein 21               114   4e-25   Nelumbo nucifera [Indian lotus]
gb|AGE44291.1|  GRAS54 protein                                          110   5e-24   Dimocarpus longan [longan]
ref|XP_010045926.1|  PREDICTED: scarecrow-like transcription fact...    108   1e-23   Eucalyptus grandis [rose gum]
gb|KJB10261.1|  hypothetical protein B456_001G192800                    108   1e-23   Gossypium raimondii
gb|KHG21504.1|  Scarecrow-like transcription factor PAT1                108   4e-23   Gossypium arboreum [tree cotton]
gb|KHG24972.1|  Scarecrow-like transcription factor PAT1                107   4e-23   Gossypium arboreum [tree cotton]
gb|KJB42774.1|  hypothetical protein B456_007G167000                    106   1e-22   Gossypium raimondii
gb|ADK92865.1|  phytochrome A signal transduction 1                     103   1e-21   Hypericum perforatum
ref|XP_008800637.1|  PREDICTED: LOW QUALITY PROTEIN: chitin-induc...    101   7e-21   
ref|XP_002274103.1|  PREDICTED: scarecrow-like protein 21               101   9e-21   Vitis vinifera
emb|CBI26738.3|  unnamed protein product                              94.4    2e-18   Vitis vinifera
ref|XP_010905298.1|  PREDICTED: scarecrow-like protein 21             91.3    2e-17   
ref|XP_010666093.1|  PREDICTED: scarecrow-like protein 21             86.7    7e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007026309.1|  SCL domain class transcription factor            83.6    8e-15   
ref|XP_002308802.1|  hypothetical protein POPTR_0006s01720g           81.3    5e-14   Populus trichocarpa [western balsam poplar]
ref|XP_010907680.1|  PREDICTED: chitin-inducible gibberellin-resp...  80.9    6e-14   Elaeis guineensis
ref|XP_010547219.1|  PREDICTED: scarecrow-like transcription fact...  80.1    1e-13   Tarenaya hassleriana [spider flower]
ref|XP_010547221.1|  PREDICTED: scarecrow-like transcription fact...  79.7    1e-13   Tarenaya hassleriana [spider flower]
ref|XP_009395599.1|  PREDICTED: scarecrow-like protein 21             77.8    6e-13   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN78295.1|  hypothetical protein VITISV_004660                   77.4    7e-13   Vitis vinifera
ref|XP_010557767.1|  PREDICTED: scarecrow-like transcription fact...  76.6    2e-12   
gb|EYU42749.1|  hypothetical protein MIMGU_mgv1a005166mg              75.5    3e-12   Erythranthe guttata [common monkey flower]
ref|XP_007020615.1|  Scarecrow-like transcription factor PAT1 iso...  74.7    4e-12   
ref|XP_006449893.1|  hypothetical protein CICLE_v10014811mg           75.1    5e-12   Citrus clementina [clementine]
ref|XP_006467309.1|  PREDICTED: scarecrow-like protein 13-like        74.7    6e-12   Citrus sinensis [apfelsine]
ref|XP_007020613.1|  Scarecrow-like transcription factor PAT1 iso...  74.7    7e-12   
ref|XP_011004506.1|  PREDICTED: scarecrow-like protein 13             74.3    8e-12   Populus euphratica
gb|KJB68542.1|  hypothetical protein B456_010G249400                  73.6    2e-11   Gossypium raimondii
ref|XP_002322514.1|  hypothetical protein POPTR_0016s01110g           73.6    2e-11   Populus trichocarpa [western balsam poplar]
ref|XP_009387556.1|  PREDICTED: scarecrow-like transcription fact...  73.6    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011040189.1|  PREDICTED: scarecrow-like protein 13             73.2    2e-11   Populus euphratica
ref|XP_008780980.1|  PREDICTED: scarecrow-like protein 21             72.8    3e-11   Phoenix dactylifera
ref|XP_006836764.1|  PREDICTED: scarecrow-like protein 21             72.4    4e-11   Amborella trichopoda
ref|XP_010052945.1|  PREDICTED: scarecrow-like protein 13             70.9    1e-10   Eucalyptus grandis [rose gum]
gb|AGW99232.1|  scarecrow-like protein 13-like protein                69.3    4e-10   Cucumis melo [Oriental melon]
ref|XP_008440083.1|  PREDICTED: scarecrow-like protein 13             69.3    4e-10   
ref|XP_004293381.1|  PREDICTED: scarecrow-like protein 13             68.9    5e-10   Fragaria vesca subsp. vesca
ref|XP_009626207.1|  PREDICTED: scarecrow-like transcription fact...  68.6    7e-10   Nicotiana tomentosiformis
ref|XP_008449075.1|  PREDICTED: scarecrow-like transcription fact...  68.6    8e-10   Cucumis melo [Oriental melon]
gb|ADL36815.1|  SCL domain class transcription factor                 68.2    1e-09   Malus domestica [apple tree]
ref|XP_008366083.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...  67.8    1e-09   
gb|KDO62219.1|  hypothetical protein CISIN_1g046067mg                 67.8    1e-09   Citrus sinensis [apfelsine]
ref|XP_004134801.1|  PREDICTED: scarecrow-like protein 13             67.8    1e-09   Cucumis sativus [cucumbers]
ref|XP_002300358.2|  hypothetical protein POPTR_0001s37270g           67.8    1e-09   
ref|XP_009374874.1|  PREDICTED: scarecrow-like protein 13             67.4    2e-09   Pyrus x bretschneideri [bai li]
ref|XP_006474942.1|  PREDICTED: scarecrow-like protein 5-like iso...  67.4    2e-09   Citrus sinensis [apfelsine]
ref|XP_006452519.1|  hypothetical protein CICLE_v10007927mg           67.4    2e-09   
ref|XP_006474943.1|  PREDICTED: scarecrow-like protein 5-like iso...  67.4    2e-09   Citrus sinensis [apfelsine]
ref|XP_004149575.1|  PREDICTED: scarecrow-like transcription fact...  67.4    2e-09   Cucumis sativus [cucumbers]
ref|XP_006452520.1|  hypothetical protein CICLE_v10007927mg           67.4    2e-09   Citrus clementina [clementine]
ref|XP_010094683.1|  hypothetical protein L484_004260                 67.0    2e-09   
ref|XP_009804325.1|  PREDICTED: scarecrow-like transcription fact...  67.0    2e-09   Nicotiana sylvestris
ref|XP_004958142.1|  PREDICTED: chitin-inducible gibberellin-resp...  66.6    3e-09   Setaria italica
ref|XP_011014635.1|  PREDICTED: scarecrow-like transcription fact...  65.5    8e-09   Populus euphratica
ref|XP_008342206.1|  PREDICTED: scarecrow-like protein 21             65.1    9e-09   
ref|XP_003546192.1|  PREDICTED: scarecrow-like protein 13-like        64.7    1e-08   Glycine max [soybeans]
ref|XP_006657889.1|  PREDICTED: chitin-inducible gibberellin-resp...  64.3    2e-08   Oryza brachyantha
ref|XP_008227448.1|  PREDICTED: scarecrow-like protein 13             63.9    2e-08   Prunus mume [ume]
ref|XP_002865612.1|  hypothetical protein ARALYDRAFT_917700           63.5    3e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_002460928.1|  hypothetical protein SORBIDRAFT_02g037650        63.5    3e-08   Sorghum bicolor [broomcorn]
ref|XP_008376441.1|  PREDICTED: scarecrow-like protein 21             63.5    4e-08   
ref|NP_001060115.1|  Os07g0583600                                     63.2    4e-08   
gb|KJB13827.1|  hypothetical protein B456_002G096300                  62.8    6e-08   Gossypium raimondii
ref|XP_002272401.1|  PREDICTED: scarecrow-like protein 21             62.8    6e-08   Vitis vinifera
ref|XP_010442232.1|  PREDICTED: scarecrow-like transcription fact...  62.4    7e-08   Camelina sativa [gold-of-pleasure]
ref|XP_007211536.1|  hypothetical protein PRUPE_ppa003910mg           62.4    7e-08   Prunus persica
ref|XP_010493620.1|  PREDICTED: scarecrow-like transcription fact...  62.4    7e-08   Camelina sativa [gold-of-pleasure]
ref|XP_004244053.1|  PREDICTED: scarecrow-like protein 21             62.4    8e-08   Solanum lycopersicum
ref|XP_003551507.1|  PREDICTED: scarecrow-like protein 5-like iso...  62.0    9e-08   Glycine max [soybeans]
ref|XP_006280361.1|  hypothetical protein CARUB_v10026289mg           62.0    1e-07   Capsella rubella
ref|XP_008370992.1|  PREDICTED: scarecrow-like protein 13             61.6    1e-07   Malus domestica [apple tree]
gb|KHG14123.1|  Scarecrow-like protein 5                              61.2    2e-07   Gossypium arboreum [tree cotton]
ref|XP_010482060.1|  PREDICTED: scarecrow-like transcription fact...  61.2    2e-07   Camelina sativa [gold-of-pleasure]
gb|KJB57876.1|  hypothetical protein B456_009G184100                  60.8    2e-07   Gossypium raimondii
ref|XP_007146593.1|  hypothetical protein PHAVU_006G053400g           60.8    3e-07   Phaseolus vulgaris [French bean]
ref|XP_009348924.1|  PREDICTED: scarecrow-like protein 13             60.8    3e-07   Pyrus x bretschneideri [bai li]
ref|XP_007211555.1|  hypothetical protein PRUPE_ppa004136mg           60.8    3e-07   
ref|XP_003532162.1|  PREDICTED: scarecrow-like protein 5-like         60.5    4e-07   Glycine max [soybeans]
gb|KHN43816.1|  Scarecrow-like protein 5                              60.5    4e-07   Glycine soja [wild soybean]
ref|XP_003562815.1|  PREDICTED: chitin-inducible gibberellin-resp...  60.1    5e-07   Brachypodium distachyon [annual false brome]
ref|XP_006346161.1|  PREDICTED: scarecrow-like transcription fact...  58.9    1e-06   Solanum tuberosum [potatoes]
emb|CDY54511.1|  BnaC07g49170D                                        58.9    1e-06   Brassica napus [oilseed rape]
ref|NP_199626.1|  GRAS family transcription factor                    58.5    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009396052.1|  PREDICTED: chitin-inducible gibberellin-resp...  58.5    2e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010097275.1|  hypothetical protein L484_009507                 58.2    2e-06   Morus notabilis
ref|XP_007147638.1|  hypothetical protein PHAVU_006G141700g           57.4    3e-06   Phaseolus vulgaris [French bean]
ref|XP_004983228.1|  PREDICTED: chitin-inducible gibberellin-resp...  57.4    4e-06   Setaria italica
emb|CDY05700.1|  BnaC02g38370D                                        56.6    6e-06   
ref|XP_006661722.1|  PREDICTED: chitin-inducible gibberellin-resp...  57.0    6e-06   Oryza brachyantha
ref|XP_008227106.1|  PREDICTED: scarecrow-like protein 21             56.6    7e-06   Prunus mume [ume]
gb|ABD84026.1|  putative chitin-inducible gibberellin-responsive ...  56.6    7e-06   Bambusa ventricosa [Buddha bamboo]
ref|XP_009129708.1|  PREDICTED: scarecrow-like transcription fact...  56.2    8e-06   Brassica rapa
gb|ABG66041.1|  Chitin-inducible gibberellin-responsive protein 2...  54.7    9e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007142381.1|  hypothetical protein PHAVU_008G275500g           56.2    1e-05   Phaseolus vulgaris [French bean]
ref|XP_009346772.1|  PREDICTED: scarecrow-like protein 21             56.2    1e-05   Pyrus x bretschneideri [bai li]
gb|KHN40815.1|  Scarecrow-like protein 13                             55.8    1e-05   Glycine soja [wild soybean]
ref|XP_003534887.1|  PREDICTED: scarecrow-like protein 13-like        55.8    1e-05   Glycine max [soybeans]
ref|XP_012069359.1|  PREDICTED: scarecrow-like protein 13             55.5    2e-05   Jatropha curcas
gb|EAY78215.1|  hypothetical protein OsI_33264                        54.7    3e-05   Oryza sativa Indica Group [Indian rice]
gb|AAM08829.1|AC113335_9  Putative SCARECROW gene regulator-like      54.7    3e-05   Oryza sativa Japonica Group [Japonica rice]
gb|ABB47346.1|  Chitin-inducible gibberellin-responsive protein 2...  54.7    3e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002534218.1|  Chitin-inducible gibberellin-responsive prot...  54.7    3e-05   Ricinus communis
ref|XP_009338895.1|  PREDICTED: scarecrow-like protein 21             54.3    4e-05   Pyrus x bretschneideri [bai li]
ref|XP_011095941.1|  PREDICTED: scarecrow-like protein 13             54.3    4e-05   Sesamum indicum [beniseed]
ref|NP_001147837.1|  LOC100281447                                     53.9    5e-05   
ref|XP_006588180.1|  PREDICTED: scarecrow-like protein 5-like         53.9    5e-05   Glycine max [soybeans]
ref|XP_003573869.1|  PREDICTED: scarecrow-like protein 21             53.9    6e-05   Brachypodium distachyon [annual false brome]
gb|KJB62971.1|  hypothetical protein B456_009G446100                  53.1    1e-04   Gossypium raimondii
emb|CDX86324.1|  BnaA06g30410D                                        53.1    1e-04   
ref|XP_004294461.1|  PREDICTED: scarecrow-like protein 21             53.1    1e-04   Fragaria vesca subsp. vesca
ref|XP_009151613.1|  PREDICTED: scarecrow-like transcription fact...  53.1    1e-04   Brassica rapa
ref|XP_006649543.1|  PREDICTED: chitin-inducible gibberellin-resp...  52.8    1e-04   Oryza brachyantha
emb|CDP04504.1|  unnamed protein product                              52.8    1e-04   Coffea canephora [robusta coffee]
ref|XP_006283515.1|  hypothetical protein CARUB_v10004566mg           52.8    1e-04   Capsella rubella
ref|XP_007154029.1|  hypothetical protein PHAVU_003G085000g           52.8    1e-04   Phaseolus vulgaris [French bean]
ref|XP_011086251.1|  PREDICTED: scarecrow-like protein 21             52.8    1e-04   Sesamum indicum [beniseed]
ref|XP_006365847.1|  PREDICTED: scarecrow-like protein 13-like is...  52.4    2e-04   Solanum tuberosum [potatoes]
ref|XP_006283514.1|  hypothetical protein CARUB_v10004566mg           52.0    2e-04   
ref|NP_001183658.1|  hypothetical protein                             52.0    2e-04   Zea mays [maize]
gb|EMT04695.1|  hypothetical protein F775_26780                       52.0    2e-04   
gb|KHN41397.1|  Scarecrow-like transcription factor PAT1              52.0    2e-04   Glycine soja [wild soybean]
gb|ADX60178.1|  GRAS transcription factor                             52.0    2e-04   Zea mays [maize]
gb|KJB13826.1|  hypothetical protein B456_002G096300                  52.0    2e-04   Gossypium raimondii
ref|XP_010686653.1|  PREDICTED: scarecrow-like protein 21             52.0    3e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009773976.1|  PREDICTED: scarecrow-like protein 13             52.0    3e-04   Nicotiana sylvestris
gb|EMS61898.1|  hypothetical protein TRIUR3_25879                     51.6    3e-04   Triticum urartu
ref|NP_001234305.1|  GRAS1 protein                                    51.6    3e-04   
ref|XP_010449649.1|  PREDICTED: scarecrow-like protein 13             51.6    4e-04   Camelina sativa [gold-of-pleasure]
ref|XP_003600261.1|  Scarecrow-like transcription factor PAT1         51.2    4e-04   Medicago truncatula
ref|XP_006414257.1|  hypothetical protein EUTSA_v10024887mg           50.8    5e-04   Eutrema salsugineum [saltwater cress]
dbj|BAJ33904.1|  unnamed protein product                              50.8    5e-04   Eutrema halophilum
ref|NP_001240165.1|  uncharacterized protein LOC100792931             50.8    6e-04   Glycine max [soybeans]
gb|KHN42281.1|  Scarecrow-like protein 13                             50.8    6e-04   Glycine soja [wild soybean]
ref|XP_004239819.1|  PREDICTED: scarecrow-like protein 13             50.4    7e-04   Solanum lycopersicum
ref|NP_001170141.1|  hypothetical protein                             50.4    8e-04   Zea mays [maize]
ref|XP_010434701.1|  PREDICTED: scarecrow-like protein 13             50.4    8e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010440036.1|  PREDICTED: scarecrow-like protein 13             50.4    0.001   Camelina sativa [gold-of-pleasure]
dbj|BAJ92120.1|  predicted protein                                    50.1    0.001   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN03530.1|  Scarecrow-like protein 13                             50.1    0.001   Glycine soja [wild soybean]
gb|ACN28625.1|  unknown                                               50.1    0.001   Zea mays [maize]



>ref|XP_006363022.1| PREDICTED: scarecrow-like transcription factor PAT1-like [Solanum 
tuberosum]
Length=545

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 107/168 (64%), Gaps = 21/168 (13%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVA--NPVHASRNLYC  480
            MQA++R RRT MSN L   PVQKA+ YCLP+FQ L+  LSY N ++   +     R+ YC
Sbjct  1    MQASRR-RRTAMSNTLYCEPVQKAEAYCLPRFQTLESHLSYINGSLGGNHSFQTYRDRYC  59

Query  481  TLESSSVSESRALYGSP----MSQQGS--------------RSYPSDNNYGSPISGSCIT  606
             LE+SS + S  +Y SP     S  GS              R  P   NYGSPISGSCIT
Sbjct  60   MLEASSATGSYGVYHSPSTASFSSNGSTTCNQESQPYLSDIRQSPETTNYGSPISGSCIT  119

Query  607  DDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
            DD + F+HKLKELET MLGPD+D  ES+DN+  SSIAS EIDSWRQMM
Sbjct  120  DDATDFMHKLKELETVMLGPDADFQESYDNSLASSIASSEIDSWRQMM  167



>ref|XP_002272334.1| PREDICTED: scarecrow-like transcription factor PAT1 [Vitis vinifera]
 ref|XP_010657429.1| PREDICTED: scarecrow-like transcription factor PAT1 [Vitis vinifera]
 ref|XP_010657430.1| PREDICTED: scarecrow-like transcription factor PAT1 [Vitis vinifera]
Length=545

 Score =   157 bits (398),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 111/169 (66%), Gaps = 23/169 (14%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNN----TNVANPVHASRNL  474
            MQA+Q+ R +GMSN L Y P Q+A+ +CLPQFQ  DH+L YN+    TN +     S   
Sbjct  1    MQASQQHRSSGMSNRLYYLPPQEAEAHCLPQFQSFDHQLCYNDGSQGTNFS--FQGSSER  58

Query  475  YCTLESSSVSESRALY-----------GSPMSQQGSRSYPSD------NNYGSPISGSCI  603
            YCTLESSS + S A+Y           GSP SQQ S+SYPSD      N YGSP+S SCI
Sbjct  59   YCTLESSSATGSYAIYNSPSTVSFSPNGSPNSQQDSQSYPSDPHHSPDNTYGSPMSASCI  118

Query  604  TDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
            TDD+S   HKL+ELET MLGPDSD++ S+D+TF  + +S E+DSWR  M
Sbjct  119  TDDVSDLKHKLRELETVMLGPDSDIINSYDSTFTPNKSSLEMDSWRDTM  167



>ref|XP_004243547.1| PREDICTED: scarecrow-like transcription factor PAT1 [Solanum 
lycopersicum]
Length=545

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 108/168 (64%), Gaps = 21/168 (13%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVA--NPVHASRNLYC  480
            MQA++R RRT MSN+L   PVQKA+ Y LPQFQ L+  LS  N ++   +      + YC
Sbjct  1    MQASRR-RRTTMSNMLYCEPVQKAEAYYLPQFQTLESHLSCINGSLGGNHSFQTYHDRYC  59

Query  481  TLESSSVSESRALYGSP----MSQQGS--------------RSYPSDNNYGSPISGSCIT  606
             LE+SS + S A+Y SP     S  GS              R  P   NYGSPISGSCIT
Sbjct  60   MLEASSATGSNAVYHSPSTASFSSNGSTTCNQESQLYLSDVRQSPETTNYGSPISGSCIT  119

Query  607  DDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
            DD++ F+HKLKELETAMLGPD+D  ES+DN+  SSIAS EIDSWRQMM
Sbjct  120  DDVTDFMHKLKELETAMLGPDADFQESYDNSLASSIASSEIDSWRQMM  167



>ref|XP_009784447.1| PREDICTED: scarecrow-like transcription factor PAT1 [Nicotiana 
sylvestris]
 ref|XP_009784449.1| PREDICTED: scarecrow-like transcription factor PAT1 [Nicotiana 
sylvestris]
 ref|XP_009784450.1| PREDICTED: scarecrow-like transcription factor PAT1 [Nicotiana 
sylvestris]
 ref|XP_009784451.1| PREDICTED: scarecrow-like transcription factor PAT1 [Nicotiana 
sylvestris]
Length=521

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 104/155 (67%), Gaps = 19/155 (12%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYCTL  486
            MQA+QRLRR+ MSN L Y PVQKA+  CLPQFQ LD+ LSY        ++ S   Y + 
Sbjct  1    MQASQRLRRSPMSNTLYYQPVQKAEACCLPQFQTLDNHLSY--------INGSHGFYHSP  52

Query  487  ESSSVSESRALYGSPMSQQGSRSYPSD-------NNYGSPISGSCITDDMSSFIHKLKEL  645
             ++S S +    GS +  Q S+ Y SD        NYGSP SGSCITD  + F+HKLKEL
Sbjct  53   STASFSSN----GSSICHQESQPYLSDVRQSSETTNYGSPTSGSCITDGANDFMHKLKEL  108

Query  646  ETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
            ET MLGPDSD LES+DN+ P+S+AS EI+SWRQMM
Sbjct  109  ETVMLGPDSDFLESYDNSLPNSVASTEINSWRQMM  143



>ref|XP_007215518.1| hypothetical protein PRUPE_ppa003702mg [Prunus persica]
 gb|EMJ16717.1| hypothetical protein PRUPE_ppa003702mg [Prunus persica]
Length=555

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 113/171 (66%), Gaps = 23/171 (13%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNL---Y  477
            MQA++  R +GMSN LCY PVQ+ + YCLP+FQ LD ++ YNN +  + V +++N    Y
Sbjct  1    MQASKHHRSSGMSNRLCYQPVQEVEAYCLPRFQTLDPQVHYNNESSQSTVFSAQNFHIKY  60

Query  478  CTLESSSVSESRALY-----------GSPMSQQGSRSYPS-------DNNYGSPISGSCI  603
            CTLESS+ + S  +Y           GSPMSQQ S SYP        D NY SPISGSCI
Sbjct  61   CTLESSAANGSYTVYNSPSTVNFSPNGSPMSQQDSHSYPPPDQYHSPDQNYSSPISGSCI  120

Query  604  TDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIAS--PEIDSWRQMM  750
            TDD + F +KLK+LET MLGPDS++L+++ +TF +  ++  PE DSW Q+M
Sbjct  121  TDDATDFKYKLKQLETVMLGPDSNILDNYCSTFQNGTSNTLPETDSWGQIM  171



>ref|XP_008229882.1| PREDICTED: scarecrow-like transcription factor PAT1 [Prunus mume]
 ref|XP_008229883.1| PREDICTED: scarecrow-like transcription factor PAT1 [Prunus mume]
 ref|XP_008229884.1| PREDICTED: scarecrow-like transcription factor PAT1 [Prunus mume]
Length=555

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 112/171 (65%), Gaps = 23/171 (13%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNL---Y  477
            MQ ++  R +GMSN LCY P+Q+ + YCLP+FQ LD ++ YNN +  + V +++N    Y
Sbjct  1    MQTSKHHRSSGMSNRLCYQPIQEVEAYCLPRFQTLDPQVLYNNESSQSTVFSAQNFHIKY  60

Query  478  CTLESSSVSESRALY-----------GSPMSQQGSRSYPS-------DNNYGSPISGSCI  603
            CTLESS+ + S  +Y           GSPMSQQ S SYP        D NY SPISGSCI
Sbjct  61   CTLESSAANGSYTVYNSPSTVNFSPNGSPMSQQDSHSYPPPDQYHSPDQNYSSPISGSCI  120

Query  604  TDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIAS--PEIDSWRQMM  750
            TDD + F +KLK+LET MLGPDS++L+++ +TF +  ++  PE DSW Q+M
Sbjct  121  TDDATDFKYKLKQLETVMLGPDSNILDNYCSTFQNGTSNTLPETDSWGQIM  171



>ref|XP_002533870.1| Chitin-inducible gibberellin-responsive protein, putative [Ricinus 
communis]
 gb|EEF28520.1| Chitin-inducible gibberellin-responsive protein, putative [Ricinus 
communis]
Length=582

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 112/171 (65%), Gaps = 25/171 (15%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNN----TNVANPVHASRNL  474
            MQ++Q+ R   MS+ L   P+Q+ + YC+PQFQ LDH+L YN     T+++ P   +R+ 
Sbjct  1    MQSSQQYRSRCMSSKLYNQPMQEFEAYCMPQFQTLDHQLRYNGSSQRTHLSIP--NARDQ  58

Query  475  YCTLESSSVSESRALY-----------GSPMSQQGSRSYPSD------NNYGSPISGSCI  603
            YCTLESSS + S  +Y           GSP+SQQ S+SYP D      NNYGSPISGSCI
Sbjct  59   YCTLESSSANGSYPIYNSPSTVSLSPNGSPVSQQESQSYPPDLHHSPDNNYGSPISGSCI  118

Query  604  TDDMSSFIHKLKELETAMLGPDSDVLESHDNTFP--SSIASPEIDSWRQMM  750
            TDD++ F  KL+ELET +LGPD   +ES ++ F   SSI SPE+D WRQMM
Sbjct  119  TDDVNDFRSKLRELETDLLGPDYGFMESIESNFQNGSSIKSPEMDIWRQMM  169



>ref|XP_009590821.1| PREDICTED: scarecrow-like transcription factor PAT1 [Nicotiana 
tomentosiformis]
 ref|XP_009590822.1| PREDICTED: scarecrow-like transcription factor PAT1 [Nicotiana 
tomentosiformis]
 ref|XP_009590823.1| PREDICTED: scarecrow-like transcription factor PAT1 [Nicotiana 
tomentosiformis]
Length=544

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 106/167 (63%), Gaps = 20/167 (12%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELS-YNNTNVAN-PVHASRNLYC  480
            MQA+QRLRR+ MS+ L Y  VQK +   LPQFQ LD +++  N T   N  +    + YC
Sbjct  1    MQASQRLRRSAMSDTL-YKSVQKTEASYLPQFQTLDKQMTNINRTQGGNHSIQTYSDWYC  59

Query  481  TLESSSVSESRALY-----------GSPMSQQGSRS------YPSDNNYGSPISGSCITD  609
            TLESSS +   A+            GSP+S Q S+S      Y  D NY SP+SGSCITD
Sbjct  60   TLESSSPTGKYAVQNSISAVSFTPNGSPISHQESQSCLSDVHYLPDTNYNSPVSGSCITD  119

Query  610  DMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
            D++ F HKLKELET MLGP+SDVL+S DN+ PS + SPEI  WRQM+
Sbjct  120  DVNDFRHKLKELETVMLGPNSDVLDSCDNSLPSCMTSPEIGCWRQML  166



>ref|XP_009761823.1| PREDICTED: scarecrow-like transcription factor PAT1 [Nicotiana 
sylvestris]
 ref|XP_009761833.1| PREDICTED: scarecrow-like transcription factor PAT1 [Nicotiana 
sylvestris]
Length=544

 Score =   143 bits (361),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 104/167 (62%), Gaps = 20/167 (12%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHEL-SYNNTNVAN-PVHASRNLYC  480
            MQA+QRLRR+  S+ L Y  VQK +   LPQFQ LD ++ S N T   N  +    + YC
Sbjct  1    MQASQRLRRSAKSDTL-YQSVQKTEASYLPQFQTLDTQMTSINRTQGGNHSIQTYSDRYC  59

Query  481  TLESSSVSESRALY-----------GSPMSQQGSRS------YPSDNNYGSPISGSCITD  609
            T+ESSS +    +            GSP S Q S+S      Y  D NY SP+SGSCITD
Sbjct  60   TMESSSPTGKYVVQNSISAVSFTPNGSPTSHQESQSCLSDVHYSPDTNYNSPVSGSCITD  119

Query  610  DMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
            D++ F HKLKELET MLGP+SDVL+S DN+ PS + SPEID WRQMM
Sbjct  120  DVNDFRHKLKELETVMLGPNSDVLDSCDNSLPSCMTSPEIDCWRQMM  166



>ref|XP_009605526.1| PREDICTED: scarecrow-like transcription factor PAT1 [Nicotiana 
tomentosiformis]
 ref|XP_009605527.1| PREDICTED: scarecrow-like transcription factor PAT1 [Nicotiana 
tomentosiformis]
 ref|XP_009605528.1| PREDICTED: scarecrow-like transcription factor PAT1 [Nicotiana 
tomentosiformis]
Length=521

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 107/155 (69%), Gaps = 19/155 (12%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYCTL  486
            MQA++RLRR+ MSN L Y PVQKA+ YCLPQFQ LD+ LSY        ++ S  +Y + 
Sbjct  1    MQASRRLRRSSMSNTLYYQPVQKAEAYCLPQFQTLDNHLSY--------INGSHGVYHSP  52

Query  487  ESSSVSESRALYGSPMSQQGSRSYPSD-------NNYGSPISGSCITDDMSSFIHKLKEL  645
             ++S S +    GS +  Q S+ Y SD        NYGSP SGSCITD ++ F+HKLKEL
Sbjct  53   STASFSSN----GSSICHQESQPYLSDVCQSSEMTNYGSPSSGSCITDGVNDFMHKLKEL  108

Query  646  ETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
            E+ MLGPDSD LES+DN+ PSSIAS EI+SWRQMM
Sbjct  109  ESVMLGPDSDFLESYDNSLPSSIASTEINSWRQMM  143



>ref|XP_007142502.1| hypothetical protein PHAVU_008G286000g [Phaseolus vulgaris]
 gb|ESW14496.1| hypothetical protein PHAVU_008G286000g [Phaseolus vulgaris]
Length=543

 Score =   140 bits (354),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 112/171 (65%), Gaps = 29/171 (17%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNN----TNVANPVHASRNL  474
            MQA+++ R + M     Y P+Q+ + YCLP+++ L+ +L Y++    T  + P  +S  L
Sbjct  1    MQASEQHRSSSMY----YQPLQQIEAYCLPRYRSLNQQLYYHDGGHGTQFSTP--SSSEL  54

Query  475  YCTLESSSVSESRALY-----------GSPMSQQGSRSYPSD------NNYGSPISGSCI  603
            YCTLESSSV+ S  LY           GSP+SQQ S SYP D      N YGSP+SGSCI
Sbjct  55   YCTLESSSVAGSFTLYNSPSTVNFSPNGSPISQQDSHSYPPDQYHSPENTYGSPMSGSCI  114

Query  604  TDDMSSFIHKLKELETAMLGPDSDVLESHDNTFP--SSIASPEIDSWRQMM  750
            TDD+S+F HKL+ELE+ MLGPDSD L+S+D+     ++ ASPE+DSWRQ M
Sbjct  115  TDDLSNFKHKLRELESIMLGPDSDNLDSYDSAISNGNNFASPEMDSWRQTM  165



>ref|XP_003617966.1| Chitin-inducible gibberellin-responsive protein [Medicago truncatula]
 gb|AET00925.1| GRAS family transcription factor [Medicago truncatula]
Length=544

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 109/170 (64%), Gaps = 26/170 (15%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHA---SRNLY  477
            MQA+++ R + M     Y P+Q+ + YCLPQ++ L+H+L  N+   A    A   S   Y
Sbjct  1    MQASEQHRSSSMY----YQPLQQIEAYCLPQYRNLNHQLYNNDGGQATQFSAPTSSDLYY  56

Query  478  CTLESSSVSESRALYGSP-----------MSQQGSRSYPSD------NNYGSPISGSCIT  606
            CTLESSS + S A+Y SP           MSQQ S+SYPSD      N YGSP+SGSCIT
Sbjct  57   CTLESSSAAGSFAVYNSPSTVSFSPNDSPMSQQESQSYPSDKYHSPDNTYGSPMSGSCIT  116

Query  607  DDMSSFIHKLKELETAMLGPDSDVLESHDNTFP--SSIASPEIDSWRQMM  750
            +D+SSF HKL+ELE+ MLGPDSD L+S+D+     ++ AS E+DSWRQ M
Sbjct  117  EDLSSFKHKLRELESVMLGPDSDNLDSYDSAISNGTNFASLEMDSWRQTM  166



>ref|XP_006447746.1| hypothetical protein CICLE_v10014845mg [Citrus clementina]
 ref|XP_006469518.1| PREDICTED: scarecrow-like transcription factor PAT1-like [Citrus 
sinensis]
 gb|ESR60986.1| hypothetical protein CICLE_v10014845mg [Citrus clementina]
Length=536

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 98/158 (62%), Gaps = 21/158 (13%)
 Frame = +1

Query  340  MSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVAN--PVHASRNLYCTLESSSVSESR  513
            MS  L Y P+Q+ +PYCLPQFQ +DH L YN+        +  S   YCTLESSS + S 
Sbjct  1    MSGRLYYQPIQEIEPYCLPQFQTVDHHLQYNDGGKGAHLSLQNSYEQYCTLESSSANGSY  60

Query  514  ALY-----------GSPMSQQGSRSYPSD------NNYGSPISGSCITDDMSSFIHKLKE  642
             +Y           GSPMSQQ S+SYP D      N YGSP+S SCIT+D S   HKL+E
Sbjct  61   TIYNSPSTVTFSPNGSPMSQQESQSYPPDLHHSPDNAYGSPMSASCITNDASDLKHKLRE  120

Query  643  LETAMLGPDSDVLESHDNTFPSSI--ASPEIDSWRQMM  750
            LE+ MLGPDSD+++  D+T+ S     SPE+DS RQ++
Sbjct  121  LESVMLGPDSDIIDGIDSTYQSGTNKGSPEMDSGRQII  158



>ref|XP_007049285.1| GRAS family transcription factor isoform 1 [Theobroma cacao]
 gb|EOX93442.1| GRAS family transcription factor isoform 1 [Theobroma cacao]
Length=569

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 108/174 (62%), Gaps = 27/174 (16%)
 Frame = +1

Query  286  IEKDWFSMQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVAN--PVH  459
            +E ++ S+QA+Q+ R   M++ L +   Q+ +PYCLPQF  +D  L Y++++  +   V 
Sbjct  26   VEVNYPSVQASQQYRSAVMASRLYHQVKQEVEPYCLPQFPTIDRSLCYSDSSQGSHFSVK  85

Query  460  ASRNLYCTLESSSVSESRALY-----------GSPMSQQGSRSYPSD------NNYGSPI  588
             S  LYCTLESSS + S  +Y           GSPMSQQ S+SYPSD      N YGSPI
Sbjct  86   NSSELYCTLESSSANGSYTVYNSSSTVSFSPNGSPMSQQESQSYPSDLHHSPDNTYGSPI  145

Query  589  SGSCITDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
            SGSCITDD+S   HKL+ELET MLGPDSD+++        S  SP++ SW  +M
Sbjct  146  SGSCITDDVSDLRHKLRELETVMLGPDSDIID--------STTSPDMGSWNLVM  191



>ref|NP_001280993.1| scarecrow-like transcription factor PAT1 [Malus domestica]
 ref|XP_008342180.1| PREDICTED: scarecrow-like transcription factor PAT1 [Malus domestica]
 ref|XP_008342182.1| PREDICTED: scarecrow-like transcription factor PAT1 [Malus domestica]
 gb|ADL36820.1| SCL domain class transcription factor [Malus domestica]
Length=551

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 105/167 (63%), Gaps = 19/167 (11%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYCTL  486
            MQA+++ R +GMSN L Y P+Q+ + YCLP+FQ LD +L YN ++ +  +      YCTL
Sbjct  1    MQASKQQRSSGMSNRLHYQPIQEVEAYCLPRFQTLDPQLHYNESSQSTHLPMQSFHYCTL  60

Query  487  ESSSVSESRALY-----------GSPMSQQGSRSYPS------DNNYGSPISGSCITDDM  615
            ESS  + S  +Y           GSPMSQQ S SYPS      D  Y SPISGSCITDD 
Sbjct  61   ESSWSNGSYTIYNSPSNVSFSPSGSPMSQQDSHSYPSERYHSPDQTYSSPISGSCITDDA  120

Query  616  SSFIHKLKELETAMLGPDSDVLESHDNTFPSSIAS--PEIDSWRQMM  750
              F +KLK+LET MLGPDS++L+++   FP+  ++  P+ DS  Q+M
Sbjct  121  PDFKYKLKQLETVMLGPDSNILDNYCINFPNGASNTLPDTDSLGQIM  167



>gb|KDO58435.1| hypothetical protein CISIN_1g009376mg [Citrus sinensis]
Length=536

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 98/158 (62%), Gaps = 21/158 (13%)
 Frame = +1

Query  340  MSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVAN--PVHASRNLYCTLESSSVSESR  513
            MS  L Y P+Q+ +PYCLPQFQ +DH L YN+        +  S   YCTLESSS + S 
Sbjct  1    MSGRLYYQPIQEIEPYCLPQFQTVDHHLQYNDGGKGAHFSLQNSYEQYCTLESSSANGSY  60

Query  514  ALY-----------GSPMSQQGSRSYPSD------NNYGSPISGSCITDDMSSFIHKLKE  642
             +Y           GSPMSQQ S+SYP D      N YGSP+S SCIT+D S   HKL+E
Sbjct  61   TIYNSPSTVTFSPNGSPMSQQESQSYPPDLHHSPDNAYGSPMSTSCITNDASDLKHKLRE  120

Query  643  LETAMLGPDSDVLESHDNTFPSSI--ASPEIDSWRQMM  750
            LE+ MLGPDSD+++  D+T+ +     SPE+DS RQ++
Sbjct  121  LESVMLGPDSDIIDGIDSTYQNGTNKGSPEMDSGRQII  158



>ref|XP_002321179.1| hypothetical protein POPTR_0014s16230g [Populus trichocarpa]
 gb|EEE99494.1| hypothetical protein POPTR_0014s16230g [Populus trichocarpa]
Length=547

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 103/169 (61%), Gaps = 21/169 (12%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANP--VHASRNLYC  480
            MQA+++LR +GMS+   Y P+Q+ + YC PQ + LD ++  + +    P  +  S   YC
Sbjct  1    MQASKQLRGSGMSSRFLYQPMQEVETYCKPQSRTLDRQIYSSGSTQGTPFTIPNSHEQYC  60

Query  481  TLESSSVSESRALY-----------GSPMSQQGSRSYP------SDNNYGSPISGSCITD  609
            TLESSS + S A Y           GSP+SQQ S+SY        DN  GSP+SGSCITD
Sbjct  61   TLESSSANGSYAAYNSPSTVSFSPNGSPLSQQESQSYSLEPRHSPDNASGSPLSGSCITD  120

Query  610  DMSSFIHKLKELETAMLGPDSDVLESHDNTFPSS--IASPEIDSWRQMM  750
            D   F HKL+ELET M GPDSD+++S +N   S   I S E+DSWRQ+M
Sbjct  121  DAHDFSHKLRELETVMFGPDSDIIDSIENALESGTNIESLEMDSWRQIM  169



>ref|XP_011048955.1| PREDICTED: scarecrow-like transcription factor PAT1 [Populus 
euphratica]
 ref|XP_011048956.1| PREDICTED: scarecrow-like transcription factor PAT1 [Populus 
euphratica]
Length=547

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 103/169 (61%), Gaps = 21/169 (12%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANP--VHASRNLYC  480
            MQA+++LR +GMS+   Y P+Q+ + YC PQ + LD ++  + +    P  +  S   YC
Sbjct  1    MQASKQLRGSGMSSRFLYQPMQEVEAYCKPQSRTLDRQIYSSGSTQGTPFTIPNSHEHYC  60

Query  481  TLESSSVSESRALY-----------GSPMSQQGSRSYP------SDNNYGSPISGSCITD  609
            TLESSS + S A Y           GSP+SQQ S+SY        DN  GSP+SGSCITD
Sbjct  61   TLESSSANGSYAAYNSPSTVSFSPNGSPLSQQESQSYSLEPRHSPDNASGSPLSGSCITD  120

Query  610  DMSSFIHKLKELETAMLGPDSDVLESHDNTFPSS--IASPEIDSWRQMM  750
            D   F HKL+ELET M GPDSD+++S +N   S   I S E+DSWRQ+M
Sbjct  121  DAHDFRHKLRELETVMFGPDSDIIDSIENALESGTNIESLEMDSWRQIM  169



>ref|XP_008379979.1| PREDICTED: scarecrow-like transcription factor PAT1 [Malus domestica]
 ref|XP_008379980.1| PREDICTED: scarecrow-like transcription factor PAT1 [Malus domestica]
Length=553

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 105/169 (62%), Gaps = 21/169 (12%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVAN--PVHASRNLYC  480
            MQA++  R +GMSN L Y P+Q+ + YCLP+FQ LD  L YN ++ +   P+ +    YC
Sbjct  1    MQASKEQRISGMSNQLYYQPIQEVEAYCLPRFQTLDPRLHYNESSQSTHLPLQSFHEHYC  60

Query  481  TLESSSVSESRALY-----------GSPMSQQGSRSYPSDN------NYGSPISGSCITD  609
            TLESS  + S  +Y           GSPMSQQ S SY SD        Y SP+SGSCITD
Sbjct  61   TLESSWSNGSYTVYNTPSNVSFSPSGSPMSQQDSHSYLSDQYHSPDQTYSSPMSGSCITD  120

Query  610  DMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIAS--PEIDSWRQMM  750
            D +   +KLK+LET MLGPDS+ L+++  TFP+  ++  P+ DSW Q+M
Sbjct  121  DATDLKYKLKQLETVMLGPDSNXLDNYCXTFPNGASNSLPDEDSWGQIM  169



>ref|XP_012081427.1| PREDICTED: scarecrow-like transcription factor PAT1 [Jatropha 
curcas]
 ref|XP_012081428.1| PREDICTED: scarecrow-like transcription factor PAT1 [Jatropha 
curcas]
Length=547

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 111/169 (66%), Gaps = 21/169 (12%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNT--NVANPVHASRNLYC  480
            MQA+Q+LR  GMS+ L Y P+ + + Y +PQF  LD +L Y  +   + + +  S    C
Sbjct  1    MQASQKLRSRGMSSRLYYQPMPEIEAYYMPQFPTLDKQLCYGGSSQGIHSSILNSCEHNC  60

Query  481  TLESSSVSESRALY-----------GSPMSQQGSRSYPSD------NNYGSPISGSCITD  609
            T ESS  + S A+Y           GSP+SQQ S+SYPSD      +NYGSPISGSCITD
Sbjct  61   TQESSLANGSFAVYNSPSTLSFSPNGSPVSQQESQSYPSDPHHSPDHNYGSPISGSCITD  120

Query  610  DMSSFIHKLKELETAMLGPDSDVLESHDNTFP--SSIASPEIDSWRQMM  750
            D++ F +KL+ELET MLGPDSD+++S ++TF   +SI SPE++S RQ++
Sbjct  121  DVNDFRNKLRELETVMLGPDSDIIDSIESTFQNGTSIESPEMESLRQIV  169



>emb|CBI28413.3| unnamed protein product [Vitis vinifera]
Length=484

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 99/158 (63%), Gaps = 24/158 (15%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNN----TNVANPVHASRNL  474
            MQA+Q+ R +GMSN L Y P Q+A+ +CLPQFQ  DH+L YN+    TN +     S   
Sbjct  1    MQASQQHRSSGMSNRLYYLPPQEAEAHCLPQFQSFDHQLCYNDGSQGTNFS--FQGSSER  58

Query  475  YCTLESSSVSESRALYGSPMSQQGSRSYPSD------NNYGSPISGSCITDDMSSFIHKL  636
            YCTLESS           P SQQ S+SYPSD      N YGSP+S SCITDD+S   HKL
Sbjct  59   YCTLESS-----------PNSQQDSQSYPSDPHHSPDNTYGSPMSASCITDDVSDLKHKL  107

Query  637  KELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
            +ELET MLGPDSD++ S+DN     +A   +D  RQM+
Sbjct  108  RELETVMLGPDSDIINSYDNN-DLLMAQWLMDELRQMV  144



>ref|XP_011100624.1| PREDICTED: scarecrow-like protein 21 [Sesamum indicum]
 ref|XP_011100625.1| PREDICTED: scarecrow-like protein 21 [Sesamum indicum]
Length=546

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 105/168 (63%), Gaps = 20/168 (12%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILD-HELSYNN-TNVAN-PVHASRNLY  477
            MQA Q   R+GM+N LC  P+ K +   L   Q ++ H LSYNN +N +N PVH S++ Y
Sbjct  1    MQACQYHSRSGMTNTLCCRPIGKLENCSLQPCQPINPHHLSYNNGSNGSNYPVHISQDRY  60

Query  478  CTLESSSVSESRALYGSP-----------MSQQGSRS------YPSDNNYGSPISGSCIT  606
            CTLESSS+S +   + SP           +SQQ S S      +  D NYGSPI+G  +T
Sbjct  61   CTLESSSLSVNYTGHDSPSTVSFSANESSLSQQESMSLCMDPHHSPDTNYGSPITGPRVT  120

Query  607  DDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
            +D++   HKLKELET MLGPD D LE  D+T PSSIAS EI+SWR MM
Sbjct  121  EDVNELKHKLKELETVMLGPDLDSLEYFDDTLPSSIASAEIESWRDMM  168



>ref|XP_009365203.1| PREDICTED: scarecrow-like transcription factor PAT1 [Pyrus x 
bretschneideri]
Length=553

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 105/169 (62%), Gaps = 21/169 (12%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVAN--PVHASRNLYC  480
            MQA++  R +GMSN L   PVQ+ + YCLP+FQ L+  L YN ++ +   P+ +    YC
Sbjct  1    MQASKEQRISGMSNRLYCQPVQEVEAYCLPRFQTLEPRLHYNESSQSTHLPLQSFHEHYC  60

Query  481  TLESSSVSESRALY-----------GSPMSQQGSRSYPSDN------NYGSPISGSCITD  609
            TLESS  + S  +Y           GSPMSQQ S SY SD        Y S ISGSCITD
Sbjct  61   TLESSWSNGSYNVYNTPSNVSFSPSGSPMSQQDSHSYLSDQYHSPDQTYSSSISGSCITD  120

Query  610  DMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIAS--PEIDSWRQMM  750
            D + F +KLK+LET MLGPDS++L+++  TFP+  ++  P+ DSW Q+M
Sbjct  121  DATDFKYKLKQLETVMLGPDSNILDNYCITFPNGASNSLPDEDSWGQIM  169



>ref|XP_003544277.1| PREDICTED: scarecrow-like transcription factor PAT1-like [Glycine 
max]
 gb|KHN46917.1| Scarecrow-like transcription factor PAT1 [Glycine soja]
Length=545

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 110/173 (64%), Gaps = 31/173 (18%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNN----TNVANPVHASRNL  474
            MQA+++ R + M     Y P+Q+ + YCLPQ++  + +L Y++    T+ + P  +S  L
Sbjct  1    MQASEQHRSSSM----YYQPLQQIEAYCLPQYRSRNQQLYYHDGGHGTHFSTP--SSSEL  54

Query  475  YCTLESSSVSESRALY-----------GSPMSQQGSRSYPSD------NNYGSPISGSCI  603
            YCTLESSSV+ S  LY           GSP+SQQ S+SYP D      N YGSP+SGSCI
Sbjct  55   YCTLESSSVAGSFTLYNSPSTVSFSPNGSPISQQDSQSYPPDQYHSPENTYGSPMSGSCI  114

Query  604  TDDMSS--FIHKLKELETAMLGPDSDVLESHDNTFPSSIASP--EIDSWRQMM  750
            TDD+SS  F HKL+ELE+ MLGPDSD L+S+++   +   S   E+DSWRQ M
Sbjct  115  TDDLSSLNFKHKLRELESVMLGPDSDNLDSYESAISNGNNSVPLEMDSWRQTM  167



>ref|XP_010252695.1| PREDICTED: scarecrow-like protein 21 [Nelumbo nucifera]
Length=586

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 107/171 (63%), Gaps = 23/171 (13%)
 Frame = +1

Query  304  SMQAAQRLRRTGMSNVLCYPPVQKADPYCLPQ-FQILDHELSYNNTNVAN-PVHASRNLY  477
            SMQ +Q+ R +  S+   Y PVQ+   YCLPQ FQ LDH+ S  ++  +N P+  S   Y
Sbjct  35   SMQTSQKYRHSVGSHSSYYQPVQEVGSYCLPQNFQNLDHQCSKASSQESNFPIQTSHEQY  94

Query  478  CTLESSSVSESRALY-----------GSPMSQQGSRSYPSDNNY--------GSPISGSC  600
            CTLESSS + S  +Y           GSP+SQQ S SYP+D ++        GSP+SGSC
Sbjct  95   CTLESSSATGSYTVYSSPSTLSFSPNGSPISQQDSHSYPADPHHSHSPDCTHGSPVSGSC  154

Query  601  ITDDMSSFIHKLKELETAMLGPDSDVLES-HDNTFPSSIASP-EIDSWRQM  747
            ITD+++   HKL++LETAMLGP+SD+++S H+N       +P EI+ WR++
Sbjct  155  ITDEVNDLRHKLRDLETAMLGPESDIVDSFHENLGGGDDQAPLEIEKWREI  205



>ref|XP_007049286.1| GRAS family transcription factor isoform 2 [Theobroma cacao]
 ref|XP_007049287.1| GRAS family transcription factor isoform 2 [Theobroma cacao]
 ref|XP_007049288.1| GRAS family transcription factor isoform 2 [Theobroma cacao]
 gb|EOX93443.1| GRAS family transcription factor isoform 2 [Theobroma cacao]
 gb|EOX93444.1| GRAS family transcription factor isoform 2 [Theobroma cacao]
 gb|EOX93445.1| GRAS family transcription factor isoform 2 [Theobroma cacao]
Length=526

 Score =   126 bits (316),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 96/156 (62%), Gaps = 27/156 (17%)
 Frame = +1

Query  340  MSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVAN--PVHASRNLYCTLESSSVSESR  513
            M++ L +   Q+ +PYCLPQF  +D  L Y++++  +   V  S  LYCTLESSS + S 
Sbjct  1    MASRLYHQVKQEVEPYCLPQFPTIDRSLCYSDSSQGSHFSVKNSSELYCTLESSSANGSY  60

Query  514  ALY-----------GSPMSQQGSRSYPSD------NNYGSPISGSCITDDMSSFIHKLKE  642
             +Y           GSPMSQQ S+SYPSD      N YGSPISGSCITDD+S   HKL+E
Sbjct  61   TVYNSSSTVSFSPNGSPMSQQESQSYPSDLHHSPDNTYGSPISGSCITDDVSDLRHKLRE  120

Query  643  LETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
            LET MLGPDSD+++        S  SP++ SW  +M
Sbjct  121  LETVMLGPDSDIID--------STTSPDMGSWNLVM  148



>ref|XP_004140012.1| PREDICTED: scarecrow-like transcription factor PAT1 [Cucumis 
sativus]
 ref|XP_011656879.1| PREDICTED: scarecrow-like transcription factor PAT1 [Cucumis 
sativus]
 ref|XP_011656880.1| PREDICTED: scarecrow-like transcription factor PAT1 [Cucumis 
sativus]
 gb|KGN46590.1| hypothetical protein Csa_6G110820 [Cucumis sativus]
Length=545

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 97/170 (57%), Gaps = 25/170 (15%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANP-----VHASRN  471
            MQA+Q  R + M+  LCY P+Q+ D Y   QFQ L  +L    +NV N      V    +
Sbjct  1    MQASQLHRGSHMAKRLCYQPLQEVDAYYFSQFQSLGRQLY---SNVGNQRGHFNVQDIGD  57

Query  472  LYCTLESSSVSESRALY-----------GSPMSQQGSRSYPSD------NNYGSPISGSC  600
             YCTLESSS S   A +           GSP+SQQ  RS PSD      N YGS +SGS 
Sbjct  58   RYCTLESSSGSHGYATHNSTSTVTFSPNGSPVSQQDYRSNPSDQHNSPDNTYGSSVSGSS  117

Query  601  ITDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
            ITDD+S F HKL ELET MLGPDSDV+ S D+ +     +PE+ +W Q+M
Sbjct  118  ITDDISDFRHKLLELETVMLGPDSDVIYSFDSIYQEGTDNPEMGTWGQVM  167



>ref|XP_003519666.1| PREDICTED: scarecrow-like transcription factor PAT1-like isoformX1 
[Glycine max]
 ref|XP_003519667.1| PREDICTED: scarecrow-like transcription factor PAT1-like isoformX2 
[Glycine max]
 ref|XP_006575742.1| PREDICTED: scarecrow-like transcription factor PAT1-like isoform 
X3 [Glycine max]
 ref|XP_006575743.1| PREDICTED: scarecrow-like transcription factor PAT1-like isoform 
X4 [Glycine max]
 ref|XP_006575744.1| PREDICTED: scarecrow-like transcription factor PAT1-like isoform 
X5 [Glycine max]
 gb|KHN43953.1| Scarecrow-like transcription factor PAT1 [Glycine soja]
Length=541

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 107/173 (62%), Gaps = 35/173 (20%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNN----TNVANPVHASRNL  474
            MQA+++ R + M     Y P+Q+ + YCLPQ++ L+ +L Y++    T  + P  +S  L
Sbjct  1    MQASEQHRNSSMY----YQPLQQIEAYCLPQYRTLNPQLYYHDGGHGTQFSTP--SSSEL  54

Query  475  YCTLESSSVSESRALY-----------GSPMSQQGSRSYPSD------NNYGSPISGSCI  603
            YCTLESSSV    ALY           GSP+SQQ S+SYP D      N YGSP+SGSCI
Sbjct  55   YCTLESSSV----ALYNSPSTVSFSPNGSPISQQDSQSYPPDQYHSPENTYGSPMSGSCI  110

Query  604  TDDMSSF--IHKLKELETAMLGPDSDVLESHDNTFPSS--IASPEIDSWRQMM  750
            TDD+SSF   HKL+ELE+ MLGPDSD L+S+D+   +       E+D W+Q M
Sbjct  111  TDDLSSFNLKHKLRELESVMLGPDSDNLDSYDSAISNGNNFVPLEMDGWKQTM  163



>ref|XP_010112792.1| hypothetical protein L484_020023 [Morus notabilis]
 gb|EXC34907.1| hypothetical protein L484_020023 [Morus notabilis]
Length=537

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 95/159 (60%), Gaps = 22/159 (14%)
 Frame = +1

Query  340  MSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVAN--PVHASRNLYCTLESSSVSESR  513
            MSN L Y P+Q+A+ YCLPQF+ LD EL YN+++      V  S   YCTLESS    + 
Sbjct  1    MSNELYYRPIQEAEAYCLPQFRSLDQELCYNDSSQGAYFSVKNSLQQYCTLESSLADGNY  60

Query  514  ALY-----------GSPMSQQGSRSY------PSDNNYGSPISGSCITDDMSSFIHKLKE  642
            A+Y           GSPMSQQ S SY        DN YGSPISGSCITD+M+   +KLKE
Sbjct  61   AIYNSPSTVSFSPNGSPMSQQDSHSYLPDQHHSPDNAYGSPISGSCITDEMTDLKYKLKE  120

Query  643  LETAMLGPDSDVLESHDNTFPSSIA---SPEIDSWRQMM  750
            +E+ MLGPD  +L ++D    S  +   S E +SW Q+M
Sbjct  121  IESVMLGPDLSLLNNYDGAILSGSSNNISHESESWGQIM  159



>emb|CDP18907.1| unnamed protein product [Coffea canephora]
Length=544

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 98/167 (59%), Gaps = 20/167 (12%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCY-PPVQKADPYCLPQFQILDHELSYNNTNVA--NPVHASRNLY  477
            MQA+QR R+ GM N      P+QK + Y LP  Q  + +LS NN+      P+  S + Y
Sbjct  1    MQASQRPRKVGMPNTFFLNQPLQKVESYFLPHIQTFEPQLSCNNSRYGPSCPIQISHDRY  60

Query  478  CTLESSSVSESRALY-----------GSPMSQQGSRSYPS-----DNNYGSPISGSCITD  609
            CTLESSS++ +  +Y           GSP+SQQ S          + NYGSP+SGSCIT+
Sbjct  61   CTLESSSLTGNHTIYNSPSTVSFSPIGSPVSQQESLHMTDPVQSPETNYGSPLSGSCITN  120

Query  610  DMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
            D++   HKL+ELE AMLGPDSD   + DN  P +  + E +SWRQM+
Sbjct  121  DVNDLRHKLRELENAMLGPDSDFFGACDNLLPINEGALE-NSWRQMI  166



>ref|XP_004491586.1| PREDICTED: scarecrow-like transcription factor PAT1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004491587.1| PREDICTED: scarecrow-like transcription factor PAT1-like isoform 
X2 [Cicer arietinum]
Length=549

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 106/175 (61%), Gaps = 31/175 (18%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTN---VANPVHASRNLY  477
            MQA+++ R + M     Y P+Q+ + YCLPQ++ L+H++ YN+           +S +LY
Sbjct  1    MQASEQHRSSSMY----YQPLQEIESYCLPQYRNLNHQMYYNDGGGHGTQFSTQSSSDLY  56

Query  478  CTLESSSVSESRALYGSP-----------MSQQGSR--SYPSD-------NNYGSPISGS  597
            CTLESSS + S A+Y SP           MSQQ S+  SYP D       N Y SP SGS
Sbjct  57   CTLESSSAAGSFAVYNSPSTVSFSPNDSPMSQQDSQTQSYPHDQYHSPDNNIYSSPRSGS  116

Query  598  CITDDMSSFIHKLKELETAMLGPDSD--VLESHDNTFPSS--IASPEIDSWRQMM  750
            CIT+D+SSF HKL+ELE  MLGPDSD  +++S+D+   +     S E+DSWRQ M
Sbjct  117  CITEDLSSFKHKLRELENVMLGPDSDYNLVDSYDSAMSNGNDFVSLEMDSWRQTM  171



>ref|XP_004293455.1| PREDICTED: scarecrow-like transcription factor PAT1 [Fragaria 
vesca subsp. vesca]
Length=551

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 103/168 (61%), Gaps = 21/168 (13%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTN--VANPVHASRNLYC  480
            MQA+++ R +GMS  L Y P Q+ + YCLP F+ILDH+ +YN ++    +   +    YC
Sbjct  1    MQASKQHRSSGMSKRLHYQPKQEVEAYCLPPFRILDHQPAYNESSQSTHSTAQSFHERYC  60

Query  481  TLESSSVSES-RALY-----------GSPMSQQGSRSYPS----DNNYGSPISGSCITDD  612
            TLESSS + S   LY           GSPMSQ    S+      D+ YGSPISGSCITDD
Sbjct  61   TLESSSTNGSYNTLYTSSSTVSFSPSGSPMSQHEQDSHYQHHSPDHMYGSPISGSCITDD  120

Query  613  MSSFIHKLKELETAMLGPDSDVLESHDNTFPSSI--ASPEIDSWRQMM  750
             + F +KLKELETAMLG DS++ +++ ++  +      PE+DSW Q+M
Sbjct  121  ATDFKYKLKELETAMLG-DSNIFDNYCSSLQNGARNTRPEVDSWGQIM  167



>ref|XP_008464182.1| PREDICTED: scarecrow-like transcription factor PAT1 [Cucumis 
melo]
 ref|XP_008464183.1| PREDICTED: scarecrow-like transcription factor PAT1 [Cucumis 
melo]
 ref|XP_008464184.1| PREDICTED: scarecrow-like transcription factor PAT1 [Cucumis 
melo]
 ref|XP_008464185.1| PREDICTED: scarecrow-like transcription factor PAT1 [Cucumis 
melo]
Length=545

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 96/171 (56%), Gaps = 27/171 (16%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNL----  474
            MQA+Q  R + M+  LCY P+Q+ D     QFQ L  +L    +NV N   A  N     
Sbjct  1    MQASQLHRGSHMAKRLCYQPLQEVDACYFSQFQSLGRQLY---SNVGNQ-RAHFNFQDIS  56

Query  475  --YCTLESSSVSESRALY-----------GSPMSQQGSRSYPSD------NNYGSPISGS  597
              YCTLESSS S   A +            SP+SQQ SRS PSD      N YGS +SGS
Sbjct  57   DQYCTLESSSGSHGYAAHNSTSTITFSPNASPVSQQDSRSNPSDQHNSPDNTYGSSVSGS  116

Query  598  CITDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
             ITDD+S F HKL ELET MLGPDSDV+ S D+ +     +PE+ +W Q+M
Sbjct  117  SITDDISDFRHKLLELETVMLGPDSDVIYSFDSIYQEGTDNPEMGTWGQVM  167



>gb|KDP29900.1| hypothetical protein JCGZ_18469 [Jatropha curcas]
Length=536

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 102/158 (65%), Gaps = 21/158 (13%)
 Frame = +1

Query  340  MSNVLCYPPVQKADPYCLPQFQILDHELSYNNT--NVANPVHASRNLYCTLESSSVSESR  513
            MS+ L Y P+ + + Y +PQF  LD +L Y  +   + + +  S    CT ESS  + S 
Sbjct  1    MSSRLYYQPMPEIEAYYMPQFPTLDKQLCYGGSSQGIHSSILNSCEHNCTQESSLANGSF  60

Query  514  ALY-----------GSPMSQQGSRSYPSD------NNYGSPISGSCITDDMSSFIHKLKE  642
            A+Y           GSP+SQQ S+SYPSD      +NYGSPISGSCITDD++ F +KL+E
Sbjct  61   AVYNSPSTLSFSPNGSPVSQQESQSYPSDPHHSPDHNYGSPISGSCITDDVNDFRNKLRE  120

Query  643  LETAMLGPDSDVLESHDNTFP--SSIASPEIDSWRQMM  750
            LET MLGPDSD+++S ++TF   +SI SPE++S RQ++
Sbjct  121  LETVMLGPDSDIIDSIESTFQNGTSIESPEMESLRQIV  158



>ref|XP_010270168.1| PREDICTED: scarecrow-like protein 21 [Nelumbo nucifera]
Length=583

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 99/170 (58%), Gaps = 21/170 (12%)
 Frame = +1

Query  304  SMQAAQRLRRTGMSNVLCYPPVQKADPYCLPQ-FQILDHELSYNNTNVAN-PVHASRNLY  477
            SMQA+Q+   +  S+   Y PVQ+ + YCL Q FQ LD + S ++   +N  V  S   Y
Sbjct  35   SMQASQKYGNSNGSHRSYYQPVQEVESYCLSQGFQNLDQQCSKDSNQESNFHVQTSHEEY  94

Query  478  CTLESSSVSESRALY-----------GSPMSQQGSRSYPSDNN------YGSPISGSCIT  606
            CTL+SSS + S  +Y           GSP+SQQ S SYPSD +      YGSPIS SCIT
Sbjct  95   CTLDSSSATGSYTVYSSPSSLSFSPNGSPISQQDSLSYPSDPHHSPDYAYGSPISSSCIT  154

Query  607  DDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSI--ASPEIDSWRQMM  750
            D+++   HKL+ELETAMLGPDS V++S   TF       S E D   Q++
Sbjct  155  DEVNDLRHKLRELETAMLGPDSYVVDSFHETFDGGADQTSLETDKLSQVL  204



>gb|AGE44291.1| GRAS54 protein [Dimocarpus longan]
 gb|AHC30883.1| PAT1 protein [Dimocarpus longan]
Length=552

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 102/174 (59%), Gaps = 26/174 (15%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANP-------VHAS  465
            MQA+     + MS+   Y P+Q+ + Y L QFQ  DH L YN+ +  +        V  +
Sbjct  1    MQASHLYTNSSMSSGSFYQPMQEVEAYYLSQFQNKDHHLRYNDNSYDDSSLVTDFSVPNT  60

Query  466  RNLYCTLESSSVSESRALY-----------GSPMSQQGSRSYPSD------NNYGSPISG  594
               YCTLESSSV+ S   Y           GSPMSQQ S+SYP D      N YGSP SG
Sbjct  61   YEPYCTLESSSVNRSYNTYKSPSTVNFSPTGSPMSQQESQSYPPDLHHSPDNAYGSPRSG  120

Query  595  SCITDDMSSFIHKLKELETAMLGPDSDVLESHDNTFP--SSIASPEIDSWRQMM  750
            SC+T+D+S   HKL+ELET MLGPDSD+++S D+TF   +   S E++ WRQ+M
Sbjct  121  SCVTNDVSDLRHKLRELETVMLGPDSDIIDSIDSTFQNGTDTCSSEMNIWRQIM  174



>ref|XP_010045926.1| PREDICTED: scarecrow-like transcription factor PAT1 [Eucalyptus 
grandis]
 ref|XP_010045932.1| PREDICTED: scarecrow-like transcription factor PAT1 [Eucalyptus 
grandis]
 ref|XP_010045939.1| PREDICTED: scarecrow-like transcription factor PAT1 [Eucalyptus 
grandis]
 ref|XP_010045945.1| PREDICTED: scarecrow-like transcription factor PAT1 [Eucalyptus 
grandis]
 gb|KCW88698.1| hypothetical protein EUGRSUZ_A01051 [Eucalyptus grandis]
Length=525

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 83/158 (53%), Gaps = 35/158 (22%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYCTL  486
            MQ +Q+     MSN +CY    +   YCLPQF  LD   SY                CTL
Sbjct  1    MQTSQKKSHLSMSNKICYQSALEIGTYCLPQFHTLDCYPSY----------------CTL  44

Query  487  ESSSVSESRALY-----------GSPMSQQGSRSYPSD------NNYGSPISGSCITDDM  615
            ESSS S   A+Y           GSP+S Q S SYP D      N Y S ISGSC+TDD 
Sbjct  45   ESSSASGGYAIYNPPSTISFSSDGSPVSLQDSVSYPPDALHSPDNTYASSISGSCVTDDA  104

Query  616  SSFIHKLKELETAMLGPDSDVLESHDNTFPSSI--ASP  723
            + F+HKL+ELE  MLGPDSD+  ++D +F   I  ASP
Sbjct  105  NDFLHKLRELENVMLGPDSDISINNDRSFQKGIHVASP  142



>gb|KJB10261.1| hypothetical protein B456_001G192800 [Gossypium raimondii]
Length=531

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 95/159 (60%), Gaps = 23/159 (14%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPV-QKADPYCLPQFQILDHELSYNNTNVAN--PVHASRNLY  477
            MQA+Q+ R + M++ L +P V ++ +P   PQF  +D    Y++++  +   V  S   Y
Sbjct  1    MQASQQHRSSVMASRL-FPQVKEEVEPCSFPQFPAIDRSFCYSDSSHGSHFSVKNSHEPY  59

Query  478  CTLESSSVSESRALY-----GSPMSQQGSRS------YPSDNNYGSPISGSCITDDMSSF  624
            CTLESSS   S  +Y     GSPMSQQ S+S      +  DN Y SPISGSCITDD+S  
Sbjct  60   CTLESSSARGSYTVYNSSSNGSPMSQQESQSNMSDLHHSPDNTYSSPISGSCITDDVSDL  119

Query  625  IHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWR  741
              KL+ELET MLGPD D++        +S  SPE+DSWR
Sbjct  120  KGKLRELETVMLGPDCDII--------NSTISPEMDSWR  150



>gb|KHG21504.1| Scarecrow-like transcription factor PAT1 [Gossypium arboreum]
Length=573

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 96/167 (57%), Gaps = 29/167 (17%)
 Frame = +1

Query  304  SMQAAQRLRRTGMSNVLCYPPVQKADP--YCLPQFQILDHELSYNNTN--VANPVHASRN  471
            SMQA+Q+ R + M++ L     Q+ +P  Y  PQ   +D  L Y++++      V +S  
Sbjct  34   SMQASQQHRSSVMASRLYRQIKQEVEPEPYWFPQLPPIDPSLCYSDSSHEFHFTVESSNE  93

Query  472  LYCTLESSSVSESRALY-----------GSPMSQQGSRSYPSD------NNYGSPISGSC  600
             +CTLESSS + S   Y           GSP SQQ S+SYPSD      NN GSPISGSC
Sbjct  94   NFCTLESSSANGSYNAYNSTSLVGFSPNGSPTSQQDSQSYPSDLHHSPDNNGGSPISGSC  153

Query  601  ITDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWR  741
            +TDD+S    KLKELET MLGPDSDV++S          SPE+ +WR
Sbjct  154  VTDDVSDLRDKLKELETVMLGPDSDVIDSK--------TSPEMGTWR  192



>gb|KHG24972.1| Scarecrow-like transcription factor PAT1 [Gossypium arboreum]
Length=531

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 95/162 (59%), Gaps = 23/162 (14%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPV-QKADPYCLPQFQILDHELSYNNTNVAN--PVHASRNLY  477
            MQA+Q+ R + M++ L +P V ++ +P   PQF  +D    Y +++  +   V  S   Y
Sbjct  1    MQASQQHRSSVMASRL-FPRVKEEVEPCSFPQFPAIDRSFCYTDSSHGSHFSVKNSHEPY  59

Query  478  CTLESSSVSESRALY-----GSPMSQQGSRS------YPSDNNYGSPISGSCITDDMSSF  624
            CTLESS    S  +Y     GSPMSQQ S+S      +  DN Y SPISGSCITDD+S  
Sbjct  60   CTLESSFACGSYRVYNSSSNGSPMSQQESQSNMSDLHHSPDNTYSSPISGSCITDDVSDL  119

Query  625  IHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
              KL+ELET MLGPD D++        +S  SPE+DSWR +M
Sbjct  120  KGKLRELETVMLGPDCDII--------NSTISPEMDSWRLVM  153



>gb|KJB42774.1| hypothetical protein B456_007G167000 [Gossypium raimondii]
 gb|KJB42775.1| hypothetical protein B456_007G167000 [Gossypium raimondii]
 gb|KJB42776.1| hypothetical protein B456_007G167000 [Gossypium raimondii]
Length=536

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 93/164 (57%), Gaps = 28/164 (17%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADP--YCLPQFQILDHELSYNNTNVANPVHASRNLYC  480
            MQA+Q+ R + M++ L +   Q+ +P  Y  PQ    D  L Y++      V +S   +C
Sbjct  1    MQASQQHRSSVMASRLYHQIKQEVEPEPYWFPQLPPTDPSLCYSD-GFHFSVESSNENFC  59

Query  481  TLESSSVSESRALY-----------GSPMSQQGSRSYPSD------NNYGSPISGSCITD  609
            TLESSS + S   Y           GSPMSQQ S+SYPSD      NN GSPISGSC+TD
Sbjct  60   TLESSSANGSYTAYNSTSLVGFSPNGSPMSQQDSQSYPSDLHHSPDNNGGSPISGSCVTD  119

Query  610  DMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWR  741
            D+S    KLKELET MLGPDSDV++S          S E+ +WR
Sbjct  120  DVSDLRDKLKELETVMLGPDSDVIDSK--------TSLEMGTWR  155



>gb|ADK92865.1| phytochrome A signal transduction 1 [Hypericum perforatum]
Length=538

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 92/160 (58%), Gaps = 23/160 (14%)
 Frame = +1

Query  340  MSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVAN--PVHASRNLYCTLESSSVSESR  513
            MS+ L   P Q+ D YC+P FQ ++H+  Y+  +      +  S   YCTL+SSS S + 
Sbjct  1    MSSRLYNQPKQEVDAYCVPPFQTVNHQQYYSGGSQGTYFSIPNSIKQYCTLDSSSASGNC  60

Query  514  ALY------------GSPMSQQGSRSYPS-------DNNYGSPISGSCITDDMSSFIHKL  636
              Y            GSP+SQQ S SYPS       D  YGSP+SGSCIT++++ F  KL
Sbjct  61   GAYSSTPSTITLSPSGSPISQQESLSYPSGGMKHSPDTTYGSPMSGSCITEEVNDFRIKL  120

Query  637  KELETAMLGPDSDVLESHDNTF--PSSIASPEIDSWRQMM  750
            +ELET MLG D D+++S +N     +++AS  +DS RQ M
Sbjct  121  RELETVMLGSDCDIVDSIENALLNGTNMASSHLDSLRQAM  160



>ref|XP_008800637.1| PREDICTED: LOW QUALITY PROTEIN: chitin-inducible gibberellin-responsive 
protein 2-like [Phoenix dactylifera]
Length=538

 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 97/165 (59%), Gaps = 21/165 (13%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYP----PVQKADPYCLPQ-FQILDHELSYNNTNVANPVHASRN  471
            MQA +R   +  S    YP    PV++A+ + LPQ  Q L++  S + +N  N    +  
Sbjct  1    MQAPKRYEHSNKSQKSYYPHNSMPVREAESHLLPQNHQSLNYVSSDDGSNQRNVHPHTSG  60

Query  472  LYCTLESSSVSESRALY------------GSPMSQQGSRSYPSDNNYGSPISGSCITDDM  615
             +CTLESSS +   A +            GSP+SQQ  +S   DN YGSP+S SCIT+D 
Sbjct  61   QFCTLESSSAAAGYATHNSPSSLAFSPNSGSPLSQQECQS---DNTYGSPLSVSCITEDP  117

Query  616  SSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
            +    KL+ELETAMLGPDSD++ES ++T+PS   S + + WRQ+M
Sbjct  118  NDLKLKLRELETAMLGPDSDIVESFESTYPSH-TSLDPEXWRQVM  161



>ref|XP_002274103.1| PREDICTED: scarecrow-like protein 21 [Vitis vinifera]
 ref|XP_010644523.1| PREDICTED: scarecrow-like protein 21 [Vitis vinifera]
Length=545

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 97/171 (57%), Gaps = 27/171 (16%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYC--  480
            MQA+Q+   +G S      PV + D  C  Q+ IL+ E    + + +  +H S   YC  
Sbjct  1    MQASQKHGISGRSGSFYSQPVPQ-DESC--QWPILNIEHHSCSDDGSQGMHFSGPTYCEQ  57

Query  481  --TLESSSVSESRALY-----------GSPMSQQGSRSYPSD------NNYGSPISGSCI  603
              T ESSS + S  +Y           GSP SQQ S++YPSD      N +GSPISGSC+
Sbjct  58   YGTHESSSATGSFPIYNSPSTVSFSPEGSPASQQDSQTYPSDQLHSPENGHGSPISGSCL  117

Query  604  TDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSI--ASPEIDSWRQMM  750
            TDD++   HKL+ELETAMLGPDSD+L+ H+   P  +   S E + W+QMM
Sbjct  118  TDDVNELRHKLRELETAMLGPDSDILDVHE-VIPRELNKISLEREKWKQMM  167



>emb|CBI26738.3| unnamed protein product [Vitis vinifera]
Length=526

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 88/167 (53%), Gaps = 38/167 (23%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYCTL  486
            MQA+Q+   +G S      PV + D                   + + P +  +  Y T 
Sbjct  1    MQASQKHGISGRSGSFYSQPVPQDD----------------QGMHFSGPTYCEQ--YGTH  42

Query  487  ESSSVSESRALY-----------GSPMSQQGSRSYPSD------NNYGSPISGSCITDDM  615
            ESSS + S  +Y           GSP SQQ S++YPSD      N +GSPISGSC+TDD+
Sbjct  43   ESSSATGSFPIYNSPSTVSFSPEGSPASQQDSQTYPSDQLHSPENGHGSPISGSCLTDDV  102

Query  616  SSFIHKLKELETAMLGPDSDVLESHDNTFPSSI--ASPEIDSWRQMM  750
            +   HKL+ELETAMLGPDSD+L+ H+   P  +   S E + W+QMM
Sbjct  103  NELRHKLRELETAMLGPDSDILDVHE-VIPRELNKISLEREKWKQMM  148



>ref|XP_010905298.1| PREDICTED: scarecrow-like protein 21 [Elaeis guineensis]
 ref|XP_010905299.1| PREDICTED: scarecrow-like protein 21 [Elaeis guineensis]
Length=538

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 96/165 (58%), Gaps = 21/165 (13%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYP----PVQKADPYCLPQ-FQILDHELSYNNTNVANPVHASRN  471
            MQA++R + +  S    +P    PV++A+ + L Q  Q L++  S + ++  N    +  
Sbjct  1    MQASERDKHSNKSQKPYHPHNSMPVREAESHFLSQNHQSLNYVSSDDGSSQRNVHPHTSG  60

Query  472  LYCTLESSSVSESRALY------------GSPMSQQGSRSYPSDNNYGSPISGSCITDDM  615
             +CTLESS  +   A +            GSP+SQQ  +S   DN YGSPIS SCIT+D 
Sbjct  61   QFCTLESSLATPGYATHNSPSSLAFSPNSGSPLSQQECQS---DNTYGSPISVSCITEDP  117

Query  616  SSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
            +    KL+ELETAMLGPD D++ES + T+PS+  S + + WRQ+M
Sbjct  118  NDLKLKLRELETAMLGPDPDIVESFETTYPSN-TSMDPEKWRQVM  161



>ref|XP_010666093.1| PREDICTED: scarecrow-like protein 21 [Beta vulgaris subsp. vulgaris]
Length=521

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 86/149 (58%), Gaps = 20/149 (13%)
 Frame = +1

Query  340  MSNVLCYPPVQKADPYCLPQFQILDHELSYNN-TNVANPVHASRNL---YCTLESSSVSE  507
            MSN L Y P ++ D Y +PQ Q L+ +L Y+N +N + P   S+N    Y TLESS+   
Sbjct  1    MSNSLYYQPKREIDLYLMPQCQPLNPQLCYSNLSNESYPT--SKNFPGQYSTLESST---  55

Query  508  SRALYGSPMSQQGSRSYPSD------NNYGSPISGSCITDDMSSFIHKLKELETAMLGPD  669
                 GSP S   S S+P D      N   SP+S SC+TDD      KL+ELE+AMLGPD
Sbjct  56   ---FIGSPGSLLDSSSFPPDQHCSPDNANNSPLSNSCVTDDCGDLKCKLRELESAMLGPD  112

Query  670  SDVLESHDNTFP--SSIASPEIDSWRQMM  750
            +DV++ + N     S ++  E+DSW +++
Sbjct  113  TDVIDGYCNMLETGSDVSPLEMDSWGKVI  141



>ref|XP_007026309.1| SCL domain class transcription factor [Theobroma cacao]
 gb|EOY28931.1| SCL domain class transcription factor [Theobroma cacao]
Length=548

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 84/154 (55%), Gaps = 19/154 (12%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPV--HASRNLYC  480
            MQ +Q+ + +     L + PVQ+ +  CLP  QILD+ +  +  +    V     ++ + 
Sbjct  1    MQTSQKHQTSACIRRLYHQPVQEMEALCLPHIQILDNNVCSDVGSQGTSVSFQTYKDQFF  60

Query  481  TLESSSVSESRALYGSPMSQ-----------QGSRSYPSD------NNYGSPISGSCITD  609
            TLESS+ +    +Y SP +            QGS+SY SD      N YGSP SGS + D
Sbjct  61   TLESSTATAGFVVYDSPSAVSISSSRSPFSPQGSQSYLSDPHHSPDNTYGSPFSGSSVVD  120

Query  610  DMSSFIHKLKELETAMLGPDSDVLESHDNTFPSS  711
            D + + HKL+ELE ++LGP+SDV++S +  F S 
Sbjct  121  DGNEWKHKLRELEISLLGPESDVIDSCNCCFSSG  154



>ref|XP_002308802.1| hypothetical protein POPTR_0006s01720g [Populus trichocarpa]
 gb|EEE92325.1| hypothetical protein POPTR_0006s01720g [Populus trichocarpa]
Length=546

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 82/169 (49%), Gaps = 22/169 (13%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNL--YC  480
            MQ +Q+ R  G+     + PVQ+ DPY L   QILD  L  +  +    V     L  + 
Sbjct  1    MQTSQKHRSAGIHG-FYHQPVQEIDPYGLSHIQILDKTLYSDAGSQGTSVSFETCLGQFF  59

Query  481  TLESSSVSESRALYGSP----------MSQQGSRSYPSD------NNYGSPISGSCITDD  612
            TLESSS +    +Y SP           S QGS S  SD      N YGSP+SGS   DD
Sbjct  60   TLESSSATAGFVVYDSPAASISSNRSPFSSQGSHSCISDPRHSPENMYGSPLSGSSSADD  119

Query  613  MSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDS---WRQMM  750
             +    KL+ELE ++LGP+SD+ +S    F S     E  +   W QMM
Sbjct  120  GNILRQKLRELEISLLGPESDITDSGSFCFVSGGYQAEPYASWDWNQMM  168



>ref|XP_010907680.1| PREDICTED: chitin-inducible gibberellin-responsive protein 2 
[Elaeis guineensis]
Length=539

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 79/134 (59%), Gaps = 20/134 (15%)
 Frame = +1

Query  394  PQ-FQILDHELSYNNT-NVANPVHASRNLYCTLESSSVSESRAL------------YGSP  531
            PQ +Q  D   S N + + + P+ AS   YCT +S+  +   AL            +GSP
Sbjct  34   PQNYQSFDQLFSDNGSLSQSCPLQASHVQYCTRDSALTTACYALRDSPSTLSFSPSFGSP  93

Query  532  MSQQGSRSYPSDNNYGSPISGSCITDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSS  711
            +SQQ    Y SDN  GSP++ SC+T+D +   HKL+ELE AMLGPD D ++S +++F S 
Sbjct  94   VSQQ---DYHSDNINGSPLNVSCLTEDPADLKHKLRELEVAMLGPDFDTIDSSESSFRSY  150

Query  712  IAS-PEIDSWRQMM  750
            + S PE+  W+QMM
Sbjct  151  LMSKPEM--WKQMM  162



>ref|XP_010547219.1| PREDICTED: scarecrow-like transcription factor PAT1 isoform X1 
[Tarenaya hassleriana]
 ref|XP_010547220.1| PREDICTED: scarecrow-like transcription factor PAT1 isoform X1 
[Tarenaya hassleriana]
Length=512

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 74/119 (62%), Gaps = 8/119 (7%)
 Frame = +1

Query  400  FQILDHELSYNNTNVAN--PVHASRNLYCTLESSSVSESR---ALYGSPMSQQGSRSYPS  564
            FQ  D++ ++++T      PV      YCTLESS+ S +    ++Y  P S +  ++   
Sbjct  15   FQTFDNQFNFSSTAKLRHLPVQNPHKRYCTLESSTSSLAGINPSVY-DPFSSKSLQNNSP  73

Query  565  DNNYGSPISGSCITDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWR  741
            D+   S +SGSC+TDD++   HKLKELETAMLGPDS+V +  D+T  S+ A  +IDSWR
Sbjct  74   DHG-SSSLSGSCVTDDVNDLRHKLKELETAMLGPDSEVFDCLDST-ESTTACQDIDSWR  130



>ref|XP_010547221.1| PREDICTED: scarecrow-like transcription factor PAT1 isoform X2 
[Tarenaya hassleriana]
 ref|XP_010547222.1| PREDICTED: scarecrow-like transcription factor PAT1 isoform X2 
[Tarenaya hassleriana]
Length=504

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 74/119 (62%), Gaps = 8/119 (7%)
 Frame = +1

Query  400  FQILDHELSYNNTNVAN--PVHASRNLYCTLESSSVSESR---ALYGSPMSQQGSRSYPS  564
            FQ  D++ ++++T      PV      YCTLESS+ S +    ++Y  P S +  ++   
Sbjct  7    FQTFDNQFNFSSTAKLRHLPVQNPHKRYCTLESSTSSLAGINPSVY-DPFSSKSLQNNSP  65

Query  565  DNNYGSPISGSCITDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWR  741
            D+   S +SGSC+TDD++   HKLKELETAMLGPDS+V +  D+T  S+ A  +IDSWR
Sbjct  66   DHG-SSSLSGSCVTDDVNDLRHKLKELETAMLGPDSEVFDCLDST-ESTTACQDIDSWR  122



>ref|XP_009395599.1| PREDICTED: scarecrow-like protein 21 [Musa acuminata subsp. malaccensis]
Length=539

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 66/104 (63%), Gaps = 16/104 (15%)
 Frame = +1

Query  475  YCTLESSSVSESRALYGS------------PMSQQGSRSYPSDNNYGSPISGSCITDDMS  618
            +CTLESS  + +  ++ S            P+SQQ S+    D  YGS +S SC+T+D +
Sbjct  63   FCTLESSLATANYNMHNSPSSQSFSSTSGSPISQQDSQY---DIVYGSSVSASCVTEDPN  119

Query  619  SFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
                +L+E+ETAMLGPDSD++ES +NT+P  + S E D+WRQ+M
Sbjct  120  DLKIRLREIETAMLGPDSDIVESFENTYPGHL-SLEPDAWRQVM  162



>emb|CAN78295.1| hypothetical protein VITISV_004660 [Vitis vinifera]
Length=444

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 47/63 (75%), Gaps = 3/63 (5%)
 Frame = +1

Query  568  NNYGSPISGSCITDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSI--ASPEIDSWR  741
            N +GSPISGSC+TDD++   HKL+ELETAMLGPDSD+L+ H+   P  +   S E + W+
Sbjct  5    NGHGSPISGSCLTDDVNELRHKLRELETAMLGPDSDILDVHE-VIPRELNKISLEREKWK  63

Query  742  QMM  750
            QMM
Sbjct  64   QMM  66



>ref|XP_010557767.1| PREDICTED: scarecrow-like transcription factor PAT1 [Tarenaya 
hassleriana]
 ref|XP_010557768.1| PREDICTED: scarecrow-like transcription factor PAT1 [Tarenaya 
hassleriana]
 ref|XP_010557769.1| PREDICTED: scarecrow-like transcription factor PAT1 [Tarenaya 
hassleriana]
 ref|XP_010557770.1| PREDICTED: scarecrow-like transcription factor PAT1 [Tarenaya 
hassleriana]
 ref|XP_010557771.1| PREDICTED: scarecrow-like transcription factor PAT1 [Tarenaya 
hassleriana]
Length=509

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 10/118 (8%)
 Frame = +1

Query  400  FQILDHELSYNNTNVAN--PVHASRNLYCTLESSSVSESRALYGSPMSQQGSRSYPSDNN  573
            FQ LD++ +YN++      PV   R  YCTLESS+ +    L G+   Q  S     D++
Sbjct  16   FQPLDNQFNYNSSAKLRYLPVQNPRKRYCTLESSACN----LAGTDSPQNNSPDDDDDDD  71

Query  574  YG--SPISGSCITDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWR  741
             G  S +SGSC+T+D++   HKLKELETAMLGPD D ++  D+T   S    EI SWR
Sbjct  72   DGKSSSLSGSCVTNDVNDLRHKLKELETAMLGPDPDFIDCLDST--DSTPCQEIYSWR  127



>gb|EYU42749.1| hypothetical protein MIMGU_mgv1a005166mg [Erythranthe guttata]
Length=494

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 77/148 (52%), Gaps = 23/148 (16%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYCTL  486
            MQA+    R+ M N LC  PV K + Y  PQ          +N N  N  H  ++ +CTL
Sbjct  1    MQASGHHSRSRMPNTLCCQPVLKFESYS-PQ--------QCHNLNPQNSSHNFQDRFCTL  51

Query  487  ESSSVSESRALYGSPMSQQGSRSYPSDNNYGSPISGSCITDDMSSFIHKLKELETAMLGP  666
            ESS + E+   Y SP     S ++  +N      S     +D +   HKL+ELE  M GP
Sbjct  52   ESSLLIET--CYNSP----SSVTFSPNNE-----SSLSHQEDANELKHKLRELENVMFGP  100

Query  667  DSDVLESHDNTFPSSIASPEIDSWRQMM  750
            D D LE+++NT    +AS EIDSWRQ++
Sbjct  101  DLDFLENYENTL---LASAEIDSWRQIV  125



>ref|XP_007020615.1| Scarecrow-like transcription factor PAT1 isoform 3, partial [Theobroma 
cacao]
 ref|XP_007020617.1| Scarecrow-like transcription factor PAT1 isoform 3, partial [Theobroma 
cacao]
 ref|XP_007020618.1| Scarecrow-like transcription factor PAT1 isoform 3, partial [Theobroma 
cacao]
 gb|EOY12140.1| Scarecrow-like transcription factor PAT1 isoform 3, partial [Theobroma 
cacao]
 gb|EOY12142.1| Scarecrow-like transcription factor PAT1 isoform 3, partial [Theobroma 
cacao]
 gb|EOY12143.1| Scarecrow-like transcription factor PAT1 isoform 3, partial [Theobroma 
cacao]
Length=361

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 82/145 (57%), Gaps = 16/145 (11%)
 Frame = +1

Query  364  PVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNL--YCTLESSSVSESRALY-----  522
            PVQ+ + +C P  + LDH  S ++       ++ +NL  YCTLESSS  ++ +       
Sbjct  17   PVQELESHCWPPNRSLDHYQSCSDDGGNGLQYSVQNLEQYCTLESSSSMQNSSSTASFSP  76

Query  523  -GSPMSQQGSRSYPSD------NNYGSPISGSCITDDMSSFIHKLKELETAMLGPDSDVL  681
             GSP+SQ  S+SY SD      N   SP+SGSC+TD+     H +++LETAMLG DSD  
Sbjct  77   SGSPVSQPNSQSYLSDVHHSPDNTCSSPVSGSCVTDNEHDLRHMIRQLETAMLGTDSDNF  136

Query  682  ESH--DNTFPSSIASPEIDSWRQMM  750
            + H  + +  ++  S E + W+ MM
Sbjct  137  DIHAINASGGATQISIEEERWKYMM  161



>ref|XP_006449893.1| hypothetical protein CICLE_v10014811mg [Citrus clementina]
 ref|XP_006449894.1| hypothetical protein CICLE_v10014811mg [Citrus clementina]
 gb|ESR63133.1| hypothetical protein CICLE_v10014811mg [Citrus clementina]
 gb|ESR63134.1| hypothetical protein CICLE_v10014811mg [Citrus clementina]
Length=547

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 91/175 (52%), Gaps = 33/175 (19%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDH----ELSYNNTNVANPVHASRNL  474
            MQ +Q+ +       + + PVQ  +P CL   QILD+    ++S   TN++   +  +  
Sbjct  1    MQTSQKHQSAASVQRMYHQPVQGIEPCCLSHVQILDNNICSDVSSQGTNMSFQTY--KEQ  58

Query  475  YCTLESS--------------SVSESRALYGSPMSQQGSRSYPSD------NNYGSPISG  594
            + TL+SS              S+S +R+ +    S QGS+SY SD      N YGSP+SG
Sbjct  59   FYTLDSSTATTGFSHDSPSAVSISSNRSTF----SPQGSQSYQSDPHHSPDNAYGSPMSG  114

Query  595  SCITDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSI---ASPEIDSWRQMM  750
            S I D+ +   +KL+ELE ++LGP+SD+++S    F S      S    +W Q+M
Sbjct  115  SSIVDESNELRNKLRELEISLLGPESDIIDSCSCCFKSGTHQDTSAASWNWDQLM  169



>ref|XP_006467309.1| PREDICTED: scarecrow-like protein 13-like [Citrus sinensis]
 ref|XP_006475190.1| PREDICTED: scarecrow-like protein 13-like [Citrus sinensis]
 gb|KDO78491.1| hypothetical protein CISIN_1g008984mg [Citrus sinensis]
 gb|KDO78492.1| hypothetical protein CISIN_1g008984mg [Citrus sinensis]
Length=547

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 91/175 (52%), Gaps = 33/175 (19%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDH----ELSYNNTNVANPVHASRNL  474
            MQ +Q+ +       + + PVQ  +P CL   QILD+    ++S   TN++   +  +  
Sbjct  1    MQTSQKHQSAASVQRMYHQPVQGIEPCCLSHVQILDNNICSDVSSQGTNMSFQTY--KEQ  58

Query  475  YCTLESS--------------SVSESRALYGSPMSQQGSRSYPSD------NNYGSPISG  594
            + TL+SS              S+S +R+ +    S QGS+SY SD      N YGSP+SG
Sbjct  59   FYTLDSSTATTGFSHDSPSAVSISSNRSTF----SPQGSQSYQSDPHHSPDNAYGSPMSG  114

Query  595  SCITDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSI---ASPEIDSWRQMM  750
            S I D+ +   +KL+ELE ++LGP+SD+++S    F S      S    +W Q+M
Sbjct  115  SSIVDEGNELRNKLRELEISLLGPESDIIDSCSCCFKSGTHQDTSAASWNWDQLM  169



>ref|XP_007020613.1| Scarecrow-like transcription factor PAT1 isoform 1 [Theobroma 
cacao]
 ref|XP_007020614.1| Scarecrow-like transcription factor PAT1 isoform 1 [Theobroma 
cacao]
 ref|XP_007020616.1| Scarecrow-like transcription factor PAT1 isoform 1 [Theobroma 
cacao]
 gb|EOY12138.1| Scarecrow-like transcription factor PAT1 isoform 1 [Theobroma 
cacao]
 gb|EOY12139.1| Scarecrow-like transcription factor PAT1 isoform 1 [Theobroma 
cacao]
 gb|EOY12141.1| Scarecrow-like transcription factor PAT1 isoform 1 [Theobroma 
cacao]
Length=540

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 82/145 (57%), Gaps = 16/145 (11%)
 Frame = +1

Query  364  PVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNL--YCTLESSSVSESRALY-----  522
            PVQ+ + +C P  + LDH  S ++       ++ +NL  YCTLESSS  ++ +       
Sbjct  17   PVQELESHCWPPNRSLDHYQSCSDDGGNGLQYSVQNLEQYCTLESSSSMQNSSSTASFSP  76

Query  523  -GSPMSQQGSRSYPSD------NNYGSPISGSCITDDMSSFIHKLKELETAMLGPDSDVL  681
             GSP+SQ  S+SY SD      N   SP+SGSC+TD+     H +++LETAMLG DSD  
Sbjct  77   SGSPVSQPNSQSYLSDVHHSPDNTCSSPVSGSCVTDNEHDLRHMIRQLETAMLGTDSDNF  136

Query  682  ESH--DNTFPSSIASPEIDSWRQMM  750
            + H  + +  ++  S E + W+ MM
Sbjct  137  DIHAINASGGATQISIEEERWKYMM  161



>ref|XP_011004506.1| PREDICTED: scarecrow-like protein 13 [Populus euphratica]
 ref|XP_011004507.1| PREDICTED: scarecrow-like protein 13 [Populus euphratica]
Length=546

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 80/169 (47%), Gaps = 22/169 (13%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNL--YC  480
            MQ +Q+ R  G+     + PV + D Y L   QILD  +  +  +    V     L  + 
Sbjct  1    MQTSQKHRSAGIHG-FYHQPVLEIDTYGLSHIQILDKNMYSDAGSQGTSVSFETCLGQFF  59

Query  481  TLESSSVSESRALYGSP----------MSQQGSRSYPSD------NNYGSPISGSCITDD  612
            TLESSS +    +Y SP           S QGS S  SD      N YGSP+SGS   DD
Sbjct  60   TLESSSATAGFVVYDSPAASISSNRSPFSSQGSLSCISDPRHSPENLYGSPLSGSSSADD  119

Query  613  MSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDS---WRQMM  750
             +    KL+ELE ++LGP+SD+ +S    F S     E  S   W QMM
Sbjct  120  SNILRQKLRELEISLLGPESDITDSGSFCFVSGGYQAEPYSSWDWNQMM  168



>gb|KJB68542.1| hypothetical protein B456_010G249400 [Gossypium raimondii]
Length=548

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 81/153 (53%), Gaps = 19/153 (12%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPV--HASRNLYC  480
            MQ +Q+ +     + L + PV+  D +CLP  QIL++    +  +    V   A  +   
Sbjct  1    MQTSQKHQTRVNIHRLYHQPVKDVDQFCLPHIQILENNACSDIGSQGPSVSYQAYNDQIF  60

Query  481  TLESSSVSESRALYGSPMSQ-----------QGSRSYPSD------NNYGSPISGSCITD  609
            TLESS+ + S   Y SP +            QGS+S+ SD      N +GSP SGS + D
Sbjct  61   TLESSTAAASIVAYDSPSAISVSSSRSPFSPQGSQSWMSDPHHSPDNTHGSPFSGSSVVD  120

Query  610  DMSSFIHKLKELETAMLGPDSDVLESHDNTFPS  708
            D +   HKL+ELE ++LGP+SD+++S +  F S
Sbjct  121  DSNGLKHKLRELEVSLLGPESDIIDSCNCCFTS  153



>ref|XP_002322514.1| hypothetical protein POPTR_0016s01110g [Populus trichocarpa]
 gb|EEF04275.1| hypothetical protein POPTR_0016s01110g [Populus trichocarpa]
Length=546

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 79/169 (47%), Gaps = 22/169 (13%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNN--TNVANPVHASRNLYC  480
            MQ +Q+ R  G+     + PVQ+ DPY L   QILD  +  +      A      +  + 
Sbjct  1    MQTSQKHRSAGIHR-FYHQPVQEIDPYGLSHIQILDSNMYSDGGSQGAAISFQTDQGEFF  59

Query  481  TLESSSVSESRALYGSP----------MSQQGSRSYPSDNN------YGSPISGSCITDD  612
            TLESSS +     Y SP           S QGS S  SD +      YGSP+SGS   D+
Sbjct  60   TLESSSATAGFVNYDSPAASVSSNRSPFSPQGSHSCISDPHHSPDTVYGSPLSGSSSADE  119

Query  613  MSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDS---WRQMM  750
                  KL+ELE ++LGP+SD+ +S    F S     E  +   W QMM
Sbjct  120  DIILRQKLRELEISLLGPESDITDSGSFCFVSGGYQAESSASWDWNQMM  168



>ref|XP_009387556.1| PREDICTED: scarecrow-like transcription factor PAT1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009387557.1| PREDICTED: scarecrow-like transcription factor PAT1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009387558.1| PREDICTED: scarecrow-like transcription factor PAT1 [Musa acuminata 
subsp. malaccensis]
Length=536

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 47/63 (75%), Gaps = 1/63 (2%)
 Frame = +1

Query  562  SDNNYGSPISGSCITDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWR  741
            SDNNY SPIS SCIT+D +   HKL+E+E AMLGPDSD ++S +N + S I S E + W+
Sbjct  98   SDNNYDSPISYSCITEDSNDLKHKLREIEAAMLGPDSDSIDSFENAYSSYI-SLEQEKWQ  156

Query  742  QMM  750
            Q+M
Sbjct  157  QVM  159



>ref|XP_011040189.1| PREDICTED: scarecrow-like protein 13 [Populus euphratica]
Length=545

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 79/168 (47%), Gaps = 21/168 (13%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNT-NVANPVHASRNLYCT  483
            MQ +Q+ R  G+     + PVQ+ DPY L   QIL++  S   +   A      +  + T
Sbjct  1    MQTSQKHRSAGIHR-FYHQPVQEIDPYGLSHIQILNNMYSDGGSQGAAISFQTDQGEFFT  59

Query  484  LESSSVSESRALYGSP----------MSQQGSRS------YPSDNNYGSPISGSCITDDM  615
            LESSS +     Y SP           S QGS S      +  D  YGSP+SGS   D+ 
Sbjct  60   LESSSATAGSINYDSPAASVSSNRSPFSPQGSHSCISDPHHSPDTAYGSPLSGSSSADED  119

Query  616  SSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDS---WRQMM  750
                 KL+ELE ++LGP+SD+ +S    F S     E  +   W QMM
Sbjct  120  HILRQKLRELEISLLGPESDITDSGSFCFVSGGYQAESSASWDWNQMM  167



>ref|XP_008780980.1| PREDICTED: scarecrow-like protein 21 [Phoenix dactylifera]
Length=553

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 77/134 (57%), Gaps = 20/134 (15%)
 Frame = +1

Query  394  PQ-FQILDHELSYNNT-NVANPVHASRNLYCTLESSSVSESRAL------------YGSP  531
            PQ +Q  DH  S N + + + P+ A    YCTLESS  +   AL            +GSP
Sbjct  48   PQNYQSFDHLCSDNRSLSQSCPLQAPHMQYCTLESSLPTACCALRDSPSSLSFSPSFGSP  107

Query  532  MSQQGSRSYPSDNNYGSPISGSCITDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSS  711
            +SQQ    Y SDN  GSP++ SC T+D +   HKL+ELE AMLGPD D + S + +F S 
Sbjct  108  VSQQ---DYQSDNINGSPLNVSCSTEDPTDLKHKLRELEAAMLGPDLDTIGSSECSFRSY  164

Query  712  IAS-PEIDSWRQMM  750
            + + PE+  W+QMM
Sbjct  165  LMTKPEM--WKQMM  176



>ref|XP_006836764.1| PREDICTED: scarecrow-like protein 21 [Amborella trichopoda]
 gb|ERM99617.1| hypothetical protein AMTR_s00088p00161000 [Amborella trichopoda]
Length=558

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 66/109 (61%), Gaps = 18/109 (17%)
 Frame = +1

Query  475  YCTLESSSVSESRALYGSP-----------MSQQGSRSYP------SDNNYGSPISGSCI  603
            Y TLESS  +   +LY SP           +SQQ S++YP       ++ YGSP SGSCI
Sbjct  74   YATLESSPQNLGHSLYSSPSTLSFSPNESPLSQQDSQTYPLELPHSPEHFYGSPRSGSCI  133

Query  604  TDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
            T++ + F +KL+ELETAMLGP+SD  +S + +  + + S E D W QM+
Sbjct  134  TEEPNDFKNKLRELETAMLGPNSDGGDSFEASVQNQV-SLEPDKWPQMV  181



>ref|XP_010052945.1| PREDICTED: scarecrow-like protein 13 [Eucalyptus grandis]
 gb|KCW77094.1| hypothetical protein EUGRSUZ_D01435 [Eucalyptus grandis]
 gb|KCW77095.1| hypothetical protein EUGRSUZ_D01435 [Eucalyptus grandis]
Length=548

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 77/163 (47%), Gaps = 30/163 (18%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELS----YNNTNVANPVHASRNL  474
            MQ +   + +   + L + PVQ  DPYC   FQI+++ +S       TN +  +      
Sbjct  1    MQTSHNRQNSAGIHGLYHQPVQDIDPYCSSNFQIMENNVSPDIGSQGTNFS--IQGYDGQ  58

Query  475  YCTLESSSVSESRALYGSP-----------MSQQGSRSYPSDNN------YGSPISGSCI  603
            Y TL+S+    S   Y SP            S QGS SY SD        YGSPISGS +
Sbjct  59   YFTLDSAPAVSSFGSYDSPSAVSVASNRSPFSTQGSHSYVSDAQHSSDYLYGSPISGSSV  118

Query  604  TDDMSSFIHKLKELETAMLGPDSDV-------LESHDNTFPSS  711
             +       KL+ELE ++LGP+SD+       L S  + FPS+
Sbjct  119  ANGGPQMWDKLRELENSLLGPESDISDSCNCCLNSGSHQFPST  161



>gb|AGW99232.1| scarecrow-like protein 13-like protein [Cucumis melo]
Length=541

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 72/130 (55%), Gaps = 27/130 (21%)
 Frame = +1

Query  367  VQKADPYCLPQFQILDHELSYNNTNVANPVHAS--RNLYCTLES---------------S  495
            + + DPY L +F +L + +S + ++  N V+ S  ++ + TLES                
Sbjct  13   IHEMDPYYLSRFHVLGNHVSSDASSQGNSVNFSSYKDQFFTLESFPATADLSGSNSPSAG  72

Query  496  SVSESRALYGSPMSQQGSRSYPSD------NNYGSPISGSCITDDMSSFIHKLKELETAM  657
            SV  SR    SP S QGS+S  SD      N  GSP+SG  +TDD +   HKLKELE ++
Sbjct  73   SVLSSR----SPFSPQGSQSCSSDQHHSFENTCGSPLSGCSVTDDDNDIKHKLKELEISL  128

Query  658  LGPDSDVLES  687
            LGP+SD+++S
Sbjct  129  LGPESDMVDS  138



>ref|XP_008440083.1| PREDICTED: scarecrow-like protein 13 [Cucumis melo]
Length=541

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 72/130 (55%), Gaps = 27/130 (21%)
 Frame = +1

Query  367  VQKADPYCLPQFQILDHELSYNNTNVANPVHAS--RNLYCTLES---------------S  495
            + + DPY L +F +L + +S + ++  N V+ S  ++ + TLES                
Sbjct  13   IHEMDPYYLSRFHVLGNHVSSDASSQGNSVNFSSYKDQFFTLESFPATADLSGSNSPSAG  72

Query  496  SVSESRALYGSPMSQQGSRSYPSD------NNYGSPISGSCITDDMSSFIHKLKELETAM  657
            SV  SR    SP S QGS+S  SD      N  GSP+SG  +TDD +   HKLKELE ++
Sbjct  73   SVLSSR----SPFSPQGSQSCSSDQHHSFENTCGSPLSGCSVTDDDNDIKHKLKELEISL  128

Query  658  LGPDSDVLES  687
            LGP+SD+++S
Sbjct  129  LGPESDMVDS  138



>ref|XP_004293381.1| PREDICTED: scarecrow-like protein 13 [Fragaria vesca subsp. vesca]
 ref|XP_011460052.1| PREDICTED: scarecrow-like protein 13 [Fragaria vesca subsp. vesca]
Length=547

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 82/149 (55%), Gaps = 22/149 (15%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPV--HASRNLYC  480
            MQ +Q+ R T + ++L + P++K DPY  P FQIL++ +  +  +    V     +  + 
Sbjct  1    MQTSQQHRNTAI-HMLHHQPMKKIDPYSSPHFQILENSVCPDTGSQGKNVSFQTDKEEFF  59

Query  481  TLESSSVSES-------RALYG----SPMSQQGSRSYPS--------DNNYGSPISGSCI  603
            TLES+ V++         A+ G    SP S QGS SY S        D   GSP+SG   
Sbjct  60   TLESTPVNDGFIACDSPSAISGLSNRSPFSPQGSHSYSSDHHHHHFSDTTSGSPVSGCSG  119

Query  604  TDDMSSFIHKLKELETAMLGPDSDVLESH  690
             DD +   +KL+ELE ++LGP+SD+++SH
Sbjct  120  VDDGNDLKYKLRELEVSLLGPESDIVDSH  148



>ref|XP_009626207.1| PREDICTED: scarecrow-like transcription factor PAT1 [Nicotiana 
tomentosiformis]
Length=547

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 61/114 (54%), Gaps = 21/114 (18%)
 Frame = +1

Query  469  NLYCTLESSSVSESRALYGSP-----------MSQQGSRSYPSD------NNYGSPISGS  597
            N YC +ESS+ + +  +  SP           M  QGS S PSD      + Y S  + S
Sbjct  57   NQYCYVESSTGNSNELVSDSPPVDTFFAGDNSMMHQGSDSCPSDMHHSPNDTYHSSGNSS  116

Query  598  CITDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIA---SPEIDSWRQMM  750
            C T D +   HKLKELETAMLGPDS+ LES+ NT P + A   S E D W  MM
Sbjct  117  CFTSDGTGLKHKLKELETAMLGPDSESLESY-NTTPLAAANQISSESDKWVDMM  169



>ref|XP_008449075.1| PREDICTED: scarecrow-like transcription factor PAT1 [Cucumis 
melo]
 ref|XP_008449076.1| PREDICTED: scarecrow-like transcription factor PAT1 [Cucumis 
melo]
 ref|XP_008449077.1| PREDICTED: scarecrow-like transcription factor PAT1 [Cucumis 
melo]
Length=545

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 62/110 (56%), Gaps = 19/110 (17%)
 Frame = +1

Query  475  YCTLESSSV--------SESRALY---GSPMSQQGSRSYP------SDNNYGSPISGSCI  603
            YC LESSS         S S A +   GSP S Q   SYP       DNN GSPIS SC+
Sbjct  57   YCNLESSSGTNSYPHQNSSSTASFTSNGSPSSHQECHSYPIDLYHSPDNNCGSPISRSCL  116

Query  604  TDDMSSFI-HKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDS-WRQM  747
            TDD +  + HK++ELETAMLGPD+D L+ +  T P     P  D+ W+ +
Sbjct  117  TDDAADDLRHKIRELETAMLGPDADGLDVYSITEPIHPLLPVQDAGWKDV  166



>gb|ADL36815.1| SCL domain class transcription factor [Malus domestica]
Length=542

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 80/150 (53%), Gaps = 25/150 (17%)
 Frame = +1

Query  307  MQAAQRLRRTG-MSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPV-----HASR  468
            M+ +Q+ R    + + L +PPVQ+ D Y    +QIL++ +  +  +  N V         
Sbjct  1    MKTSQQHRGVASIHHKLYHPPVQQIDAY---GYQILENSVFPDTGSQGNNVSFQTGKDDE  57

Query  469  NLYCTLESS------SVSESRALYG----SPMSQQGSRSYPSD------NNYGSPISGSC  600
              + TLESS      +     A+ G    SP S QGS S  SD      NNYGSP SG  
Sbjct  58   EQFFTLESSPATAFVTCDSPSAVSGLSNKSPFSPQGSHSCLSDQHHSSGNNYGSPTSGCS  117

Query  601  ITDDMSSFIHKLKELETAMLGPDSDVLESH  690
            + +D + F ++L+E+E ++LGPDSD+++SH
Sbjct  118  VVEDDNEFKYRLREVEVSLLGPDSDIVDSH  147



>ref|XP_008366083.1| PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 13 [Malus 
domestica]
Length=542

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 83/159 (52%), Gaps = 25/159 (16%)
 Frame = +1

Query  307  MQAAQRLRRTG-MSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPV-----HASR  468
            M+ +Q+ R    + + L +PPVQ+ D Y    +QIL++ +  +  +  N V         
Sbjct  1    MKTSQQHRGVASIHHKLYHPPVQQIDAY---GYQILENSVFPDTGSQGNNVSFQTGKDDE  57

Query  469  NLYCTLESSSVSE------SRALYG----SPMSQQGSRSYPSD------NNYGSPISGSC  600
              + TLESS  +         A+ G    SP S QGS S  SD      NNYGSP SG  
Sbjct  58   EQFFTLESSPATAFVXCDSPSAVSGLSNKSPFSPQGSHSCLSDQHHSSGNNYGSPTSGCS  117

Query  601  ITDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIA  717
            + +D + F ++L+E+E ++LGPDSD+++SH     S +A
Sbjct  118  VVEDDNEFKYRLREVEVSLLGPDSDIVDSHFCCHKSGMA  156



>gb|KDO62219.1| hypothetical protein CISIN_1g046067mg [Citrus sinensis]
Length=521

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 73/145 (50%), Gaps = 19/145 (13%)
 Frame = +1

Query  364  PVQKADPYCLPQFQILDHELSYNNTNVANPVHA-SRNLYCTLESSSVSESRALYGSPMS-  537
            PVQK      P  Q +DH+ S +++N    +   +   YCTLESSS + S     SP + 
Sbjct  20   PVQKLASKNWPPHQNIDHQPSSDDSNERARLSVDTFEQYCTLESSSGTGSHGAPNSPSTA  79

Query  538  ----QQGSRSYPSDNNY------------GSPISGSCITDDMSSFIHKLKELETAMLGPD  669
                ++   S+P+  +Y            GSP+SGSCIT + +   HKL+ELET MLGPD
Sbjct  80   SFSPEKTQVSWPNQQSYSSELYQSPDRTCGSPVSGSCITQNENDLRHKLRELETVMLGPD  139

Query  670  SDVLESHDNTFPSS-IASPEIDSWR  741
             D    ++ T P     S E + W+
Sbjct  140  LDTPAMYNVTSPKEDQISSESERWK  164



>ref|XP_004134801.1| PREDICTED: scarecrow-like protein 13 [Cucumis sativus]
 gb|KGN49047.1| hypothetical protein Csa_6G511620 [Cucumis sativus]
Length=541

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 79/150 (53%), Gaps = 35/150 (23%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHAS--RNLYC  480
            MQA+Q  + + M        + + DPY L  F +L + +S + ++  N V+ S  ++ + 
Sbjct  1    MQASQNRQASSM--------IHEMDPYYLSGFHVLGNHVSPDASSQGNSVNFSSYKDQFF  52

Query  481  TLES---------------SSVSESRALYGSPMSQQGSRSYPSD------NNYGSPISGS  597
            TLES                SV  SR    SP S QGS+S  SD      N  GSP+SG 
Sbjct  53   TLESFPATADLSGSNSPSTGSVLSSR----SPFSPQGSQSCSSDQHHSFENTCGSPMSGC  108

Query  598  CITDDMSSFIHKLKELETAMLGPDSDVLES  687
             +TD+ +   HKLKELE ++LGP+SD+++S
Sbjct  109  SVTDEDNDIKHKLKELEISLLGPESDIVDS  138



>ref|XP_002300358.2| hypothetical protein POPTR_0001s37270g [Populus trichocarpa]
 ref|XP_006369988.1| hypothetical protein POPTR_0001s37270g [Populus trichocarpa]
 ref|XP_006369989.1| hypothetical protein POPTR_0001s37270g [Populus trichocarpa]
 gb|EEE85163.2| hypothetical protein POPTR_0001s37270g [Populus trichocarpa]
 gb|ERP66557.1| hypothetical protein POPTR_0001s37270g [Populus trichocarpa]
 gb|ERP66558.1| hypothetical protein POPTR_0001s37270g [Populus trichocarpa]
Length=533

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 60/168 (36%), Positives = 84/168 (50%), Gaps = 33/168 (20%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYCTL  486
            MQ +Q+   +  S      P+Q  + YC P  Q +D       T+++     + + YCTL
Sbjct  1    MQTSQKKTISDGSRRYGDQPMQYQESYCWPPIQNIDA--GSQGTHLSA---MTSDQYCTL  55

Query  487  ESSSVSESRALYGSP-----------MSQQGSRSYPSD------NNYGSPISGSCITDDM  615
            ESSS + +  +  SP           +SQ  S+SYPSD      N  GSP S S +T   
Sbjct  56   ESSSETSAYPVQNSPSTASFSPNESVVSQPNSQSYPSDPQDSSENACGSPTSESYVT---  112

Query  616  SSFIHKLKELETAMLGPDSDVLESHDNTF---PSSIASPEIDSWRQMM  750
                HKL+ELETAMLGPDSD L+ H  T    P+ I S E + W+ ++
Sbjct  113  ----HKLRELETAMLGPDSDNLDMHSMTAMPGPNQIVS-EAEKWKFLV  155



>ref|XP_009374874.1| PREDICTED: scarecrow-like protein 13 [Pyrus x bretschneideri]
 ref|XP_009374875.1| PREDICTED: scarecrow-like protein 13 [Pyrus x bretschneideri]
 ref|XP_009344952.1| PREDICTED: scarecrow-like protein 13 [Pyrus x bretschneideri]
 ref|XP_009344953.1| PREDICTED: scarecrow-like protein 13 [Pyrus x bretschneideri]
Length=542

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 81/159 (51%), Gaps = 25/159 (16%)
 Frame = +1

Query  307  MQAAQRLRRTG-MSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPV-----HASR  468
            M+ +Q+ R    + + L +PPVQ+ D Y    +QIL++ +  +  +  N V         
Sbjct  1    MKTSQQHRGVASIHHKLYHPPVQQIDAY---GYQILENSVFPDTGSQGNNVSFQTCKDGE  57

Query  469  NLYCTLESSSVSE----------SRALYGSPMSQQGSRSYPSD------NNYGSPISGSC  600
              + TLESS  +           S     SP S QGS S  SD      NNYGSP SG  
Sbjct  58   EQFFTLESSPATAFVTCDSPSAVSSLSNKSPFSPQGSHSCLSDQHHSSGNNYGSPTSGCS  117

Query  601  ITDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIA  717
            + +D + F ++L+E+E ++LGPDSD+++SH     S +A
Sbjct  118  VVEDDNEFKYRLREVEVSLLGPDSDIVDSHFCCHKSGMA  156



>ref|XP_006474942.1| PREDICTED: scarecrow-like protein 5-like isoform X1 [Citrus sinensis]
Length=545

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 73/145 (50%), Gaps = 19/145 (13%)
 Frame = +1

Query  364  PVQKADPYCLPQFQILDHELSYNNTNVANPVHA-SRNLYCTLESSSVSESRALYGSPMS-  537
            PVQK      P  Q +DH+ S +++N    +   +   YCTLESSS + S     SP + 
Sbjct  20   PVQKLASKNWPPHQNIDHQPSSDDSNERARLSVDTFEQYCTLESSSGTGSHGAPNSPSTA  79

Query  538  ----QQGSRSYPSDNNY------------GSPISGSCITDDMSSFIHKLKELETAMLGPD  669
                ++   S+P+  +Y            GSP+SGSCIT + +   HKL+ELET MLGPD
Sbjct  80   SFSPEKTQVSWPNQQSYSSELYQSPDRTCGSPVSGSCITQNENDLRHKLRELETVMLGPD  139

Query  670  SDVLESHDNTFPSS-IASPEIDSWR  741
             D    ++ T P     S E + W+
Sbjct  140  LDTPAMYNVTSPKEDQISSESERWK  164



>ref|XP_006452519.1| hypothetical protein CICLE_v10007927mg [Citrus clementina]
 gb|ESR65759.1| hypothetical protein CICLE_v10007927mg [Citrus clementina]
Length=545

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 73/145 (50%), Gaps = 19/145 (13%)
 Frame = +1

Query  364  PVQKADPYCLPQFQILDHELSYNNTNVANPVHA-SRNLYCTLESSSVSESRALYGSPMS-  537
            PVQK      P  Q +DH+ S +++N    +   +   YCTLESSS + S     SP + 
Sbjct  20   PVQKLASKNWPPHQNIDHQPSSDDSNERARLSVDTFEQYCTLESSSGTGSHGAPNSPSTA  79

Query  538  ----QQGSRSYPSDNNY------------GSPISGSCITDDMSSFIHKLKELETAMLGPD  669
                ++   S+P+  +Y            GSP+SGSCIT + +   HKL+ELET MLGPD
Sbjct  80   SFSPEKTQVSWPNQQSYSSELYQSPDHTCGSPVSGSCITQNENDLRHKLRELETVMLGPD  139

Query  670  SDVLESHDNTFPSS-IASPEIDSWR  741
             D    ++ T P     S E + W+
Sbjct  140  LDTPAMYNVTSPKEDQISSESERWK  164



>ref|XP_006474943.1| PREDICTED: scarecrow-like protein 5-like isoform X2 [Citrus sinensis]
Length=540

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 73/145 (50%), Gaps = 19/145 (13%)
 Frame = +1

Query  364  PVQKADPYCLPQFQILDHELSYNNTNVANPVHA-SRNLYCTLESSSVSESRALYGSPMS-  537
            PVQK      P  Q +DH+ S +++N    +   +   YCTLESSS + S     SP + 
Sbjct  15   PVQKLASKNWPPHQNIDHQPSSDDSNERARLSVDTFEQYCTLESSSGTGSHGAPNSPSTA  74

Query  538  ----QQGSRSYPSDNNY------------GSPISGSCITDDMSSFIHKLKELETAMLGPD  669
                ++   S+P+  +Y            GSP+SGSCIT + +   HKL+ELET MLGPD
Sbjct  75   SFSPEKTQVSWPNQQSYSSELYQSPDRTCGSPVSGSCITQNENDLRHKLRELETVMLGPD  134

Query  670  SDVLESHDNTFPSS-IASPEIDSWR  741
             D    ++ T P     S E + W+
Sbjct  135  LDTPAMYNVTSPKEDQISSESERWK  159



>ref|XP_004149575.1| PREDICTED: scarecrow-like transcription factor PAT1 [Cucumis 
sativus]
 ref|XP_011650494.1| PREDICTED: scarecrow-like transcription factor PAT1 [Cucumis 
sativus]
 gb|KGN56052.1| hypothetical protein Csa_3G061550 [Cucumis sativus]
Length=545

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 60/110 (55%), Gaps = 19/110 (17%)
 Frame = +1

Query  475  YCTLESSS-----------VSESRALYGSPMSQQGSRSYP------SDNNYGSPISGSCI  603
            YC +ESSS            + S    GSP S Q   SYP       DNN GSPIS SC+
Sbjct  57   YCNVESSSGTSSYPHQNSSSTASLTSIGSPSSHQECHSYPIDPYYSPDNNCGSPISRSCL  116

Query  604  TDDMSSFI-HKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDS-WRQM  747
            TDD +  + HK++ELETAMLGPD+D L+ +  T P     P  D+ W+ +
Sbjct  117  TDDAADDLRHKIRELETAMLGPDADGLDVYSITEPVHPLLPMQDAGWKDV  166



>ref|XP_006452520.1| hypothetical protein CICLE_v10007927mg [Citrus clementina]
 gb|ESR65760.1| hypothetical protein CICLE_v10007927mg [Citrus clementina]
Length=540

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 73/145 (50%), Gaps = 19/145 (13%)
 Frame = +1

Query  364  PVQKADPYCLPQFQILDHELSYNNTNVANPVHA-SRNLYCTLESSSVSESRALYGSPMS-  537
            PVQK      P  Q +DH+ S +++N    +   +   YCTLESSS + S     SP + 
Sbjct  15   PVQKLASKNWPPHQNIDHQPSSDDSNERARLSVDTFEQYCTLESSSGTGSHGAPNSPSTA  74

Query  538  ----QQGSRSYPSDNNY------------GSPISGSCITDDMSSFIHKLKELETAMLGPD  669
                ++   S+P+  +Y            GSP+SGSCIT + +   HKL+ELET MLGPD
Sbjct  75   SFSPEKTQVSWPNQQSYSSELYQSPDHTCGSPVSGSCITQNENDLRHKLRELETVMLGPD  134

Query  670  SDVLESHDNTFPSS-IASPEIDSWR  741
             D    ++ T P     S E + W+
Sbjct  135  LDTPAMYNVTSPKEDQISSESERWK  159



>ref|XP_010094683.1| hypothetical protein L484_004260 [Morus notabilis]
 gb|EXB56655.1| hypothetical protein L484_004260 [Morus notabilis]
Length=597

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 87/172 (51%), Gaps = 28/172 (16%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHE-----------LSYNNTNV---  444
            MQ +Q+ + TG  + L    VQ  +PY  P FQIL++            LS+   N    
Sbjct  49   MQTSQKHQATGGIHGLYQQHVQDINPYYSPHFQILENNMFPDTGSQGKSLSFETCNEQYF  108

Query  445  ---ANPVHASRNLYCTLESSSVSESRAL-YGSPMSQQGSRSYPSDNNY------GSPISG  594
               ++P  A    + T +S S S    L + SP S QGS S  SD ++      GSPISG
Sbjct  109  TLDSSPATAD---FLTCDSHSPSAVSVLSHRSPFSPQGSHSCSSDPHHSSEIYSGSPISG  165

Query  595  SCITDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSI-ASPEIDSWRQM  747
              +TDD +   HKL+ELE ++LG +SD+++S   ++ +    +  + SW+ M
Sbjct  166  CSVTDDGNELKHKLRELEISLLGIESDIVDSCYCSYKTEAHQATSLASWKMM  217



>ref|XP_009804325.1| PREDICTED: scarecrow-like transcription factor PAT1 [Nicotiana 
sylvestris]
 ref|XP_009804326.1| PREDICTED: scarecrow-like transcription factor PAT1 [Nicotiana 
sylvestris]
Length=547

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 60/114 (53%), Gaps = 21/114 (18%)
 Frame = +1

Query  469  NLYCTLESSSVSESRALYGSP-----------MSQQGSRSYPSD------NNYGSPISGS  597
            N YC +ESS+ + S  +  SP           M  QGS S PSD      + Y S  + S
Sbjct  57   NQYCYVESSTGNSSELVSDSPPVDTFFADDNSMMHQGSDSCPSDMHHSPNDTYHSSGNSS  116

Query  598  CITDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIA---SPEIDSWRQMM  750
            C T D +   HKLKELETAMLGPDS+ LES+ NT P + A   S E   W  MM
Sbjct  117  CFTSDGTGLKHKLKELETAMLGPDSESLESY-NTTPLAAANQISSESGKWVDMM  169



>ref|XP_004958142.1| PREDICTED: chitin-inducible gibberellin-responsive protein 2-like 
[Setaria italica]
Length=547

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 87/158 (55%), Gaps = 17/158 (11%)
 Frame = +1

Query  310  QAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYCTLE  489
            Q  ++   +G +  LC+P    +D + +P+     + +  ++ +  +  H +R  Y TL+
Sbjct  19   QTPKQFLYSGNTQHLCHPYQSASDTHVVPEHH---YTMKSHSPDAVSEEHETRKQY-TLD  74

Query  490  SSSVS--------ESRALY---GSPMSQQGSRSYPSDNNYGSPISGSCITDDMSSFIHKL  636
            SS+ S         S++++   GSP+S + S S  ++ N GSP+S SC+T+D +    KL
Sbjct  75   SSAASGCSRHDSPSSQSIHTGSGSPLSHEDSHSGSTNGN-GSPVSASCVTEDPTDLKQKL  133

Query  637  KELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
            K+LE  MLG DS++++S + +  + + S E + W  MM
Sbjct  134  KDLEAVMLGTDSEIVDSLEISVANQL-SLEPEKWVHMM  170



>ref|XP_011014635.1| PREDICTED: scarecrow-like transcription factor PAT1 [Populus 
euphratica]
 ref|XP_011014636.1| PREDICTED: scarecrow-like transcription factor PAT1 [Populus 
euphratica]
Length=533

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 86/168 (51%), Gaps = 33/168 (20%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYCTL  486
            MQ +Q+   +  S      P+Q  + YC P  Q +D   + +     +P+   +N  CTL
Sbjct  1    MQTSQKKTISDGSRRYGDQPMQYQESYCWPPIQNID---AGSQGMHLSPMTFDQN--CTL  55

Query  487  ESSSVSESRALYGSP-----------MSQQGSRSYPSD------NNYGSPISGSCITDDM  615
            ESSS + +  ++ SP           +SQ  S+SYPSD      N  GSP S S +T   
Sbjct  56   ESSSETSAYPVHNSPSTASFSPNESVVSQPNSQSYPSDLQDSSENACGSPTSESYVT---  112

Query  616  SSFIHKLKELETAMLGPDSDVLESHDNTF---PSSIASPEIDSWRQMM  750
                HKL+ELETAMLGPDSD L+ ++ T    P+ I S E + W+ ++
Sbjct  113  ----HKLRELETAMLGPDSDNLDMYNMTAMPGPNQIVS-EAEKWKVLV  155



>ref|XP_008342206.1| PREDICTED: scarecrow-like protein 21 [Malus domestica]
 ref|XP_008342207.1| PREDICTED: scarecrow-like protein 21 [Malus domestica]
 ref|XP_008368529.1| PREDICTED: scarecrow-like protein 21 [Malus domestica]
 ref|XP_008368530.1| PREDICTED: scarecrow-like protein 21 [Malus domestica]
Length=537

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 62/122 (51%), Gaps = 15/122 (12%)
 Frame = +1

Query  364  PVQKADPYCLPQFQILDHELSYNNTNVANPVHASR-NLYCTLESSSVSESR---------  513
            PV++ + YC P FQ  DH+ S +       +   R   +C LESSS + +          
Sbjct  20   PVEEPESYCWPSFQNADHQASSDEVVQGTKLSVQRFEQHCXLESSSGTSAYPGRSSASSL  79

Query  514  --ALYGSPMSQQGSRSYPSDNNYGSPISGSCITDDMSSFIHKLKELETAMLGPDSDVLES  687
              +  GSP S     SY S    GSP++ SC+++D     HK++ELE A+LG DSD  + 
Sbjct  80   NFSGNGSPASHPDLHSYQSG---GSPVNQSCMSNDTDDLXHKMRELENALLGNDSDAFDV  136

Query  688  HD  693
            +D
Sbjct  137  YD  138



>ref|XP_003546192.1| PREDICTED: scarecrow-like protein 13-like [Glycine max]
 gb|KHN32954.1| Scarecrow-like protein 13 [Glycine soja]
Length=552

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 75/154 (49%), Gaps = 34/154 (22%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILD----HELSYNNTNVANPV--HASR  468
            MQ +Q+   T     L + P Q  DPY    +QIL     HE+  N+++    +    S+
Sbjct  1    MQTSQK-HPTSAGIHLYHQPAQDIDPY--THYQILQSNSCHEIHDNSSSQGTTISFETSK  57

Query  469  NLYCTLESS---------------SVSESRALYGSPMSQQGSRSY------PSDNNYGSP  585
            + Y TLESS               SVS +R    SP S Q S SY       SDN YGSP
Sbjct  58   DQYFTLESSPVINDLIGCDSPSYASVSSNR----SPFSPQASHSYHSDQHQSSDNTYGSP  113

Query  586  ISGSCITDDMSSFIHKLKELETAMLGPDSDVLES  687
             S     DD     +KL+ELE ++LGPDSD+++S
Sbjct  114  TSSHSTADDSYELKNKLRELEISLLGPDSDIVDS  147



>ref|XP_006657889.1| PREDICTED: chitin-inducible gibberellin-responsive protein 2-like 
[Oryza brachyantha]
Length=545

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 71/139 (51%), Gaps = 11/139 (8%)
 Frame = +1

Query  355  CYPPVQKADPYCLPQ--FQILDHELSYNNTNVANP----VHASRNLYCTLESSSVSESRA  516
            C+P    +D + +PQ  + +  H       + A P    + +S    C    S  S+S  
Sbjct  34   CHPYRGPSDTHVVPQHHYSLKSHSPDAGCESQAAPNKYTLDSSEGARCMRNDSPSSQSFT  93

Query  517  LY-GSPMSQQGSRSYPSDNNYGSPISGSCITDDMSSFIHKLKELETAMLGPDSDVLESHD  693
               GSP+SQ+ S S   D+  GSP+  SC+TDD +    KLK+LE  MLGPDS ++ S +
Sbjct  94   TRSGSPLSQEDSHS---DSTDGSPVGASCVTDDPTDLKQKLKDLEAVMLGPDSHIVNSLE  150

Query  694  NTFPSSIASPEIDSWRQMM  750
            N+  + + S E + W  MM
Sbjct  151  NSVANQL-SLEPEKWVHMM  168



>ref|XP_008227448.1| PREDICTED: scarecrow-like protein 13 [Prunus mume]
Length=540

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 78/149 (52%), Gaps = 24/149 (16%)
 Frame = +1

Query  307  MQAAQRLRRTG-MSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPV--HASRNLY  477
            MQ +Q+ R T  +  +  + P+Q  DP     FQIL++ +  +  +  N V     +  Y
Sbjct  1    MQTSQKHRSTASIHRLYHHQPMQDIDPSI---FQILENSVCSDTGSQGNNVSFQTYKEEY  57

Query  478  CTLESSSVSES-------RALYG----SPMSQQGSRS------YPSDNNYGSPISGSCIT  606
             TLESS  +          A+ G    SP S QGS+S      +  DN  GSPISG  + 
Sbjct  58   FTLESSPATTGFVACDSPSAVSGLSNRSPFSSQGSQSCLSDQHHSPDNTSGSPISGCSVA  117

Query  607  DDMSSFIHKLKELETAMLGPDSDVL-ESH  690
            DD +   +KL+ELE ++LGP+SD++ +SH
Sbjct  118  DDGNGLRYKLRELEISLLGPESDIIVDSH  146



>ref|XP_002865612.1| hypothetical protein ARALYDRAFT_917700 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41871.1| hypothetical protein ARALYDRAFT_917700 [Arabidopsis lyrata subsp. 
lyrata]
Length=490

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 56/101 (55%), Gaps = 16/101 (16%)
 Frame = +1

Query  451  PVHASRNLYCTLESSSVSESRALYGSPMSQQGSRSYPSDNNYGSPISGSCITDDMSSFIH  630
            PVH SR  +CTLE S          SP     S +   D        GSC+TDD++ F H
Sbjct  26   PVHNSRKRFCTLEPSP--------DSPAYNALSTATYEDT------CGSCVTDDLNDFKH  71

Query  631  KLKELETAMLGPDS-DVLESHDNTFPSSIASPEIDSWRQMM  750
            K++E+ET M+GPDS D++    ++F S+ A  EI+SWR  +
Sbjct  72   KIREIETVMMGPDSLDLVVDCTDSFDST-ACQEINSWRSTL  111



>ref|XP_002460928.1| hypothetical protein SORBIDRAFT_02g037650 [Sorghum bicolor]
 gb|EER97449.1| hypothetical protein SORBIDRAFT_02g037650 [Sorghum bicolor]
Length=547

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 81/161 (50%), Gaps = 23/161 (14%)
 Frame = +1

Query  310  QAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYCTLE  489
            Q  ++   +G S  LCYP    +D + +PQ       +  ++ +  +  H +   Y TL+
Sbjct  19   QTPKQFLYSGNSQHLCYPYQSASDTHVVPQRHC---TMRSHSPDAGSEDHDNHKQY-TLD  74

Query  490  SSSVS-----------ESRALYGSPMSQQGSRSYPSDNNYGSPISGSCITDDMSSFIHKL  636
            SS+ S              A  GSP+S + S S  ++ N GSP+S SC+T+D +    KL
Sbjct  75   SSATSGCSRHDSPSSQSVHAGSGSPVSLEDSHSGSTNGN-GSPVSASCVTEDPTDLKQKL  133

Query  637  KELETAMLGPDSDVLESHDNTFPSSIA---SPEIDSWRQMM  750
            K+LE AMLG D +++    N+   SIA   S E + W+ MM
Sbjct  134  KDLEAAMLGTDPEIV----NSLEISIADQLSLEPEEWKHMM  170



>ref|XP_008376441.1| PREDICTED: scarecrow-like protein 21 [Malus domestica]
 ref|XP_008376442.1| PREDICTED: scarecrow-like protein 21 [Malus domestica]
Length=537

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 71/144 (49%), Gaps = 19/144 (13%)
 Frame = +1

Query  364  PVQKADPYCLPQFQILDHELSYNNTNVANPVHASR-NLYCTLESSSVSESR---------  513
            PV++ + YC P  Q +D + S +       +   +   +CTLESSS +            
Sbjct  20   PVEEQESYCWPSSQNVDQQASSDEVVQGTQLSVQKVEQHCTLESSSGTSGYPGRSSSSSL  79

Query  514  --ALYGSPMSQQGSRSYPSDNNYGSPISGSCITDDMSSFIHKLKELETAMLGPDSDVLES  687
              +  GSP+S     SY S    GSP++ SCI+++     HK++ELE A+LG DSD  ++
Sbjct  80   NFSGNGSPVSHPDVHSYQS---CGSPVNQSCISNETDGLGHKIRELENALLGNDSDAFDA  136

Query  688  H---DNTFPSSIASPEIDSWRQMM  750
            +   D      I S E + W QMM
Sbjct  137  YKIIDEVGADQIYS-EAEHWEQMM  159



>ref|NP_001060115.1| Os07g0583600 [Oryza sativa Japonica Group]
 sp|Q8GVE1.1|CIGR2_ORYSJ RecName: Full=Chitin-inducible gibberellin-responsive protein 
2 [Oryza sativa Japonica Group]
 gb|AAL61821.1| chitin-inducible gibberellin-responsive protein [Oryza sativa 
Japonica Group]
 dbj|BAC55608.1| chitin-inducible gibberellin-responsive protein [Oryza sativa 
Japonica Group]
 dbj|BAF22029.1| Os07g0583600 [Oryza sativa Japonica Group]
 gb|EAZ04489.1| hypothetical protein OsI_26640 [Oryza sativa Indica Group]
 gb|EAZ40446.1| hypothetical protein OsJ_24900 [Oryza sativa Japonica Group]
 dbj|BAG93797.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93469.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00810.1| unnamed protein product [Oryza sativa Japonica Group]
Length=544

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 4/76 (5%)
 Frame = +1

Query  523  GSPMSQQGSRSYPSDNNYGSPISGSCITDDMSSFIHKLKELETAMLGPDSDVLESHDNTF  702
            GSP+SQ+ S S   D+  GSP+  SC+T+D +    KLK+LE  MLGPDS+++ S +N+ 
Sbjct  96   GSPLSQEDSHS---DSTDGSPVGASCVTEDPNDLKQKLKDLEAVMLGPDSEIVNSLENSV  152

Query  703  PSSIASPEIDSWRQMM  750
             + + S E + W +MM
Sbjct  153  ANQL-SLEPEKWVRMM  167



>gb|KJB13827.1| hypothetical protein B456_002G096300 [Gossypium raimondii]
Length=538

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 87/163 (53%), Gaps = 21/163 (13%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYP-PVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNL--Y  477
            MQ +Q+ + TG     C   PVQ+ + YC P  Q L+   S ++    +  H+  NL  Y
Sbjct  1    MQTSQKHKITGK----CIDWPVQELESYCWPPNQSLEPYQSGSDDGSNSVQHSVPNLERY  56

Query  478  CTLESSSV------SESRALYGSPMSQQGSRSYPSD-----NNYGSPISGSCITDDMSSF  624
            CTL+SSS       + S +  GSP+SQQ + +YP D     N   SPISGSC+ D+ +  
Sbjct  57   CTLDSSSSMQNSSSTASFSPDGSPVSQQ-NYTYPLDLHSPENTCASPISGSCVIDNENDL  115

Query  625  IHKLKELETAMLGPDSDVLESH--DNTFPSSIASPEIDSWRQM  747
               +++LETAMLG DS  L+ H    +  ++  S E + W+ M
Sbjct  116  GLMIRQLETAMLGIDSGDLDLHAIAASGRATKVSVEAERWKYM  158



>ref|XP_002272401.1| PREDICTED: scarecrow-like protein 21 [Vitis vinifera]
 ref|XP_010647042.1| PREDICTED: scarecrow-like protein 21 [Vitis vinifera]
Length=545

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 86/169 (51%), Gaps = 21/169 (12%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDH-ELSYNNTNVANPVHASRN-LYC  480
            MQ ++  + +G  + L + PVQ+  PYCL + QILD+ E   N     +    + N  Y 
Sbjct  1    MQTSEEHQSSGGIHRLYHQPVQELQPYCLSEIQILDNNECPSNGIQQTHLSFGTYNEQYF  60

Query  481  TLESSSVSESRALYG------------SPMSQQGSRSYPSD------NNYGSPISGSCIT  606
            TLES+ V+    +              SP S QGS+SY SD      N  GSPISGS   
Sbjct  61   TLESAPVTAGYNVCDSSPSAGSISSNRSPFSPQGSQSYLSDPHHSPDNASGSPISGSSGV  120

Query  607  DDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSI-ASPEIDSWRQMM  750
            DD +   HKL+ELE ++LGP+SD  +S + +F S    +  I  W+  M
Sbjct  121  DDGNELRHKLRELELSLLGPESDTTDSCNCSFRSGAHQAASIARWKVEM  169



>ref|XP_010442232.1| PREDICTED: scarecrow-like transcription factor PAT1 [Camelina 
sativa]
 ref|XP_010442233.1| PREDICTED: scarecrow-like transcription factor PAT1 [Camelina 
sativa]
 ref|XP_010442234.1| PREDICTED: scarecrow-like transcription factor PAT1 [Camelina 
sativa]
Length=491

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 57/101 (56%), Gaps = 15/101 (15%)
 Frame = +1

Query  451  PVHASRNLYCTLESSSVSESRALYGSPMSQQGSRSYPSDNNYGSPISGSCITDDMSSFIH  630
            PV+ SR  +CTLE S  S +     S  + + +              GSC+TDD++ F H
Sbjct  26   PVNNSRKRFCTLEPSPDSPAYNALSSTATYEDT-------------CGSCVTDDLNDFKH  72

Query  631  KLKELETAMLGPDS-DVLESHDNTFPSSIASPEIDSWRQMM  750
            K+KE+ET M+GPDS D++    ++F S+ A  EI+SWR  +
Sbjct  73   KIKEIETVMMGPDSLDLVVDGTDSFDST-ACQEINSWRSTL  112



>ref|XP_007211536.1| hypothetical protein PRUPE_ppa003910mg [Prunus persica]
 gb|EMJ12735.1| hypothetical protein PRUPE_ppa003910mg [Prunus persica]
Length=540

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 77/149 (52%), Gaps = 24/149 (16%)
 Frame = +1

Query  307  MQAAQRLRRTG-MSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPV--HASRNLY  477
            MQ +Q+ R T  +  +  + P+Q  DP     FQIL++ +  +  +  N V     +  Y
Sbjct  1    MQTSQKHRSTASIHRLYHHQPMQDIDPSI---FQILENSVCSDTGSQGNNVSFQTYKEEY  57

Query  478  CTLESS----------SVSESRALYG-SPMSQQGSRS------YPSDNNYGSPISGSCIT  606
             TLESS          S S    L   SP S QGS+S      +  DN  GSPISG  + 
Sbjct  58   FTLESSPATTGFVACDSPSAGSGLSNRSPFSSQGSQSCLSDQRHSPDNTSGSPISGCSVA  117

Query  607  DDMSSFIHKLKELETAMLGPDSDVL-ESH  690
            DD +   +KL+ELE ++LGP+SD++ +SH
Sbjct  118  DDGNGLRYKLRELEISLLGPESDIIVDSH  146



>ref|XP_010493620.1| PREDICTED: scarecrow-like transcription factor PAT1 isoform X1 
[Camelina sativa]
 ref|XP_010493621.1| PREDICTED: scarecrow-like transcription factor PAT1 isoform X1 
[Camelina sativa]
 ref|XP_010493622.1| PREDICTED: scarecrow-like transcription factor PAT1 isoform X1 
[Camelina sativa]
 ref|XP_010493623.1| PREDICTED: scarecrow-like transcription factor PAT1 isoform X1 
[Camelina sativa]
 ref|XP_010493624.1| PREDICTED: scarecrow-like transcription factor PAT1 isoform X2 
[Camelina sativa]
Length=491

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 57/101 (56%), Gaps = 15/101 (15%)
 Frame = +1

Query  451  PVHASRNLYCTLESSSVSESRALYGSPMSQQGSRSYPSDNNYGSPISGSCITDDMSSFIH  630
            PV+ SR  +CTLE S  S +     S  + + +              GSC+TDD++ F H
Sbjct  26   PVNNSRKRFCTLEPSPDSPAYNALSSTATYEDT-------------CGSCVTDDLNDFKH  72

Query  631  KLKELETAMLGPDS-DVLESHDNTFPSSIASPEIDSWRQMM  750
            K+KE+ET M+GPDS D++    ++F S+ A  EI+SWR  +
Sbjct  73   KIKEIETVMMGPDSLDLVVDGTDSFDST-ACQEINSWRSTL  112



>ref|XP_004244053.1| PREDICTED: scarecrow-like protein 21 [Solanum lycopersicum]
 ref|XP_004244054.1| PREDICTED: scarecrow-like protein 21 [Solanum lycopersicum]
Length=538

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 69/133 (52%), Gaps = 19/133 (14%)
 Frame = +1

Query  364  PVQKADPYCLPQFQILDHELS-YNNTNVANPVHASRNLYCTLESSSVSESRALYGSP---  531
            P++  + Y LP     ++  S Y + +   P       +C +ESS+ + S  +  SP   
Sbjct  20   PIEYQESYFLPSVNNPNNNQSFYADVSALKPAQ-----HCYVESSAGNSSELVSDSPPIV  74

Query  532  ----MSQQGSRSYPSD------NNYGSPISGSCITDDMSSFIHKLKELETAMLGPDSDVL  681
                M  QGS S  SD      + + S  + SC T D++   HKL+ELETAMLGPDS+ L
Sbjct  75   NFNPMMNQGSDSCRSDMHHSPDDTFQSSGNSSCYTSDVTDLKHKLRELETAMLGPDSESL  134

Query  682  ESHDNTFPSSIAS  720
            ES +NT P + A+
Sbjct  135  ESFNNTIPVTAAN  147



>ref|XP_003551507.1| PREDICTED: scarecrow-like protein 5-like isoform X1 [Glycine 
max]
 ref|XP_006602158.1| PREDICTED: scarecrow-like protein 5-like isoform X2 [Glycine 
max]
Length=545

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 82/167 (49%), Gaps = 19/167 (11%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQ-ILDHELSYNNTNVANPVHASRNLYCT  483
            MQ +Q  + +  S      PVQ  + YC+P  + I ++  S N++    P   +   YCT
Sbjct  1    MQTSQNHKISYGSGGFYVEPVQNLESYCMPSSENIDNYSSSDNSSQTTYPSVQTLEQYCT  60

Query  484  LESSSVSESR-------ALY----GSPMSQQGSRSYPSDNNY------GSPISGSCITDD  612
            LES+S   S        AL      SP+S+  S SY     +      GSP   S +T D
Sbjct  61   LESASTGNSFPNQNSPPALSFSSNNSPLSKLESNSYVLRPQHSLEIASGSPEDDSYLTHD  120

Query  613  MSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIAS-PEIDSWRQMM  750
            +    HK++ELETAMLGP++D+L+ +    P   +   E + W+++M
Sbjct  121  LDDLTHKIRELETAMLGPNADMLDIYGTVIPEPDSFLLEAEKWKKLM  167



>ref|XP_006280361.1| hypothetical protein CARUB_v10026289mg [Capsella rubella]
 gb|EOA13259.1| hypothetical protein CARUB_v10026289mg [Capsella rubella]
Length=490

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 56/101 (55%), Gaps = 16/101 (16%)
 Frame = +1

Query  451  PVHASRNLYCTLESSSVSESRALYGSPMSQQGSRSYPSDNNYGSPISGSCITDDMSSFIH  630
            PV+ SR  +CTLE S          SP     S +   D        GSC+TDD++ F H
Sbjct  26   PVNNSRKRFCTLEPSP--------DSPGYNALSTATYEDT------CGSCVTDDLNDFKH  71

Query  631  KLKELETAMLGPD-SDVLESHDNTFPSSIASPEIDSWRQMM  750
            K+KE+ET M+GPD SD++    ++F SS A  EI+SWR  +
Sbjct  72   KIKEIETVMMGPDSSDLVVDCTDSFDSS-ACQEINSWRSTL  111



>ref|XP_008370992.1| PREDICTED: scarecrow-like protein 13 [Malus domestica]
Length=536

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 78/144 (54%), Gaps = 27/144 (19%)
 Frame = +1

Query  352  LCYPPVQKADPYCLPQFQILDHELSYNNTNVANPV-----HASRNLYCTLESSSVSE---  507
            L + PVQ+ D  C   FQIL++ +  +  +  N +        +  + TLESS  ++   
Sbjct  12   LYHQPVQQID-RC--GFQILENSMYPDTGSQGNNLSFQTDKDDKEQFFTLESSPSTDFLP  68

Query  508  ---SRALYG----SPMSQQGSRSYPSD------NNYGSPISG-SCITDDMSSFIHKLKEL  645
                 A+ G    SP S QGS S  SD      NNYGSPISG S I DD   F +KL+E+
Sbjct  69   CDSPSAISGLSNRSPFSPQGSHSCFSDQHHSSGNNYGSPISGCSIIVDD--DFKYKLREM  126

Query  646  ETAMLGPDSDVLESHDNTFPSSIA  717
            E ++LGPDSD+++SH  +  S +A
Sbjct  127  EVSLLGPDSDIVDSHFCSHRSGMA  150



>gb|KHG14123.1| Scarecrow-like protein 5 [Gossypium arboreum]
Length=539

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 87/164 (53%), Gaps = 22/164 (13%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYP-PVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNL--Y  477
            MQ +Q+ + TG     C   PVQ+ + YC P  Q L+   S ++    +  H+  NL  Y
Sbjct  1    MQTSQKHKITGK----CIDWPVQELESYCCPPNQSLEPCQSGSDDGSNSVQHSIPNLERY  56

Query  478  CTLESSSV------SESRALYGSPMSQQGSRSYPSD------NNYGSPISGSCITDDMSS  621
            CTL+SSS       + S +  GSP+SQQ + +YP D      N   SPISGSC+ D+ + 
Sbjct  57   CTLDSSSSVQNSSSTASFSPDGSPVSQQ-NYTYPLDLHHSPENTCASPISGSCVIDNEND  115

Query  622  FIHKLKELETAMLGPDSDVLESH--DNTFPSSIASPEIDSWRQM  747
                +++LETAMLG DS  L+ H    +  ++  S E + W+ M
Sbjct  116  LGLMIRQLETAMLGIDSGDLDLHAIAASGRATEVSVEAERWKYM  159



>ref|XP_010482060.1| PREDICTED: scarecrow-like transcription factor PAT1 [Camelina 
sativa]
 ref|XP_010482061.1| PREDICTED: scarecrow-like transcription factor PAT1 [Camelina 
sativa]
 ref|XP_010482062.1| PREDICTED: scarecrow-like transcription factor PAT1 [Camelina 
sativa]
 ref|XP_010482063.1| PREDICTED: scarecrow-like transcription factor PAT1 [Camelina 
sativa]
Length=492

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 58/102 (57%), Gaps = 16/102 (16%)
 Frame = +1

Query  451  PVHASRNLYCTLESSSVSES-RALYGSPMSQQGSRSYPSDNNYGSPISGSCITDDMSSFI  627
            PV+ SR  +CT E S  S +  AL  S  + + +              GSC+TDD++ F 
Sbjct  26   PVNNSRKRFCTFEPSPDSPAYNALSSSTATYEDT-------------CGSCVTDDLNDFK  72

Query  628  HKLKELETAMLGPDS-DVLESHDNTFPSSIASPEIDSWRQMM  750
            HK+KE+ET M+GPDS D++    ++F S+ A  EI+SWR  +
Sbjct  73   HKIKEIETVMMGPDSLDLVVDGTDSFDST-ACQEINSWRSTL  113



>gb|KJB57876.1| hypothetical protein B456_009G184100 [Gossypium raimondii]
Length=548

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 68/134 (51%), Gaps = 23/134 (17%)
 Frame = +1

Query  364  PVQKADPYCLPQFQILDH----ELSYNNTNVANPVHASRNLYCTLESSSVSESRALYGSP  531
            PV++ DP+ L + Q+LD+    +     TNV+      ++   TLESS        Y SP
Sbjct  20   PVKENDPFYLSRIQMLDNNACSDTGVQGTNVS--FQTCKDQVFTLESSMAGAGFVAYDSP  77

Query  532  MSQ-----------QGSRSYPSD------NNYGSPISGSCITDDMSSFIHKLKELETAML  660
             +             GS+S  SD      N YGSP SGS + DD +   HKL+ELE ++L
Sbjct  78   SAVSISSSRSPFSPHGSQSCLSDPRPSPENTYGSPYSGSSVVDDSNKLKHKLRELELSLL  137

Query  661  GPDSDVLESHDNTF  702
            GP+S+ ++S +  F
Sbjct  138  GPESNTVDSCNGCF  151



>ref|XP_007146593.1| hypothetical protein PHAVU_006G053400g [Phaseolus vulgaris]
 gb|ESW18587.1| hypothetical protein PHAVU_006G053400g [Phaseolus vulgaris]
Length=545

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 78/167 (47%), Gaps = 19/167 (11%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYCTL  486
            MQ +Q  + +  S      PVQ  + YCLP  + +D+  S N++    P   + + Y TL
Sbjct  1    MQTSQNHKISYGSGGFYVEPVQNLESYCLPSSENIDNYSSDNSSQTTYPSVQTLDQYLTL  60

Query  487  ESSSVSESR-------ALY----GSPMSQQGSRSYPSDNNY------GSPISGSCITDDM  615
            ES+S S S        AL      SP+S   S SY     +      G P + S    D 
Sbjct  61   ESASTSNSFPCQNSPPALSFSSNNSPLSNLESNSYVLRPQHSLEIANGPPENDSYPILDF  120

Query  616  SSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASP--EIDSWRQMM  750
                HK++ELETAML P++D+L+ +    P    S   E + W++MM
Sbjct  121  DELTHKIRELETAMLEPNADMLDIYGAIMPGEADSILLETEKWKEMM  167



>ref|XP_009348924.1| PREDICTED: scarecrow-like protein 13 [Pyrus x bretschneideri]
Length=536

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 82/160 (51%), Gaps = 33/160 (21%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHEL------SYNNTNVANPVHASR  468
            M+A+Q+ R       L + PVQ+ D  C   FQIL+  +        NN +  N     +
Sbjct  1    MKASQQHRGVA----LYHQPVQQID-RC--GFQILEKSMYPDTGSQGNNLSFQN-YKDDK  52

Query  469  NLYCTLESS------SVSESRALYG----SPMSQQGSRSYPSD------NNYGSPISG-S  597
              + TL+SS      +     A+ G    SP S QGS S  SD      NNYGSPISG S
Sbjct  53   EQFFTLDSSPATAFLTCDSPSAISGLSNRSPFSPQGSHSCFSDQHHSSGNNYGSPISGCS  112

Query  598  CITDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIA  717
             I DD   F  KL+E+E ++LGPDSD+++SH  +  S +A
Sbjct  113  IIVDD--DFKSKLREMEVSLLGPDSDIVDSHFCSHRSGMA  150



>ref|XP_007211555.1| hypothetical protein PRUPE_ppa004136mg [Prunus persica]
 ref|XP_007211556.1| hypothetical protein PRUPE_ppa004136mg [Prunus persica]
 gb|EMJ12754.1| hypothetical protein PRUPE_ppa004136mg [Prunus persica]
 gb|EMJ12755.1| hypothetical protein PRUPE_ppa004136mg [Prunus persica]
Length=527

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 81/161 (50%), Gaps = 14/161 (9%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASR-NLYCT  483
            MQ +Q+     +S+     PV++ + Y  P    +DH+ S +       +       YCT
Sbjct  1    MQESQKHIIPNVSHGCGEQPVEEPESYSWPPIPSVDHQASSDEVIQGTQLSVQHLAQYCT  60

Query  484  LESSS-VSESRALYGSP----MSQQGS-RSYPSDNNY---GSPISGSCITDDMSSFIHKL  636
             ESSS  S    ++ SP     S  GS  S+P   NY   GSP++ SC+++D     HK+
Sbjct  61   HESSSGTSTYHPVHSSPSSIGFSANGSPTSHPDLQNYQSCGSPVNQSCLSNDTDDLGHKM  120

Query  637  KELETAMLGPDSDVLESH---DNTFPSSIASPEIDSWRQMM  750
            +ELE+ +LG D D  + +   D   P+ ++S E ++W QMM
Sbjct  121  RELESVLLGNDLDAFDMYAITDELGPNQLSS-EAENWEQMM  160



>ref|XP_003532162.1| PREDICTED: scarecrow-like protein 5-like [Glycine max]
 gb|KHM99486.1| Scarecrow-like protein 5 [Glycine soja]
Length=545

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 79/167 (47%), Gaps = 19/167 (11%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQ-ILDHELSYNNTNVANPVHASRNLYCT  483
            MQ  Q  + +  S      PVQ  D YC+P  + I ++  S N++    P   +   YCT
Sbjct  1    MQTPQNHKISYGSGGFYVEPVQNLDSYCIPSSENIDNYSSSDNSSQTTYPSVQTLEQYCT  60

Query  484  LESSSVSESRALYGSP-----------MSQQGSRSYPSDNNY------GSPISGSCITDD  612
            LES+S   S     SP           +S+  S SY     +      GSP   S +T D
Sbjct  61   LESASTGNSFPSQNSPPALSFSSNNSLLSKLESNSYVLRPQHSLEIASGSPEDDSYLTHD  120

Query  613  MSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIAS-PEIDSWRQMM  750
            +    HK++ELETAMLGP++D+L+ +    P   +   E + W++MM
Sbjct  121  LDGLTHKIRELETAMLGPNADMLDIYGTVIPEPDSFLLEAEKWKKMM  167



>gb|KHN43816.1| Scarecrow-like protein 5 [Glycine soja]
Length=545

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 81/167 (49%), Gaps = 19/167 (11%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQ-ILDHELSYNNTNVANPVHASRNLYCT  483
            MQ +Q  + +  S      PVQ  + YC+P  + I ++  S N++    P   +   YCT
Sbjct  1    MQTSQNHKISYGSGGFYVEPVQNLESYCMPSSENIDNYSSSDNSSQTTYPSVQTLEQYCT  60

Query  484  LESSSVSESR-------ALY----GSPMSQQGSRSYPSDNNY------GSPISGSCITDD  612
            LES+S   S        AL      SP+S+  S SY     +      GSP   S +  D
Sbjct  61   LESASTGNSFPNQNSPPALSFSSNNSPLSKLESNSYVLRPQHSLEIASGSPEDDSYLAHD  120

Query  613  MSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIAS-PEIDSWRQMM  750
            +    HK++ELETAMLGP++D+L+ +    P   +   E + W+++M
Sbjct  121  LDDLTHKIRELETAMLGPNADMLDIYGTVIPEPDSFLLEAEKWKKLM  167



>ref|XP_003562815.1| PREDICTED: chitin-inducible gibberellin-responsive protein 2 
[Brachypodium distachyon]
Length=549

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 77/146 (53%), Gaps = 21/146 (14%)
 Frame = +1

Query  355  CYPPVQKADPYCLPQ--FQILDH--ELSYNN--TNVANPVHASRNLYCTLESSSVSES--  510
            C+P     D + +PQ  + +  H  +  + N  T++   + +S  + C    S  S S  
Sbjct  34   CHPYQSSPDTHVVPQHDYSLKSHSPDAGFENQVTHMKYTLDSSAEVGCMRHDSPSSHSFT  93

Query  511  -RALYGSPMSQQGSRSYPSDNNYGSPISGSCIT--DDMSSFIHKLKELETAMLGPDSDVL  681
             R+   SP+SQ+ S S   D+  GSP+S SC+T  +D +    KLK+LE  MLGPDS+V+
Sbjct  94   PRSDSSSPLSQEDSHS---DSTNGSPVSASCVTVTEDPNHLRQKLKDLEAVMLGPDSEVV  150

Query  682  ESHDNTFPSSIA---SPEIDSWRQMM  750
                N+  SSIA   S E + W QMM
Sbjct  151  ----NSLESSIANQLSLEPEKWVQMM  172



>ref|XP_006346161.1| PREDICTED: scarecrow-like transcription factor PAT1-like [Solanum 
tuberosum]
Length=537

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 51/84 (61%), Gaps = 10/84 (12%)
 Frame = +1

Query  526  SPMSQQGSRSYPSD------NNYGSPISGSCITDDMSSFIHKLKELETAMLGPDSDVLES  687
            +PM QQGS S  SD      + + S  + SC T D++   HKL+ELETAMLGPDS+ +ES
Sbjct  77   NPMMQQGSDSCRSDMHHSPDDTFQSSGNSSCYTSDVTDLKHKLRELETAMLGPDSESMES  136

Query  688  HDNTFPSSIA---SPEIDSWRQMM  750
            + NT P++ A   S E D    MM
Sbjct  137  Y-NTIPAAAANQVSSESDKLVGMM  159



>emb|CDY54511.1| BnaC07g49170D [Brassica napus]
Length=497

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 66/130 (51%), Gaps = 18/130 (14%)
 Frame = +1

Query  364  PVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYCTLESSSVSESRALYGSPMSQQ  543
            P QK + Y LP F     E S        P H S   YC LE SS S     Y + +S  
Sbjct  5    PRQKTEAYTLPPF-----EASSVGKLRYIPAHNSLKRYCMLEPSSSSLVSPAY-AVLSNA  58

Query  544  GSRSYPSDNNYGSPISGSCITDDMSSFIHKLKELETAMLGPDS-DVLESHDNTFPSSIAS  720
             S ++          SGSC+TDD   F  K+KELET M+GPDS D++  ++++F S+ + 
Sbjct  59   NSSAHED-------TSGSCVTDD---FNDKIKELETVMMGPDSLDLVFDYNDSFDST-SC  107

Query  721  PEIDSWRQMM  750
             E +SWR  +
Sbjct  108  QETNSWRSTL  117



>ref|NP_199626.1| GRAS family transcription factor [Arabidopsis thaliana]
 ref|NP_974903.1| GRAS family transcription factor [Arabidopsis thaliana]
 sp|Q9LDL7.1|PAT1_ARATH RecName: Full=Scarecrow-like transcription factor PAT1; AltName: 
Full=GRAS family protein 29; Short=AtGRAS-29; AltName: Full=Protein 
PHYTOCHROME A SIGNAL TRANSDUCTION 1 [Arabidopsis 
thaliana]
 gb|AAF73237.1|AF153443_1 phytochrome A signal transduction 1 protein [Arabidopsis thaliana]
 dbj|BAA96995.1| SCARECROW gene regulator-like [Arabidopsis thaliana]
 gb|ABF57282.1| At5g48150 [Arabidopsis thaliana]
 dbj|BAH19931.1| AT5G48150 [Arabidopsis thaliana]
 dbj|BAH20403.1| AT5G48150 [Arabidopsis thaliana]
 gb|AED95624.1| GRAS family transcription factor [Arabidopsis thaliana]
 gb|AED95625.1| GRAS family transcription factor [Arabidopsis thaliana]
Length=490

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 56/101 (55%), Gaps = 16/101 (16%)
 Frame = +1

Query  451  PVHASRNLYCTLESSSVSESRALYGSPMSQQGSRSYPSDNNYGSPISGSCITDDMSSFIH  630
            PV+ SR  +CTLE    S        P +   + +Y           GSC+TD+++ F H
Sbjct  26   PVNNSRKRFCTLEPFPDS-------PPYNALSTATYDD-------TCGSCVTDELNDFKH  71

Query  631  KLKELETAMLGPDS-DVLESHDNTFPSSIASPEIDSWRQMM  750
            K++E+ET M+GPDS D+L    ++F S+ AS EI+ WR  +
Sbjct  72   KIREIETVMMGPDSLDLLVDCTDSFDST-ASQEINGWRSTL  111



>ref|XP_009396052.1| PREDICTED: chitin-inducible gibberellin-responsive protein 2-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009396053.1| PREDICTED: chitin-inducible gibberellin-responsive protein 2-like 
[Musa acuminata subsp. malaccensis]
Length=515

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 57/104 (55%), Gaps = 18/104 (17%)
 Frame = +1

Query  475  YCTLESSSVSESRALY------------GSPMSQQGSRSYPSDNNYGSPISGSCITDDMS  618
            +CTLESS  + +   +            GS MSQQ S    SDN  GSP+S +   +D S
Sbjct  41   FCTLESSLATANCTTHNPPSSLSFSPISGSSMSQQDS---VSDNANGSPVSAT--IEDPS  95

Query  619  SFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
               ++L+E+E AMLGPD D + + DN +P  + S E + WR +M
Sbjct  96   DLKNRLREIEAAMLGPDLDTIGNSDNGYPGDL-SLEPEKWRGVM  138



>ref|XP_010097275.1| hypothetical protein L484_009507 [Morus notabilis]
 gb|EXB67427.1| hypothetical protein L484_009507 [Morus notabilis]
Length=546

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 74/150 (49%), Gaps = 29/150 (19%)
 Frame = +1

Query  355  CYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYCTLESSSVSESR-------  513
            C+PP QK++          D   S      A+        YCTLESSS + +        
Sbjct  28   CWPPTQKSN----------DLTGSAKGNQEAHLSSKVFEQYCTLESSSGTGTHPGQNSSS  77

Query  514  ----ALYGSPMSQQGSRSYPSDNNYG------SPISGSCITDDMSSFIHKLKELETAMLG  663
                +  GSP SQ  ++SYP D N+       SP + SC+TDD     HK++ELETAMLG
Sbjct  78   SVSFSPSGSPSSQPETQSYPIDQNHSPDNACVSPFNHSCLTDDADDLRHKIRELETAMLG  137

Query  664  PDSDVLESHD--NTFPSSIASPEIDSWRQM  747
             DSD+ + ++  N      +S + +SW+Q+
Sbjct  138  IDSDIPDMYNMYNQVEYKESSLDGESWKQI  167



>ref|XP_007147638.1| hypothetical protein PHAVU_006G141700g [Phaseolus vulgaris]
 gb|ESW19632.1| hypothetical protein PHAVU_006G141700g [Phaseolus vulgaris]
Length=553

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 65/138 (47%), Gaps = 30/138 (22%)
 Frame = +1

Query  352  LCYPPVQKADPYCLPQFQILD-------HELSYNNTNVANPVHASRNLYCTLESS-----  495
            L + PVQ  D Y   ++Q+L        H+ S   T ++     S+  Y TLESS     
Sbjct  15   LYHQPVQDIDSY--TRYQVLQSNSCHEIHDSSSQGTTIS--FEPSKEQYFTLESSPQIND  70

Query  496  --------SVSESRALYGSPMSQQGSRSY------PSDNNYGSPISGSCITDDMSSFIHK  633
                      S S     SP S   S SY       SDNNYGSP S +   D+     HK
Sbjct  71   LIGCDSPSYASVSSNSNRSPFSPHASHSYHSDQHQSSDNNYGSPTSANSSADESYELKHK  130

Query  634  LKELETAMLGPDSDVLES  687
            L+ELE ++LGPDSD+++S
Sbjct  131  LRELEISLLGPDSDIVDS  148



>ref|XP_004983228.1| PREDICTED: chitin-inducible gibberellin-responsive protein 2-like 
isoform X1 [Setaria italica]
 ref|XP_004983229.1| PREDICTED: chitin-inducible gibberellin-responsive protein 2-like 
isoform X2 [Setaria italica]
Length=542

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 53/104 (51%), Gaps = 16/104 (15%)
 Frame = +1

Query  475  YCTLESSSVS------------ESRALYGSPMSQQGSRSYPSDNNYGSPISGSCITDDMS  618
            YCTLESSS +                L GSP+SQ    S   D+ Y SP S SC+T+ ++
Sbjct  66   YCTLESSSANGIYPAQSSTSSHSISPLSGSPLSQHDGHS---DHTYSSPPSASCLTE-VA  121

Query  619  SFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
                KLKELE  +LGP+ D+      +F  +      D+WRQ++
Sbjct  122  DLQIKLKELENVILGPELDITSDSPESFLQANVQLRPDNWRQLL  165



>emb|CDY05700.1| BnaC02g38370D [Brassica napus]
Length=497

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 64/130 (49%), Gaps = 17/130 (13%)
 Frame = +1

Query  364  PVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYCTLESSSVSESRALYGSPMSQQ  543
            P Q+ + Y LP   +              PVH SR  YCT ESSS           +   
Sbjct  5    PRQEIEAYSLPANSVGKRRYV--------PVHNSRKRYCTPESSSPDSP----AHDVISN  52

Query  544  GSRSYPSDNNYGSPISGSCITDDMSSFIHKLKELETAMLGPDS-DVLESHDNTFPSSIAS  720
             +     +N+     SGSC+TDD   F  K+KELET M+GPDS D++  ++++F S+ + 
Sbjct  53   ATVLVSHNNSAYEDTSGSCVTDD---FNDKIKELETVMMGPDSLDLVLDYNDSFDST-SC  108

Query  721  PEIDSWRQMM  750
             E +SWR  +
Sbjct  109  QETNSWRSTL  118



>ref|XP_006661722.1| PREDICTED: chitin-inducible gibberellin-responsive protein 2-like 
[Oryza brachyantha]
Length=541

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 63/106 (59%), Gaps = 20/106 (19%)
 Frame = +1

Query  475  YCTLESSSVS------------ESRALYGSPMSQQGSRSYPSDNNYGSPISGSCITDDMS  618
            YCTLESSS +                + GSP+S   S S   D+ Y SP S SC+T+ ++
Sbjct  65   YCTLESSSANGAHPAHSSASSHSISPISGSPLSHHDSHS---DHTYSSPPSASCLTE-IT  120

Query  619  SFIHKLKELETAMLGPDSDV-LESHDNTF-PSSIASPEIDSWRQMM  750
                KLKELE A+LGP+ D+  +S +++  P+++A+PE  +WRQ++
Sbjct  121  DLQIKLKELENAILGPELDIAYDSPESSLQPNTMATPE--NWRQLL  164



>ref|XP_008227106.1| PREDICTED: scarecrow-like protein 21 [Prunus mume]
 ref|XP_008227107.1| PREDICTED: scarecrow-like protein 21 [Prunus mume]
Length=538

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 86/162 (53%), Gaps = 16/162 (10%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNL--YC  480
            MQ +Q+     +S+     PV++ + Y  P    +DH+ S ++  +     + ++L  YC
Sbjct  1    MQESQKHIIPNVSHGCGEQPVEEPESYSWPPIHSVDHQAS-SDEFIQGTQLSVQHLAQYC  59

Query  481  TLESSS-VSESRALYGSP----MSQQGS-RSYPSDNNY---GSPISGSCITDDMSSFIHK  633
            T ESSS  S    ++ SP     S  GS  S+P   NY   GSP++ SC+++D     HK
Sbjct  60   THESSSGTSTYHPVHSSPSSIGFSANGSPTSHPDLQNYQSCGSPVNQSCLSNDTDDLGHK  119

Query  634  LKELETAMLGPDSDVLESH---DNTFPSSIASPEIDSWRQMM  750
            ++ELE+ +LG D D L+ +   D   P+ ++S E ++  QMM
Sbjct  120  MRELESVLLGNDLDALDMYAITDELGPNQLSS-EAENREQMM  160



>gb|ABD84026.1| putative chitin-inducible gibberellin-responsive protein [Bambusa 
ventricosa]
Length=545

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = +1

Query  523  GSPMSQQGSRSYPSDNNYGSPISGSCITDDMSSFIHKLKELETAMLGPDS---DVLES  687
            GSP SQ+ S S   D+  GSPIS SC+T+D +    KLK+LE AMLGP+S   D+LES
Sbjct  97   GSPQSQEDSHS---DSTNGSPISASCVTEDPNDLKQKLKDLEAAMLGPESEIVDILES  151



>ref|XP_009129708.1| PREDICTED: scarecrow-like transcription factor PAT1 [Brassica 
rapa]
 ref|XP_009129709.1| PREDICTED: scarecrow-like transcription factor PAT1 [Brassica 
rapa]
 ref|XP_009129711.1| PREDICTED: scarecrow-like transcription factor PAT1 [Brassica 
rapa]
 emb|CDY71174.1| BnaAnng36390D [Brassica napus]
Length=497

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 67/138 (49%), Gaps = 33/138 (24%)
 Frame = +1

Query  364  PVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYCTLESSS--------VSESRAL  519
            P Q+ + Y LP   +              PVH SR  YCT ESSS        +S + AL
Sbjct  5    PRQEIEAYSLPANSVGKRRYV--------PVHNSRKRYCTPESSSPDSPAYDVLSNATAL  56

Query  520  YGSPMSQQGSRSYPSDNNYGSPISGSCITDDMSSFIHKLKELETAMLGPDS-DVLESHDN  696
                           +N+     SGSC+TDD   F  K+KELET M+GPDS D++  +++
Sbjct  57   VSH------------NNSAYEDTSGSCVTDD---FNDKIKELETVMMGPDSLDLVLDYND  101

Query  697  TFPSSIASPEIDSWRQMM  750
            +F S+ +  E ++WR  +
Sbjct  102  SFDST-SCQETNTWRSTL  118



>gb|ABG66041.1| Chitin-inducible gibberellin-responsive protein 2, putative, 
expressed [Oryza sativa Japonica Group]
Length=207

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 61/106 (58%), Gaps = 20/106 (19%)
 Frame = +1

Query  475  YCTLESSSVS------------ESRALYGSPMSQQGSRSYPSDNNYGSPISGSCITDDMS  618
            YCTLESSS +                + GSP+S   S S   D+ Y SP S SC+T+ ++
Sbjct  65   YCTLESSSANGAHPAHSSASSHSISPISGSPLSHHDSHS---DHTYNSPPSASCVTE-IT  120

Query  619  SFIHKLKELETAMLGPDSDV-LESHDNTF-PSSIASPEIDSWRQMM  750
                KL+ELE A+LGP+ D+  +S ++   P+ +A+PE  +WRQ++
Sbjct  121  DLQIKLRELENAILGPELDIAYDSPESALQPNIMATPE--NWRQLL  164



>ref|XP_007142381.1| hypothetical protein PHAVU_008G275500g [Phaseolus vulgaris]
 gb|ESW14375.1| hypothetical protein PHAVU_008G275500g [Phaseolus vulgaris]
Length=538

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 73/152 (48%), Gaps = 19/152 (13%)
 Frame = +1

Query  352  LCYPPVQKADPYCLPQFQILDHELSYNNTNVAN-PVHASRNLYCTLESSSVSESRALY--  522
            + Y PVQ     C  Q +  D+  S +N+  A  P   +   YCTLESS+ +   +L   
Sbjct  9    MSYEPVQNFGSCCFLQSENQDYYSSSDNSGHATYPSVRTSEQYCTLESSTKNSFPSLNSP  68

Query  523  --------GSPMSQQGSRSYPSDNNYGSPISG------SCITDDMSSFIHKLKELETAML  660
                     SP+S+   +SY   +     I+       SC+T + +   HK++ELE+ ML
Sbjct  69   STISFSPNNSPVSKLQPKSYVLSSQNSLEIANDSLENESCLTHNDNELRHKIRELESVML  128

Query  661  GPDSDVLESHDNTFPSSIAS--PEIDSWRQMM  750
            G D+D+L+ +D   P    S   E + W++MM
Sbjct  129  GHDADILDMYDPVIPEESESFFLEAERWKKMM  160



>ref|XP_009346772.1| PREDICTED: scarecrow-like protein 21 [Pyrus x bretschneideri]
 ref|XP_009346773.1| PREDICTED: scarecrow-like protein 21 [Pyrus x bretschneideri]
Length=536

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 57/121 (47%), Gaps = 14/121 (12%)
 Frame = +1

Query  364  PVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYCTLESSSVSESR----------  513
            PV++ + YC P FQ  DH+ S                + TLESSS + +           
Sbjct  20   PVEEPESYCWPSFQNADHQASDEVIQGTKLSVQRFEQHSTLESSSGTSAYPGRSSASSLN  79

Query  514  -ALYGSPMSQQGSRSYPSDNNYGSPISGSCITDDMSSFIHKLKELETAMLGPDSDVLESH  690
             +  GSP S     SY S    GSP++ SC+  D     HK++EL+ A+LG DSD  + +
Sbjct  80   FSGNGSPASHPDLHSYQSG---GSPVNQSCMLTDTDDLGHKIRELQNALLGNDSDAFDVY  136

Query  691  D  693
            D
Sbjct  137  D  137



>gb|KHN40815.1| Scarecrow-like protein 13 [Glycine soja]
Length=548

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 63/127 (50%), Gaps = 22/127 (17%)
 Frame = +1

Query  364  PVQKADPYCLPQFQILDHELSYNNTNVANPV---HASRNLYCTLESS-------------  495
            P Q  DPY    +QIL     ++N++          S+  Y TLESS             
Sbjct  19   PAQDIDPYT--HYQILQSNSCHDNSSSQGTTISFETSKEQYFTLESSPAINDLIGCDSPS  76

Query  496  --SVSESRALYGSPMSQQGSRSYPSDNNYGSPISG-SCITDDMSSFIHKLKELETAMLGP  666
              SVS +R+ + SP +    +   SDN YGSP S  S   DD     +KL+ELE ++LGP
Sbjct  77   YASVSSNRSPF-SPQASHSDQHQSSDNTYGSPTSAHSRYDDDGYELKNKLRELEISLLGP  135

Query  667  DSDVLES  687
            DSD+++S
Sbjct  136  DSDIVDS  142



>ref|XP_003534887.1| PREDICTED: scarecrow-like protein 13-like [Glycine max]
Length=548

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 63/127 (50%), Gaps = 22/127 (17%)
 Frame = +1

Query  364  PVQKADPYCLPQFQILDHELSYNNTNVANPV---HASRNLYCTLESS-------------  495
            P Q  DPY    +QIL     ++N++          S+  Y TLESS             
Sbjct  19   PAQDIDPYT--HYQILQSNSCHDNSSSQGTTISFETSKEQYFTLESSPAINDLIGCDSPS  76

Query  496  --SVSESRALYGSPMSQQGSRSYPSDNNYGSPISG-SCITDDMSSFIHKLKELETAMLGP  666
              SVS +R+ + SP +    +   SDN YGSP S  S   DD     +KL+ELE ++LGP
Sbjct  77   YASVSSNRSPF-SPQASHSDQHQSSDNTYGSPTSAHSRYDDDGYELKNKLRELEISLLGP  135

Query  667  DSDVLES  687
            DSD+++S
Sbjct  136  DSDIVDS  142



>ref|XP_012069359.1| PREDICTED: scarecrow-like protein 13 [Jatropha curcas]
 gb|KDP40388.1| hypothetical protein JCGZ_04207 [Jatropha curcas]
 gb|AIY30623.1| GRAS18 [Jatropha curcas]
Length=542

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 82/166 (49%), Gaps = 20/166 (12%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPV--HASRNLYC  480
            MQ +Q+ R +   +   + P ++ DPY L   Q+LD+    +  +    +   + +  Y 
Sbjct  1    MQTSQKHRNSASIHGFYHQP-KEIDPYGLSHIQVLDNNALSDGGSQGTSLSFQSYKEEYF  59

Query  481  TLESSSVSESRALY---------GSPMSQQGSRS------YPSDNNYGSPISGSCIT-DD  612
            TLESSS +   A+Y          SP S QGS S      +  DN YGSP+SGS    DD
Sbjct  60   TLESSSATTGFAVYDSPAASVSSKSPFSPQGSHSCLSDPHHSPDNTYGSPMSGSSSASDD  119

Query  613  MSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
                  KL+ELE  +LG +SD+  +++  F  S   P+ D W QM+
Sbjct  120  NILMKQKLRELEFMLLGSESDITSNYNFCFHQSDQLPKWD-WTQMV  164



>gb|EAY78215.1| hypothetical protein OsI_33264 [Oryza sativa Indica Group]
Length=524

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 61/106 (58%), Gaps = 20/106 (19%)
 Frame = +1

Query  475  YCTLESSSVS------------ESRALYGSPMSQQGSRSYPSDNNYGSPISGSCITDDMS  618
            YCTLESSS +                + GSP+S   S S   D+ Y SP S SC+T+ ++
Sbjct  48   YCTLESSSANGAHPAHSSASSHSISPISGSPLSHHDSHS---DHTYNSPPSASCVTE-IT  103

Query  619  SFIHKLKELETAMLGPDSDV-LESHDNTF-PSSIASPEIDSWRQMM  750
                KL+ELE A+LGP+ D+  +S ++   P+ +A+PE  +WRQ++
Sbjct  104  DLQIKLRELENAILGPELDIAYDSPESALQPNIMATPE--NWRQLL  147



>gb|AAM08829.1|AC113335_9 Putative SCARECROW gene regulator-like [Oryza sativa Japonica 
Group]
 gb|EAZ15846.1| hypothetical protein OsJ_31266 [Oryza sativa Japonica Group]
Length=524

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 61/106 (58%), Gaps = 20/106 (19%)
 Frame = +1

Query  475  YCTLESSSVS------------ESRALYGSPMSQQGSRSYPSDNNYGSPISGSCITDDMS  618
            YCTLESSS +                + GSP+S   S S   D+ Y SP S SC+T+ ++
Sbjct  48   YCTLESSSANGAHPAHSSASSHSISPISGSPLSHHDSHS---DHTYNSPPSASCVTE-IT  103

Query  619  SFIHKLKELETAMLGPDSDV-LESHDNTF-PSSIASPEIDSWRQMM  750
                KL+ELE A+LGP+ D+  +S ++   P+ +A+PE  +WRQ++
Sbjct  104  DLQIKLRELENAILGPELDIAYDSPESALQPNIMATPE--NWRQLL  147



>gb|ABB47346.1| Chitin-inducible gibberellin-responsive protein 2, putative, 
expressed [Oryza sativa Japonica Group]
Length=541

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 61/106 (58%), Gaps = 20/106 (19%)
 Frame = +1

Query  475  YCTLESSSVS------------ESRALYGSPMSQQGSRSYPSDNNYGSPISGSCITDDMS  618
            YCTLESSS +                + GSP+S   S S   D+ Y SP S SC+T+ ++
Sbjct  65   YCTLESSSANGAHPAHSSASSHSISPISGSPLSHHDSHS---DHTYNSPPSASCVTE-IT  120

Query  619  SFIHKLKELETAMLGPDSDV-LESHDNTF-PSSIASPEIDSWRQMM  750
                KL+ELE A+LGP+ D+  +S ++   P+ +A+PE  +WRQ++
Sbjct  121  DLQIKLRELENAILGPELDIAYDSPESALQPNIMATPE--NWRQLL  164



>ref|XP_002534218.1| Chitin-inducible gibberellin-responsive protein, putative [Ricinus 
communis]
 gb|EEF28164.1| Chitin-inducible gibberellin-responsive protein, putative [Ricinus 
communis]
Length=542

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 72/146 (49%), Gaps = 26/146 (18%)
 Frame = +1

Query  307  MQAAQRLRR-TGMSNVLCYPPVQKADPYCLPQFQILDH----ELSYNNTNVANPVHASRN  471
            MQ +Q+ R   G+     +P  Q+ D Y L   QIL++    ++    T+V+   +  + 
Sbjct  1    MQTSQKHRNPAGIHGFYNHP--QEIDQYGLSHIQILENSAFSDVGSQGTSVSFQTY--KE  56

Query  472  LYCTLESSSVSESRALYGSP----------MSQQGSRSYPSD------NNYGSPISGSCI  603
             Y TLESSS +     Y SP           S QGS S  SD      N YGSP+SG   
Sbjct  57   EYFTLESSSANAGFVGYDSPAASVSSNRSPFSPQGSNSCLSDPHRSPDNTYGSPMSGVSS  116

Query  604  TDDMSSFI-HKLKELETAMLGPDSDV  678
             DD ++ +  KL+ELE  +LG +SD+
Sbjct  117  ADDENALMRQKLRELEFLLLGSESDI  142



>ref|XP_009338895.1| PREDICTED: scarecrow-like protein 21 [Pyrus x bretschneideri]
 ref|XP_009338900.1| PREDICTED: scarecrow-like protein 21 [Pyrus x bretschneideri]
Length=549

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 56/106 (53%), Gaps = 18/106 (17%)
 Frame = +1

Query  475  YCTLESSSVSESR-----------ALYGSPMSQQGSRSYPSDNNYGSPISGSCITDDMSS  621
            +CTLESSS +              +  GSP S     SY S    GSP++ SCI+++   
Sbjct  70   HCTLESSSGTSGYPGRSSSSSLNFSANGSPASHPDVHSYHS---CGSPVNQSCISNETDD  126

Query  622  FIHKLKELETAMLGPDSDVLESH---DNTFPSSIASPEIDSWRQMM  750
              HK++ELE A+LG DSD  +++   D    + I S E ++W QMM
Sbjct  127  LGHKIRELENALLGNDSDAFDAYNIIDEVGANQIYS-EAENWEQMM  171



>ref|XP_011095941.1| PREDICTED: scarecrow-like protein 13 [Sesamum indicum]
Length=552

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 71/156 (46%), Gaps = 19/156 (12%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHE-LSYNNTNVANPVHASRNLYCT  483
            MQA+Q    +   +     PVQ+ +PY +  FQ+L++   S  +             + T
Sbjct  1    MQASQESETSSGFHSFYNRPVQQVEPYGISTFQVLNNNSTSSKSQGSGFSFQTYTEQFFT  60

Query  484  LESSSVSESRAL----------YGSPMSQQGSRSY------PSDNNYGSPISGSCITDDM  615
            LES+  ++  A             SP S QGS SY       SDN YGSP+SGS   +D 
Sbjct  61   LESTPATDFAAYNSPSAVSVSSSRSPFSPQGSHSYGSDLHHSSDNTYGSPLSGSSGVEDE  120

Query  616  SSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASP  723
            +  +H L  L   +LGP+SD  +S   +F   +  P
Sbjct  121  NKLMHALWVLRNELLGPESDTDDS--GSFNGIVTQP  154



>ref|NP_001147837.1| LOC100281447 [Zea mays]
 gb|ACG28850.1| chitin-inducible gibberellin-responsive protein 2 [Zea mays]
Length=554

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 81/162 (50%), Gaps = 18/162 (11%)
 Frame = +1

Query  310  QAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYCTLE  489
            Q  ++   +G    LC+P     D + +PQ +      S++  N  +  H +   Y TLE
Sbjct  19   QTPKQFLYSGNPQHLCHPYQSAPDAHVVPQRRYTVRSQSHSPNNAGSQDHETHKQY-TLE  77

Query  490  SSSVS--------ESRALY---GSPMSQQGSRSYPSDNNYGSPISGSCIT-DDMSSFIHK  633
            SS+ S         S++++   GSP+S   S S  S N +GSP+S SC+T +D +    K
Sbjct  78   SSAASGCSRHGSPSSQSVHAGSGSPVSHDDSHS-GSTNGHGSPVSASCVTGEDPTDLKQK  136

Query  634  LKELETAMLG---PDSDVLESHDNTFPSSIASPEIDSWRQMM  750
            LK+LE  MLG    D +++ S + +  + + S E + W  M+
Sbjct  137  LKDLEAVMLGTSETDPEIVNSLEISAANQL-SLEPEEWEHMV  177



>ref|XP_006588180.1| PREDICTED: scarecrow-like protein 5-like [Glycine max]
Length=353

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 50/167 (30%), Positives = 81/167 (49%), Gaps = 19/167 (11%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVAN-PVHASRNLYCT  483
            MQ +Q+ + +  S+     PVQ     C  Q   LD+  S +N + A  P       YCT
Sbjct  1    MQMSQKHKMSYDSSRFSIEPVQNLGSCCFLQSGNLDYSSSSDNGSHATYPSVCIFEQYCT  60

Query  484  LESSSVSESRALY----------GSPMSQQGSRSYP-SDNNYGSPISGSC-----ITDDM  615
            LESS+ +   +L            SP+S+  S++Y  S  N    ++ S      +T + 
Sbjct  61   LESSTNNNIPSLNSPSTVSFSPNNSPVSKLHSKAYVLSSQNLLEIVNESLENKSFLTLND  120

Query  616  SSFIHKLKELETAMLGPDSDVLESHDNTFPSSIAS--PEIDSWRQMM  750
                HK++ELE+AMLG D+D+L+++D   P    S   E + W++M+
Sbjct  121  DELRHKIRELESAMLGHDTDILDTYDTIIPKESDSFLKEAERWKRMV  167



>ref|XP_003573869.1| PREDICTED: scarecrow-like protein 21 [Brachypodium distachyon]
 ref|XP_010234693.1| PREDICTED: scarecrow-like protein 21 [Brachypodium distachyon]
Length=541

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 56/104 (54%), Gaps = 16/104 (15%)
 Frame = +1

Query  475  YCTLESSS------------VSESRALYGSPMSQQGSRSYPSDNNYGSPISGSCITDDMS  618
            YCTLESSS                  + GSP+SQ  S S   D+ YGSP S SC+T+ ++
Sbjct  65   YCTLESSSGNGVYPTQSSTSSHSISPISGSPLSQHDSHS---DHIYGSPPSASCVTE-VA  120

Query  619  SFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
                KLKELE A+LGP+ D+      +   +I   + D+WRQ++
Sbjct  121  DLQVKLKELEDAILGPELDITSDSPESSLQAINPLKPDNWRQLL  164



>gb|KJB62971.1| hypothetical protein B456_009G446100 [Gossypium raimondii]
Length=508

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 60/105 (57%), Gaps = 14/105 (13%)
 Frame = +1

Query  475  YCTLESSSV------SESRALYGSPMSQQGSRSYPSD-----NNYGSPISGSCITDDMSS  621
            YCTL+SSS       + S +  GSP+SQ  + S P D     +N  SP+S SC+TD+   
Sbjct  26   YCTLDSSSGVQNSSSTASFSPNGSPVSQPNN-SCPMDLRRSPDNTCSPVSNSCVTDNEHD  84

Query  622  FIHKLKELETAMLGPDSDVLESHD--NTFPSSIASPEIDSWRQMM  750
              H +++LETAMLG DSD ++ H    +  S+  S E + W+ MM
Sbjct  85   LSHMIRQLETAMLGTDSDNIDVHAIMASGRSTEVSIESERWKYMM  129



>emb|CDX86324.1| BnaA06g30410D [Brassica napus]
Length=497

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 64/131 (49%), Gaps = 19/131 (15%)
 Frame = +1

Query  364  PVQKADPYCLPQFQILD-HELSYNNTNVANPVHASRNLYCTLESSSVSESRA-LYGSPMS  537
            P Q+ + Y LP F+     +L Y       P H S   YC LE SS S   +  Y  P +
Sbjct  5    PRQETEAYTLPPFEANSVGKLRYI------PAHNSLKRYCMLEPSSSSSLVSPAYAVPSN  58

Query  538  QQGSRSYPSDNNYGSPISGSCITDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIA  717
               + S   D       SGSC+TDD   F  K+KELET M+GPDS V + +D+    S +
Sbjct  59   ATVNNSAYEDT------SGSCVTDD---FNDKIKELETVMMGPDSLVFDYNDSF--DSTS  107

Query  718  SPEIDSWRQMM  750
              E +SWR  +
Sbjct  108  CQETNSWRSTL  118



>ref|XP_004294461.1| PREDICTED: scarecrow-like protein 21 [Fragaria vesca subsp. vesca]
 ref|XP_004294462.1| PREDICTED: scarecrow-like protein 21 [Fragaria vesca subsp. vesca]
Length=524

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 49/80 (61%), Gaps = 9/80 (11%)
 Frame = +1

Query  523  GSPMSQQGSRSYPSDNNYGSPISGSCITDDMSSFIHKLKELETAMLGPDSDVLESHDNTF  702
            GSP SQ   +SY S    GSP++ SC+T+D+    HK++ELE+ +LG +SDVL+ +  T 
Sbjct  72   GSPTSQPDLQSYQSS---GSPLNQSCLTNDVGGLSHKIRELESLLLGNESDVLDIYGIT-  127

Query  703  PSSIASPEIDS----WRQMM  750
             S +   +  S    W+QMM
Sbjct  128  -SQVKHNQDLSGEQNWKQMM  146



>ref|XP_009151613.1| PREDICTED: scarecrow-like transcription factor PAT1 [Brassica 
rapa]
 ref|XP_009151614.1| PREDICTED: scarecrow-like transcription factor PAT1 [Brassica 
rapa]
 ref|XP_009151615.1| PREDICTED: scarecrow-like transcription factor PAT1 [Brassica 
rapa]
 ref|XP_009151616.1| PREDICTED: scarecrow-like transcription factor PAT1 [Brassica 
rapa]
Length=497

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 64/131 (49%), Gaps = 19/131 (15%)
 Frame = +1

Query  364  PVQKADPYCLPQFQILD-HELSYNNTNVANPVHASRNLYCTLESSSVSESRA-LYGSPMS  537
            P Q+ + Y LP F+     +L Y       P H S   YC LE SS S   +  Y  P +
Sbjct  5    PRQETEAYTLPPFEANSVGKLRYI------PAHNSLKRYCMLEPSSSSSLVSPAYAVPSN  58

Query  538  QQGSRSYPSDNNYGSPISGSCITDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIA  717
               + S   D       SGSC+TDD   F  K+KELET M+GPDS V + +D+    S +
Sbjct  59   ATVNSSAHEDT------SGSCVTDD---FNDKIKELETVMMGPDSLVFDYNDSF--DSTS  107

Query  718  SPEIDSWRQMM  750
              E +SWR  +
Sbjct  108  CQETNSWRSTL  118



>ref|XP_006649543.1| PREDICTED: chitin-inducible gibberellin-responsive protein 2-like 
isoform X1 [Oryza brachyantha]
 ref|XP_006649544.1| PREDICTED: chitin-inducible gibberellin-responsive protein 2-like 
isoform X2 [Oryza brachyantha]
 ref|XP_006649545.1| PREDICTED: chitin-inducible gibberellin-responsive protein 2-like 
isoform X3 [Oryza brachyantha]
Length=538

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 71/144 (49%), Gaps = 25/144 (17%)
 Frame = +1

Query  367  VQKADPYCLPQFQILDHELSY----NNTNVANP-VHASRNLYCTLESSS-----------  498
            V +   YC+ Q    +HE  Y    + +  +NP     +  YCTL+SSS           
Sbjct  28   VGRNGTYCVQQ----NHEDLYVSSDDGSQNSNPKAQVLQAQYCTLDSSSGNFVYPAHSST  83

Query  499  VSESRALYGSPMSQQGSRSYPSDNNYGSPISGSCITDDMSSFIHKLKELETAMLGPDSDV  678
             S+S+ + GSP+SQQ S S   ++  GSP+S SC+T+        ++E+E AM GP+ D 
Sbjct  84   SSQSQYISGSPISQQDSHS---EHTSGSPVSASCVTEVPGLRFTTIEEIENAMFGPEPDT  140

Query  679  LESHDNTFPSSIASPEIDSWRQMM  750
            + S  +    S      D+WR+ +
Sbjct  141  VSSDCSLLTDSAFYQ--DNWREHL  162



>emb|CDP04504.1| unnamed protein product [Coffea canephora]
Length=544

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 69/140 (49%), Gaps = 26/140 (19%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPV--HASRNLYC  480
            MQA+Q  + +   ++L + P Q+ + Y L  FQ+L+  +  +N++    V   A    + 
Sbjct  1    MQASQASQTSEAIHMLYHQPFQQIESYNLSPFQVLNSNVCADNSSQGAQVSFQACNEQFA  60

Query  481  TLES--------------SSVSESRALYGSPMSQQGSRSY------PSDNNYGSPISGSC  600
            TLES               S+S +R    SP S Q S+SY       SDN YGSP+SGS 
Sbjct  61   TLESLPMTDYVNSDSPSTVSISSNR----SPFSPQCSQSYMSDVHHSSDNTYGSPLSGSS  116

Query  601  ITDDMSSFIHKLKELETAML  660
              DD +   + L+ELE  ++
Sbjct  117  GVDDSNELRNVLRELEIKLM  136



>ref|XP_006283515.1| hypothetical protein CARUB_v10004566mg [Capsella rubella]
 gb|EOA16413.1| hypothetical protein CARUB_v10004566mg [Capsella rubella]
Length=532

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 71/143 (50%), Gaps = 31/143 (22%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYCTL  486
            MQ +Q+       ++L YP V     YC PQFQ +D     NN     P   S+  + TL
Sbjct  1    MQTSQKHHSAAGLHML-YPQV-----YCSPQFQAID-----NNGFSDIP---SKENFFTL  46

Query  487  ESSSVSESRALYGSP----------MSQQGSRS-----YPS-DNNYGSPISG-SCITDDM  615
            ESS+ S S   Y SP           S QGS+S     +PS DN YGSP+SG S +  D 
Sbjct  47   ESSTASGSLPSYDSPSVSITSGRSPFSPQGSQSCISDLHPSPDNVYGSPLSGTSSLAYDE  106

Query  616  SSFIHKLKELETAMLGPDSDVLE  684
            +    K++ELE ++L  D+ V E
Sbjct  107  AGVKSKIRELEVSLLSGDTKVEE  129



>ref|XP_007154029.1| hypothetical protein PHAVU_003G085000g [Phaseolus vulgaris]
 gb|ESW26023.1| hypothetical protein PHAVU_003G085000g [Phaseolus vulgaris]
Length=549

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 45/72 (63%), Gaps = 11/72 (15%)
 Frame = +1

Query  493  SSVSESRALYGSPMSQQGSRS-----YPS-DNNYGSPISGSCITDDMSSFIHKLKELETA  654
            +SVS  R    SP S QGS+S     +PS DN YGSPISG    DD     HKL+ELE +
Sbjct  78   ASVSSKR----SPFSPQGSQSCYSDHHPSSDNTYGSPISGLSSVDDGHELKHKLRELEIS  133

Query  655  MLGPDS-DVLES  687
            +LGP+  D+++S
Sbjct  134  LLGPEELDIVDS  145



>ref|XP_011086251.1| PREDICTED: scarecrow-like protein 21 [Sesamum indicum]
Length=552

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 58/121 (48%), Gaps = 19/121 (16%)
 Frame = +1

Query  367  VQKADPYCLPQFQILDHELSYNNTNVAN-PVHASRNLYCTLESSSVSESRALYGSP----  531
            +Q  +PYCL  F++L+ + ++        P+      + TLES+  SE  A+Y SP    
Sbjct  21   MQHIEPYCLSTFEVLNDDSTHIRRQATEFPLRTYAEQFFTLESTPASE-YAVYNSPSTPG  79

Query  532  -------MSQQGSRSYPSD------NNYGSPISGSCITDDMSSFIHKLKELETAMLGPDS  672
                    S Q  +SY SD      N  GSP+SGS   DD +  +H L  L   +LGP+ 
Sbjct  80   VSSNMSPFSPQYFQSYASDLHHASDNPCGSPMSGSSGVDDENKLMHALWVLRNELLGPEC  139

Query  673  D  675
            D
Sbjct  140  D  140



>ref|XP_006365847.1| PREDICTED: scarecrow-like protein 13-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006365848.1| PREDICTED: scarecrow-like protein 13-like isoform X2 [Solanum 
tuberosum]
Length=559

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 44/81 (54%), Gaps = 8/81 (10%)
 Frame = +1

Query  526  SPMSQQGSRSY------PSDNNYGSPISGSCITDDMSSFIHKLKELETAMLGPDSDVLES  687
            SP S Q S+SY       SDN YGSP+SG  + +D +   H L+E+   +LGP SD+ E 
Sbjct  84   SPFSPQCSQSYISDQHHSSDNTYGSPLSGCSVINDGNELKHVLREMANNLLGPGSDIDED  143

Query  688  HDNTFPSSIASPEIDSWRQMM  750
               +F   ++ P    W +++
Sbjct  144  SSCSFNGEVSKP--SKWNRVL  162



>ref|XP_006283514.1| hypothetical protein CARUB_v10004566mg [Capsella rubella]
 gb|EOA16412.1| hypothetical protein CARUB_v10004566mg [Capsella rubella]
Length=518

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 64/128 (50%), Gaps = 30/128 (23%)
 Frame = +1

Query  352  LCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYCTLESSSVSESRALYGSP  531
            + YP V     YC PQFQ +D     NN     P   S+  + TLESS+ S S   Y SP
Sbjct  1    MLYPQV-----YCSPQFQAID-----NNGFSDIP---SKENFFTLESSTASGSLPSYDSP  47

Query  532  ----------MSQQGSRS-----YPS-DNNYGSPISG-SCITDDMSSFIHKLKELETAML  660
                       S QGS+S     +PS DN YGSP+SG S +  D +    K++ELE ++L
Sbjct  48   SVSITSGRSPFSPQGSQSCISDLHPSPDNVYGSPLSGTSSLAYDEAGVKSKIRELEVSLL  107

Query  661  GPDSDVLE  684
              D+ V E
Sbjct  108  SGDTKVEE  115



>ref|NP_001183658.1| hypothetical protein [Zea mays]
 gb|ACR37895.1| unknown [Zea mays]
 tpg|DAA46868.1| TPA: hypothetical protein ZEAMMB73_504340 [Zea mays]
Length=542

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 53/104 (51%), Gaps = 16/104 (15%)
 Frame = +1

Query  475  YCTLESSSVS------------ESRALYGSPMSQQGSRSYPSDNNYGSPISGSCITDDMS  618
            YCTLESSS +                L GSP+SQ  S S   D+ Y SP S SC+T+ ++
Sbjct  66   YCTLESSSANGVYPAQSSTSSHSISPLSGSPLSQHDSHS---DHTYSSPPSASCLTE-VA  121

Query  619  SFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
              + K KELE +++GP  D+      +   +      D+WRQ++
Sbjct  122  DLLIKQKELENSIVGPGLDISSDCSRSLLQAHVPVRPDNWRQLL  165



>gb|EMT04695.1| hypothetical protein F775_26780 [Aegilops tauschii]
Length=524

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 55/104 (53%), Gaps = 16/104 (15%)
 Frame = +1

Query  475  YCTLESSSVS------------ESRALYGSPMSQQGSRSYPSDNNYGSPISGSCITDDMS  618
            YCTLESSS +                + GSP+SQ  S SY   + Y SP + SC+T+ + 
Sbjct  48   YCTLESSSANGVYPTQSSTSSHSISPISGSPLSQNDSHSY---HTYDSPPTASCVTE-IP  103

Query  619  SFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
             F  KLKELE A+LGP+ D+      +   +    + D+WRQ++
Sbjct  104  DFQSKLKELENAILGPELDIASDSPESLLQANHPLKQDNWRQLL  147



>gb|KHN41397.1| Scarecrow-like transcription factor PAT1 [Glycine soja]
Length=345

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 72/148 (49%), Gaps = 19/148 (13%)
 Frame = +1

Query  364  PVQKADPYCLPQFQILDHELSYNN-TNVANPVHASRNLYCTLESSSVSESRALY------  522
            PVQ     C  Q   LD+  S +N ++   P       YCTLESS+ +   +L       
Sbjct  12   PVQNLGSCCFLQSGNLDYSSSSDNGSHTTYPSVCIFEQYCTLESSTNNNFPSLNSPSTVS  71

Query  523  ----GSPMSQQGSRSYP-SDNNYGSPISGSC-----ITDDMSSFIHKLKELETAMLGPDS  672
                 SP+S+  S++Y  S  N    ++ S      +T +     HK++ELE+AMLG D+
Sbjct  72   FSPNNSPVSKLHSKAYVLSSQNLLEIVNESLENKSFLTLNDDELRHKIRELESAMLGHDT  131

Query  673  DVLESHDNTFPSSIAS--PEIDSWRQMM  750
            D+L+++D   P    S   E + W++MM
Sbjct  132  DILDTYDTIIPKESDSFLKEAERWKRMM  159



>gb|ADX60178.1| GRAS transcription factor [Zea mays]
Length=542

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 53/104 (51%), Gaps = 16/104 (15%)
 Frame = +1

Query  475  YCTLESSSVS------------ESRALYGSPMSQQGSRSYPSDNNYGSPISGSCITDDMS  618
            YCTLESSS +                L GSP+SQ  S S   D+ Y SP S SC+T+ ++
Sbjct  66   YCTLESSSANGVYPAQSSTSSHSISPLSGSPLSQHDSHS---DHTYSSPPSASCLTE-VA  121

Query  619  SFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
              + K KELE +++GP  D+      +   +      D+WRQ++
Sbjct  122  DLLIKQKELENSIVGPGLDISSDCSRSLLQAHVPVRPDNWRQLL  165



>gb|KJB13826.1| hypothetical protein B456_002G096300 [Gossypium raimondii]
Length=474

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 56/95 (59%), Gaps = 8/95 (8%)
 Frame = +1

Query  484  LESSSVSESRALYGSPMSQQGSRSYPSD-----NNYGSPISGSCITDDMSSFIHKLKELE  648
            +++SS + S +  GSP+SQQ + +YP D     N   SPISGSC+ D+ +     +++LE
Sbjct  1    MQNSSSTASFSPDGSPVSQQ-NYTYPLDLHSPENTCASPISGSCVIDNENDLGLMIRQLE  59

Query  649  TAMLGPDSDVLESH--DNTFPSSIASPEIDSWRQM  747
            TAMLG DS  L+ H    +  ++  S E + W+ M
Sbjct  60   TAMLGIDSGDLDLHAIAASGRATKVSVEAERWKYM  94



>ref|XP_010686653.1| PREDICTED: scarecrow-like protein 21 [Beta vulgaris subsp. vulgaris]
Length=548

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 57/116 (49%), Gaps = 20/116 (17%)
 Frame = +1

Query  382  PYCLPQFQILDHELSYNNTNVANPVHASRNL---YCTLESSSVSESRALYGSP-------  531
            PYC   +Q L+  +  +NT   N + + +     + TL+SS        Y SP       
Sbjct  26   PYCSSHYQALNKNMYPDNTTKGNQIISFQTFDEGFVTLDSSPNIGLYTNYDSPSGVSTSS  85

Query  532  ----MSQQGSRSY------PSDNNYGSPISGSCITDDMSSFIHKLKELETAMLGPD  669
                +S Q S+SY       SDN YGSP SGS + DD +   ++L+ LE +++GPD
Sbjct  86   NRSQVSPQCSQSYISDPQQSSDNTYGSPTSGSSVVDDNTELRNRLRYLERSLMGPD  141



>ref|XP_009773976.1| PREDICTED: scarecrow-like protein 13 [Nicotiana sylvestris]
Length=542

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 77/175 (44%), Gaps = 38/175 (22%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPV-----HASRN  471
            MQA+QR + +G  + L   P+Q+ + Y  P      +    NN N  + V          
Sbjct  1    MQASQRPQMSGGVHGLYNQPMQQVEQYYAP------YHFKNNNCNNTSSVTQFTFQTQNE  54

Query  472  LYCTLESS--------------SVSESRALYGSPMSQQGSRSYPSD-------NNYGSPI  588
             + TL+S               SVS +R    SP S Q S+SY SD       N  GSP 
Sbjct  55   HFFTLDSLPATDYVVYDSPTALSVSSNR----SPFSPQCSQSYMSDLHHSSDNNTCGSPF  110

Query  589  SGSCITDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASP-EIDSWRQMM  750
            SG    DD     H L+ELE  +LGP+SD  +S   +F   ++ P  +  W Q++
Sbjct  111  SGCSGVDD-GDLKHVLRELENKLLGPESDTDDSCSCSFNDVVSKPSSLTRWNQVL  164



>gb|EMS61898.1| hypothetical protein TRIUR3_25879 [Triticum urartu]
Length=524

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 54/104 (52%), Gaps = 16/104 (15%)
 Frame = +1

Query  475  YCTLESSSVS------------ESRALYGSPMSQQGSRSYPSDNNYGSPISGSCITDDMS  618
            YCTLESSS +                + GSP+SQ  S SY   + Y SP + SC+T+ + 
Sbjct  48   YCTLESSSANGVYPTQSSTSSHSISPISGSPLSQNDSHSY---HTYDSPPTASCVTE-IP  103

Query  619  SFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
             F  KLKELE A+LGP+ D+      +   +      D+WRQ++
Sbjct  104  DFQSKLKELENAILGPELDIASDSPESLLQANHPLRQDNWRQLL  147



>ref|NP_001234305.1| GRAS1 protein [Solanum lycopersicum]
 gb|ABD72958.1| GRAS1 [Solanum lycopersicum]
Length=542

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 80/170 (47%), Gaps = 28/170 (16%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYN-NTNVANPVHASRNLYCT  483
            MQ +QR + +G  + L    +Q+ + Y  P + +L +    N ++ +   + A    + T
Sbjct  1    MQTSQRTQMSGSVHGLYNQQMQQVEQYYAP-YDVLKNSCKDNRSSGMQFSLQAQDEQFFT  59

Query  484  LESS--------------SVSESRALYGSPMSQQGSRSY------PSDNNYGSPISGSCI  603
            L+SS              SVS +R    SP S Q SRSY       SDN  GSP+SG   
Sbjct  60   LDSSPATDYVVNDSPPALSVSSNR----SPFSPQCSRSYMSDLHHSSDNTCGSPLSGCSG  115

Query  604  TDDMSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASP-EIDSWRQMM  750
             DD     H L+ELE  +LGP+SD  +S   +    ++ P  +  W +++
Sbjct  116  IDD-GDLRHVLRELENKLLGPESDTDDSCSCSLNDMVSKPSSVTRWNRVL  164



>ref|XP_010449649.1| PREDICTED: scarecrow-like protein 13 [Camelina sativa]
 ref|XP_010449650.1| PREDICTED: scarecrow-like protein 13 [Camelina sativa]
Length=532

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 68/143 (48%), Gaps = 31/143 (22%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYCTL  486
            MQ +Q+       ++L YP V     YC PQFQ +D        N  + + +  N + TL
Sbjct  1    MQTSQKHHSAAGLHML-YPQV-----YCSPQFQAID-------KNGFSDIQSKENFF-TL  46

Query  487  ESSSVSESRALYG----------SPMSQQGSRSYPSD------NNYGSPISG-SCITDDM  615
            ESS+ S S   Y           SP S QGS+S  SD      N YGSP+SG S    D 
Sbjct  47   ESSTASGSLPSYDSPSVSITSGRSPFSPQGSQSCISDLHPSPENVYGSPLSGASSFAYDE  106

Query  616  SSFIHKLKELETAMLGPDSDVLE  684
            +    K++ELE ++L  D+ V E
Sbjct  107  ADVKSKIRELEVSLLSGDTKVEE  129



>ref|XP_003600261.1| Scarecrow-like transcription factor PAT1 [Medicago truncatula]
 gb|AES70512.1| GRAS family transcription factor [Medicago truncatula]
Length=542

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 76/166 (46%), Gaps = 24/166 (14%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNT-NVANPVHASRNLYCT  483
            MQ +Q    +  S+     PVQ  + YCLP  + LD+  S +N+     P H +   Y T
Sbjct  1    MQTSQNHEISYGSDRFYVEPVQNLESYCLPSIENLDNYSSSDNSCQTFYPSHQTLEPYNT  60

Query  484  LESSSVSESRALY-GSPMSQQGSRSYPSDNNYGSP---------ISGS-------CITDD  612
            LES+S S +   Y  SP     + S+  +N+ GS          ++GS        I  D
Sbjct  61   LESASTSNNSLPYQNSP----STHSFSPNNSPGSTLRPQHSLEFVNGSPEEEDSYLIYHD  116

Query  613  MSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIAS--PEIDSWRQ  744
                 HK+ ELE+ M GP+ ++LE +D       AS   E + W++
Sbjct  117  HDDLRHKMSELESVMRGPNVEMLEMYDTKVQEESASFLLEAEKWKK  162



>ref|XP_006414257.1| hypothetical protein EUTSA_v10024887mg [Eutrema salsugineum]
 gb|ESQ55710.1| hypothetical protein EUTSA_v10024887mg [Eutrema salsugineum]
Length=532

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 70/143 (49%), Gaps = 31/143 (22%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYCTL  486
            MQ +Q+       ++L YP V     YC PQFQ++D       +N  + + +  N + TL
Sbjct  1    MQTSQKHHSAAGLHML-YPQV-----YCSPQFQMID-------SNGFSDIPSKENFF-TL  46

Query  487  ESSSVSESRALYG----------SPMSQQGSRSYPSD------NNYGSPISG-SCITDDM  615
            ESS+ S S   Y           SP S QGS+S  SD      N YGSP+SG S    D 
Sbjct  47   ESSTASGSLPSYDSPSVSITSGRSPFSPQGSQSCISDLHPSPENVYGSPLSGASSYVYDE  106

Query  616  SSFIHKLKELETAMLGPDSDVLE  684
            +    K++ELE ++L  D+ V E
Sbjct  107  AGVRSKIRELEVSLLSGDTKVEE  129



>dbj|BAJ33904.1| unnamed protein product [Thellungiella halophila]
Length=532

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 70/143 (49%), Gaps = 31/143 (22%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYCTL  486
            MQ +Q+       ++L YP V     YC PQFQ++D       +N  + + +  N + TL
Sbjct  1    MQTSQKHHSAAGLHML-YPQV-----YCSPQFQMID-------SNGFSDIPSKENFF-TL  46

Query  487  ESSSVSESRALYG----------SPMSQQGSRSYPSD------NNYGSPISG-SCITDDM  615
            ESS+ S S   Y           SP S QGS+S  SD      N YGSP+SG S    D 
Sbjct  47   ESSTASGSLPSYDSPSVSITSGRSPFSPQGSQSCISDLHPSPENVYGSPLSGASSYVYDE  106

Query  616  SSFIHKLKELETAMLGPDSDVLE  684
            +    K++ELE ++L  D+ V E
Sbjct  107  AGVRSKIRELEVSLLSGDTKVEE  129



>ref|NP_001240165.1| uncharacterized protein LOC100792931 [Glycine max]
 gb|ACU22951.1| unknown [Glycine max]
Length=542

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 38/65 (58%), Gaps = 10/65 (15%)
 Frame = +1

Query  493  SSVSESRALYGSPMSQQGSRS------YPSDNNYGSPISGSCITDDMSSFIHKLKELETA  654
            +SVS  R    +P S QGS+S        SDN YGSPISG    DD     HKL+ELE +
Sbjct  74   ASVSSKR----TPFSPQGSQSCYSDHQQSSDNTYGSPISGLSSVDDGHELKHKLRELEIS  129

Query  655  MLGPD  669
            +LGP+
Sbjct  130  LLGPE  134



>gb|KHN42281.1| Scarecrow-like protein 13 [Glycine soja]
Length=517

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 38/65 (58%), Gaps = 10/65 (15%)
 Frame = +1

Query  493  SSVSESRALYGSPMSQQGSRS------YPSDNNYGSPISGSCITDDMSSFIHKLKELETA  654
            +SVS  R    +P S QGS+S        SDN YGSPISG    DD     HKL+ELE +
Sbjct  49   ASVSSKR----TPFSPQGSQSCYSDHQQSSDNTYGSPISGLSSVDDGHELKHKLRELEIS  104

Query  655  MLGPD  669
            +LGP+
Sbjct  105  LLGPE  109



>ref|XP_004239819.1| PREDICTED: scarecrow-like protein 13 [Solanum lycopersicum]
 ref|XP_004239821.1| PREDICTED: scarecrow-like protein 13 [Solanum lycopersicum]
 ref|XP_010321394.1| PREDICTED: scarecrow-like protein 13 [Solanum lycopersicum]
Length=559

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 43/81 (53%), Gaps = 8/81 (10%)
 Frame = +1

Query  526  SPMSQQGSRSY------PSDNNYGSPISGSCITDDMSSFIHKLKELETAMLGPDSDVLES  687
            SP S Q S+SY       SDN YGSP+SG  + +D +   H L+E+   +LGP  D+ E 
Sbjct  84   SPFSPQCSQSYISDQHHSSDNTYGSPLSGCSVINDGNELKHVLREMANNLLGPGFDIDED  143

Query  688  HDNTFPSSIASPEIDSWRQMM  750
               +F   ++ P    W +++
Sbjct  144  SSCSFNGEVSKP--SKWNRVL  162



>ref|NP_001170141.1| hypothetical protein [Zea mays]
 ref|XP_008651757.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008651758.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN35970.1| unknown [Zea mays]
 gb|AFT82641.1| GRAS38 transcription factor, partial [Zea mays subsp. mays]
 tpg|DAA63341.1| TPA: hypothetical protein ZEAMMB73_803613 [Zea mays]
 tpg|DAA63342.1| TPA: hypothetical protein ZEAMMB73_803613 [Zea mays]
Length=558

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 63/140 (45%), Gaps = 23/140 (16%)
 Frame = +1

Query  310  QAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYC---  480
            Q  ++   +G S  LC+P    +D +  PQ     H    + +   +P   S +      
Sbjct  20   QTPKQFLYSGSSQHLCHPYQSASDAHVAPQ----RHYTVRSQSQSQSPDAGSEDFETHSR  75

Query  481  --TLESSSVSESRALYGSPMSQ---QGSRS----------YPSDNNYGSPISGSCITDDM  615
              TL+SSS S     +GSP  Q    GSRS            S N  GSP S SC+T+D 
Sbjct  76   QYTLDSSSASGCSG-HGSPSCQSVHAGSRSPVSHSHDDSHSGSTNGNGSPASASCVTEDP  134

Query  616  SSFIHKLKELETAMLGPDSD  675
            +    KLK+LE  MLG D+D
Sbjct  135  TDLKQKLKDLEAVMLGTDTD  154



>ref|XP_010434701.1| PREDICTED: scarecrow-like protein 13 [Camelina sativa]
 ref|XP_010434702.1| PREDICTED: scarecrow-like protein 13 [Camelina sativa]
 ref|XP_010434703.1| PREDICTED: scarecrow-like protein 13 [Camelina sativa]
Length=532

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 68/143 (48%), Gaps = 31/143 (22%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYCTL  486
            MQ +Q+       ++L YP V     YC PQFQ +D        N  + + +  N + TL
Sbjct  1    MQTSQKHHSAAGLHML-YPQV-----YCSPQFQAID-------KNGFSDIPSKENFF-TL  46

Query  487  ESSSVSESRALYG----------SPMSQQGSRSYPSD------NNYGSPISG-SCITDDM  615
            ESS+ S S   Y           SP S QGS+S  SD      N YGSP+SG S    D 
Sbjct  47   ESSTASGSLPSYDSLSVSITSGRSPFSPQGSQSCISDLHPSPENVYGSPLSGASSFAYDE  106

Query  616  SSFIHKLKELETAMLGPDSDVLE  684
            +    K++ELE ++L  D+ V E
Sbjct  107  AGVKSKIRELEVSLLSGDTKVEE  129



>ref|XP_010440036.1| PREDICTED: scarecrow-like protein 13 [Camelina sativa]
 ref|XP_010440037.1| PREDICTED: scarecrow-like protein 13 [Camelina sativa]
Length=532

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 68/143 (48%), Gaps = 31/143 (22%)
 Frame = +1

Query  307  MQAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYCTL  486
            MQ +Q+       ++L YP V     YC PQFQ +D        N  + + +  N + TL
Sbjct  1    MQTSQKHHSAAGLHML-YPQV-----YCSPQFQAID-------KNGFSDIPSKENFF-TL  46

Query  487  ESSSVSESRALYG----------SPMSQQGSRSYPSD------NNYGSPISG-SCITDDM  615
            ESS+ S S   Y           SP S QGS+S  SD      N YGSP+SG S    D 
Sbjct  47   ESSTASGSLPSYDSPSVSITSGRSPFSPQGSQSCISDLHPSPENVYGSPLSGASSFAYDE  106

Query  616  SSFIHKLKELETAMLGPDSDVLE  684
            +    K++ELE ++L  D+ V E
Sbjct  107  AGVKTKIRELEVSLLSGDTKVEE  129



>dbj|BAJ92120.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=548

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 56/106 (53%), Gaps = 20/106 (19%)
 Frame = +1

Query  475  YCTLESSSVSES------------RALYGSPMSQQGSRSYPSDNNYGSPISGSCITD--D  612
            YCTLESSS + +              + GSPMSQ  S SY   + Y SP + SC+T+  D
Sbjct  74   YCTLESSSANGTYSTQSSTSSHSISPISGSPMSQHDSYSY---HTYDSPPTVSCVTEIPD  130

Query  613  MSSFIHKLKELETAMLGPDSDVLESHDNTFPSSIASPEIDSWRQMM  750
            + S   KLKELE A+LGP+ D+      +   +    + D WRQ++
Sbjct  131  LQS---KLKELENAILGPELDIASDSPESLLQANNPLKQDDWRQLL  173



>gb|KHN03530.1| Scarecrow-like protein 13 [Glycine soja]
Length=545

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 42/72 (58%), Gaps = 11/72 (15%)
 Frame = +1

Query  493  SSVSESRALYGSPMSQQGSRS------YPSDNNYGSPISGSCITDDMSSFIHKLKELETA  654
            +SVS  R    +P S QGS+S        SDN YGSPISG    DD     HKL+ELE +
Sbjct  74   ASVSSKR----TPFSPQGSQSCYSDHHQSSDNTYGSPISGLSSVDDRHQLKHKLRELEIS  129

Query  655  MLGP-DSDVLES  687
            +L P +SD+ +S
Sbjct  130  LLAPEESDITDS  141



>gb|ACN28625.1| unknown [Zea mays]
 tpg|DAA41243.1| TPA: chitin-inducible gibberellin-responsive protein 2 [Zea mays]
 gb|AIB04326.1| GRAS transcription factor, partial [Zea mays]
Length=554

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 80/162 (49%), Gaps = 18/162 (11%)
 Frame = +1

Query  310  QAAQRLRRTGMSNVLCYPPVQKADPYCLPQFQILDHELSYNNTNVANPVHASRNLYCTLE  489
            Q  ++   +G    LC+P     D + + Q +      S++  N  +  H +   Y TLE
Sbjct  19   QTPKQFLYSGNPQHLCHPYQSAPDTHVVLQRRYTVRSQSHSPNNAGSEDHETHKQY-TLE  77

Query  490  SSSVS--------ESRALY---GSPMSQQGSRSYPSDNNYGSPISGSCIT-DDMSSFIHK  633
            SS+ S         S++++   GSP+S   S S  S N +GSP+S SC+T +D +    K
Sbjct  78   SSAASGCSRHGSPSSQSVHAGSGSPVSHDDSHS-GSTNGHGSPVSASCVTGEDPTDLKQK  136

Query  634  LKELETAMLG---PDSDVLESHDNTFPSSIASPEIDSWRQMM  750
            LK+LE  MLG    D +++ S + +  + + S E + W  M+
Sbjct  137  LKDLEAVMLGTSETDPEIVNSLEISAANQL-SLEPEEWEHMV  177



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441662578200