BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3865

Length=964
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009774097.1|  PREDICTED: upstream activation factor subuni...    269   2e-84   Nicotiana sylvestris
ref|XP_004230795.1|  PREDICTED: upstream activation factor subuni...    269   5e-84   
ref|XP_006346439.1|  PREDICTED: upstream activation factor subuni...    269   5e-84   Solanum tuberosum [potatoes]
ref|XP_006346438.1|  PREDICTED: upstream activation factor subuni...    269   5e-84   Solanum tuberosum [potatoes]
ref|XP_009629953.1|  PREDICTED: upstream activation factor subuni...    265   9e-83   Nicotiana tomentosiformis
ref|XP_010315240.1|  PREDICTED: upstream activation factor subuni...    265   1e-82   Solanum lycopersicum
gb|KHN42058.1|  Upstream activation factor subunit spp27                259   3e-82   Glycine soja [wild soybean]
ref|XP_007042350.1|  SWIB complex BAF60b domain-containing protei...    267   1e-81   Theobroma cacao [chocolate]
ref|XP_009774096.1|  PREDICTED: upstream activation factor subuni...    261   3e-81   Nicotiana sylvestris
ref|XP_009774095.1|  PREDICTED: upstream activation factor subuni...    261   3e-81   Nicotiana sylvestris
ref|XP_010255131.1|  PREDICTED: upstream activation factor subuni...    261   5e-81   Nelumbo nucifera [Indian lotus]
ref|XP_003517282.1|  PREDICTED: upstream activation factor subuni...    260   1e-80   Glycine max [soybeans]
ref|XP_003537360.1|  PREDICTED: upstream activation factor subuni...    260   1e-80   Glycine max [soybeans]
ref|XP_007156836.1|  hypothetical protein PHAVU_002G021500g             258   6e-80   Phaseolus vulgaris [French bean]
ref|XP_007156837.1|  hypothetical protein PHAVU_002G021500g             258   6e-80   Phaseolus vulgaris [French bean]
ref|XP_009629952.1|  PREDICTED: upstream activation factor subuni...    258   9e-80   Nicotiana tomentosiformis
ref|XP_009629951.1|  PREDICTED: upstream activation factor subuni...    257   1e-79   Nicotiana tomentosiformis
ref|XP_007047160.1|  SWIB complex BAF60b domain-containing protei...    256   2e-79   
gb|KDO79317.1|  hypothetical protein CISIN_1g0196442mg                  251   1e-78   Citrus sinensis [apfelsine]
ref|XP_002522329.1|  Upstream activation factor subunit UAF30, pu...    253   3e-78   Ricinus communis
ref|XP_008792695.1|  PREDICTED: upstream activation factor subuni...    251   1e-77   
ref|XP_004511971.1|  PREDICTED: upstream activation factor subuni...    252   3e-77   Cicer arietinum [garbanzo]
ref|XP_008792693.1|  PREDICTED: upstream activation factor subuni...    251   3e-77   
ref|XP_008792591.1|  PREDICTED: upstream activation factor subuni...    249   2e-76   Phoenix dactylifera
ref|XP_008792590.1|  PREDICTED: upstream activation factor subuni...    249   2e-76   Phoenix dactylifera
ref|XP_010652654.1|  PREDICTED: upstream activation factor subuni...    248   5e-76   Vitis vinifera
ref|XP_010263746.1|  PREDICTED: upstream activation factor subuni...    248   6e-76   Nelumbo nucifera [Indian lotus]
ref|XP_010263744.1|  PREDICTED: upstream activation factor subuni...    248   6e-76   Nelumbo nucifera [Indian lotus]
ref|XP_006425831.1|  hypothetical protein CICLE_v10026010mg             248   7e-76   Citrus clementina [clementine]
ref|XP_011099215.1|  PREDICTED: upstream activation factor subuni...    246   2e-75   Sesamum indicum [beniseed]
emb|CAN83123.1|  hypothetical protein VITISV_044372                     246   3e-75   Vitis vinifera
gb|KJB32415.1|  hypothetical protein B456_005G239900                    249   6e-75   Gossypium raimondii
ref|XP_012079173.1|  PREDICTED: upstream activation factor subuni...    244   1e-74   Jatropha curcas
gb|KJB32414.1|  hypothetical protein B456_005G239900                    249   2e-74   Gossypium raimondii
gb|KJB32416.1|  hypothetical protein B456_005G239900                    249   2e-74   Gossypium raimondii
ref|XP_012072453.1|  PREDICTED: DNA ligase 1 isoform X1                 249   3e-74   
ref|XP_012072454.1|  PREDICTED: DNA ligase 1 isoform X2                 249   4e-74   Jatropha curcas
ref|XP_010905631.1|  PREDICTED: upstream activation factor subuni...    243   4e-74   Elaeis guineensis
ref|XP_012072455.1|  PREDICTED: DNA ligase 1 isoform X3                 248   4e-74   Jatropha curcas
ref|XP_011099216.1|  PREDICTED: upstream activation factor subuni...    243   5e-74   Sesamum indicum [beniseed]
ref|XP_010905630.1|  PREDICTED: upstream activation factor subuni...    243   6e-74   Elaeis guineensis
gb|KHG25549.1|  Upstream activation factor subunit spp27                246   3e-73   Gossypium arboreum [tree cotton]
ref|XP_002521839.1|  brg-1 associated factor, putative                  247   1e-72   
emb|CDP02467.1|  unnamed protein product                                239   1e-72   Coffea canephora [robusta coffee]
ref|XP_010941845.1|  PREDICTED: upstream activation factor subuni...    233   3e-70   Elaeis guineensis
gb|KJB43613.1|  hypothetical protein B456_007G210300                    228   8e-70   Gossypium raimondii
ref|XP_009397729.1|  PREDICTED: upstream activation factor subuni...    232   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB43618.1|  hypothetical protein B456_007G210300                    226   2e-69   Gossypium raimondii
gb|KJB43608.1|  hypothetical protein B456_007G210300                    230   2e-69   Gossypium raimondii
ref|XP_002306454.2|  hypothetical protein POPTR_0005s14110g             230   3e-69   
gb|KEH27539.1|  upstream activation factor subunit UAF30, putative      228   4e-69   Medicago truncatula
ref|XP_011009270.1|  PREDICTED: protein TRI1-like                       228   1e-68   Populus euphratica
gb|KJB43609.1|  hypothetical protein B456_007G210300                    229   2e-68   Gossypium raimondii
gb|KJB43616.1|  hypothetical protein B456_007G210300                    224   2e-68   Gossypium raimondii
gb|AES94759.2|  upstream activation factor subunit UAF30, putative      229   2e-68   Medicago truncatula
gb|KJB43610.1|  hypothetical protein B456_007G210300                    228   3e-68   Gossypium raimondii
gb|KJB43617.1|  hypothetical protein B456_007G210300                    223   3e-68   Gossypium raimondii
gb|KHG26278.1|  Upstream activation factor subunit spp27                227   5e-68   Gossypium arboreum [tree cotton]
ref|XP_003611801.1|  Upstream activation factor subunit spp27           228   5e-68   
ref|XP_010028508.1|  PREDICTED: DNA ligase 1                            231   5e-68   Eucalyptus grandis [rose gum]
ref|XP_010691015.1|  PREDICTED: upstream activation factor subuni...    225   3e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004148436.1|  PREDICTED: upstream activation factor subuni...    225   4e-67   Cucumis sativus [cucumbers]
ref|XP_009587440.1|  PREDICTED: upstream activation factor subuni...    224   8e-67   Nicotiana tomentosiformis
ref|XP_003558997.1|  PREDICTED: upstream activation factor subuni...    224   8e-67   Brachypodium distachyon [annual false brome]
ref|XP_010691016.1|  PREDICTED: upstream activation factor subuni...    223   2e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009803136.1|  PREDICTED: upstream activation factor subuni...    223   2e-66   Nicotiana sylvestris
ref|XP_010096161.1|  Upstream activation factor subunit spp27           226   4e-66   Morus notabilis
ref|XP_006650641.1|  PREDICTED: upstream activation factor subuni...    219   9e-65   Oryza brachyantha
ref|XP_008457882.1|  PREDICTED: upstream activation factor subuni...    218   2e-64   Cucumis melo [Oriental melon]
gb|ABF99032.1|  SWIB complex BAF60b domain-containing protein, pu...    218   3e-64   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB01706.1|  unnamed protein product                                217   1e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011626436.1|  PREDICTED: upstream activation factor subuni...    211   5e-62   Amborella trichopoda
ref|XP_004981658.1|  PREDICTED: upstream activation factor subuni...    210   2e-61   Setaria italica
ref|NP_188538.1|  SWIB complex BAF60b domain-containing protein         214   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001147426.1|  LOC100281035                                       208   9e-61   Zea mays [maize]
ref|XP_002466401.1|  hypothetical protein SORBIDRAFT_01g007140          207   2e-60   Sorghum bicolor [broomcorn]
gb|AGT16365.1|  SWIB/MDM2 domain containing protein                     206   9e-60   Saccharum hybrid cultivar R570
gb|AGT16808.1|  SWIB/MDM2 domain containing protein                     205   1e-59   Saccharum hybrid cultivar R570
ref|NP_001148210.1|  SWIB/MDM2 domain containing protein                205   2e-59   
emb|CDX99270.1|  BnaC05g33850D                                          209   2e-59   
ref|XP_009145829.1|  PREDICTED: uncharacterized protein LOC103869495    208   2e-59   Brassica rapa
emb|CDX92300.1|  BnaA05g21070D                                          208   2e-59   
gb|KFK39235.1|  hypothetical protein AALP_AA3G218000                    207   6e-59   Arabis alpina [alpine rockcress]
ref|XP_010680445.1|  PREDICTED: uncharacterized protein LOC104895589    199   3e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002977839.1|  hypothetical protein SELMODRAFT_176439             199   3e-57   Selaginella moellendorffii
ref|XP_010536330.1|  PREDICTED: synaptonemal complex protein 1 is...    209   8e-57   Tarenaya hassleriana [spider flower]
ref|XP_010536329.1|  PREDICTED: calponin homology domain-containi...    209   8e-57   Tarenaya hassleriana [spider flower]
ref|XP_010536328.1|  PREDICTED: golgin subfamily A member 6-like ...    209   8e-57   Tarenaya hassleriana [spider flower]
ref|XP_010536327.1|  PREDICTED: golgin subfamily A member 6-like ...    209   8e-57   Tarenaya hassleriana [spider flower]
ref|XP_010536324.1|  PREDICTED: golgin subfamily A member 6-like ...    209   8e-57   Tarenaya hassleriana [spider flower]
gb|EYU44365.1|  hypothetical protein MIMGU_mgv1a025674mg                197   8e-57   Erythranthe guttata [common monkey flower]
gb|ACJ85465.1|  unknown                                                 195   8e-56   Medicago truncatula
gb|KDO79318.1|  hypothetical protein CISIN_1g0196442mg                  189   3e-55   Citrus sinensis [apfelsine]
gb|KDO79319.1|  hypothetical protein CISIN_1g0196442mg                  189   3e-55   Citrus sinensis [apfelsine]
gb|AFW67527.1|  hypothetical protein ZEAMMB73_352797                    193   4e-55   
ref|XP_002883161.1|  SWIB complex BAF60b domain-containing protein      196   7e-55   
ref|XP_002979488.1|  hypothetical protein SELMODRAFT_419232             192   2e-54   Selaginella moellendorffii
ref|XP_001768652.1|  predicted protein                                  189   2e-53   
ref|XP_008236631.1|  PREDICTED: upstream activation factor subuni...    187   4e-52   Prunus mume [ume]
ref|XP_008236632.1|  PREDICTED: upstream activation factor subuni...    187   4e-52   Prunus mume [ume]
ref|XP_007199917.1|  hypothetical protein PRUPE_ppa007326mg             186   7e-52   
gb|KDP38240.1|  hypothetical protein JCGZ_04883                         182   8e-52   Jatropha curcas
emb|CBI23284.3|  unnamed protein product                                183   2e-51   Vitis vinifera
ref|XP_010317157.1|  PREDICTED: LOW QUALITY PROTEIN: upstream act...    182   6e-51   
ref|XP_010263743.1|  PREDICTED: upstream activation factor subuni...    183   1e-50   
ref|XP_010263742.1|  PREDICTED: upstream activation factor subuni...    183   1e-50   
ref|XP_012072456.1|  PREDICTED: DNA ligase 1 isoform X4                 183   9e-50   
gb|EMS67367.1|  Upstream activation factor subunit spp27                182   2e-49   Triticum urartu
ref|XP_004290311.1|  PREDICTED: upstream activation factor subuni...    179   5e-49   Fragaria vesca subsp. vesca
ref|XP_011458331.1|  PREDICTED: upstream activation factor subuni...    179   5e-49   Fragaria vesca subsp. vesca
ref|XP_011458329.1|  PREDICTED: upstream activation factor subuni...    179   5e-49   Fragaria vesca subsp. vesca
ref|XP_011458333.1|  PREDICTED: upstream activation factor subuni...    179   5e-49   Fragaria vesca subsp. vesca
ref|XP_011458335.1|  PREDICTED: upstream activation factor subuni...    179   7e-49   Fragaria vesca subsp. vesca
ref|XP_009345973.1|  PREDICTED: upstream activation factor subuni...    177   1e-48   Pyrus x bretschneideri [bai li]
ref|XP_009345972.1|  PREDICTED: upstream activation factor subuni...    177   2e-48   Pyrus x bretschneideri [bai li]
ref|XP_009345971.1|  PREDICTED: upstream activation factor subuni...    177   2e-48   Pyrus x bretschneideri [bai li]
ref|XP_010941848.1|  PREDICTED: upstream activation factor subuni...    176   2e-48   
ref|XP_010999905.1|  PREDICTED: upstream activation factor subuni...    177   3e-48   Populus euphratica
ref|XP_010999877.1|  PREDICTED: upstream activation factor subuni...    177   4e-48   Populus euphratica
ref|XP_010999862.1|  PREDICTED: upstream activation factor subuni...    177   6e-48   Populus euphratica
ref|XP_010999870.1|  PREDICTED: upstream activation factor subuni...    177   8e-48   Populus euphratica
ref|XP_010999856.1|  PREDICTED: uncharacterized protein PFB0145c-...    177   9e-48   Populus euphratica
ref|XP_001767040.1|  predicted protein                                  176   1e-47   
ref|XP_010941846.1|  PREDICTED: upstream activation factor subuni...    174   1e-47   Elaeis guineensis
ref|XP_010999846.1|  PREDICTED: uncharacterized protein PFB0145c-...    177   1e-47   Populus euphratica
ref|XP_009345974.1|  PREDICTED: ABC transporter F family member 4       177   3e-47   
gb|EMT28995.1|  hypothetical protein F775_31871                         170   4e-47   
gb|KHN36203.1|  Upstream activation factor subunit spp27                173   7e-47   Glycine soja [wild soybean]
ref|XP_009375740.1|  PREDICTED: upstream activation factor subuni...    172   1e-46   Pyrus x bretschneideri [bai li]
ref|XP_009375739.1|  PREDICTED: upstream activation factor subuni...    172   1e-46   Pyrus x bretschneideri [bai li]
ref|XP_009375737.1|  PREDICTED: upstream activation factor subuni...    172   1e-46   Pyrus x bretschneideri [bai li]
ref|XP_009375738.1|  PREDICTED: upstream activation factor subuni...    172   1e-46   Pyrus x bretschneideri [bai li]
ref|XP_006384456.1|  SWIB complex BAF60b domain-containing family...    172   4e-46   
ref|XP_010229398.1|  PREDICTED: upstream activation factor subuni...    167   2e-45   
ref|XP_011001193.1|  PREDICTED: upstream activation factor subuni...    168   5e-45   Populus euphratica
ref|XP_006393249.1|  hypothetical protein EUTSA_v10011568mg             168   7e-45   Eutrema salsugineum [saltwater cress]
ref|XP_011001192.1|  PREDICTED: protein TRI1-like isoform X2            168   8e-45   Populus euphratica
ref|XP_011001190.1|  PREDICTED: upstream activation factor subuni...    168   2e-44   Populus euphratica
ref|XP_009803137.1|  PREDICTED: protein TRI1-like isoform X2            164   6e-44   Nicotiana sylvestris
gb|KFK36005.1|  hypothetical protein AALP_AA4G065400                    162   1e-42   Arabis alpina [alpine rockcress]
gb|KFK36004.1|  hypothetical protein AALP_AA4G065400                    162   1e-42   Arabis alpina [alpine rockcress]
ref|XP_002891515.1|  SWIB complex BAF60b domain-containing protein      161   3e-42   
ref|XP_010461791.1|  PREDICTED: upstream activation factor subuni...    159   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010461790.1|  PREDICTED: upstream activation factor subuni...    159   2e-41   Camelina sativa [gold-of-pleasure]
emb|CDO97141.1|  unnamed protein product                                161   3e-41   Coffea canephora [robusta coffee]
ref|XP_010500494.1|  PREDICTED: upstream activation factor subuni...    157   6e-41   Camelina sativa [gold-of-pleasure]
gb|ABK26533.1|  unknown                                                 154   2e-40   Picea sitchensis
ref|XP_003574734.1|  PREDICTED: mediator of RNA polymerase II tra...    157   2e-40   Brachypodium distachyon [annual false brome]
ref|XP_010479385.1|  PREDICTED: upstream activation factor subuni...    155   3e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010479386.1|  PREDICTED: protein TRI1-like isoform X2            155   3e-40   Camelina sativa [gold-of-pleasure]
ref|XP_008806342.1|  PREDICTED: uncharacterized protein LOC103719054    153   1e-39   Phoenix dactylifera
ref|XP_006480142.1|  PREDICTED: upstream activation factor subuni...    154   1e-39   Citrus sinensis [apfelsine]
ref|NP_001062171.1|  Os08g0502800                                       154   2e-39   
ref|NP_175375.2|  SWIB complex BAF60b domain-containing protein         153   2e-39   Arabidopsis thaliana [mouse-ear cress]
gb|ERN14421.1|  hypothetical protein AMTR_s00033p00241730               151   2e-39   Amborella trichopoda
gb|AAD43149.1|AC007504_4  Hypothetical Protein                          153   3e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006423075.1|  hypothetical protein CICLE_v10028659mg             153   3e-39   
ref|XP_010439338.1|  PREDICTED: uncharacterized protein LOC104722801    153   3e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010448893.1|  PREDICTED: uncharacterized protein LOC104731266    153   4e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010434052.1|  PREDICTED: uncharacterized protein LOC104718075    153   4e-39   Camelina sativa [gold-of-pleasure]
ref|XP_006480141.1|  PREDICTED: upstream activation factor subuni...    153   4e-39   
ref|XP_006660252.1|  PREDICTED: uncharacterized protein LOC102711373    152   5e-39   
ref|XP_010928509.1|  PREDICTED: uncharacterized protein LOC105050254    151   8e-39   Elaeis guineensis
ref|XP_006303686.1|  hypothetical protein CARUB_v10011771mg             151   1e-38   Capsella rubella
ref|XP_006297542.1|  hypothetical protein CARUB_v10013568mg             153   1e-38   
ref|XP_010539556.1|  PREDICTED: uncharacterized protein LOC104813595    151   1e-38   Tarenaya hassleriana [spider flower]
ref|XP_003635018.1|  PREDICTED: uncharacterized protein LOC100853436    150   2e-38   Vitis vinifera
ref|XP_010419877.1|  PREDICTED: uncharacterized protein LOC104705555    153   2e-38   
ref|XP_008792594.1|  PREDICTED: upstream activation factor subuni...    147   3e-38   Phoenix dactylifera
ref|XP_008792593.1|  PREDICTED: upstream activation factor subuni...    147   3e-38   Phoenix dactylifera
ref|XP_010913182.1|  PREDICTED: uncharacterized protein LOC105038...    149   4e-38   Elaeis guineensis
ref|XP_002278125.1|  PREDICTED: uncharacterized protein LOC100267408    149   6e-38   Vitis vinifera
ref|XP_002445921.1|  hypothetical protein SORBIDRAFT_07g028070          150   7e-38   
ref|XP_010913181.1|  PREDICTED: uncharacterized protein LOC105038...    149   8e-38   Elaeis guineensis
ref|XP_002985006.1|  hypothetical protein SELMODRAFT_121478             147   1e-37   
ref|XP_004973841.1|  PREDICTED: centrosomal and chromosomal facto...    149   1e-37   Setaria italica
ref|XP_010529474.1|  PREDICTED: uncharacterized protein LOC104806331    148   1e-37   Tarenaya hassleriana [spider flower]
ref|XP_004973842.1|  PREDICTED: centrosomal and chromosomal facto...    149   2e-37   Setaria italica
ref|XP_006449863.1|  hypothetical protein CICLE_v10015752mg             147   3e-37   Citrus clementina [clementine]
ref|XP_011627948.1|  PREDICTED: uncharacterized protein LOC18446666     145   8e-37   Amborella trichopoda
gb|ABK24867.1|  unknown                                                 144   9e-37   Picea sitchensis
gb|EMT17610.1|  Upstream activation factor subunit UAF30                147   1e-36   
ref|XP_006467332.1|  PREDICTED: alpha/beta-gliadin A-III-like iso...    145   2e-36   Citrus sinensis [apfelsine]
ref|XP_006283894.1|  hypothetical protein CARUB_v10005012mg             145   2e-36   Capsella rubella
ref|XP_010042645.1|  PREDICTED: uncharacterized protein LOC104431786    141   3e-36   Eucalyptus grandis [rose gum]
ref|XP_010538758.1|  PREDICTED: uncharacterized protein LOC104812994    145   3e-36   Tarenaya hassleriana [spider flower]
ref|XP_010252656.1|  PREDICTED: formin-G                                144   3e-36   Nelumbo nucifera [Indian lotus]
ref|XP_011095959.1|  PREDICTED: uncharacterized protein LOC105175270    144   3e-36   Sesamum indicum [beniseed]
ref|XP_010448899.1|  PREDICTED: SWI/SNF-related matrix-associated...    141   3e-36   
ref|XP_012085022.1|  PREDICTED: angiomotin-like                         145   3e-36   Jatropha curcas
ref|XP_010489932.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    145   4e-36   
emb|CDY27449.1|  BnaC03g64890D                                          143   4e-36   Brassica napus [oilseed rape]
ref|XP_006406538.1|  hypothetical protein EUTSA_v10020944mg             144   5e-36   
gb|EEE68957.1|  hypothetical protein OsJ_27851                          143   6e-36   Oryza sativa Japonica Group [Japonica rice]
emb|CDX98747.1|  BnaA03g45320D                                          143   8e-36   
ref|XP_009137258.1|  PREDICTED: formin-like protein 4                   143   8e-36   Brassica rapa
gb|EEC83834.1|  hypothetical protein OsI_29784                          144   1e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_002520558.1|  brg-1 associated factor, putative                  144   1e-35   Ricinus communis
ref|XP_010270124.1|  PREDICTED: uncharacterized protein LOC104606552    142   1e-35   Nelumbo nucifera [Indian lotus]
ref|XP_011095484.1|  PREDICTED: uncharacterized protein LOC105174926    142   3e-35   Sesamum indicum [beniseed]
ref|XP_004150254.1|  PREDICTED: angiomotin                              141   3e-35   Cucumis sativus [cucumbers]
ref|XP_008447697.1|  PREDICTED: uncharacterized protein LOC103490111    141   3e-35   Cucumis melo [Oriental melon]
ref|NP_567661.1|  SWIB complex BAF60b domain-containing protein         142   3e-35   Arabidopsis thaliana [mouse-ear cress]
gb|AFW65191.1|  hypothetical protein ZEAMMB73_350137                    146   3e-35   
gb|AAM61516.1|  unknown                                                 142   4e-35   Arabidopsis thaliana [mouse-ear cress]
gb|EYU27400.1|  hypothetical protein MIMGU_mgv1a008947mg                141   4e-35   Erythranthe guttata [common monkey flower]
ref|XP_006413663.1|  hypothetical protein EUTSA_v10025487mg             142   4e-35   Eutrema salsugineum [saltwater cress]
gb|EYU27702.1|  hypothetical protein MIMGU_mgv1a010230mg                140   4e-35   Erythranthe guttata [common monkey flower]
ref|XP_006352354.1|  PREDICTED: uncharacterized protein LOC102595561    141   6e-35   Solanum tuberosum [potatoes]
ref|XP_004293361.1|  PREDICTED: uncharacterized protein LOC101314347    140   8e-35   Fragaria vesca subsp. vesca
emb|CAN72895.1|  hypothetical protein VITISV_022315                     140   9e-35   Vitis vinifera
gb|KHG15356.1|  Upstream activation factor subunit spp27                139   2e-34   Gossypium arboreum [tree cotton]
gb|KJB68546.1|  hypothetical protein B456_010G249800                    139   3e-34   Gossypium raimondii
ref|XP_008384272.1|  PREDICTED: upstream activation factor subuni...    135   3e-34   
ref|XP_009770617.1|  PREDICTED: uncharacterized protein LOC104221287    138   6e-34   Nicotiana sylvestris
ref|XP_011097816.1|  PREDICTED: uncharacterized protein LOC105176645    138   7e-34   Sesamum indicum [beniseed]
emb|CDX94096.1|  BnaC07g37300D                                          138   8e-34   
ref|XP_009411861.1|  PREDICTED: formin-like protein 18                  138   9e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007146548.1|  hypothetical protein PHAVU_006G049900g             137   1e-33   Phaseolus vulgaris [French bean]
ref|XP_007026264.1|  SWIB complex BAF60b domain-containing protei...    136   3e-33   
emb|CDP13762.1|  unnamed protein product                                136   3e-33   Coffea canephora [robusta coffee]
ref|XP_008358815.1|  PREDICTED: uncharacterized protein LOC103422526    135   7e-33   
ref|XP_003600192.1|  Upstream activation factor subunit UAF30           135   8e-33   
ref|XP_004250267.1|  PREDICTED: uncharacterized protein LOC101256830    135   8e-33   Solanum lycopersicum
ref|XP_009623786.1|  PREDICTED: protein TRI1                            135   1e-32   Nicotiana tomentosiformis
ref|XP_008366453.1|  PREDICTED: uncharacterized protein LOC103430100    132   1e-32   
gb|EPS66203.1|  hypothetical protein M569_08575                         130   1e-32   Genlisea aurea
ref|XP_009361076.1|  PREDICTED: upstream activation factor subuni...    132   2e-32   Pyrus x bretschneideri [bai li]
ref|XP_009357601.1|  PREDICTED: uncharacterized protein LOC103948320    133   2e-32   
ref|XP_003532156.1|  PREDICTED: uncharacterized protein LOC100801960    134   2e-32   Glycine max [soybeans]
gb|AES70443.2|  SWIB/MDM2 domain protein                                133   3e-32   Medicago truncatula
ref|XP_007154015.1|  hypothetical protein PHAVU_003G083900g             133   3e-32   Phaseolus vulgaris [French bean]
ref|XP_009335440.1|  PREDICTED: uncharacterized protein LOC103928154    132   4e-32   
ref|XP_009339387.1|  PREDICTED: uncharacterized protein LOC103931595    133   4e-32   Pyrus x bretschneideri [bai li]
ref|XP_002275854.1|  PREDICTED: uncharacterized protein LOC100264067    132   5e-32   Vitis vinifera
ref|XP_009391890.1|  PREDICTED: uncharacterized protein LOC103977949    133   5e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009348467.1|  PREDICTED: upstream activation factor subuni...    132   6e-32   Pyrus x bretschneideri [bai li]
ref|XP_008385810.1|  PREDICTED: formin-like protein 13                  132   7e-32   
ref|XP_008355916.1|  PREDICTED: uncharacterized protein LOC103419593    132   9e-32   
ref|XP_008371009.1|  PREDICTED: uncharacterized protein LOC103434436    132   1e-31   
gb|KJB69188.1|  hypothetical protein B456_011G009800                    132   1e-31   Gossypium raimondii
ref|XP_007047161.1|  SWIB complex BAF60b domain-containing protei...    129   1e-31   
gb|KDO35066.1|  hypothetical protein SPRG_01130                         132   1e-31   Saprolegnia parasitica CBS 223.65
ref|XP_003549577.1|  PREDICTED: uncharacterized protein LOC100804281    131   1e-31   Glycine max [soybeans]
ref|XP_010090987.1|  Upstream activation factor subunit spp27           133   1e-31   
emb|CDX79150.1|  BnaA01g12170D                                          131   1e-31   
gb|ABK94708.1|  unknown                                                 132   2e-31   Populus trichocarpa [western balsam poplar]
ref|XP_002308782.2|  hypothetical protein POPTR_0006s01230g             132   2e-31   
ref|XP_008604916.1|  hypothetical protein SDRG_01178                    131   2e-31   Saprolegnia diclina VS20
ref|XP_011008625.1|  PREDICTED: uncharacterized protein LOC105113...    131   2e-31   Populus euphratica
ref|XP_011008623.1|  PREDICTED: uncharacterized protein LOC105113...    131   2e-31   Populus euphratica
ref|XP_006373623.1|  hypothetical protein POPTR_0016s01500g             131   3e-31   
ref|XP_004500124.1|  PREDICTED: uncharacterized protein LOC101504815    130   3e-31   Cicer arietinum [garbanzo]
ref|XP_008798760.1|  PREDICTED: formin-like protein 18                  130   4e-31   Phoenix dactylifera
ref|XP_003529660.1|  PREDICTED: uncharacterized protein LOC100788173    130   4e-31   Glycine max [soybeans]
ref|XP_008345803.1|  PREDICTED: uncharacterized protein LOC103408756    130   4e-31   
ref|XP_002288942.1|  predicted protein                                  129   7e-31   Thalassiosira pseudonana CCMP1335
ref|XP_002176898.1|  predicted protein                                  128   1e-30   Phaeodactylum tricornutum CCAP 1055/1
gb|KJB68547.1|  hypothetical protein B456_010G249800                    129   2e-30   Gossypium raimondii
ref|XP_002869827.1|  hypothetical protein ARALYDRAFT_492627             129   2e-30   
ref|XP_007211527.1|  hypothetical protein PRUPE_ppa008138mg             128   3e-30   Prunus persica
gb|KHN03519.1|  Upstream activation factor subunit UAF30                127   4e-30   Glycine soja [wild soybean]
gb|EYU33684.1|  hypothetical protein MIMGU_mgv1a009014mg                127   4e-30   Erythranthe guttata [common monkey flower]
ref|XP_011000993.1|  PREDICTED: uncharacterized protein LOC105108...    128   5e-30   Populus euphratica
ref|XP_009793151.1|  PREDICTED: uncharacterized protein LOC104240060    127   5e-30   Nicotiana sylvestris
ref|XP_011000995.1|  PREDICTED: uncharacterized protein LOC105108...    128   5e-30   Populus euphratica
ref|XP_008227478.1|  PREDICTED: RNA-binding protein 33                  127   6e-30   Prunus mume [ume]
ref|XP_010064304.1|  PREDICTED: uncharacterized protein LOC104451305    127   6e-30   
ref|XP_002307875.2|  SWIB complex BAF60b domain-containing family...    128   6e-30   
ref|XP_008782909.1|  PREDICTED: formin-like protein 18                  126   9e-30   Phoenix dactylifera
gb|ACU23275.1|  unknown                                                 126   9e-30   Glycine max [soybeans]
ref|XP_004960201.1|  PREDICTED: protein bassoon-like                    127   1e-29   Setaria italica
ref|XP_010928869.1|  PREDICTED: formin-like protein 18                  126   1e-29   Elaeis guineensis
ref|XP_007211482.1|  hypothetical protein PRUPE_ppa007617mg             126   1e-29   Prunus persica
ref|XP_011400995.1|  Upstream activation factor subunit spp27           125   1e-29   Auxenochlorella protothecoides
gb|AEV40987.1|  SWIB/MDM2 domain-containing protein                     126   1e-29   Oryza minuta
ref|XP_009364677.1|  PREDICTED: uncharacterized protein LOC103954562    126   1e-29   Pyrus x bretschneideri [bai li]
gb|AEV40937.1|  SWIB/MDM2 domain-containing protein                     126   2e-29   Oryza punctata
ref|XP_009364688.1|  PREDICTED: uncharacterized protein LOC103954575    126   2e-29   Pyrus x bretschneideri [bai li]
gb|ACG35017.1|  SWIB/MDM2 domain containing protein                     126   2e-29   
emb|CDX76378.1|  BnaA08g10220D                                          125   2e-29   
ref|XP_009353301.1|  PREDICTED: alpha/beta-gliadin A-III-like           125   3e-29   
ref|XP_008227057.1|  PREDICTED: upstream activation factor subuni...    125   3e-29   
ref|XP_009135888.1|  PREDICTED: uncharacterized protein LOC103860027    125   3e-29   
ref|XP_002447280.1|  hypothetical protein SORBIDRAFT_06g031960          125   4e-29   
ref|NP_001054177.1|  Os04g0665500                                       124   5e-29   
ref|XP_006652975.1|  PREDICTED: uncharacterized protein LOC102702652    125   5e-29   
ref|XP_008668741.1|  PREDICTED: uncharacterized protein LOC103645800    125   6e-29   
gb|EAZ32320.1|  hypothetical protein OsJ_16531                          124   7e-29   
ref|XP_009626078.1|  PREDICTED: uncharacterized protein LOC104116838    123   1e-28   
gb|EEC78199.1|  hypothetical protein OsI_17819                          123   2e-28   
ref|XP_002979058.1|  hypothetical protein SELMODRAFT_418723             121   2e-28   
gb|KCW66882.1|  hypothetical protein EUGRSUZ_F00636                     117   3e-28   
gb|EPS58295.1|  hypothetical protein M569_16523                         121   5e-28   
ref|XP_008897102.1|  hypothetical protein PPTG_05335                    122   6e-28   
ref|XP_010240569.1|  PREDICTED: uncharacterized protein LOC100831700    122   6e-28   
ref|XP_008661410.1|  PREDICTED: uncharacterized protein LOC100193...    119   3e-27   
ref|NP_001131941.2|  uncharacterized protein LOC100193333               119   4e-27   
ref|XP_002991531.1|  hypothetical protein SELMODRAFT_429825             117   6e-27   
gb|ERN18305.1|  hypothetical protein AMTR_s00055p00180320               117   1e-26   
ref|XP_001702451.1|  SWIB domain-containing protein 1                   116   2e-26   
ref|XP_009838176.1|  hypothetical protein H257_12602                    117   2e-26   
ref|XP_008867795.1|  hypothetical protein H310_04980                    115   5e-26   
ref|XP_009518024.1|  hypothetical protein PHYSODRAFT_475850             116   5e-26   
ref|XP_010675851.1|  PREDICTED: wiskott-Aldrich syndrome protein ...    115   7e-26   
ref|XP_002955658.1|  hypothetical protein VOLCADRAFT_106876             114   1e-25   
emb|CCA21358.1|  conserved hypothetical protein                         114   2e-25   
gb|AAL34119.1|AC090713_6  putative parathymosin                         113   3e-25   
gb|EWM25482.1|  swib mdm2 domain containing protein                     113   3e-25   
emb|CAA16786.1|  putative protein                                       113   6e-25   
gb|ACN26234.1|  unknown                                                 104   2e-24   
ref|XP_010099977.1|  Upstream activation factor subunit spp27           111   2e-24   
ref|XP_006680223.1|  hypothetical protein BATDEDRAFT_89688              110   2e-24   
ref|XP_002907507.1|  conserved hypothetical protein                     110   5e-24   
ref|XP_002313088.2|  hypothetical protein POPTR_0009s10990g             105   6e-23   
emb|CCI50145.1|  unnamed protein product                                106   7e-23   
emb|CCI50144.1|  unnamed protein product                                106   8e-23   
tpg|DAA51565.1|  TPA: hypothetical protein ZEAMMB73_913346              105   8e-23   
gb|KDO49158.1|  hypothetical protein CISIN_1g0161771mg                  105   9e-23   
gb|KEH33952.1|  SWIB/MDM2 domain protein                                105   1e-22   
gb|KJB43614.1|  hypothetical protein B456_007G210300                    103   2e-22   
gb|EMS66228.1|  Upstream activation factor subunit spp27              99.8    2e-21   
ref|XP_005709165.1|  hypothetical protein Gasu_00170                  99.0    2e-20   
gb|EYU37715.1|  hypothetical protein MIMGU_mgv1a011940mg              98.2    3e-20   
ref|XP_005648792.1|  SWIB-domain-containing protein                   99.0    3e-20   
gb|EMT28399.1|  hypothetical protein F775_30150                       95.9    5e-20   
gb|KDO49154.1|  hypothetical protein CISIN_1g0161772mg                93.2    5e-20   
gb|KDO49153.1|  hypothetical protein CISIN_1g0161772mg                92.4    9e-20   
ref|XP_002986194.1|  hypothetical protein SELMODRAFT_123621           91.3    2e-19   
ref|XP_007026266.1|  SWIB complex BAF60b domain-containing protei...  94.4    7e-19   
gb|KDO49157.1|  hypothetical protein CISIN_1g0161772mg                90.5    8e-19   
ref|XP_007720699.1|  hypothetical protein A1O1_01596                  94.4    8e-19   
gb|EPS57960.1|  hypothetical protein M569_16857                       92.0    1e-18   
ref|XP_005716867.1|  unnamed protein product                          92.0    6e-18   
ref|XP_002566120.1|  Pc22g22250                                       91.3    6e-18   
ref|XP_009152283.1|  hypothetical protein HMPREF1120_00049            91.3    7e-18   
tpg|DAA51566.1|  TPA: hypothetical protein ZEAMMB73_058775            86.3    7e-18   
ref|XP_011460704.1|  PREDICTED: upstream activation factor subuni...  88.2    3e-17   
gb|KJB69189.1|  hypothetical protein B456_011G009800                  89.0    5e-17   
ref|XP_009037641.1|  hypothetical protein AURANDRAFT_64768            89.4    6e-17   
ref|XP_008722847.1|  hypothetical protein G647_01224                  88.2    7e-17   
ref|XP_009651924.1|  hypothetical protein VDAG_02976                  87.8    9e-17   
ref|XP_003008309.1|  conserved hypothetical protein                   87.8    1e-16   
emb|CBI32466.3|  unnamed protein product                              84.7    1e-16   
gb|ENH78559.1|  swib mdm2 domain protein                              87.4    1e-16   
gb|KIW84564.1|  hypothetical protein Z517_03814                       87.4    1e-16   
emb|CDM27437.1|  SWIB/MDM2 domain                                     87.0    2e-16   
gb|EQL31132.1|  hypothetical protein BDFG_06445                       86.7    3e-16   
gb|KJJ25743.1|  Homeodomain-like protein                              86.7    3e-16   
gb|KGO46833.1|  DEK, C-terminal                                       86.7    3e-16   
ref|XP_002626264.1|  SWIB/MDM2 domain-containing protein              86.7    3e-16   
ref|XP_959523.1|  SWIB/MDM2 domain-containing protein                 86.3    3e-16   
ref|XP_009853554.1|  hypothetical protein NEUTE1DRAFT_131437          86.3    3e-16   
gb|KGO77741.1|  DEK, C-terminal                                       86.3    3e-16   
gb|KIK22342.1|  hypothetical protein PISMIDRAFT_505499                85.9    4e-16   
emb|CEF67174.1|  SWIB/MDM2 domain and Homeodomain-like and SWIB d...  88.6    4e-16   
ref|XP_007736761.1|  hypothetical protein A1O3_08473                  85.9    4e-16   
gb|EKV09807.1|  hypothetical protein PDIP_63010                       86.3    5e-16   
ref|XP_007753393.1|  hypothetical protein A1O7_01164                  85.5    6e-16   
gb|KKA27446.1|  hypothetical protein TD95_005475                      84.3    6e-16   
emb|CCC09614.1|  unnamed protein product                              85.5    7e-16   
ref|XP_011112662.1|  hypothetical protein H072_6883                   85.5    7e-16   
gb|KFX51692.1|  Upstream activation factor subunit spp27              85.1    9e-16   
gb|KEF52069.1|  hypothetical protein A1O9_12059                       85.5    9e-16   
gb|EME39146.1|  hypothetical protein DOTSEDRAFT_28327                 85.5    9e-16   
ref|XP_005852206.1|  hypothetical protein CHLNCDRAFT_49597            87.0    1e-15   
ref|XP_007681798.1|  hypothetical protein BAUCODRAFT_127412           85.1    1e-15   
dbj|GAM43293.1|  SWIB/MDM2 domain protein                             85.1    1e-15   
gb|ESA19797.1|  hypothetical protein GLOINDRAFT_133123                86.3    1e-15   
gb|KEZ46342.1|  hypothetical protein SAPIO_CDS0646                    84.7    1e-15   
gb|EMF09869.1|  SWIB-domain-containing protein                        84.7    1e-15   
ref|XP_007274591.1|  swib mdm2 domain protein                         84.3    1e-15   
emb|CEF86758.1|  unnamed protein product                              84.0    1e-15   
gb|KIW30635.1|  hypothetical protein PV07_06363                       84.7    1e-15   
gb|KIW96573.1|  hypothetical protein Z519_01964                       84.3    2e-15   
gb|KIW72639.1|  hypothetical protein PV04_00819                       84.3    2e-15   
ref|XP_009255897.1|  hypothetical protein FPSE_04504                  84.0    2e-15   
ref|XP_007750620.1|  hypothetical protein A1O5_11860                  84.3    2e-15   
ref|XP_011324362.1|  hypothetical protein FGSG_12808                  84.0    2e-15   
gb|ACO12370.1|  YMR233W                                               83.6    2e-15   
gb|EPS29571.1|  hypothetical protein PDE_04521                        84.0    2e-15   
gb|EWG44839.1|  hypothetical protein FVEG_05817                       83.6    3e-15   
gb|KEQ83973.1|  SWIB-domain-containing protein                        83.6    3e-15   
gb|KIL93041.1|  hypothetical protein FAVG1_04222                      83.2    4e-15   
ref|XP_002482714.1|  SWIB/MDM2 domain protein                         83.2    4e-15   
ref|NP_588345.1|  RNA polymerase I upstream activation factor com...  82.4    4e-15   
gb|KIV94557.1|  hypothetical protein PV10_02312                       82.8    5e-15   
ref|XP_007847070.1|  swib mdm2 domain protein                         82.8    5e-15   
emb|CCT65051.1|  probable UAF30-subunit of RNA polymerase I trans...  82.8    5e-15   
gb|EGU86688.1|  hypothetical protein FOXB_02794                       82.8    6e-15   
gb|KEY67052.1|  hypothetical protein S7711_04732                      82.8    6e-15   
gb|ETS04858.1|  SWIB/MDM2 domain protein                              82.4    7e-15   
gb|KIJ51307.1|  hypothetical protein M422DRAFT_74231                  82.8    7e-15   
ref|XP_009227214.1|  hypothetical protein GGTG_11070                  82.8    7e-15   
ref|XP_002585358.1|  conserved hypothetical protein                   82.4    7e-15   
gb|KKA16376.1|  DNA topoisomerase                                     82.4    7e-15   
ref|XP_006672037.1|  SWIB/MDM2 domain protein                         82.4    8e-15   
ref|XP_008599094.1|  DEK C terminal domain-containing protein         82.4    8e-15   
ref|XP_010275139.1|  PREDICTED: upstream activation factor subuni...  79.3    8e-15   
gb|KGQ06922.1|  Upstream activation factor subunit spp27              82.4    9e-15   
ref|XP_007003955.1|  hypothetical protein TREMEDRAFT_38764            82.8    9e-15   
gb|EMS52106.1|  Upstream activation factor subunit UAF30              79.0    9e-15   
ref|XP_002148429.1|  C2H2 finger domain protein, putative             85.1    1e-14   
gb|KIW50752.1|  hypothetical protein PV05_09540                       82.0    1e-14   
gb|EYU27179.1|  hypothetical protein MIMGU_mgv1a016089mg              79.7    1e-14   
ref|XP_005537000.1|  hypothetical protein, conserved                  84.0    1e-14   
gb|EPY51368.1|  RNA polymerase I upstream activation factor compl...  81.6    1e-14   
ref|XP_008719338.1|  hypothetical protein HMPREF1541_06787            82.4    1e-14   
gb|EKC98869.1|  hypothetical protein A1Q2_06840                       81.3    1e-14   
ref|XP_001904978.1|  hypothetical protein                             81.6    1e-14   
ref|XP_001214067.1|  conserved hypothetical protein                   84.7    1e-14   
gb|EJT49862.1|  hypothetical protein A1Q1_01014                       81.3    1e-14   
emb|CDY53042.1|  BnaC03g73910D                                        79.7    1e-14   
gb|ENH66657.1|  Upstream activation factor subunit spp27              81.3    1e-14   
ref|XP_007591595.1|  DEK C terminal domain-containing protein         82.8    2e-14   
gb|KDN71176.1|  putative DEK C terminal domain-containing protein     81.3    2e-14   
gb|EHK17858.1|  hypothetical protein TRIVIDRAFT_80752                 81.3    2e-14   
ref|XP_011120434.1|  hypothetical protein AOL_s00054g816              81.6    2e-14   
gb|KJX92079.1|  SWIB/MDM2 domain-containing protein                   81.6    2e-14   
ref|XP_007787582.1|  hypothetical protein EPUS_04835                  81.3    2e-14   
gb|EIE91885.1|  hypothetical protein RO3G_16596                       79.3    2e-14   
ref|XP_003064172.1|  high mobility group family B protein             81.3    2e-14   
emb|CCE30192.1|  probable UAF30-subunit of RNA polymerase I trans...  81.3    2e-14   
ref|XP_002173939.2|  RNA polymerase I upstream activation factor ...  81.3    2e-14   
ref|XP_776513.1|  hypothetical protein CNBC4390                       80.9    2e-14   
ref|XP_001265449.1|  SWIB/MDM2 domain protein                         81.6    2e-14   
gb|EQK99895.1|  SWIB/MDM2 domain protein                              77.0    2e-14   
gb|KIX00154.1|  hypothetical protein Z518_10291                       81.3    2e-14   
gb|EGC49170.1|  SWIB/MDM2 domain-containing protein                   81.3    2e-14   
ref|XP_569575.1|  hypothetical protein                                80.9    2e-14   
emb|CCF34198.1|  DEK C terminal domain-containing protein             80.9    3e-14   
ref|XP_003654228.1|  hypothetical protein THITE_2117056               80.9    3e-14   
gb|KEQ91034.1|  hypothetical protein AUEXF2481DRAFT_8835              81.3    3e-14   
ref|XP_003850719.1|  hypothetical protein MYCGRDRAFT_100770           81.3    3e-14   
emb|CEJ93736.1|  Putative SWIB/MDM2 domain protein                    80.5    3e-14   
gb|KIX93318.1|  hypothetical protein Z520_10961                       83.6    3e-14   
gb|EDP55545.1|  SWIB/MDM2 domain protein                              80.9    3e-14   
ref|XP_749952.2|  SWIB/MDM2 domain protein                            80.9    3e-14   
ref|XP_003045696.1|  hypothetical protein NECHADRAFT_33302            83.6    3e-14   
ref|XP_007793512.1|  putative swib mdm2 domain protein                80.5    3e-14   
ref|XP_007928856.1|  hypothetical protein MYCFIDRAFT_56639            80.5    4e-14   
gb|ESZ98247.1|  hypothetical protein SBOR_1343                        80.5    4e-14   
gb|KJZ80087.1|  hypothetical protein HIM_00801                        80.5    4e-14   
emb|CAK37099.1|  unnamed protein product                              80.5    4e-14   
ref|XP_009130373.1|  PREDICTED: protein TRI1                          78.2    4e-14   
ref|XP_001389048.2|  SWIB/MDM2 domain protein                         80.5    4e-14   
ref|XP_003665329.1|  hypothetical protein MYCTH_2308924               80.1    4e-14   
ref|XP_001269940.1|  SWIB/MDM2 domain protein                         80.5    5e-14   
ref|XP_003708728.1|  hypothetical protein MGG_01988                   80.5    5e-14   
gb|KIV78456.1|  hypothetical protein PV11_10175                       80.1    5e-14   
gb|KDQ19962.1|  hypothetical protein BOTBODRAFT_51325                 80.1    5e-14   
emb|CEP60635.1|  LALA0S01e15478g1_1                                   79.0    6e-14   
ref|XP_010549735.1|  PREDICTED: protein TRI1                          77.4    6e-14   
gb|EPX73721.1|  RNA polymerase I upstream activation factor compl...  79.7    6e-14   
ref|XP_006408288.1|  hypothetical protein EUTSA_v10021710mg           77.8    6e-14   
emb|CDY50651.1|  BnaC05g48150D                                        77.8    6e-14   
dbj|GAD93942.1|  SWIB/MDM2 domain protein                             79.7    7e-14   
gb|EFW13318.1|  hypothetical protein CPSG_10065                       79.7    8e-14   
ref|XP_003071966.1|  SWIB/MDM2 domain containing protein              78.6    8e-14   
ref|XP_008085472.1|  SWIB/MDM2                                        79.7    8e-14   
ref|XP_007828881.1|  hypothetical protein PFICI_02109                 79.7    8e-14   
ref|XP_002508564.1|  animal specific-mbd4, 5 and 6                    79.7    9e-14   
gb|EGE01453.1|  SWIB/MDM2 domain-containing protein                   79.3    1e-13   
emb|CDS07643.1|  hypothetical protein LRAMOSA01592                    81.3    1e-13   
gb|EGE00567.1|  hypothetical protein TESG_07838                       79.0    1e-13   
gb|KJK62981.1|  hypothetical protein P875_00034049                    79.3    1e-13   
emb|CDH59650.1|  hypothetical protein RO3G_16596                      80.9    1e-13   
gb|KFH41954.1|  Upstream activation factor subunit-like protein       79.0    1e-13   
ref|XP_001549977.1|  hypothetical protein BC1G_11869                  79.0    1e-13   
ref|XP_002373059.1|  SWIB/MDM2 domain protein                         79.0    1e-13   
dbj|BAE55899.1|  unnamed protein product                              79.0    1e-13   
gb|EPZ36176.1|  SWIB/MDM2 domain-containing protein                   78.2    1e-13   
gb|EZG09214.1|  hypothetical protein H106_01751                       79.0    1e-13   
ref|XP_003232670.1|  SWIB/MDM2 domain-containing protein              78.6    2e-13   
emb|CEP17977.1|  hypothetical protein                                 80.9    2e-13   
ref|XP_006437339.1|  hypothetical protein CICLE_v10033040mg           76.3    2e-13   
ref|XP_003351341.1|  hypothetical protein SMAC_03646                  78.6    2e-13   
gb|KIH91971.1|  upstream activation factor subunit UAF30              79.0    2e-13   
gb|KDO72266.1|  hypothetical protein CISIN_1g048564mg                 75.5    2e-13   
ref|XP_657964.1|  hypothetical protein AN0360.2                       78.6    2e-13   
ref|XP_006430903.1|  hypothetical protein CICLE_v10013159mg           75.5    2e-13   
ref|XP_009782755.1|  PREDICTED: upstream activation factor subuni...  75.5    2e-13   
ref|XP_001226234.1|  hypothetical protein CHGG_10967                  78.6    3e-13   
gb|EJK56158.1|  hypothetical protein THAOC_24008                      79.3    3e-13   
ref|XP_001947263.3|  PREDICTED: LOW QUALITY PROTEIN: nucleolin-like   77.8    3e-13   
dbj|GAA83554.1|  C2H2 finger domain protein                           80.5    3e-13   
emb|CCX32309.1|  Similar to Upstream activation factor subunit sp...  79.3    3e-13   
ref|XP_002553667.1|  KLTH0E04246p                                     77.0    3e-13   
gb|KIR43577.1|  upstream activation factor subunit UAF30              77.4    3e-13   
gb|KIR67840.1|  upstream activation factor subunit UAF30              77.4    3e-13   
emb|CDS07389.1|  hypothetical protein LRAMOSA01338                    79.0    3e-13   
emb|CDY51761.1|  BnaA05g32850D                                        75.1    4e-13   
ref|XP_001595016.1|  hypothetical protein SS1G_04824                  77.8    4e-13   
gb|KGB77480.1|  upstream activation factor subunit UAF30              77.4    4e-13   
ref|XP_002270166.1|  PREDICTED: upstream activation factor subuni...  75.1    4e-13   
ref|XP_001238943.1|  hypothetical protein CIMG_09965                  77.8    4e-13   
ref|XP_009631043.1|  PREDICTED: uncharacterized protein LOC104120876  76.3    4e-13   
ref|XP_003192826.1|  hypothetical protein CGB_C4270C                  77.4    4e-13   
gb|KIR87135.1|  upstream activation factor subunit UAF30              77.4    4e-13   
gb|KIR56397.1|  upstream activation factor subunit UAF30              77.4    4e-13   



>ref|XP_009774097.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Nicotiana sylvestris]
Length=320

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 161/198 (81%), Gaps = 11/198 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q LV E EL R EVVK+IWAYIRE NLQ+P+ K++I+CDE L  IFR KTIDMF+MN+ L
Sbjct  131  QKLVGESELGRPEVVKKIWAYIREKNLQNPQNKRKILCDEVLSEIFRAKTIDMFQMNKVL  190

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWPI++ED + VKS+ K+R  K+GR+E           EPKQ+EKR    KGGG+GF
Sbjct  191  SKHIWPIDEEDASQVKSSVKKRLPKQGREEALD--------EPKQKEKRH---KGGGSGF  239

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            LAP++LSD+LVKFFG GENAL+R DV+KR+W+YIKENELQDPS+K+ +ICD++L+EL +V
Sbjct  240  LAPVRLSDALVKFFGIGENALTRADVIKRIWQYIKENELQDPSDKKTIICDERLKELFQV  299

Query  423  DSFEGFTMTKLLTAHFIK  370
            DSF GFT+TKLLTAHFIK
Sbjct  300  DSFHGFTVTKLLTAHFIK  317



>ref|XP_004230795.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Solanum lycopersicum]
Length=333

 Score =   269 bits (687),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 163/198 (82%), Gaps = 11/198 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q LV EPEL R EVVK+IWAYIRE NLQ+P+ K++I+CDE L GIF+VK+IDMF+MN+ L
Sbjct  144  QKLVGEPELGRPEVVKKIWAYIREKNLQNPENKRKILCDEVLSGIFQVKSIDMFQMNKVL  203

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP+ +E+ T VK++ K R  KKGR+E       DSD EPKQ+EKRQ   KGGG+GF
Sbjct  204  SKHIWPLNEENGTQVKTSVKRRLPKKGREE-------DSD-EPKQKEKRQ---KGGGSGF  252

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            LAP+QLSD+LVKF G  ENAL R DV+KR+W+YIKENELQDPS+K+ +ICD++L+EL +V
Sbjct  253  LAPVQLSDALVKFLGIDENALPRADVIKRIWQYIKENELQDPSDKKTIICDERLKELFQV  312

Query  423  DSFEGFTMTKLLTAHFIK  370
            DSF GFT+TKLLTAHFIK
Sbjct  313  DSFHGFTVTKLLTAHFIK  330



>ref|XP_006346439.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Solanum tuberosum]
Length=335

 Score =   269 bits (687),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 160/198 (81%), Gaps = 11/198 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q LV EPEL R EVVK+IWAYIRE NLQ+P+ K++I+CDE L GIF+VK+IDMF+MN+ L
Sbjct  146  QKLVGEPELGRPEVVKKIWAYIREKNLQNPENKRKILCDEVLSGIFQVKSIDMFQMNKVL  205

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP+ +E+ T VK++ K R  KKGR+E           EPKQ+EKRQ   KGGG GF
Sbjct  206  SKHIWPLNEENGTQVKTSVKRRLPKKGREEALD--------EPKQKEKRQ---KGGGFGF  254

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            LAP+QLSD+LVKF G GENAL R DV+KR+W+YIKENELQDPS+K+ +ICD++L+EL +V
Sbjct  255  LAPVQLSDALVKFLGIGENALPRADVIKRIWQYIKENELQDPSDKKTIICDERLKELFQV  314

Query  423  DSFEGFTMTKLLTAHFIK  370
            DSF GFT+TKLLTAHFIK
Sbjct  315  DSFHGFTVTKLLTAHFIK  332



>ref|XP_006346438.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Solanum tuberosum]
Length=336

 Score =   269 bits (687),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 160/198 (81%), Gaps = 11/198 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q LV EPEL R EVVK+IWAYIRE NLQ+P+ K++I+CDE L GIF+VK+IDMF+MN+ L
Sbjct  147  QKLVGEPELGRPEVVKKIWAYIREKNLQNPENKRKILCDEVLSGIFQVKSIDMFQMNKVL  206

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP+ +E+ T VK++ K R  KKGR+E           EPKQ+EKRQ   KGGG GF
Sbjct  207  SKHIWPLNEENGTQVKTSVKRRLPKKGREEALD--------EPKQKEKRQ---KGGGFGF  255

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            LAP+QLSD+LVKF G GENAL R DV+KR+W+YIKENELQDPS+K+ +ICD++L+EL +V
Sbjct  256  LAPVQLSDALVKFLGIGENALPRADVIKRIWQYIKENELQDPSDKKTIICDERLKELFQV  315

Query  423  DSFEGFTMTKLLTAHFIK  370
            DSF GFT+TKLLTAHFIK
Sbjct  316  DSFHGFTVTKLLTAHFIK  333



>ref|XP_009629953.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Nicotiana tomentosiformis]
Length=321

 Score =   265 bits (677),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 160/198 (81%), Gaps = 11/198 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q LV E EL R EVVK+IWAYIRE NLQ+P+ K++I+CDE L  IFR KTIDMF+MN+ L
Sbjct  132  QKLVGESELGRPEVVKKIWAYIREKNLQNPQNKRKILCDEVLSEIFRAKTIDMFQMNKVL  191

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWPI++ED + VKS+ K+R  K+GR+E           EPKQ+EKRQ   K GG+GF
Sbjct  192  SKHIWPIDEEDASQVKSSVKKRLPKQGREEALD--------EPKQKEKRQ---KRGGSGF  240

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            LAP++LSD+LVKFFG GE AL+R DV+KR+W+YIKENELQDPS+K+ +ICD++L+EL +V
Sbjct  241  LAPVRLSDALVKFFGNGEKALTRADVIKRIWQYIKENELQDPSDKKTIICDERLKELFQV  300

Query  423  DSFEGFTMTKLLTAHFIK  370
            DSF GFT+TKLLTAHFIK
Sbjct  301  DSFHGFTVTKLLTAHFIK  318



>ref|XP_010315240.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Solanum lycopersicum]
Length=331

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 160/198 (81%), Gaps = 13/198 (7%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q LV EPEL R EVVK+IWAYIRE NLQ+P+ K++I+CDE L GIF+VK+IDMF+MN+ L
Sbjct  144  QKLVGEPELGRPEVVKKIWAYIREKNLQNPENKRKILCDEVLSGIFQVKSIDMFQMNKVL  203

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP+ +E+ T VK++ K R  KKGR+E           EPKQ+EKRQ   KGGG+GF
Sbjct  204  SKHIWPLNEENGTQVKTSVKRRLPKKGREED----------EPKQKEKRQ---KGGGSGF  250

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            LAP+QLSD+LVKF G  ENAL R DV+KR+W+YIKENELQDPS+K+ +ICD++L+EL +V
Sbjct  251  LAPVQLSDALVKFLGIDENALPRADVIKRIWQYIKENELQDPSDKKTIICDERLKELFQV  310

Query  423  DSFEGFTMTKLLTAHFIK  370
            DSF GFT+TKLLTAHFIK
Sbjct  311  DSFHGFTVTKLLTAHFIK  328



>gb|KHN42058.1| Upstream activation factor subunit spp27 [Glycine soja]
Length=188

 Score =   259 bits (662),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 157/193 (81%), Gaps = 10/193 (5%)
 Frame = -2

Query  945  PELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWP  766
            PE+ARTEVVK++WAYIRE NLQDP  ++ IICDE L  +F V +I+MF+MN+ LSKHIWP
Sbjct  4    PEMARTEVVKQLWAYIREKNLQDPNNRRNIICDERLRSLFNVNSINMFQMNKALSKHIWP  63

Query  765  IEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQL  586
            ++ +DV  VKSTPKE+Q+K+ RD+       DSD EPK++EKRQ+G  GG +GFLAP+QL
Sbjct  64   LDSDDVVQVKSTPKEKQKKQERDD-------DSD-EPKKKEKRQKG--GGKSGFLAPLQL  113

Query  585  SDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGF  406
            SD+LV F GTGE+ L+R DV+KRMW YIK N LQDPS+KR++ICD+KL+EL +VD+F GF
Sbjct  114  SDALVNFLGTGESELARTDVIKRMWDYIKGNNLQDPSDKRKIICDEKLKELFDVDTFTGF  173

Query  405  TMTKLLTAHFIKT  367
            T+TKLL  HFIKT
Sbjct  174  TVTKLLAPHFIKT  186


 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -2

Query  555  GENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            G   ++R +VVK++W YI+E  LQDP+N+R +ICD++LR L  V+S   F M K L+ H 
Sbjct  2    GAPEMARTEVVKQLWAYIREKNLQDPNNRRNIICDERLRSLFNVNSINMFQMNKALSKHI  61


 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHI  772
            E ELART+V+KR+W YI+ NNLQDP  K++IICDE L  +F V T   F + + L+ H 
Sbjct  125  ESELARTDVIKRMWDYIKGNNLQDPSDKRKIICDEKLKELFDVDTFTGFTVTKLLAPHF  183



>ref|XP_007042350.1| SWIB complex BAF60b domain-containing protein, putative [Theobroma 
cacao]
 gb|EOX98181.1| SWIB complex BAF60b domain-containing protein, putative [Theobroma 
cacao]
Length=472

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 156/198 (79%), Gaps = 12/198 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  + EPELARTEVVKR+W YIRE NLQDPK ++ I+CD++L  IFRV TI+MF+MN+ L
Sbjct  284  QAFIGEPELARTEVVKRLWTYIREKNLQDPKNRRNILCDQSLHAIFRVNTINMFQMNKAL  343

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP+ +ED     ST  ER+ K+GR+           FEPKQ+EKRQ   K G +GF
Sbjct  344  SKHIWPLNEEDAQ-ADSTKIERKSKQGRER--------GPFEPKQKEKRQ---KKGASGF  391

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            LAP+ LSD+LV FFGTGENALSR DVVKRMW+YIK+N+LQDPS+KRR++CDDKL+ELLEV
Sbjct  392  LAPLPLSDALVNFFGTGENALSRADVVKRMWEYIKQNDLQDPSDKRRILCDDKLKELLEV  451

Query  423  DSFEGFTMTKLLTAHFIK  370
            DSF GFT+ KLLT HFIK
Sbjct  452  DSFNGFTIPKLLTTHFIK  469


 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/232 (38%), Positives = 121/232 (52%), Gaps = 42/232 (18%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V + EL RTEVVK++W YIRENNLQDPK K+ IICDE+L  IFRV +I+MF+MN+ L
Sbjct  122  QKVVGQSELPRTEVVKKLWLYIRENNLQDPKNKRNIICDESLRAIFRVNSINMFQMNKAL  181

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDF-------------------  661
            +KHIWP+  ED    ++   E + +   D V  D+ +  +                    
Sbjct  182  TKHIWPLSAED----ENVKHEMKCEDSHDSVSVDAKNAEEEEEEEEEEREEEEEEEEVEE  237

Query  660  -----------------EPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRG  532
                             + K+  K  + +K  G GF     LS  L  F G  E  L+R 
Sbjct  238  EEEEEQEPEQEGNARGSKNKRSAKVDKDVKRRGGGFTKLCSLSPQLQAFIGEPE--LART  295

Query  531  DVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            +VVKR+W YI+E  LQDP N+R ++CD  L  +  V++   F M K L+ H 
Sbjct  296  EVVKRLWTYIREKNLQDPKNRRNILCDQSLHAIFRVNTINMFQMNKALSKHI  347


 Score = 60.8 bits (146),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E  L+R +VVKR+W YI++N+LQDP  K+RI+CD+ L  +  V + + F + + L+ H  
Sbjct  409  ENALSRADVVKRMWEYIKQNDLQDPSDKRRILCDDKLKELLEVDSFNGFTIPKLLTTHFI  468

Query  768  PIEK  757
             +E+
Sbjct  469  KMEQ  472



>ref|XP_009774096.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Nicotiana sylvestris]
Length=327

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 161/206 (78%), Gaps = 19/206 (9%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q LV E EL R EVVK+IWAYIRE NLQ+P+ K++I+CDE L  IFR KTIDMF+MN+ L
Sbjct  130  QKLVGESELGRPEVVKKIWAYIREKNLQNPQNKRKILCDEVLSEIFRAKTIDMFQMNKVL  189

Query  783  SKHIWPIEKED--------VTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRG  628
            SKHIWPI++ED         + VKS+ K+R  K+GR+E           EPKQ+EKR   
Sbjct  190  SKHIWPIDEEDGSFPLTHAASQVKSSVKKRLPKQGREEALD--------EPKQKEKRH--  239

Query  627  LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDD  448
             KGGG+GFLAP++LSD+LVKFFG GENAL+R DV+KR+W+YIKENELQDPS+K+ +ICD+
Sbjct  240  -KGGGSGFLAPVRLSDALVKFFGIGENALTRADVIKRIWQYIKENELQDPSDKKTIICDE  298

Query  447  KLRELLEVDSFEGFTMTKLLTAHFIK  370
            +L+EL +VDSF GFT+TKLLTAHFIK
Sbjct  299  RLKELFQVDSFHGFTVTKLLTAHFIK  324



>ref|XP_009774095.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Nicotiana sylvestris]
Length=328

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 161/206 (78%), Gaps = 19/206 (9%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q LV E EL R EVVK+IWAYIRE NLQ+P+ K++I+CDE L  IFR KTIDMF+MN+ L
Sbjct  131  QKLVGESELGRPEVVKKIWAYIREKNLQNPQNKRKILCDEVLSEIFRAKTIDMFQMNKVL  190

Query  783  SKHIWPIEKED--------VTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRG  628
            SKHIWPI++ED         + VKS+ K+R  K+GR+E           EPKQ+EKR   
Sbjct  191  SKHIWPIDEEDGSFPLTHAASQVKSSVKKRLPKQGREEALD--------EPKQKEKRH--  240

Query  627  LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDD  448
             KGGG+GFLAP++LSD+LVKFFG GENAL+R DV+KR+W+YIKENELQDPS+K+ +ICD+
Sbjct  241  -KGGGSGFLAPVRLSDALVKFFGIGENALTRADVIKRIWQYIKENELQDPSDKKTIICDE  299

Query  447  KLRELLEVDSFEGFTMTKLLTAHFIK  370
            +L+EL +VDSF GFT+TKLLTAHFIK
Sbjct  300  RLKELFQVDSFHGFTVTKLLTAHFIK  325



>ref|XP_010255131.1| PREDICTED: upstream activation factor subunit spp27-like [Nelumbo 
nucifera]
Length=323

 Score =   261 bits (666),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 158/199 (79%), Gaps = 12/199 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V  PE+ARTEVVK++WAYIRENNLQDP  K+ IICDETL  +FRV +I+MF+MN+ L
Sbjct  135  QKFVGVPEMARTEVVKQLWAYIRENNLQDPNNKRNIICDETLRSLFRVDSINMFQMNKAL  194

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP++ ED   VKST KE+Q+K+ R E       D + EPKQ+EKRQ   KGG +GF
Sbjct  195  SKHIWPLDTEDAP-VKSTQKEKQQKQERKE-------DPN-EPKQKEKRQ---KGGNSGF  242

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            LAP+ LSD+LVKF GTGE++LSR  VVKRMW+YIK+N LQDPS+KRR+ICD+KL+EL EV
Sbjct  243  LAPLPLSDALVKFLGTGESSLSRAGVVKRMWEYIKQNNLQDPSDKRRIICDEKLKELFEV  302

Query  423  DSFEGFTMTKLLTAHFIKT  367
            DSF GFT+ KLL  HFIKT
Sbjct  303  DSFHGFTVPKLLATHFIKT  321


 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E  L+R  VVKR+W YI++NNLQDP  K+RIICDE L  +F V +   F + + L+ H  
Sbjct  260  ESSLSRAGVVKRMWEYIKQNNLQDPSDKRRIICDEKLKELFEVDSFHGFTVPKLLATHFI  319

Query  768  PIEK  757
              E+
Sbjct  320  KTEQ  323



>ref|XP_003517282.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
1 [Glycine max]
Length=337

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 158/199 (79%), Gaps = 10/199 (5%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  ++ PE+ARTEVVK++W YIRE NLQDP  ++ IICDE L  +F V +I+MF+MN+ L
Sbjct  147  QEFMEAPEMARTEVVKQLWVYIREKNLQDPNNRRNIICDERLRSLFNVNSINMFQMNKAL  206

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP+E +DV  VKSTPKE+Q+K+ RD+       DSD E K++EKRQ+G  GG +GF
Sbjct  207  SKHIWPLESDDVVQVKSTPKEKQKKQERDD-------DSD-EAKKKEKRQKG--GGKSGF  256

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            LAP+QLSD+LV F GTGE+ L+R DV+KRMW YIK N LQDPS+KR++ICD+KL+EL +V
Sbjct  257  LAPLQLSDALVNFLGTGESELARTDVIKRMWDYIKGNNLQDPSDKRKIICDEKLKELFDV  316

Query  423  DSFEGFTMTKLLTAHFIKT  367
            DSF GFT+TKLL  HFIKT
Sbjct  317  DSFTGFTVTKLLAPHFIKT  335


 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E ELART+V+KR+W YI+ NNLQDP  K++IICDE L  +F V +   F + + L+ H  
Sbjct  274  ESELARTDVIKRMWDYIKGNNLQDPSDKRKIICDEKLKELFDVDSFTGFTVTKLLAPHFI  333

Query  768  PIEK  757
              E+
Sbjct  334  KTEQ  337



>ref|XP_003537360.1| PREDICTED: upstream activation factor subunit spp27-like [Glycine 
max]
Length=346

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 159/199 (80%), Gaps = 10/199 (5%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  +  PE+ARTEVVK++WAYIRE NLQDP  ++ IICDE L  +F V +I+MF+MN+ L
Sbjct  156  QEFMGAPEMARTEVVKQLWAYIREKNLQDPNNRRNIICDERLRSLFNVNSINMFQMNKAL  215

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP++ +DV  VKSTPKE+Q+K+ RD+       DSD EPK++EKRQ+G  GG +GF
Sbjct  216  SKHIWPLDSDDVVQVKSTPKEKQKKQERDD-------DSD-EPKKKEKRQKG--GGKSGF  265

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            LAP+QLSD+LV F GTGE+ L+R DV+KRMW YIK N LQDPS+KR++ICD+KL+EL +V
Sbjct  266  LAPLQLSDALVNFLGTGESELARTDVIKRMWDYIKGNNLQDPSDKRKIICDEKLKELFDV  325

Query  423  DSFEGFTMTKLLTAHFIKT  367
            D+F GFT+TKLL  HFIKT
Sbjct  326  DTFTGFTVTKLLAPHFIKT  344


 Score = 69.3 bits (168),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E ELART+V+KR+W YI+ NNLQDP  K++IICDE L  +F V T   F + + L+ H  
Sbjct  283  ESELARTDVIKRMWDYIKGNNLQDPSDKRKIICDEKLKELFDVDTFTGFTVTKLLAPHFI  342

Query  768  PIEK  757
              E+
Sbjct  343  KTEQ  346



>ref|XP_007156836.1| hypothetical protein PHAVU_002G021500g [Phaseolus vulgaris]
 gb|ESW28830.1| hypothetical protein PHAVU_002G021500g [Phaseolus vulgaris]
Length=341

 Score =   258 bits (660),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 155/199 (78%), Gaps = 10/199 (5%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  +  PE+ARTEVVK++W YI+E NLQDP   + IICDE L  +F V +I+MF+MN+ L
Sbjct  150  QEFMGAPEMARTEVVKQLWVYIKEKNLQDPSNGRNIICDERLRALFNVNSINMFQMNKVL  209

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP++ +DV  VKSTPKE+Q+K  RD+       DSD EPK +EKRQ+G  GG +GF
Sbjct  210  SKHIWPLDSDDVVQVKSTPKEKQKKHERDD-------DSD-EPKGKEKRQKG--GGKSGF  259

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            LAP+QLSD+LV F GTGE+ LSR DV+KRMW YIK N LQDPSNKR+++CD+KL+EL +V
Sbjct  260  LAPLQLSDALVNFLGTGESELSRTDVIKRMWDYIKGNNLQDPSNKRQILCDEKLKELFDV  319

Query  423  DSFEGFTMTKLLTAHFIKT  367
            DSF GFT+TKLL  HFIKT
Sbjct  320  DSFNGFTVTKLLAPHFIKT  338



>ref|XP_007156837.1| hypothetical protein PHAVU_002G021500g [Phaseolus vulgaris]
 gb|ESW28831.1| hypothetical protein PHAVU_002G021500g [Phaseolus vulgaris]
Length=340

 Score =   258 bits (660),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 155/199 (78%), Gaps = 10/199 (5%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  +  PE+ARTEVVK++W YI+E NLQDP   + IICDE L  +F V +I+MF+MN+ L
Sbjct  150  QEFMGAPEMARTEVVKQLWVYIKEKNLQDPSNGRNIICDERLRALFNVNSINMFQMNKVL  209

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP++ +DV  VKSTPKE+Q+K  RD+       DSD EPK +EKRQ+G  GG +GF
Sbjct  210  SKHIWPLDSDDVVQVKSTPKEKQKKHERDD-------DSD-EPKGKEKRQKG--GGKSGF  259

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            LAP+QLSD+LV F GTGE+ LSR DV+KRMW YIK N LQDPSNKR+++CD+KL+EL +V
Sbjct  260  LAPLQLSDALVNFLGTGESELSRTDVIKRMWDYIKGNNLQDPSNKRQILCDEKLKELFDV  319

Query  423  DSFEGFTMTKLLTAHFIKT  367
            DSF GFT+TKLL  HFIKT
Sbjct  320  DSFNGFTVTKLLAPHFIKT  338



>ref|XP_009629952.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Nicotiana tomentosiformis]
Length=328

 Score =   258 bits (658),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 160/206 (78%), Gaps = 19/206 (9%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q LV E EL R EVVK+IWAYIRE NLQ+P+ K++I+CDE L  IFR KTIDMF+MN+ L
Sbjct  131  QKLVGESELGRPEVVKKIWAYIREKNLQNPQNKRKILCDEVLSEIFRAKTIDMFQMNKVL  190

Query  783  SKHIWPIEKED--------VTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRG  628
            SKHIWPI++ED         + VKS+ K+R  K+GR+E           EPKQ+EKRQ  
Sbjct  191  SKHIWPIDEEDGSFSLTHPASQVKSSVKKRLPKQGREEALD--------EPKQKEKRQ--  240

Query  627  LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDD  448
             K GG+GFLAP++LSD+LVKFFG GE AL+R DV+KR+W+YIKENELQDPS+K+ +ICD+
Sbjct  241  -KRGGSGFLAPVRLSDALVKFFGNGEKALTRADVIKRIWQYIKENELQDPSDKKTIICDE  299

Query  447  KLRELLEVDSFEGFTMTKLLTAHFIK  370
            +L+EL +VDSF GFT+TKLLTAHFIK
Sbjct  300  RLKELFQVDSFHGFTVTKLLTAHFIK  325



>ref|XP_009629951.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Nicotiana tomentosiformis]
Length=329

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 160/206 (78%), Gaps = 19/206 (9%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q LV E EL R EVVK+IWAYIRE NLQ+P+ K++I+CDE L  IFR KTIDMF+MN+ L
Sbjct  132  QKLVGESELGRPEVVKKIWAYIREKNLQNPQNKRKILCDEVLSEIFRAKTIDMFQMNKVL  191

Query  783  SKHIWPIEKED--------VTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRG  628
            SKHIWPI++ED         + VKS+ K+R  K+GR+E           EPKQ+EKRQ  
Sbjct  192  SKHIWPIDEEDGSFSLTHPASQVKSSVKKRLPKQGREEALD--------EPKQKEKRQ--  241

Query  627  LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDD  448
             K GG+GFLAP++LSD+LVKFFG GE AL+R DV+KR+W+YIKENELQDPS+K+ +ICD+
Sbjct  242  -KRGGSGFLAPVRLSDALVKFFGNGEKALTRADVIKRIWQYIKENELQDPSDKKTIICDE  300

Query  447  KLRELLEVDSFEGFTMTKLLTAHFIK  370
            +L+EL +VDSF GFT+TKLLTAHFIK
Sbjct  301  RLKELFQVDSFHGFTVTKLLTAHFIK  326



>ref|XP_007047160.1| SWIB complex BAF60b domain-containing protein, putative isoform 
1 [Theobroma cacao]
 gb|EOX91317.1| SWIB complex BAF60b domain-containing protein, putative isoform 
1 [Theobroma cacao]
Length=322

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 157/199 (79%), Gaps = 15/199 (8%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q LV  P LARTEVVK+IWAYIRE NLQDP  KK IICDE LL +F V++IDMF+MN+ L
Sbjct  139  QELVGVPALARTEVVKQIWAYIREKNLQDPLNKKNIICDEPLLALFGVRSIDMFQMNKAL  198

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP++ ++V  VKST +E+QRK  R+E       D D EPK++EKRQ+G       F
Sbjct  199  SKHIWPLDSDEVVSVKSTEREKQRKHVREE-------DPD-EPKRKEKRQKG-------F  243

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            LAP+QLSD+LVKF GTGE+ L+R DV+KRMW YIKEN LQDPS+KR+VICD+KL+EL EV
Sbjct  244  LAPLQLSDALVKFLGTGESVLTRADVIKRMWDYIKENNLQDPSDKRKVICDEKLKELFEV  303

Query  423  DSFEGFTMTKLLTAHFIKT  367
            ++F GFT++KLL AHF+KT
Sbjct  304  ETFTGFTVSKLLAAHFLKT  322



>gb|KDO79317.1| hypothetical protein CISIN_1g0196442mg, partial [Citrus sinensis]
Length=213

 Score =   251 bits (640),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 155/199 (78%), Gaps = 11/199 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  +   ELARTEVVK++WAYIRE +LQDP  ++ I+CDE L  +F V TI+MF+MN+ L
Sbjct  26   QEFIGVTELARTEVVKQLWAYIREKDLQDPNNRRNIVCDERLRALFGVDTINMFQMNKAL  85

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP++ +DV  VKSTPKE+QRK+ R E       D D EP ++EKRQ   KGG +GF
Sbjct  86   SKHIWPLDSDDVISVKSTPKEKQRKQERTE-------DLD-EPTRKEKRQ---KGGKSGF  134

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            LAP+QLSD+L+KF GTGE+AL R DV+KRMW YIKE  LQDPS+KRR+ICD+KL+EL +V
Sbjct  135  LAPLQLSDALIKFLGTGESALPRSDVIKRMWDYIKEKNLQDPSDKRRIICDEKLKELFDV  194

Query  423  DSFEGFTMTKLLTAHFIKT  367
            D+F GFT+TKLL  HF+KT
Sbjct  195  DTFNGFTVTKLLVVHFLKT  213



>ref|XP_002522329.1| Upstream activation factor subunit UAF30, putative [Ricinus communis]
 gb|EEF40013.1| Upstream activation factor subunit UAF30, putative [Ricinus communis]
Length=322

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 159/199 (80%), Gaps = 11/199 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q L   P+LARTEVVK++W++IRE  LQDP  ++ IICDE    +F V +IDMF+MN+ L
Sbjct  135  QELTGVPQLARTEVVKQLWSHIREKKLQDPNNRRNIICDEPFRALFGVDSIDMFQMNKVL  194

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP++ + V   KS PKE+QRK+ R+E       + D EPK++EKR++G K   +GF
Sbjct  195  SKHIWPLDSDGVVPAKSEPKEKQRKQEREE-------EPD-EPKRKEKRRKGEK---SGF  243

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            LAP+QLSD+L+KFFGTGENALSR DV+KRMW+YIK+N LQDPS+KRR+ICD+KL+EL +V
Sbjct  244  LAPLQLSDALIKFFGTGENALSRADVIKRMWEYIKQNNLQDPSDKRRIICDEKLKELFDV  303

Query  423  DSFEGFTMTKLLTAHFIKT  367
            D+F GFT+TKLL+AHF+KT
Sbjct  304  DTFNGFTVTKLLSAHFVKT  322



>ref|XP_008792695.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Phoenix dactylifera]
 ref|XP_008792696.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Phoenix dactylifera]
Length=319

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 148/201 (74%), Gaps = 22/201 (11%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V E ELARTEVVK++WAYIR+NNLQDP  KK+IICDE L  IF V TIDMF+MN+ L
Sbjct  138  QQFVGESELARTEVVKKLWAYIRQNNLQDPNNKKKIICDERLQSIFNVSTIDMFQMNKAL  197

Query  783  SKHIWPIEKED--VTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGT  610
            SKHIWP+  E    T+VKS PKE+Q KK R                 E KRQ   KGG +
Sbjct  198  SKHIWPLNSEGGPSTVVKSEPKEKQHKKER-----------------EGKRQ---KGGSS  237

Query  609  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  430
            G LAP+ LSD LVKF GTGENALSR DVVKRMW+YIK+N LQDP++KR +ICD KL+ELL
Sbjct  238  GLLAPLPLSDDLVKFIGTGENALSRSDVVKRMWEYIKQNNLQDPADKRNIICDKKLKELL  297

Query  429  EVDSFEGFTMTKLLTAHFIKT  367
            +VDSF GFT++KLL AHFIKT
Sbjct  298  KVDSFRGFTVSKLLVAHFIKT  318



>ref|XP_004511971.1| PREDICTED: upstream activation factor subunit spp27-like [Cicer 
arietinum]
Length=352

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 157/200 (79%), Gaps = 12/200 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V  PE+ARTEVVK++WAYIRE NLQDP  ++ I+CDE L  +F V TI+MF+MN+ L
Sbjct  162  QEFVGAPEMARTEVVKQLWAYIREKNLQDPTNRRNIVCDEPLRALFGVNTINMFQMNKVL  221

Query  783  SKHIWPIEKEDVTLVK-STPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTG  607
            +KHIWP++ +DV  VK S PKE+Q+K+ R++       DSD EP+++EKRQ   KGGG G
Sbjct  222  TKHIWPLDSDDVVPVKKSAPKEKQKKQERED-------DSD-EPQRKEKRQ---KGGGKG  270

Query  606  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  427
            FLAP+QLSD+LVKF GTGE+ LSR DV+KRMW YIK N LQDPS+KR V+CD+KL+EL +
Sbjct  271  FLAPLQLSDALVKFLGTGESELSRSDVIKRMWDYIKGNNLQDPSDKRNVLCDEKLKELFD  330

Query  426  VDSFEGFTMTKLLTAHFIKT  367
            +DSF GFT++KLL  HFIKT
Sbjct  331  IDSFTGFTVSKLLAPHFIKT  350


 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E EL+R++V+KR+W YI+ NNLQDP  K+ ++CDE L  +F + +   F +++ L+ H  
Sbjct  289  ESELSRSDVIKRMWDYIKGNNLQDPSDKRNVLCDEKLKELFDIDSFTGFTVSKLLAPHFI  348

Query  768  PIEK  757
              E+
Sbjct  349  KTEQ  352


 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 60/117 (51%), Gaps = 26/117 (22%)
 Frame = -2

Query  654  KQEEKRQRG------------------------LKGGGTGFLAPIQLSDSLVKFFGTGEN  547
            ++EEK++R                          K GG GF     LS  L +F G  E 
Sbjct  111  EEEEKKERPKRSNSVKKKKKNKERSNKLGNEVVKKKGGGGFCKLCSLSPQLQEFVGAPE-  169

Query  546  ALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
             ++R +VVK++W YI+E  LQDP+N+R ++CD+ LR L  V++   F M K+LT H 
Sbjct  170  -MARTEVVKQLWAYIREKNLQDPTNRRNIVCDEPLRALFGVNTINMFQMNKVLTKHI  225



>ref|XP_008792693.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X1 [Phoenix dactylifera]
Length=337

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 148/201 (74%), Gaps = 22/201 (11%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V E ELARTEVVK++WAYIR+NNLQDP  KK+IICDE L  IF V TIDMF+MN+ L
Sbjct  138  QQFVGESELARTEVVKKLWAYIRQNNLQDPNNKKKIICDERLQSIFNVSTIDMFQMNKAL  197

Query  783  SKHIWPIEKED--VTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGT  610
            SKHIWP+  E    T+VKS PKE+Q KK R                 E KRQ   KGG +
Sbjct  198  SKHIWPLNSEGGPSTVVKSEPKEKQHKKER-----------------EGKRQ---KGGSS  237

Query  609  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  430
            G LAP+ LSD LVKF GTGENALSR DVVKRMW+YIK+N LQDP++KR +ICD KL+ELL
Sbjct  238  GLLAPLPLSDDLVKFIGTGENALSRSDVVKRMWEYIKQNNLQDPADKRNIICDKKLKELL  297

Query  429  EVDSFEGFTMTKLLTAHFIKT  367
            +VDSF GFT++KLL AHFIKT
Sbjct  298  KVDSFRGFTVSKLLVAHFIKT  318



>ref|XP_008792591.1| PREDICTED: upstream activation factor subunit spp27 isoform X2 
[Phoenix dactylifera]
Length=327

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 149/201 (74%), Gaps = 22/201 (11%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V E ELARTEVVK++WAYIREN+LQDP  +K+IICDE L  +F+V TIDMF+MN+ L
Sbjct  146  QQFVGESELARTEVVKKLWAYIRENSLQDPNNRKKIICDERLQNLFKVNTIDMFQMNKAL  205

Query  783  SKHIWPIEKED--VTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGT  610
            SKHIWP+  ED  VT VKS PK++Q KK R                 E KRQ   KGG +
Sbjct  206  SKHIWPLTSEDGPVTTVKSKPKDKQHKKER-----------------EGKRQ---KGGSS  245

Query  609  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  430
            G L P+ LSD LVKF GTGEN LSR DVVKRMW+YIK+N LQDP++KR VICD+KL+EL 
Sbjct  246  GLLVPLPLSDDLVKFIGTGENTLSRSDVVKRMWEYIKQNNLQDPADKRNVICDEKLKELF  305

Query  429  EVDSFEGFTMTKLLTAHFIKT  367
            +VDSF GFT++KLLTAHFIKT
Sbjct  306  KVDSFRGFTVSKLLTAHFIKT  326



>ref|XP_008792590.1| PREDICTED: upstream activation factor subunit spp27 isoform X1 
[Phoenix dactylifera]
Length=328

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 149/202 (74%), Gaps = 23/202 (11%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V E ELARTEVVK++WAYIREN+LQDP  +K+IICDE L  +F+V TIDMF+MN+ L
Sbjct  146  QQFVGESELARTEVVKKLWAYIRENSLQDPNNRKKIICDERLQNLFKVNTIDMFQMNKAL  205

Query  783  SKHIWPIEKED---VTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGG  613
            SKHIWP+  ED   VT VKS PK++Q KK R                 E KRQ   KGG 
Sbjct  206  SKHIWPLTSEDAGPVTTVKSKPKDKQHKKER-----------------EGKRQ---KGGS  245

Query  612  TGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLREL  433
            +G L P+ LSD LVKF GTGEN LSR DVVKRMW+YIK+N LQDP++KR VICD+KL+EL
Sbjct  246  SGLLVPLPLSDDLVKFIGTGENTLSRSDVVKRMWEYIKQNNLQDPADKRNVICDEKLKEL  305

Query  432  LEVDSFEGFTMTKLLTAHFIKT  367
             +VDSF GFT++KLLTAHFIKT
Sbjct  306  FKVDSFRGFTVSKLLTAHFIKT  327



>ref|XP_010652654.1| PREDICTED: upstream activation factor subunit spp27-like [Vitis 
vinifera]
Length=332

 Score =   248 bits (633),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 156/199 (78%), Gaps = 12/199 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  +  PELARTEVVK++W +IRE +LQDP  ++ IICDETL  +F V +I+MF+MN+ L
Sbjct  144  QKFIGVPELARTEVVKQLWVHIREKDLQDPNNRRNIICDETLRALFGVDSINMFQMNKAL  203

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP++ +D   VK TPKE+QRK+ RD        DSD EPK+++KRQ   KGG +GF
Sbjct  204  SKHIWPLDSDDAAPVKPTPKEKQRKQERD--------DSD-EPKRKQKRQ---KGGNSGF  251

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            LAP+ LSD+LVKF    E+ALSR +VVK++W+YIK+N LQDPS+KRR+ICD+KL+EL +V
Sbjct  252  LAPLPLSDALVKFLNIEESALSRAEVVKKIWEYIKQNNLQDPSDKRRIICDEKLKELFDV  311

Query  423  DSFEGFTMTKLLTAHFIKT  367
            DSF GFT+ KLL+AHFIKT
Sbjct  312  DSFNGFTVPKLLSAHFIKT  330


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -2

Query  954  VQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKH  775
            ++E  L+R EVVK+IW YI++NNLQDP  K+RIICDE L  +F V + + F + + LS H
Sbjct  267  IEESALSRAEVVKKIWEYIKQNNLQDPSDKRRIICDEKLKELFDVDSFNGFTVPKLLSAH  326

Query  774  IWPIEK  757
                E+
Sbjct  327  FIKTEQ  332



>ref|XP_010263746.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X4 [Nelumbo nucifera]
Length=328

 Score =   248 bits (632),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 153/197 (78%), Gaps = 12/197 (6%)
 Frame = -2

Query  957  LVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSK  778
             V  PE+ARTEVVK++W YIRE NLQDP  K+ I+CDE L  +F V +I+MF+MN+ LSK
Sbjct  144  FVGVPEMARTEVVKQLWVYIREKNLQDPNNKRNIMCDEKLRSLFGVDSINMFQMNKALSK  203

Query  777  HIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLA  598
            HI P++ ED   VKST KE+QRK+ R E       D++ EPKQ+EKRQ   KGG +GFLA
Sbjct  204  HIGPLDTEDAP-VKSTQKEKQRKQERKE-------DTN-EPKQKEKRQ---KGGNSGFLA  251

Query  597  PIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDS  418
            P+ LS +LVKF GTGEN+LSR  VVKRMW+YIK+N LQDPS+KRR+ICD+KL+EL EVDS
Sbjct  252  PLPLSGALVKFLGTGENSLSRASVVKRMWEYIKQNNLQDPSDKRRIICDEKLKELFEVDS  311

Query  417  FEGFTMTKLLTAHFIKT  367
            F GFT+ KLL AHF+KT
Sbjct  312  FNGFTVLKLLAAHFVKT  328


 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 55/93 (59%), Gaps = 2/93 (2%)
 Frame = -2

Query  654  KQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  475
            K   K  + +K  G GF     LS  L KF G  E  ++R +VVK++W YI+E  LQDP+
Sbjct  115  KSSNKLSKEVKKRGGGFTKLCTLSPQLKKFVGVPE--MARTEVVKQLWVYIREKNLQDPN  172

Query  474  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            NKR ++CD+KLR L  VDS   F M K L+ H 
Sbjct  173  NKRNIMCDEKLRSLFGVDSINMFQMNKALSKHI  205



>ref|XP_010263744.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Nelumbo nucifera]
 ref|XP_010263745.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Nelumbo nucifera]
Length=329

 Score =   248 bits (632),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 153/197 (78%), Gaps = 12/197 (6%)
 Frame = -2

Query  957  LVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSK  778
             V  PE+ARTEVVK++W YIRE NLQDP  K+ I+CDE L  +F V +I+MF+MN+ LSK
Sbjct  145  FVGVPEMARTEVVKQLWVYIREKNLQDPNNKRNIMCDEKLRSLFGVDSINMFQMNKALSK  204

Query  777  HIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLA  598
            HI P++ ED   VKST KE+QRK+ R E       D++ EPKQ+EKRQ   KGG +GFLA
Sbjct  205  HIGPLDTEDAP-VKSTQKEKQRKQERKE-------DTN-EPKQKEKRQ---KGGNSGFLA  252

Query  597  PIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDS  418
            P+ LS +LVKF GTGEN+LSR  VVKRMW+YIK+N LQDPS+KRR+ICD+KL+EL EVDS
Sbjct  253  PLPLSGALVKFLGTGENSLSRASVVKRMWEYIKQNNLQDPSDKRRIICDEKLKELFEVDS  312

Query  417  FEGFTMTKLLTAHFIKT  367
            F GFT+ KLL AHF+KT
Sbjct  313  FNGFTVLKLLAAHFVKT  329


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = -2

Query  627  LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDD  448
            +K  G GF     LS  L KF G  E  ++R +VVK++W YI+E  LQDP+NKR ++CD+
Sbjct  125  VKKRGGGFTKLCTLSPQLKKFVGVPE--MARTEVVKQLWVYIREKNLQDPNNKRNIMCDE  182

Query  447  KLRELLEVDSFEGFTMTKLLTAHF  376
            KLR L  VDS   F M K L+ H 
Sbjct  183  KLRSLFGVDSINMFQMNKALSKHI  206



>ref|XP_006425831.1| hypothetical protein CICLE_v10026010mg [Citrus clementina]
 ref|XP_006466650.1| PREDICTED: upstream activation factor subunit spp27-like [Citrus 
sinensis]
 gb|ESR39071.1| hypothetical protein CICLE_v10026010mg [Citrus clementina]
Length=338

 Score =   248 bits (633),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 154/199 (77%), Gaps = 11/199 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  +   ELARTEVVK++WAYIRE +LQDP  ++ I+CDE L  +F V TI+MF+MN+ L
Sbjct  151  QEFIGVTELARTEVVKQLWAYIREKDLQDPNNRRNIVCDERLRALFGVDTINMFQMNKAL  210

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP++ +DV  VKSTPKE+QRK+ R E       D D EP ++EKRQ   KGG +GF
Sbjct  211  SKHIWPLDSDDVISVKSTPKEKQRKQERTE-------DLD-EPTRKEKRQ---KGGKSGF  259

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            LAP+QLS +L+KF GTGE+AL R DV+KRMW YIKE  LQDPS+KRR+ICD+KL+EL +V
Sbjct  260  LAPLQLSGALIKFLGTGESALPRSDVIKRMWDYIKEKNLQDPSDKRRIICDEKLKELFDV  319

Query  423  DSFEGFTMTKLLTAHFIKT  367
            ++F GFT+TKLL  HF+KT
Sbjct  320  ETFNGFTVTKLLAVHFLKT  338



>ref|XP_011099215.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Sesamum indicum]
Length=325

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 150/193 (78%), Gaps = 11/193 (6%)
 Frame = -2

Query  945  PELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWP  766
            PELARTEVVK++W+YIRENNLQDP  ++ I+CD+TL  +F V TIDMF+MN+ L+KHIWP
Sbjct  142  PELARTEVVKQLWSYIRENNLQDPSNRRNIVCDDTLRNLFGVDTIDMFQMNKALAKHIWP  201

Query  765  IEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQL  586
            ++ +      S PKE+QRK+ RDE       D D EPK++EKRQR    G + FLAP++L
Sbjct  202  LDSDGAASTNSAPKEKQRKQERDE-------DQD-EPKRKEKRQRA---GNSAFLAPVKL  250

Query  585  SDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGF  406
            SD+L KF GTGE+AL R +VVKR+W+YIK N LQDPS+KR++ICD+KL+EL  VD+F GF
Sbjct  251  SDALAKFLGTGESALPRSNVVKRIWEYIKLNNLQDPSDKRQIICDEKLKELFNVDTFCGF  310

Query  405  TMTKLLTAHFIKT  367
            T+ KLLTAH +KT
Sbjct  311  TVAKLLTAHLVKT  323


 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = -2

Query  615  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  436
            G GF     LS  L KF G  E  L+R +VVK++W YI+EN LQDPSN+R ++CDD LR 
Sbjct  122  GGGFTKLCSLSPELQKFTGVPE--LARTEVVKQLWSYIRENNLQDPSNRRNIVCDDTLRN  179

Query  435  LLEVDSFEGFTMTKLLTAHF  376
            L  VD+ + F M K L  H 
Sbjct  180  LFGVDTIDMFQMNKALAKHI  199


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E  L R+ VVKRIW YI+ NNLQDP  K++IICDE L  +F V T   F + + L+ H+ 
Sbjct  262  ESALPRSNVVKRIWEYIKLNNLQDPSDKRQIICDEKLKELFNVDTFCGFTVAKLLTAHLV  321

Query  768  PIEK  757
              E+
Sbjct  322  KTEQ  325



>emb|CAN83123.1| hypothetical protein VITISV_044372 [Vitis vinifera]
Length=332

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 155/199 (78%), Gaps = 12/199 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  +  PELARTEVVK++W +IRE +LQDP  ++ IICDETL  +F V +I+MF+MN+ L
Sbjct  144  QKFIGVPELARTEVVKQLWVHIREKDLQDPNNRRNIICDETLRALFGVDSINMFQMNKAL  203

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP++ +D   VK TPKE+QRK+ R     DSD     EPK+++KRQ   KGG +GF
Sbjct  204  SKHIWPLDSDDAAPVKPTPKEKQRKQER----XDSD-----EPKRKQKRQ---KGGNSGF  251

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            LAP+ LSD+LVKF    E+ALSR +VVK++W+YIK+N LQDPS+KRR+ICD+KL+EL +V
Sbjct  252  LAPLPLSDALVKFLNIEESALSRAEVVKKIWEYIKQNNLQDPSDKRRIICDEKLKELFDV  311

Query  423  DSFEGFTMTKLLTAHFIKT  367
            DSF GFT+ KLL+AHFIKT
Sbjct  312  DSFNGFTVPKLLSAHFIKT  330


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -2

Query  954  VQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKH  775
            ++E  L+R EVVK+IW YI++NNLQDP  K+RIICDE L  +F V + + F + + LS H
Sbjct  267  IEESALSRAEVVKKIWEYIKQNNLQDPSDKRRIICDEKLKELFDVDSFNGFTVPKLLSAH  326

Query  774  IWPIEK  757
                E+
Sbjct  327  FIKTEQ  332



>gb|KJB32415.1| hypothetical protein B456_005G239900 [Gossypium raimondii]
Length=453

 Score =   249 bits (635),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 157/199 (79%), Gaps = 12/199 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  + E ELARTEVVKR+W YIRE NLQDPK K+ ++CD++L  +FRVK+I+MF+MN+ L
Sbjct  263  QAFIGESELARTEVVKRLWTYIREKNLQDPKDKRNVLCDDSLYALFRVKSINMFQMNKAL  322

Query  783  SKHIWPIEKEDVTLVKSTPK-ERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTG  607
            SKHIWP+ +E+VT+   + K ER+ K+ R+ V          EPKQ+EK+Q   K G +G
Sbjct  323  SKHIWPLNEEEVTVQADSAKTERKSKQARERVAD--------EPKQKEKKQ---KKGASG  371

Query  606  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  427
            FLAP+ LSD+LVKFF TGENALSR DVVK+MW+YIK+N+LQDPS+KRR++CDDKL+EL E
Sbjct  372  FLAPLPLSDALVKFFATGENALSRADVVKKMWEYIKQNDLQDPSDKRRILCDDKLKELFE  431

Query  426  VDSFEGFTMTKLLTAHFIK  370
            VDSF GF MTKLLT HFIK
Sbjct  432  VDSFNGFAMTKLLTTHFIK  450


 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V E +LARTEVVK++W YI+E +LQDPK K+ IICDE L  IFRV +I+MF+MN+ L
Sbjct  65   QKVVGESKLARTEVVKKLWVYIKEKDLQDPKNKRNIICDELLRDIFRVNSINMFQMNKAL  124

Query  783  SKHIWPIEKED  751
            +KHIWP+  ED
Sbjct  125  TKHIWPLSVED  135


 Score = 78.6 bits (192),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = -2

Query  642  KRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRR  463
            K  +  K  G GF     LS  L K    GE+ L+R +VVK++W YIKE +LQDP NKR 
Sbjct  42   KSDKKAKKRGGGFQTVCSLSPQLQKV--VGESKLARTEVVKKLWVYIKEKDLQDPKNKRN  99

Query  462  VICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            +ICD+ LR++  V+S   F M K LT H 
Sbjct  100  IICDELLRDIFRVNSINMFQMNKALTKHI  128


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E  L+R +VVK++W YI++N+LQDP  K+RI+CD+ L  +F V + + F M + L+ H  
Sbjct  390  ENALSRADVVKKMWEYIKQNDLQDPSDKRRILCDDKLKELFEVDSFNGFAMTKLLTTHFI  449

Query  768  PIEK  757
             +E+
Sbjct  450  KMEQ  453



>ref|XP_012079173.1| PREDICTED: upstream activation factor subunit spp27-like [Jatropha 
curcas]
 gb|KDP31884.1| hypothetical protein JCGZ_12345 [Jatropha curcas]
Length=334

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 156/201 (78%), Gaps = 13/201 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  +  P+LARTEVVK++WAYIRE +LQDP  ++ I CD+ L  +F V +I+MF+MN+ L
Sbjct  145  QEFIGVPQLARTEVVKQLWAYIREKDLQDPNNRRNINCDKPLRALFGVDSINMFQMNKAL  204

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGG--T  610
            SKHIWP++ +DV   +  PKE+QRK+ R+E           EPK++EKRQ+G K  G  +
Sbjct  205  SKHIWPLDSQDV---EPAPKEKQRKQEREEGLD--------EPKRKEKRQKGEKSKGEKS  253

Query  609  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  430
            GFLAP+QLSD+L+KF GTGENALSR +VVKRMW+YIK+N LQDPS+KRR+ICD+KL++L 
Sbjct  254  GFLAPLQLSDALIKFLGTGENALSRAEVVKRMWEYIKQNNLQDPSDKRRIICDEKLKQLF  313

Query  429  EVDSFEGFTMTKLLTAHFIKT  367
            +VD F GFT++KLL+AHF+K 
Sbjct  314  DVDFFNGFTVSKLLSAHFVKA  334



>gb|KJB32414.1| hypothetical protein B456_005G239900 [Gossypium raimondii]
Length=514

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 157/199 (79%), Gaps = 12/199 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  + E ELARTEVVKR+W YIRE NLQDPK K+ ++CD++L  +FRVK+I+MF+MN+ L
Sbjct  324  QAFIGESELARTEVVKRLWTYIREKNLQDPKDKRNVLCDDSLYALFRVKSINMFQMNKAL  383

Query  783  SKHIWPIEKEDVTLVKSTPK-ERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTG  607
            SKHIWP+ +E+VT+   + K ER+ K+ R+ V          EPKQ+EK+Q   K G +G
Sbjct  384  SKHIWPLNEEEVTVQADSAKTERKSKQARERVAD--------EPKQKEKKQ---KKGASG  432

Query  606  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  427
            FLAP+ LSD+LVKFF TGENALSR DVVK+MW+YIK+N+LQDPS+KRR++CDDKL+EL E
Sbjct  433  FLAPLPLSDALVKFFATGENALSRADVVKKMWEYIKQNDLQDPSDKRRILCDDKLKELFE  492

Query  426  VDSFEGFTMTKLLTAHFIK  370
            VDSF GF MTKLLT HFIK
Sbjct  493  VDSFNGFAMTKLLTTHFIK  511


 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V E +LARTEVVK++W YI+E +LQDPK K+ IICDE L  IFRV +I+MF+MN+ L
Sbjct  126  QKVVGESKLARTEVVKKLWVYIKEKDLQDPKNKRNIICDELLRDIFRVNSINMFQMNKAL  185

Query  783  SKHIWPIEKED  751
            +KHIWP+  ED
Sbjct  186  TKHIWPLSVED  196


 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = -2

Query  642  KRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRR  463
            K  +  K  G GF     LS  L K    GE+ L+R +VVK++W YIKE +LQDP NKR 
Sbjct  103  KSDKKAKKRGGGFQTVCSLSPQLQKV--VGESKLARTEVVKKLWVYIKEKDLQDPKNKRN  160

Query  462  VICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            +ICD+ LR++  V+S   F M K LT H 
Sbjct  161  IICDELLRDIFRVNSINMFQMNKALTKHI  189


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E  L+R +VVK++W YI++N+LQDP  K+RI+CD+ L  +F V + + F M + L+ H  
Sbjct  451  ENALSRADVVKKMWEYIKQNDLQDPSDKRRILCDDKLKELFEVDSFNGFAMTKLLTTHFI  510

Query  768  PIEK  757
             +E+
Sbjct  511  KMEQ  514



>gb|KJB32416.1| hypothetical protein B456_005G239900 [Gossypium raimondii]
Length=513

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 157/199 (79%), Gaps = 12/199 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  + E ELARTEVVKR+W YIRE NLQDPK K+ ++CD++L  +FRVK+I+MF+MN+ L
Sbjct  323  QAFIGESELARTEVVKRLWTYIREKNLQDPKDKRNVLCDDSLYALFRVKSINMFQMNKAL  382

Query  783  SKHIWPIEKEDVTLVKSTPK-ERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTG  607
            SKHIWP+ +E+VT+   + K ER+ K+ R+ V          EPKQ+EK+Q   K G +G
Sbjct  383  SKHIWPLNEEEVTVQADSAKTERKSKQARERVAD--------EPKQKEKKQ---KKGASG  431

Query  606  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  427
            FLAP+ LSD+LVKFF TGENALSR DVVK+MW+YIK+N+LQDPS+KRR++CDDKL+EL E
Sbjct  432  FLAPLPLSDALVKFFATGENALSRADVVKKMWEYIKQNDLQDPSDKRRILCDDKLKELFE  491

Query  426  VDSFEGFTMTKLLTAHFIK  370
            VDSF GF MTKLLT HFIK
Sbjct  492  VDSFNGFAMTKLLTTHFIK  510


 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V E +LARTEVVK++W YI+E +LQDPK K+ IICDE L  IFRV +I+MF+MN+ L
Sbjct  126  QKVVGESKLARTEVVKKLWVYIKEKDLQDPKNKRNIICDELLRDIFRVNSINMFQMNKAL  185

Query  783  SKHIWPIEKED  751
            +KHIWP+  ED
Sbjct  186  TKHIWPLSVED  196


 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = -2

Query  642  KRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRR  463
            K  +  K  G GF     LS  L K    GE+ L+R +VVK++W YIKE +LQDP NKR 
Sbjct  103  KSDKKAKKRGGGFQTVCSLSPQLQKV--VGESKLARTEVVKKLWVYIKEKDLQDPKNKRN  160

Query  462  VICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            +ICD+ LR++  V+S   F M K LT H 
Sbjct  161  IICDELLRDIFRVNSINMFQMNKALTKHI  189


 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E  L+R +VVK++W YI++N+LQDP  K+RI+CD+ L  +F V + + F M + L+ H  
Sbjct  450  ENALSRADVVKKMWEYIKQNDLQDPSDKRRILCDDKLKELFEVDSFNGFAMTKLLTTHFI  509

Query  768  PIEK  757
             +E+
Sbjct  510  KMEQ  513



>ref|XP_012072453.1| PREDICTED: DNA ligase 1 isoform X1 [Jatropha curcas]
Length=518

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 154/198 (78%), Gaps = 14/198 (7%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  + E ELARTEVVKR+WAYIRE NLQDPK K+ IICDE+L  +F V +I+MF+MN+ L
Sbjct  332  QEFIGESELARTEVVKRLWAYIRERNLQDPKNKQNIICDESLHALFHVNSINMFQMNKAL  391

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP+ +E      ++ KE++ K+ R+         SD EPKQ+EKRQ   K G +G 
Sbjct  392  SKHIWPLNEEVPN--NTSEKEKRSKQPRE--------GSD-EPKQKEKRQ---KKGASGL  437

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            LAP+ LSD+LVKFFGTGEN LSR DVVKRMW YIK+N+LQDPS+KRR+ICDDKL+EL EV
Sbjct  438  LAPLPLSDALVKFFGTGENELSRADVVKRMWGYIKQNDLQDPSDKRRIICDDKLKELFEV  497

Query  423  DSFEGFTMTKLLTAHFIK  370
            DSF GF+++KLLT+HFIK
Sbjct  498  DSFNGFSVSKLLTSHFIK  515


 Score =   156 bits (394),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/218 (42%), Positives = 124/218 (57%), Gaps = 33/218 (15%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V   ELARTEVVK++WAYIRENNLQDPK K+ I CD+    +FRV +I+MF+MN+ L
Sbjct  189  QKIVGVTELARTEVVKKLWAYIRENNLQDPKNKRNIKCDQAFRDLFRVNSINMFQMNKAL  248

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKR-----------  637
            SKHIWP+  E          E ++ K +DE  ++S S+ + E + + +            
Sbjct  249  SKHIWPLTAE---------AENEKLKVKDEDGSNSVSEEEEEEEDQSEEEEEEEEEDMEK  299

Query  636  -----QRGLKGG------GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENE  490
                  R +KG       G GF     LS  L +F   GE+ L+R +VVKR+W YI+E  
Sbjct  300  KKKKGSRSIKGDKDGKKRGGGFTKLCSLSPQLQEFI--GESELARTEVVKRLWAYIRERN  357

Query  489  LQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            LQDP NK+ +ICD+ L  L  V+S   F M K L+ H 
Sbjct  358  LQDPKNKQNIICDESLHALFHVNSINMFQMNKALSKHI  395


 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E EL+R +VVKR+W YI++N+LQDP  K+RIICD+ L  +F V + + F +++ L+ H  
Sbjct  455  ENELSRADVVKRMWGYIKQNDLQDPSDKRRIICDDKLKELFEVDSFNGFSVSKLLTSHFI  514

Query  768  PIEK  757
             +E+
Sbjct  515  KMEQ  518



>ref|XP_012072454.1| PREDICTED: DNA ligase 1 isoform X2 [Jatropha curcas]
Length=517

 Score =   249 bits (635),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 154/198 (78%), Gaps = 14/198 (7%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  + E ELARTEVVKR+WAYIRE NLQDPK K+ IICDE+L  +F V +I+MF+MN+ L
Sbjct  331  QEFIGESELARTEVVKRLWAYIRERNLQDPKNKQNIICDESLHALFHVNSINMFQMNKAL  390

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP+ +E      ++ KE++ K+ R+         SD EPKQ+EKRQ   K G +G 
Sbjct  391  SKHIWPLNEE--VPNNTSEKEKRSKQPRE--------GSD-EPKQKEKRQ---KKGASGL  436

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            LAP+ LSD+LVKFFGTGEN LSR DVVKRMW YIK+N+LQDPS+KRR+ICDDKL+EL EV
Sbjct  437  LAPLPLSDALVKFFGTGENELSRADVVKRMWGYIKQNDLQDPSDKRRIICDDKLKELFEV  496

Query  423  DSFEGFTMTKLLTAHFIK  370
            DSF GF+++KLLT+HFIK
Sbjct  497  DSFNGFSVSKLLTSHFIK  514


 Score =   156 bits (395),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/217 (42%), Positives = 125/217 (58%), Gaps = 32/217 (15%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V   ELARTEVVK++WAYIRENNLQDPK K+ I CD+    +FRV +I+MF+MN+ L
Sbjct  189  QKIVGVTELARTEVVKKLWAYIRENNLQDPKNKRNIKCDQAFRDLFRVNSINMFQMNKAL  248

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQ----------  634
            SKHIWP+  E          E ++ K +DE  ++S S+ + E + + + +          
Sbjct  249  SKHIWPLTAE---------AENEKLKVKDEDGSNSVSEEEEEEEDQSEEEEEEEEEDMEK  299

Query  633  -----RGLKGG------GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENEL  487
                 R +KG       G GF     LS  L +F   GE+ L+R +VVKR+W YI+E  L
Sbjct  300  KKKKGRSIKGDKDGKKRGGGFTKLCSLSPQLQEFI--GESELARTEVVKRLWAYIRERNL  357

Query  486  QDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            QDP NK+ +ICD+ L  L  V+S   F M K L+ H 
Sbjct  358  QDPKNKQNIICDESLHALFHVNSINMFQMNKALSKHI  394


 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E EL+R +VVKR+W YI++N+LQDP  K+RIICD+ L  +F V + + F +++ L+ H  
Sbjct  454  ENELSRADVVKRMWGYIKQNDLQDPSDKRRIICDDKLKELFEVDSFNGFSVSKLLTSHFI  513

Query  768  PIEK  757
             +E+
Sbjct  514  KMEQ  517



>ref|XP_010905631.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Elaeis guineensis]
Length=325

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 146/201 (73%), Gaps = 22/201 (11%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V E ELARTEVVK++WAYIREN+LQDP  +++IICDE L  +F V TIDMF+MN+ L
Sbjct  144  QQFVGESELARTEVVKKLWAYIRENSLQDPNNRRKIICDERLQKLFNVNTIDMFQMNKAL  203

Query  783  SKHIWPIEKED--VTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGT  610
            SKHIWP+  ED     VKS PK++Q KK                 + E KRQ   KGG +
Sbjct  204  SKHIWPLTSEDGPANTVKSKPKDKQHKK-----------------EGEGKRQ---KGGSS  243

Query  609  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  430
            G L P+ LSD LVKF GTGENALSR DVVKRMW+YIK+N LQDP++KR VICD+KL+EL 
Sbjct  244  GLLVPLPLSDDLVKFIGTGENALSRSDVVKRMWEYIKQNNLQDPADKRNVICDEKLKELF  303

Query  429  EVDSFEGFTMTKLLTAHFIKT  367
            +VDSF GFT++KLL AHFIKT
Sbjct  304  KVDSFRGFTVSKLLAAHFIKT  324



>ref|XP_012072455.1| PREDICTED: DNA ligase 1 isoform X3 [Jatropha curcas]
Length=500

 Score =   248 bits (633),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 154/198 (78%), Gaps = 14/198 (7%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  + E ELARTEVVKR+WAYIRE NLQDPK K+ IICDE+L  +F V +I+MF+MN+ L
Sbjct  314  QEFIGESELARTEVVKRLWAYIRERNLQDPKNKQNIICDESLHALFHVNSINMFQMNKAL  373

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP+ +E      ++ KE++ K+ R+         SD EPKQ+EKRQ   K G +G 
Sbjct  374  SKHIWPLNEEVPN--NTSEKEKRSKQPRE--------GSD-EPKQKEKRQ---KKGASGL  419

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            LAP+ LSD+LVKFFGTGEN LSR DVVKRMW YIK+N+LQDPS+KRR+ICDDKL+EL EV
Sbjct  420  LAPLPLSDALVKFFGTGENELSRADVVKRMWGYIKQNDLQDPSDKRRIICDDKLKELFEV  479

Query  423  DSFEGFTMTKLLTAHFIK  370
            DSF GF+++KLLT+HFIK
Sbjct  480  DSFNGFSVSKLLTSHFIK  497


 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 117/196 (60%), Gaps = 7/196 (4%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V   ELARTEVVK++WAYIRENNLQDPK K+ I CD+    +FRV +I+MF+MN+ L
Sbjct  189  QKIVGVTELARTEVVKKLWAYIRENNLQDPKNKRNIKCDQAFRDLFRVNSINMFQMNKAL  248

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP+     T      +E + +   +E   + D +   +  +  K  +  K  G GF
Sbjct  249  SKHIWPL-----TAEAEEEEEEEDQSEEEEEEEEEDMEKKKKKGRSIKGDKDGKKRGGGF  303

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
                 LS  L +F   GE+ L+R +VVKR+W YI+E  LQDP NK+ +ICD+ L  L  V
Sbjct  304  TKLCSLSPQLQEFI--GESELARTEVVKRLWAYIRERNLQDPKNKQNIICDESLHALFHV  361

Query  423  DSFEGFTMTKLLTAHF  376
            +S   F M K L+ H 
Sbjct  362  NSINMFQMNKALSKHI  377


 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E EL+R +VVKR+W YI++N+LQDP  K+RIICD+ L  +F V + + F +++ L+ H  
Sbjct  437  ENELSRADVVKRMWGYIKQNDLQDPSDKRRIICDDKLKELFEVDSFNGFSVSKLLTSHFI  496

Query  768  PIEK  757
             +E+
Sbjct  497  KMEQ  500



>ref|XP_011099216.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Sesamum indicum]
Length=324

 Score =   243 bits (619),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 151/193 (78%), Gaps = 12/193 (6%)
 Frame = -2

Query  945  PELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWP  766
            PELARTEVVK++W+YIRENNLQDP  ++ I+CD+TL  +F V TIDMF+MN+ L+KHIWP
Sbjct  142  PELARTEVVKQLWSYIRENNLQDPSNRRNIVCDDTLRNLFGVDTIDMFQMNKALAKHIWP  201

Query  765  IEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQL  586
            ++ +  +   S PKE+QRK+ RDE       D D EPK++EKRQR    G + FLAP++L
Sbjct  202  LDSDGAS-TNSAPKEKQRKQERDE-------DQD-EPKRKEKRQRA---GNSAFLAPVKL  249

Query  585  SDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGF  406
            SD+L KF GTGE+AL R +VVKR+W+YIK N LQDPS+KR++ICD+KL+EL  VD+F GF
Sbjct  250  SDALAKFLGTGESALPRSNVVKRIWEYIKLNNLQDPSDKRQIICDEKLKELFNVDTFCGF  309

Query  405  TMTKLLTAHFIKT  367
            T+ KLLTAH +KT
Sbjct  310  TVAKLLTAHLVKT  322


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = -2

Query  615  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  436
            G GF     LS  L KF G  E  L+R +VVK++W YI+EN LQDPSN+R ++CDD LR 
Sbjct  122  GGGFTKLCSLSPELQKFTGVPE--LARTEVVKQLWSYIRENNLQDPSNRRNIVCDDTLRN  179

Query  435  LLEVDSFEGFTMTKLLTAHF  376
            L  VD+ + F M K L  H 
Sbjct  180  LFGVDTIDMFQMNKALAKHI  199


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E  L R+ VVKRIW YI+ NNLQDP  K++IICDE L  +F V T   F + + L+ H+ 
Sbjct  261  ESALPRSNVVKRIWEYIKLNNLQDPSDKRQIICDEKLKELFNVDTFCGFTVAKLLTAHLV  320

Query  768  PIEK  757
              E+
Sbjct  321  KTEQ  324



>ref|XP_010905630.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Elaeis guineensis]
Length=326

 Score =   243 bits (619),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 146/202 (72%), Gaps = 23/202 (11%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V E ELARTEVVK++WAYIREN+LQDP  +++IICDE L  +F V TIDMF+MN+ L
Sbjct  144  QQFVGESELARTEVVKKLWAYIRENSLQDPNNRRKIICDERLQKLFNVNTIDMFQMNKAL  203

Query  783  SKHIWPIEKEDV---TLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGG  613
            SKHIWP+  ED      VKS PK++Q KK                 + E KRQ   KGG 
Sbjct  204  SKHIWPLTSEDAGPANTVKSKPKDKQHKK-----------------EGEGKRQ---KGGS  243

Query  612  TGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLREL  433
            +G L P+ LSD LVKF GTGENALSR DVVKRMW+YIK+N LQDP++KR VICD+KL+EL
Sbjct  244  SGLLVPLPLSDDLVKFIGTGENALSRSDVVKRMWEYIKQNNLQDPADKRNVICDEKLKEL  303

Query  432  LEVDSFEGFTMTKLLTAHFIKT  367
             +VDSF GFT++KLL AHFIKT
Sbjct  304  FKVDSFRGFTVSKLLAAHFIKT  325



>gb|KHG25549.1| Upstream activation factor subunit spp27 [Gossypium arboreum]
Length=515

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 154/199 (77%), Gaps = 12/199 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  + E ELARTEVVKR+W YIRE NLQDPK K+ ++CD++L  +FRVK+I+MF+MN+ L
Sbjct  325  QAFIGESELARTEVVKRLWTYIREKNLQDPKDKRNVLCDDSLYALFRVKSINMFQMNKAL  384

Query  783  SKHIWPIEKEDVTLVKSTPK-ERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTG  607
            SKHIWP+ +E+V +   + K ER+ K+ R+ V            ++ +++++  K G +G
Sbjct  385  SKHIWPLNEEEVAVQADSAKTERKSKQARERV-----------AEEPKQKEKKQKKGASG  433

Query  606  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  427
            FLAP+ LSD+LVKFF TGENALSR DVVK+MW+YIK+N+LQDPS+KRR++CDDKL+EL E
Sbjct  434  FLAPLPLSDALVKFFATGENALSRADVVKKMWEYIKQNDLQDPSDKRRILCDDKLKELFE  493

Query  426  VDSFEGFTMTKLLTAHFIK  370
            VDSF GF MTKLLT HFIK
Sbjct  494  VDSFNGFAMTKLLTTHFIK  512


 Score =   103 bits (256),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V E +LARTEVVK++WAYI+E +LQDPK K+ IICDE L  IFRV +I+MF+MN+ L
Sbjct  126  QKVVGESKLARTEVVKKLWAYIKEKDLQDPKNKRNIICDELLRDIFRVNSINMFQMNKAL  185

Query  783  SKHIWPIEKED  751
            +KHIWP+  ED
Sbjct  186  TKHIWPLSVED  196


 Score = 79.0 bits (193),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = -2

Query  642  KRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRR  463
            K  +  K  G GF     LS  L K    GE+ L+R +VVK++W YIKE +LQDP NKR 
Sbjct  103  KSDKKAKKRGGGFQTVCSLSPQLQKV--VGESKLARTEVVKKLWAYIKEKDLQDPKNKRN  160

Query  462  VICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            +ICD+ LR++  V+S   F M K LT H 
Sbjct  161  IICDELLRDIFRVNSINMFQMNKALTKHI  189


 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E  L+R +VVK++W YI++N+LQDP  K+RI+CD+ L  +F V + + F M + L+ H  
Sbjct  452  ENALSRADVVKKMWEYIKQNDLQDPSDKRRILCDDKLKELFEVDSFNGFAMTKLLTTHFI  511

Query  768  PIEK  757
             +E+
Sbjct  512  KMEQ  515



>ref|XP_002521839.1| brg-1 associated factor, putative [Ricinus communis]
 gb|EEF40475.1| brg-1 associated factor, putative [Ricinus communis]
Length=614

 Score =   247 bits (631),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 153/198 (77%), Gaps = 13/198 (7%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q    E ELARTEVVK++W YIRENNLQDPK K+ I+CDE+L  +FRV  I+MF+MN+ L
Sbjct  427  QEFTGESELARTEVVKKLWIYIRENNLQDPKNKRNILCDESLRTLFRVDCINMFQMNKVL  486

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP+++ED     S  KER+ K+ R+E       DSD EPKQ+EKRQ   K G +G 
Sbjct  487  SKHIWPLDEEDAE--NSLQKERRSKQQREE-------DSD-EPKQKEKRQ---KKGVSGL  533

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            L P+ LSD LVKF GTGEN LSR DVVKR+W YIK+N+LQDPS+KRR++CDDKL+EL EV
Sbjct  534  LVPLPLSDPLVKFIGTGENELSRADVVKRIWGYIKQNDLQDPSDKRRILCDDKLKELFEV  593

Query  423  DSFEGFTMTKLLTAHFIK  370
            DSF GF+++KLLTAHFIK
Sbjct  594  DSFNGFSVSKLLTAHFIK  611


 Score =   156 bits (395),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/229 (40%), Positives = 124/229 (54%), Gaps = 49/229 (21%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  + E + ARTEVVK++W YIRENNLQDPK ++ I+CDE+L  +FRV +I+MF+MN+ L
Sbjct  278  QEFIGESKSARTEVVKKLWVYIRENNLQDPKNRRIILCDESLRALFRVDSINMFQMNKVL  337

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEK------------  640
            SKHIWP+ +E+              +G D V   S+        +EEK            
Sbjct  338  SKHIWPLNEEE--------------EGNDSVSEASNGSGKEGEDEEEKSEEDEEEEEGDK  383

Query  639  ----------RQRGLKGGGT-----------GFLAPIQLSDSLVKFFGTGENALSRGDVV  523
                       +R  KGG T           GF     LS  L +F  TGE+ L+R +VV
Sbjct  384  EEEEAVEKEDSERSKKGGATKVDKDVKKRGGGFTKLCSLSPQLQEF--TGESELARTEVV  441

Query  522  KRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            K++W YI+EN LQDP NKR ++CD+ LR L  VD    F M K+L+ H 
Sbjct  442  KKLWIYIRENNLQDPKNKRNILCDESLRTLFRVDCINMFQMNKVLSKHI  490


 Score =   151 bits (382),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 123/207 (59%), Gaps = 20/207 (10%)
 Frame = -2

Query  942  ELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI  763
            ELARTEVVK++WAYIREN+LQDPK ++ I CDE L  +FRV +I+MF+MN+ LSKHIWP+
Sbjct  137  ELARTEVVKKLWAYIRENDLQDPKNRRIIKCDEALRDLFRVNSINMFQMNKALSKHIWPL  196

Query  762  ------------EKED----VTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQ--EEKR  637
                        E+ED    V+   + P + +  +       + + + +   K+    K 
Sbjct  197  TAQAEASNDPGKEEEDEEGSVSEGSNDPSKEEEDEEEKMEEDEEEEEDNKRSKKGRATKV  256

Query  636  QRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVI  457
             + +K  G GF     LS  L +F G  ++A  R +VVK++W YI+EN LQDP N+R ++
Sbjct  257  NKDVKKRGGGFTKLCSLSPQLQEFIGESKSA--RTEVVKKLWVYIRENNLQDPKNRRIIL  314

Query  456  CDDKLRELLEVDSFEGFTMTKLLTAHF  376
            CD+ LR L  VDS   F M K+L+ H 
Sbjct  315  CDESLRALFRVDSINMFQMNKVLSKHI  341


 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = -2

Query  660  EPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  481
            E  +E +R +  K  G GF     LS  L KF G  E  L+R +VVK++W YI+EN+LQD
Sbjct  101  EQSEESERSKKAKKRGGGFTMLCSLSPQLHKFVGVSE--LARTEVVKKLWAYIRENDLQD  158

Query  480  PSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            P N+R + CD+ LR+L  V+S   F M K L+ H 
Sbjct  159  PKNRRIIKCDEALRDLFRVNSINMFQMNKALSKHI  193


 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E EL+R +VVKRIW YI++N+LQDP  K+RI+CD+ L  +F V + + F +++ L+ H  
Sbjct  551  ENELSRADVVKRIWGYIKQNDLQDPSDKRRILCDDKLKELFEVDSFNGFSVSKLLTAHFI  610

Query  768  PIEK  757
             +E+
Sbjct  611  KMEQ  614



>emb|CDP02467.1| unnamed protein product [Coffea canephora]
Length=323

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 149/192 (78%), Gaps = 13/192 (7%)
 Frame = -2

Query  945  PELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWP  766
            PELARTEVVK++W+YIRENNLQDP  ++ I+CD TL  +F V +I+MF+MN+ L++HIWP
Sbjct  142  PELARTEVVKQLWSYIRENNLQDPSNRRNILCDGTLRDLFGVDSINMFQMNKALAQHIWP  201

Query  765  IEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQL  586
            +E      V STPKE+QRK+ R E           EPK++EKR    KGG +GFLAP+ L
Sbjct  202  LETN--ASVSSTPKEKQRKQERAEEMD--------EPKRKEKRH---KGGTSGFLAPLPL  248

Query  585  SDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGF  406
            SD+LVKF GTGE+AL R DVVKR+W YIK+N LQDPS++RR++CD+KL+EL +VD+F+GF
Sbjct  249  SDALVKFLGTGESALPRSDVVKRIWDYIKQNNLQDPSDRRRILCDEKLKELFDVDNFQGF  308

Query  405  TMTKLLTAHFIK  370
            T+ KLLT HFIK
Sbjct  309  TVPKLLTGHFIK  320


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = -2

Query  615  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  436
            G GF     LS  L KF G  E  L+R +VVK++W YI+EN LQDPSN+R ++CD  LR+
Sbjct  122  GGGFTKLCSLSPQLQKFTGVPE--LARTEVVKQLWSYIRENNLQDPSNRRNILCDGTLRD  179

Query  435  LLEVDSFEGFTMTKLLTAHF  376
            L  VDS   F M K L  H 
Sbjct  180  LFGVDSINMFQMNKALAQHI  199


 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHI  772
            E  L R++VVKRIW YI++NNLQDP  ++RI+CDE L  +F V     F + + L+ H 
Sbjct  260  ESALPRSDVVKRIWDYIKQNNLQDPSDRRRILCDEKLKELFDVDNFQGFTVPKLLTGHF  318



>ref|XP_010941845.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Elaeis guineensis]
Length=334

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 142/201 (71%), Gaps = 10/201 (5%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V E ELARTEVVK++WAYIR+N+LQDP  +K IICD+TL  IF V TIDMF+MN+ L
Sbjct  141  QQFVGESELARTEVVKKLWAYIRQNSLQDPNNRKNIICDDTLQNIFNVSTIDMFQMNKAL  200

Query  783  SKHIWPIEKE--DVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGT  610
            SKHIWP++ E    T V+S P        R E           +P ++E+  +  KGG +
Sbjct  201  SKHIWPLDSEGGSSTTVRSEPTGGSSTTVRSEPKA--------KPHKKEREVKRQKGGSS  252

Query  609  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  430
            G L P+ LSD LVKF GTGEN LSR D VKRMW+YIK+N LQDP++KR VICD KL+EL 
Sbjct  253  GLLVPLPLSDDLVKFIGTGENTLSRSDAVKRMWEYIKQNNLQDPADKRNVICDKKLKELF  312

Query  429  EVDSFEGFTMTKLLTAHFIKT  367
            +VD+F GFT++KLL AHFIKT
Sbjct  313  KVDTFRGFTVSKLLAAHFIKT  333



>gb|KJB43613.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
 gb|KJB43615.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
Length=223

 Score =   228 bits (582),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 117/206 (57%), Positives = 152/206 (74%), Gaps = 20/206 (10%)
 Frame = -2

Query  957  LVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSK  778
            L+  PE+ARTEVVK++W YIRE NLQDP  KK IICDE L  +F V++IDMF+MN+ LSK
Sbjct  29   LLGVPEMARTEVVKQMWVYIREKNLQDPVNKKNIICDEPLHALFGVESIDMFQMNKALSK  88

Query  777  HIWPIEKEDVTLVKSTPKERQRKKGRDEVYT---------DSDSDSDFEPKQEEKRQRGL  625
            HI P++ ++V   KS  +E+ RK  R+EV +         + + D D E K +EKRQ+G 
Sbjct  89   HILPLDSDEV---KSMEREKPRKHEREEVKSTEKEKPRKHEREEDPD-EAKGKEKRQKG-  143

Query  624  KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDK  445
                  FLAP+QLSD+LVKF GTGEN L+R  V+KRMW YIKEN LQDP++KR+VICD+K
Sbjct  144  ------FLAPLQLSDALVKFLGTGENELTRAVVIKRMWDYIKENNLQDPADKRKVICDEK  197

Query  444  LRELLEVDSFEGFTMTKLLTAHFIKT  367
            L+EL EV++F GFT+TKLL AHF+K+
Sbjct  198  LKELFEVETFHGFTVTKLLAAHFLKS  223



>ref|XP_009397729.1| PREDICTED: upstream activation factor subunit UAF30-like [Musa 
acuminata subsp. malaccensis]
Length=343

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 140/198 (71%), Gaps = 19/198 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V EPELARTEVVKR+WAYIRE NLQDP  +++IICDE L  +F V  IDMF+MN+ L
Sbjct  162  QDFVGEPELARTEVVKRLWAYIREKNLQDPNNRRKIICDEKLKPLFNVNVIDMFQMNKAL  221

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP+  +D  +  + PK+  +                  PK+E + +R  K G +G 
Sbjct  222  SKHIWPLNSDDGPVTSAKPKQHDK------------------PKKELEGKRQ-KVGSSGL  262

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            LAP+ LSD LVKFFGTGEN LSR DVVKRMW YIK N LQDP++KR VICD+KL+ELL+V
Sbjct  263  LAPLPLSDDLVKFFGTGENTLSRSDVVKRMWDYIKGNNLQDPADKRNVICDEKLKELLKV  322

Query  423  DSFEGFTMTKLLTAHFIK  370
            DSF GFT++KLL  HFIK
Sbjct  323  DSFHGFTVSKLLAPHFIK  340



>gb|KJB43618.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
Length=173

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 145/191 (76%), Gaps = 18/191 (9%)
 Frame = -2

Query  939  LARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIE  760
            +ARTEVVK++W YIRE NLQDP  KK IICDE L  +F V++IDMF+MN+ LSKHI P++
Sbjct  1    MARTEVVKQMWVYIREKNLQDPVNKKNIICDEPLHALFGVESIDMFQMNKALSKHILPLD  60

Query  759  KEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSD  580
             ++V   KST KE+ RK  R+E       D D E K +EKRQ+G       FLAP+QLSD
Sbjct  61   SDEV---KSTEKEKPRKHEREE-------DPD-EAKGKEKRQKG-------FLAPLQLSD  102

Query  579  SLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTM  400
            +LVKF GTGEN L+R  V+KRMW YIKEN LQDP++KR+VICD+KL+EL EV++F GFT+
Sbjct  103  ALVKFLGTGENELTRAVVIKRMWDYIKENNLQDPADKRKVICDEKLKELFEVETFHGFTV  162

Query  399  TKLLTAHFIKT  367
            TKLL AHF+K+
Sbjct  163  TKLLAAHFLKS  173


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHI  772
            E EL R  V+KR+W YI+ENNLQDP  K+++ICDE L  +F V+T   F + + L+ H 
Sbjct  112  ENELTRAVVIKRMWDYIKENNLQDPADKRKVICDEKLKELFEVETFHGFTVTKLLAAHF  170



>gb|KJB43608.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
 gb|KJB43612.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
Length=315

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 149/197 (76%), Gaps = 18/197 (9%)
 Frame = -2

Query  957  LVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSK  778
            L+  PE+ARTEVVK++W YIRE NLQDP  KK IICDE L  +F V++IDMF+MN+ LSK
Sbjct  137  LLGVPEMARTEVVKQMWVYIREKNLQDPVNKKNIICDEPLHALFGVESIDMFQMNKALSK  196

Query  777  HIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLA  598
            HI P++ ++V   KST KE+ RK  R+E       D D E K +EKRQ+G       FLA
Sbjct  197  HILPLDSDEV---KSTEKEKPRKHEREE-------DPD-EAKGKEKRQKG-------FLA  238

Query  597  PIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDS  418
            P+QLSD+LVKF GTGEN L+R  V+KRMW YIKEN LQDP++KR+VICD+KL+EL EV++
Sbjct  239  PLQLSDALVKFLGTGENELTRAVVIKRMWDYIKENNLQDPADKRKVICDEKLKELFEVET  298

Query  417  FEGFTMTKLLTAHFIKT  367
            F GFT+TKLL AHF+K+
Sbjct  299  FHGFTVTKLLAAHFLKS  315



>ref|XP_002306454.2| hypothetical protein POPTR_0005s14110g [Populus trichocarpa]
 gb|EEE93450.2| hypothetical protein POPTR_0005s14110g [Populus trichocarpa]
Length=316

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 151/211 (72%), Gaps = 16/211 (8%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  +  P LARTEVV+++W YIRE NLQDP  ++ I CDE L  +F V +I+MF+MN+ L
Sbjct  110  QEFIGVPHLARTEVVRQLWTYIREKNLQDPSDRRNINCDEPLQALFGVDSINMFQMNKAL  169

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDF------------EPKQEEK  640
            S+HIWP++ EDV  + S   E+Q K+ R+E   +S+ D+              E  ++EK
Sbjct  170  SRHIWPLDSEDVVSINSKQHEKQHKREREEG-NESNYDAILPRMLYLYVKYGNESNKKEK  228

Query  639  RQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRV  460
            +Q   KGG +GFLAP+QLSD+L KF GTGE+ LSR DVVKRMW+YIK+N LQDPS+KRR+
Sbjct  229  KQ---KGGNSGFLAPLQLSDALKKFLGTGESTLSRSDVVKRMWEYIKQNNLQDPSDKRRI  285

Query  459  ICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  367
            +CD KL+EL ++DSF GFT+ KLL+AHF+K 
Sbjct  286  LCDVKLKELFDIDSFTGFTVPKLLSAHFVKA  316



>gb|KEH27539.1| upstream activation factor subunit UAF30, putative [Medicago 
truncatula]
Length=267

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 149/205 (73%), Gaps = 11/205 (5%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V  PE+ARTEVVK++WAYIRE +LQDP  ++ IICDE L  +F V TI+MF+MN+ L
Sbjct  66   QEFVGAPEMARTEVVKQLWAYIREKDLQDPNNRRNIICDEPLRALFGVDTINMFQMNKVL  125

Query  783  SKHIWPIEKEDVTLVKSTPKER------QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLK  622
            +KHIWP++ +DV  VKS PKE+        +K + +     D D D EPK +EKRQ+   
Sbjct  126  AKHIWPLDSDDVIQVKSAPKEKPAPKEKPARKEKKKKQEREDDDLD-EPKGKEKRQK--V  182

Query  621  GGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKL  442
            G G GFLAP+QLSD+L KF   GE+ LSR DV+KRMW YIK N LQDPS+KR+++CD+KL
Sbjct  183  GSGKGFLAPLQLSDALAKFL--GESELSRSDVIKRMWDYIKGNNLQDPSDKRQILCDEKL  240

Query  441  RELLEVDSFEGFTMTKLLTAHFIKT  367
            +EL +VDSF GFT+TKLL  HFIK 
Sbjct  241  KELFDVDSFVGFTVTKLLAPHFIKA  265



>ref|XP_011009270.1| PREDICTED: protein TRI1-like [Populus euphratica]
Length=316

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 144/193 (75%), Gaps = 11/193 (6%)
 Frame = -2

Query  945  PELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWP  766
            P LARTEVV+++W YIRE NLQDP  ++ I CDE L  +F V +I+MF+MN+ LS+HIWP
Sbjct  135  PHLARTEVVRQLWNYIREKNLQDPSDRRNINCDEPLQALFGVDSINMFQMNKALSRHIWP  194

Query  765  IEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQL  586
            ++ EDV  + S   E+Q K+ R+E   +S+           K+++  KGG +GFLAP+QL
Sbjct  195  LDSEDVVSINSKQHEKQHKREREEEEDESN-----------KKEKKQKGGNSGFLAPLQL  243

Query  585  SDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGF  406
            SD+L KF GTGE+ LSR DVVKRMW+YIK+N LQDPS+KRR++CD KL+EL E+DSF GF
Sbjct  244  SDALKKFLGTGESTLSRSDVVKRMWEYIKQNNLQDPSDKRRILCDVKLKELFEIDSFTGF  303

Query  405  TMTKLLTAHFIKT  367
            T+ KLL+AHF+K 
Sbjct  304  TVPKLLSAHFVKA  316


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 62/108 (57%), Gaps = 3/108 (3%)
 Frame = -2

Query  702  RDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVV  523
            ++EV +D +   + +    E +  G K  G+GF     LS  L +FFG     L+R +VV
Sbjct  87   QEEVQSDDEEKGNVKRGYNENKNEG-KKRGSGFSKLCSLSPQLQEFFGVPH--LARTEVV  143

Query  522  KRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  379
            +++W YI+E  LQDPS++R + CD+ L+ L  VDS   F M K L+ H
Sbjct  144  RQLWNYIREKNLQDPSDRRNINCDEPLQALFGVDSINMFQMNKALSRH  191


 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHI  772
            E  L+R++VVKR+W YI++NNLQDP  K+RI+CD  L  +F + +   F + + LS H 
Sbjct  255  ESTLSRSDVVKRMWEYIKQNNLQDPSDKRRILCDVKLKELFEIDSFTGFTVPKLLSAHF  313



>gb|KJB43609.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
 gb|KJB43611.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
Length=331

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/206 (57%), Positives = 152/206 (74%), Gaps = 20/206 (10%)
 Frame = -2

Query  957  LVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSK  778
            L+  PE+ARTEVVK++W YIRE NLQDP  KK IICDE L  +F V++IDMF+MN+ LSK
Sbjct  137  LLGVPEMARTEVVKQMWVYIREKNLQDPVNKKNIICDEPLHALFGVESIDMFQMNKALSK  196

Query  777  HIWPIEKEDVTLVKSTPKERQRKKGRDEVYT---------DSDSDSDFEPKQEEKRQRGL  625
            HI P++ ++V   KS  +E+ RK  R+EV +         + + D D E K +EKRQ+G 
Sbjct  197  HILPLDSDEV---KSMEREKPRKHEREEVKSTEKEKPRKHEREEDPD-EAKGKEKRQKG-  251

Query  624  KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDK  445
                  FLAP+QLSD+LVKF GTGEN L+R  V+KRMW YIKEN LQDP++KR+VICD+K
Sbjct  252  ------FLAPLQLSDALVKFLGTGENELTRAVVIKRMWDYIKENNLQDPADKRKVICDEK  305

Query  444  LRELLEVDSFEGFTMTKLLTAHFIKT  367
            L+EL EV++F GFT+TKLL AHF+K+
Sbjct  306  LKELFEVETFHGFTVTKLLAAHFLKS  331



>gb|KJB43616.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
 gb|KJB43619.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
 gb|KJB43620.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
Length=189

 Score =   224 bits (570),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 145/192 (76%), Gaps = 4/192 (2%)
 Frame = -2

Query  939  LARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIE  760
            +ARTEVVK++W YIRE NLQDP  KK IICDE L  +F V++IDMF+MN+ LSKHI P++
Sbjct  1    MARTEVVKQMWVYIREKNLQDPVNKKNIICDEPLHALFGVESIDMFQMNKALSKHILPLD  60

Query  759  KEDVTLVKSTPKERQRKKGRDEV-YTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLS  583
             ++V   KS  +E+ RK  R+EV  T+ +     E +++    +G +    GFLAP+QLS
Sbjct  61   SDEV---KSMEREKPRKHEREEVKSTEKEKPRKHEREEDPDEAKGKEKRQKGFLAPLQLS  117

Query  582  DSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFT  403
            D+LVKF GTGEN L+R  V+KRMW YIKEN LQDP++KR+VICD+KL+EL EV++F GFT
Sbjct  118  DALVKFLGTGENELTRAVVIKRMWDYIKENNLQDPADKRKVICDEKLKELFEVETFHGFT  177

Query  402  MTKLLTAHFIKT  367
            +TKLL AHF+K+
Sbjct  178  VTKLLAAHFLKS  189


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHI  772
            E EL R  V+KR+W YI+ENNLQDP  K+++ICDE L  +F V+T   F + + L+ H 
Sbjct  128  ENELTRAVVIKRMWDYIKENNLQDPADKRKVICDEKLKELFEVETFHGFTVTKLLAAHF  186



>gb|AES94759.2| upstream activation factor subunit UAF30, putative [Medicago 
truncatula]
Length=344

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 149/205 (73%), Gaps = 11/205 (5%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V  PE+ARTEVVK++WAYIRE +LQDP  ++ IICDE L  +F V TI+MF+MN+ L
Sbjct  143  QEFVGAPEMARTEVVKQLWAYIREKDLQDPNNRRNIICDEPLRALFGVDTINMFQMNKVL  202

Query  783  SKHIWPIEKEDVTLVKSTPKER------QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLK  622
            +KHIWP++ +DV  VKS PKE+        +K + +     D D D EPK +EKRQ+   
Sbjct  203  AKHIWPLDSDDVIQVKSAPKEKPAPKEKPARKEKKKKQEREDDDLD-EPKGKEKRQK--V  259

Query  621  GGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKL  442
            G G GFLAP+QLSD+L KF   GE+ LSR DV+KRMW YIK N LQDPS+KR+++CD+KL
Sbjct  260  GSGKGFLAPLQLSDALAKFL--GESELSRSDVIKRMWDYIKGNNLQDPSDKRQILCDEKL  317

Query  441  RELLEVDSFEGFTMTKLLTAHFIKT  367
            +EL +VDSF GFT+TKLL  HFIK 
Sbjct  318  KELFDVDSFVGFTVTKLLAPHFIKA  342


 Score = 63.2 bits (152),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E EL+R++V+KR+W YI+ NNLQDP  K++I+CDE L  +F V +   F + + L+ H  
Sbjct  281  ESELSRSDVIKRMWDYIKGNNLQDPSDKRQILCDEKLKELFDVDSFVGFTVTKLLAPHFI  340

Query  768  PIEK  757
              E+
Sbjct  341  KAEQ  344



>gb|KJB43610.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
Length=315

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 148/197 (75%), Gaps = 18/197 (9%)
 Frame = -2

Query  957  LVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSK  778
            L+  PE+ARTEVVK++W YIRE NLQDP  KK IICDE L  +F V++IDMF+MN+ LSK
Sbjct  137  LLGVPEMARTEVVKQMWVYIREKNLQDPVNKKNIICDEPLHALFGVESIDMFQMNKALSK  196

Query  777  HIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLA  598
            HI P++ ++V   KS  +E+ RK  R+E       D D E K +EKRQ+G       FLA
Sbjct  197  HILPLDSDEV---KSMEREKPRKHEREE-------DPD-EAKGKEKRQKG-------FLA  238

Query  597  PIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDS  418
            P+QLSD+LVKF GTGEN L+R  V+KRMW YIKEN LQDP++KR+VICD+KL+EL EV++
Sbjct  239  PLQLSDALVKFLGTGENELTRAVVIKRMWDYIKENNLQDPADKRKVICDEKLKELFEVET  298

Query  417  FEGFTMTKLLTAHFIKT  367
            F GFT+TKLL AHF+K+
Sbjct  299  FHGFTVTKLLAAHFLKS  315



>gb|KJB43617.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
Length=173

 Score =   223 bits (567),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 144/191 (75%), Gaps = 18/191 (9%)
 Frame = -2

Query  939  LARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIE  760
            +ARTEVVK++W YIRE NLQDP  KK IICDE L  +F V++IDMF+MN+ LSKHI P++
Sbjct  1    MARTEVVKQMWVYIREKNLQDPVNKKNIICDEPLHALFGVESIDMFQMNKALSKHILPLD  60

Query  759  KEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSD  580
             ++V   KS  +E+ RK  R+E       D D E K +EKRQ+G       FLAP+QLSD
Sbjct  61   SDEV---KSMEREKPRKHEREE-------DPD-EAKGKEKRQKG-------FLAPLQLSD  102

Query  579  SLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTM  400
            +LVKF GTGEN L+R  V+KRMW YIKEN LQDP++KR+VICD+KL+EL EV++F GFT+
Sbjct  103  ALVKFLGTGENELTRAVVIKRMWDYIKENNLQDPADKRKVICDEKLKELFEVETFHGFTV  162

Query  399  TKLLTAHFIKT  367
            TKLL AHF+K+
Sbjct  163  TKLLAAHFLKS  173


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHI  772
            E EL R  V+KR+W YI+ENNLQDP  K+++ICDE L  +F V+T   F + + L+ H 
Sbjct  112  ENELTRAVVIKRMWDYIKENNLQDPADKRKVICDEKLKELFEVETFHGFTVTKLLAAHF  170



>gb|KHG26278.1| Upstream activation factor subunit spp27 [Gossypium arboreum]
Length=331

 Score =   227 bits (579),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 117/208 (56%), Positives = 152/208 (73%), Gaps = 20/208 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q L+  PE+ARTEVVK++W YIRE NLQDP  KK IICDE L  +F V++IDMF+MN+ L
Sbjct  135  QELLGVPEMARTEVVKQMWVYIREKNLQDPVNKKNIICDEPLHALFGVESIDMFQMNKAL  194

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYT---------DSDSDSDFEPKQEEKRQR  631
            SKHI P++ ++V   KS  +E+ RK  R+EV +         + + D D E K +EKRQ+
Sbjct  195  SKHILPLDSDEV---KSMEREKPRKHEREEVKSTEKEKPRKHEREEDPD-EAKGKEKRQK  250

Query  630  GLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICD  451
            G       FLAP+QLSD+LVKF GTGEN L+R  V+KRMW YIK N LQDP++KR+VICD
Sbjct  251  G-------FLAPLQLSDALVKFLGTGENELTRAVVIKRMWDYIKANNLQDPADKRKVICD  303

Query  450  DKLRELLEVDSFEGFTMTKLLTAHFIKT  367
            +KL+EL EV++F GFT+TKLL AHF+K+
Sbjct  304  EKLKELFEVETFHGFTVTKLLAAHFLKS  331



>ref|XP_003611801.1| Upstream activation factor subunit spp27 [Medicago truncatula]
Length=361

 Score =   228 bits (582),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 149/205 (73%), Gaps = 11/205 (5%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V  PE+ARTEVVK++WAYIRE +LQDP  ++ IICDE L  +F V TI+MF+MN+ L
Sbjct  143  QEFVGAPEMARTEVVKQLWAYIREKDLQDPNNRRNIICDEPLRALFGVDTINMFQMNKVL  202

Query  783  SKHIWPIEKEDVTLVKSTPKER------QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLK  622
            +KHIWP++ +DV  VKS PKE+        +K + +     D D D EPK +EKRQ+   
Sbjct  203  AKHIWPLDSDDVIQVKSAPKEKPAPKEKPARKEKKKKQEREDDDLD-EPKGKEKRQK--V  259

Query  621  GGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKL  442
            G G GFLAP+QLSD+L KF   GE+ LSR DV+KRMW YIK N LQDPS+KR+++CD+KL
Sbjct  260  GSGKGFLAPLQLSDALAKFL--GESELSRSDVIKRMWDYIKGNNLQDPSDKRQILCDEKL  317

Query  441  RELLEVDSFEGFTMTKLLTAHFIKT  367
            +EL +VDSF GFT+TKLL  HFIK 
Sbjct  318  KELFDVDSFVGFTVTKLLAPHFIKA  342


 Score = 63.2 bits (152),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E EL+R++V+KR+W YI+ NNLQDP  K++I+CDE L  +F V +   F + + L+ H  
Sbjct  281  ESELSRSDVIKRMWDYIKGNNLQDPSDKRQILCDEKLKELFDVDSFVGFTVTKLLAPHFI  340

Query  768  PIEK  757
              E+
Sbjct  341  KAEQ  344



>ref|XP_010028508.1| PREDICTED: DNA ligase 1 [Eucalyptus grandis]
 gb|KCW55248.1| hypothetical protein EUGRSUZ_I01179 [Eucalyptus grandis]
Length=469

 Score =   231 bits (590),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 150/198 (76%), Gaps = 14/198 (7%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            QV+  EP+LAR EVVKR+WAYIR NNLQDPK K+ I+CDE+L  +F V TI+MF+MN+ L
Sbjct  284  QVVTGEPDLARPEVVKRLWAYIRANNLQDPKNKQNIVCDESLRSLFCVDTINMFQMNKAL  343

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP+   +     S  +ER +        T  + + + + ++++KR       G+GF
Sbjct  344  SKHIWPLNGGEAPEKNSLKEERCQ-------ATRDEDEEEQKDEKQKKR-------GSGF  389

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
             AP+ LSD+LVKFFGTGE+ALSR DVVKRMW YIK+N+LQDPS+KRRVICD+KLRELLEV
Sbjct  390  TAPLPLSDALVKFFGTGESALSRADVVKRMWDYIKQNDLQDPSDKRRVICDEKLRELLEV  449

Query  423  DSFEGFTMTKLLTAHFIK  370
            DSF GF+++KLLTAHF+K
Sbjct  450  DSFNGFSVSKLLTAHFVK  467


 Score =   159 bits (401),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 87/222 (39%), Positives = 120/222 (54%), Gaps = 37/222 (17%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V E  LARTEVVKRIW +IR+ +LQDP  +++I+CDE+L  +F V +IDMF+MN+ L
Sbjct  137  QSFVGESTLARTEVVKRIWNHIRQKDLQDPSNRRKILCDESLHKLFHVNSIDMFQMNKAL  196

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPK----------------  652
            +KHIWP++ +D   +K T         ++E   DS SD +                    
Sbjct  197  AKHIWPLDADDENAIKKT---------KNEESVDSHSDGEVSNAMEEAEEDEQNENEEEE  247

Query  651  ----------QEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYI  502
                      +  K  +G+K  G GF     LS  L     TGE  L+R +VVKR+W YI
Sbjct  248  EMNGRRSKKGRSSKEDKGVKKRGGGFNKLCSLSPQLQVV--TGEPDLARPEVVKRLWAYI  305

Query  501  KENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            + N LQDP NK+ ++CD+ LR L  VD+   F M K L+ H 
Sbjct  306  RANNLQDPKNKQNIVCDESLRSLFCVDTINMFQMNKALSKHI  347



>ref|XP_010691015.1| PREDICTED: upstream activation factor subunit spp27 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=335

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 148/208 (71%), Gaps = 12/208 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q LV  PE+ARTEVVK++WAYI+E +LQDPK ++ I CD+ L  IFRV TI+MF+MN++L
Sbjct  127  QELVGVPEMARTEVVKKLWAYIKEKDLQDPKNRRNIKCDQMLHSIFRVDTINMFQMNKSL  186

Query  783  SKHIWPIEK-EDVTLVKSTPKERQRKKGRDEVYTDSDS---------DSDFEPKQEEKRQ  634
            +KHIWP+E  ED +     P ++Q+ +  ++  TD+ +         D D E   E  +Q
Sbjct  187  TKHIWPLESGEDCSTDAPAPAKKQKGQKDEDRSTDAPAPAKKQKRRKDEDTEKSNENTKQ  246

Query  633  RGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVIC  454
            +  KG  TGFL P+QLSD+  KF GTGE  + R D VKR+W YIK+N+LQDPS+KRR++C
Sbjct  247  K--KGNATGFLKPLQLSDAFAKFLGTGETTIVRSDAVKRIWDYIKQNQLQDPSDKRRILC  304

Query  453  DDKLRELLEVDSFEGFTMTKLLTAHFIK  370
            D+KL+EL +VD+F GFT++KLL+AH  K
Sbjct  305  DEKLKELFDVDTFNGFTVSKLLSAHLTK  332


 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E  + R++ VKRIW YI++N LQDP  K+RI+CDE L  +F V T + F +++ LS H+ 
Sbjct  272  ETTIVRSDAVKRIWDYIKQNQLQDPSDKRRILCDEKLKELFDVDTFNGFTVSKLLSAHLT  331

Query  768  PIE  760
             IE
Sbjct  332  KIE  334


 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 53/93 (57%), Gaps = 4/93 (4%)
 Frame = -2

Query  654  KQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  475
             +EEK ++  K  G+GF     LS  L +  G  E  ++R +VVK++W YIKE +LQDP 
Sbjct  102  LKEEKTKKKRK--GSGFTRLCSLSPQLQELVGVPE--MARTEVVKKLWAYIKEKDLQDPK  157

Query  474  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            N+R + CD  L  +  VD+   F M K LT H 
Sbjct  158  NRRNIKCDQMLHSIFRVDTINMFQMNKSLTKHI  190



>ref|XP_004148436.1| PREDICTED: upstream activation factor subunit UAF30 [Cucumis 
sativus]
 gb|KGN62068.1| hypothetical protein Csa_2G295440 [Cucumis sativus]
Length=332

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 152/212 (72%), Gaps = 25/212 (12%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  +  PE+ARTEVVK++W +IRENNLQDP  ++ I+CDE L  +F V +I+MF+MN+ L
Sbjct  129  QEFIGAPEMARTEVVKQLWNHIRENNLQDPSNRRNILCDEPLKALFGVNSINMFQMNKAL  188

Query  783  SKHIWPIEKEDVTLVKSTPKER--------------QRKKGRDEVYTDSDSDSDFEPKQE  646
            SKHIWP+E  DV   KS+ KE+              ++K+G++E   DSD  +     +E
Sbjct  189  SKHIWPLESNDVIPAKSSQKEKPQKEKQPKEKPQKKRQKQGKEE---DSDDSA-----RE  240

Query  645  EKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKR  466
            +KRQ   K G +GFLAP+ LS++LV F GTGE+AL R DVVKRMW YIK+N LQDPS+KR
Sbjct  241  DKRQ---KKGKSGFLAPLPLSNALVAFLGTGEDALPRSDVVKRMWDYIKQNNLQDPSDKR  297

Query  465  RVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  370
            R+ICD++L+EL +VDSF GFT++KLL  HFIK
Sbjct  298  RIICDERLKELFDVDSFNGFTVSKLLATHFIK  329



>ref|XP_009587440.1| PREDICTED: upstream activation factor subunit UAF30-like [Nicotiana 
tomentosiformis]
Length=344

 Score =   224 bits (572),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 147/205 (72%), Gaps = 13/205 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q    E ELARTEVVKR+W YIREN+LQ+P  ++ I CD+TL  +F V  IDMF+MN+ L
Sbjct  145  QKFTGEAELARTEVVKRMWNYIRENDLQEPSNRRNINCDDTLRELFGVDKIDMFQMNKAL  204

Query  783  SKHIWPIEKEDVTL------VKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLK  622
            +KHIWP++ + V+       V ST KE+     +     + D DSD EPK++EKR     
Sbjct  205  AKHIWPLDSDGVSTITTSGSVNSTAKEKSSTAKKKRRKQEEDEDSD-EPKRKEKRH----  259

Query  621  GGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKL  442
               +G LAP+QLSD+L+KF GTGE+ L RG+VVKR+W YIK+N LQDPS+KR++ICD+KL
Sbjct  260  --NSGILAPLQLSDALIKFLGTGESELPRGNVVKRIWDYIKQNNLQDPSDKRKIICDEKL  317

Query  441  RELLEVDSFEGFTMTKLLTAHFIKT  367
            +EL +VD+F GF ++KLLTAHFIK 
Sbjct  318  KELFDVDTFTGFGVSKLLTAHFIKA  342


 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E EL R  VVKRIW YI++NNLQDP  K++IICDE L  +F V T   F +++ L+ H  
Sbjct  281  ESELPRGNVVKRIWDYIKQNNLQDPSDKRKIICDEKLKELFDVDTFTGFGVSKLLTAHFI  340

Query  768  PIEK  757
              E+
Sbjct  341  KAER  344



>ref|XP_003558997.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Brachypodium distachyon]
Length=334

 Score =   224 bits (571),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 143/200 (72%), Gaps = 16/200 (8%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V   ELARTEVVK++WAYIRENNLQDP  K++I+CDETL  +F+V +IDMF+MN+ L
Sbjct  149  QEFVGASELARTEVVKKLWAYIRENNLQDPSNKRKILCDETLKKLFKVNSIDMFQMNKAL  208

Query  783  SKHIWPIEKED-VTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTG  607
            +KHIWP+  E   +  KSTPKE+ +K+ ++E                +K++ G    GTG
Sbjct  209  TKHIWPLNSEGPASPKKSTPKEKPQKREKNE---------------GKKQKVGSSRPGTG  253

Query  606  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  427
              AP+QLSD L  F GTGE+ LSR DVVK MW YIKEN LQDPS++R++ICD+KL+ L +
Sbjct  254  LNAPLQLSDDLANFIGTGESMLSRSDVVKIMWDYIKENNLQDPSDRRKIICDEKLKNLFQ  313

Query  426  VDSFEGFTMTKLLTAHFIKT  367
            VDSF GFT++KLL+ HF KT
Sbjct  314  VDSFTGFTVSKLLSPHFTKT  333



>ref|XP_010691016.1| PREDICTED: upstream activation factor subunit spp27 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=330

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 143/203 (70%), Gaps = 7/203 (3%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q LV  PE+ARTEVVK++WAYI+E +LQDPK ++ I CD+ L  IFRV TI+MF+MN++L
Sbjct  127  QELVGVPEMARTEVVKKLWAYIKEKDLQDPKNRRNIKCDQMLHSIFRVDTINMFQMNKSL  186

Query  783  SKHIWPIEK-EDVTLVKSTPKERQRKKGRDEVYTDSDS----DSDFEPKQEEKRQRGLKG  619
            +KHIWP+E  ED +     P ++Q+ +  D            D D E   E  +Q+  KG
Sbjct  187  TKHIWPLESGEDCSTDAPAPAKKQKDRSTDAPAPAKKQKRRKDEDTEKSNENTKQK--KG  244

Query  618  GGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLR  439
              TGFL P+QLSD+  KF GTGE  + R D VKR+W YIK+N+LQDPS+KRR++CD+KL+
Sbjct  245  NATGFLKPLQLSDAFAKFLGTGETTIVRSDAVKRIWDYIKQNQLQDPSDKRRILCDEKLK  304

Query  438  ELLEVDSFEGFTMTKLLTAHFIK  370
            EL +VD+F GFT++KLL+AH  K
Sbjct  305  ELFDVDTFNGFTVSKLLSAHLTK  327


 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E  + R++ VKRIW YI++N LQDP  K+RI+CDE L  +F V T + F +++ LS H+ 
Sbjct  267  ETTIVRSDAVKRIWDYIKQNQLQDPSDKRRILCDEKLKELFDVDTFNGFTVSKLLSAHLT  326

Query  768  PIE  760
             IE
Sbjct  327  KIE  329


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 53/93 (57%), Gaps = 4/93 (4%)
 Frame = -2

Query  654  KQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  475
             +EEK ++  K  G+GF     LS  L +  G  E  ++R +VVK++W YIKE +LQDP 
Sbjct  102  LKEEKTKKKRK--GSGFTRLCSLSPQLQELVGVPE--MARTEVVKKLWAYIKEKDLQDPK  157

Query  474  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            N+R + CD  L  +  VD+   F M K LT H 
Sbjct  158  NRRNIKCDQMLHSIFRVDTINMFQMNKSLTKHI  190



>ref|XP_009803136.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X1 [Nicotiana sylvestris]
Length=340

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 147/205 (72%), Gaps = 13/205 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q    E ELARTEVVKR+W YIREN+LQ+P  ++ I CD+TL  +F V  IDMF+MN+ L
Sbjct  141  QKFTGEAELARTEVVKRMWNYIRENDLQEPSNRRNINCDDTLRELFGVDKIDMFQMNKAL  200

Query  783  SKHIWPIEKEDVTL------VKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLK  622
            +KHIWP++ + V+       V ST +E+     +     + D DSD EPK++EKR     
Sbjct  201  AKHIWPLDSDGVSTITTSGSVNSTAREKNSTAKKKRQKQEEDEDSD-EPKRKEKRH----  255

Query  621  GGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKL  442
               +G LAP+QLSD+L+KF GTGE+ L RG+VVKR+W YIK+N LQDPS+KR++ICD+KL
Sbjct  256  --NSGILAPLQLSDALIKFLGTGESELPRGNVVKRIWDYIKQNNLQDPSDKRKIICDEKL  313

Query  441  RELLEVDSFEGFTMTKLLTAHFIKT  367
            +EL +VD+F GF ++KLLTAHFIK 
Sbjct  314  KELFDVDTFTGFGVSKLLTAHFIKA  338


 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E EL R  VVKRIW YI++NNLQDP  K++IICDE L  +F V T   F +++ L+ H  
Sbjct  277  ESELPRGNVVKRIWDYIKQNNLQDPSDKRKIICDEKLKELFDVDTFTGFGVSKLLTAHFI  336

Query  768  PIEK  757
              E+
Sbjct  337  KAER  340



>ref|XP_010096161.1| Upstream activation factor subunit spp27 [Morus notabilis]
 gb|EXB63556.1| Upstream activation factor subunit spp27 [Morus notabilis]
Length=463

 Score =   226 bits (576),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 157/199 (79%), Gaps = 3/199 (2%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  + E ELARTEVVK++W+YI+EN+LQDPK K+ IICDE+L  +F V  I+MF+MN+ L
Sbjct  267  QAFIGEAELARTEVVKKLWSYIKENDLQDPKNKQNIICDESLRALFHVDRINMFQMNKAL  326

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHIWP+  ++     S+ KE+Q K+ ++E   +   +   EPK++EKRQ   K GG+GF
Sbjct  327  AKHIWPLNADNAVTENSSQKEKQSKQEQEEEEEEDKEEDSDEPKKKEKRQ---KKGGSGF  383

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
             AP+ LSD+LVKF GTGEN LSR DVVKRMW+YIK+N+LQDPS+KRR++CDDKL+EL +V
Sbjct  384  TAPLPLSDALVKFIGTGENTLSRADVVKRMWQYIKQNDLQDPSDKRRILCDDKLKELFDV  443

Query  423  DSFEGFTMTKLLTAHFIKT  367
            DSF GF++TKLLTAHF+KT
Sbjct  444  DSFNGFSVTKLLTAHFVKT  462


 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 129/220 (59%), Gaps = 33/220 (15%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V E E++R EVVK++W+YIREN+LQDPK K+ IICDE+L  +FRV TI+MF+MN+ L
Sbjct  120  QEVVGEAEMSRPEVVKKLWSYIRENDLQDPKNKRNIICDESLQALFRVNTINMFQMNKAL  179

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGL-------  625
            SKHIWP+  ED  +       RQ+KK  D  +++S+ +S+   KQEE+ +          
Sbjct  180  SKHIWPLSTEDENV-------RQKKKAEDIDHSESEEESNKAQKQEEEEEEEEEEDEKDS  232

Query  624  -----------------KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKE  496
                             K GG GF     LS  L  F G  E  L+R +VVK++W YIKE
Sbjct  233  RRRKRKGRSAKVDKDVKKRGGGGFAKVCSLSPQLQAFIGEAE--LARTEVVKKLWSYIKE  290

Query  495  NELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            N+LQDP NK+ +ICD+ LR L  VD    F M K L  H 
Sbjct  291  NDLQDPKNKQNIICDESLRALFHVDRINMFQMNKALAKHI  330



>ref|XP_006650641.1| PREDICTED: upstream activation factor subunit spp27-like [Oryza 
brachyantha]
Length=338

 Score =   219 bits (558),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 143/203 (70%), Gaps = 19/203 (9%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V   ELARTEVVK++WAYIREN+LQDP  KK+I+CDE L  IF V +IDMF+MN+ L
Sbjct  150  QEFVGASELARTEVVKKLWAYIRENSLQDPNNKKKILCDERLKKIFNVNSIDMFQMNKAL  209

Query  783  SKHIWPIEKE----DVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGG  616
            +KHIWP+  E     V+  +STPKE+ +K+ R+E        S                 
Sbjct  210  TKHIWPLNSEGPVTSVSPERSTPKEKPQKRERNEGKKQKGGSSGSG--------------  255

Query  615  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  436
             +GFL P+QLSD LVKF GTGE+ LSR DVVKRMW YIKEN+LQDPS++R++ICD+KL++
Sbjct  256  -SGFLVPLQLSDDLVKFIGTGESMLSRSDVVKRMWDYIKENKLQDPSDRRKIICDEKLKD  314

Query  435  LLEVDSFEGFTMTKLLTAHFIKT  367
            LL+V+SF GFT++KLL  HF KT
Sbjct  315  LLQVESFNGFTVSKLLAPHFTKT  337



>ref|XP_008457882.1| PREDICTED: upstream activation factor subunit UAF30-like [Cucumis 
melo]
Length=332

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/212 (53%), Positives = 150/212 (71%), Gaps = 25/212 (12%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  +   E+ARTEVVK++W +IRENNLQDP  ++ I+CDE L  +F V +I+MF+MN+ L
Sbjct  129  QEFIGATEMARTEVVKQLWNHIRENNLQDPSNRRNILCDEPLKALFGVNSINMFQMNKAL  188

Query  783  SKHIWPIEKEDV--------------TLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQE  646
            SKHIWP+E  DV                 K  P+++++K+G++E   DSD  +     +E
Sbjct  189  SKHIWPLESNDVIPAKSSQKEKQQKEKQPKEKPQKKRQKQGKEE---DSDDSA-----RE  240

Query  645  EKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKR  466
            +KRQ   K G +GFLAP+ LSD+LV F GTGE+AL R DVVKRMW YIK+N LQDPS+KR
Sbjct  241  DKRQ---KKGKSGFLAPLPLSDALVAFLGTGEDALPRSDVVKRMWDYIKQNNLQDPSDKR  297

Query  465  RVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  370
            R+ICD++L+EL +VDSF GFT++KLL  HFIK
Sbjct  298  RIICDERLKELFDVDSFNGFTVSKLLATHFIK  329



>gb|ABF99032.1| SWIB complex BAF60b domain-containing protein, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EEC76232.1| hypothetical protein OsI_13647 [Oryza sativa Indica Group]
 gb|EEE59982.1| hypothetical protein OsJ_12695 [Oryza sativa Japonica Group]
Length=334

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 142/203 (70%), Gaps = 19/203 (9%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V   ELARTEVVK++WAYIRENNLQDP  K++I+CDE L  IF V +IDMF+MN+ L
Sbjct  146  QEFVGASELARTEVVKKLWAYIRENNLQDPSNKRKILCDERLKKIFNVNSIDMFQMNKAL  205

Query  783  SKHIWPIEKE----DVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGG  616
            +KHIWP+  +      +  +STPKE+ +K+ R+E        S                 
Sbjct  206  TKHIWPLNSDGPVTSASPERSTPKEKPQKRERNEGKKQKGGSSGSG--------------  251

Query  615  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  436
             +GFL P+QLSD LVKF GTGE+ LSR DVVKRMW YIKEN+LQDPS++R++ICD+KL++
Sbjct  252  -SGFLVPLQLSDDLVKFIGTGESMLSRSDVVKRMWDYIKENKLQDPSDRRKIICDEKLKD  310

Query  435  LLEVDSFEGFTMTKLLTAHFIKT  367
            LL+V+SF GFT++KLL  HF KT
Sbjct  311  LLQVESFNGFTVSKLLAPHFTKT  333



>dbj|BAB01706.1| unnamed protein product [Arabidopsis thaliana]
Length=452

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 143/192 (74%), Gaps = 11/192 (6%)
 Frame = -2

Query  942  ELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI  763
            ELARTEVVK +W YI+ENNLQDP  K+ IICDE+   +F V++I+MF+MN+ L+KHIWP+
Sbjct  270  ELARTEVVKLLWKYIKENNLQDPNDKRSIICDESFRSLFPVESINMFQMNKQLTKHIWPL  329

Query  762  EKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLS  583
            E      V S    +  K G+ ++ +D D+DS+ EP +++K+Q+         LAP+ LS
Sbjct  330  EDNAGESVSS----KSPKNGKQKMESDGDTDSE-EPNEKDKKQK------KEVLAPLPLS  378

Query  582  DSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFT  403
            D+LVKF G GEN+LSR DVVKR+W+YI  N+LQDPS+KRRVICD+KL+EL EVDSFE  +
Sbjct  379  DALVKFLGDGENSLSRADVVKRLWEYINHNDLQDPSDKRRVICDEKLKELFEVDSFEDTS  438

Query  402  MTKLLTAHFIKT  367
            ++KLLT HFIK 
Sbjct  439  VSKLLTNHFIKA  450


 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 94/218 (43%), Positives = 124/218 (57%), Gaps = 30/218 (14%)
 Frame = -2

Query  957  LVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSK  778
            +V   +L RTEVVK++WAYIRE +LQDPK +++I+CDE L  +FRVKTI+MF+MN+ L+K
Sbjct  115  VVGASQLGRTEVVKKMWAYIREKDLQDPKDRRKIVCDELLHSLFRVKTINMFQMNKALTK  174

Query  777  HIWPIEKED--VTLVKSTPKERQRKKGRDEVYTDSDSDSDFE------------------  658
            HIWP+   D     VK    E +  +G D+    S+   + +                  
Sbjct  175  HIWPLGDGDGCANDVKEE-DEDEASEGTDKKGEQSEEVEENKEEESEEQEVRSLRKRKRK  233

Query  657  ----PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENE  490
                 K  EK +R  KGGG GF     LS  L  F G  E  L+R +VVK +WKYIKEN 
Sbjct  234  KNRPAKSVEKPKR--KGGG-GFAKVCSLSPELQAFTGVTE--LARTEVVKLLWKYIKENN  288

Query  489  LQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            LQDP++KR +ICD+  R L  V+S   F M K LT H 
Sbjct  289  LQDPNDKRSIICDESFRSLFPVESINMFQMNKQLTKHI  326


 Score = 69.7 bits (169),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 2/80 (3%)
 Frame = -2

Query  615  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  436
            G G     QLS  L K  G  +  L R +VVK+MW YI+E +LQDP ++R+++CD+ L  
Sbjct  99   GGGITKVSQLSPQLEKVVGASQ--LGRTEVVKKMWAYIREKDLQDPKDRRKIVCDELLHS  156

Query  435  LLEVDSFEGFTMTKLLTAHF  376
            L  V +   F M K LT H 
Sbjct  157  LFRVKTINMFQMNKALTKHI  176


 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E  L+R +VVKR+W YI  N+LQDP  K+R+ICDE L  +F V + +   +++ L+ H  
Sbjct  389  ENSLSRADVVKRLWEYINHNDLQDPSDKRRVICDEKLKELFEVDSFEDTSVSKLLTNHFI  448

Query  768  PIEK  757
              E+
Sbjct  449  KAEQ  452



>ref|XP_011626436.1| PREDICTED: upstream activation factor subunit spp27 [Amborella 
trichopoda]
Length=303

 Score =   211 bits (537),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 134/194 (69%), Gaps = 21/194 (11%)
 Frame = -2

Query  939  LARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIE  760
            L RTEVVKRIWA+IRE+NLQDP  K+ IICDE L  +F V +I MF+MN+ LSKHI P+ 
Sbjct  127  LPRTEVVKRIWAHIREHNLQDPANKRNIICDEQLRSLFDVDSIGMFQMNKVLSKHILPLA  186

Query  759  KE---DVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQ  589
             E   DV++ K  P                  D      + +K+++G  G G+  LAP+ 
Sbjct  187  TENGPDVSVPKVKP------------------DVSVPKVKRQKQEKGQGGKGSALLAPLP  228

Query  588  LSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEG  409
            LSD+L+KF GTGENAL R +V+KR+W +IK+NELQDPS+KRR+ICD KL+ELLEVD+F G
Sbjct  229  LSDALIKFIGTGENALPRSEVIKRIWNHIKQNELQDPSDKRRIICDKKLKELLEVDTFNG  288

Query  408  FTMTKLLTAHFIKT  367
            F++ KLL  HFIKT
Sbjct  289  FSVAKLLAPHFIKT  302


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 55/85 (65%), Gaps = 2/85 (2%)
 Frame = -2

Query  618  GGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLR  439
            GG GF  P  LS  L  F G   + L R +VVKR+W +I+E+ LQDP+NKR +ICD++LR
Sbjct  104  GGGGFSKPCGLSPELQAFMGV--SVLPRTEVVKRIWAHIREHNLQDPANKRNIICDEQLR  161

Query  438  ELLEVDSFEGFTMTKLLTAHFIKTA  364
             L +VDS   F M K+L+ H +  A
Sbjct  162  SLFDVDSIGMFQMNKVLSKHILPLA  186


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E  L R+EV+KRIW +I++N LQDP  K+RIICD+ L  +  V T + F + + L+ H  
Sbjct  241  ENALPRSEVIKRIWNHIKQNELQDPSDKRRIICDKKLKELLEVDTFNGFSVAKLLAPHFI  300

Query  768  PIE  760
              E
Sbjct  301  KTE  303



>ref|XP_004981658.1| PREDICTED: upstream activation factor subunit spp27-like [Setaria 
italica]
Length=332

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 146/200 (73%), Gaps = 16/200 (8%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V   ELARTEVVK++WAYIRE+NLQD   K++I+ DE L  IF V +IDMF+MN+ L
Sbjct  147  QEFVGASELARTEVVKKLWAYIREHNLQDQSNKRKILPDERLRKIFNVNSIDMFQMNKAL  206

Query  783  SKHIWPIEKED-VTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTG  607
            +KHIWP+  E  V+  +STPKE+ +K+ R+E                +K++ G  G G+G
Sbjct  207  TKHIWPLNSEGPVSPDRSTPKEKPQKRDRNE---------------GKKQKGGSSGAGSG  251

Query  606  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  427
             L P+QLS+ LVKF GTGE+ LSR DVVKRMW+YIKEN LQDPS++R++ICD+KL++LL+
Sbjct  252  LLVPLQLSNDLVKFIGTGESMLSRSDVVKRMWEYIKENNLQDPSDRRKIICDEKLKDLLQ  311

Query  426  VDSFEGFTMTKLLTAHFIKT  367
            V+SF GFT++KLL  HF KT
Sbjct  312  VESFNGFTVSKLLAPHFTKT  331



>ref|NP_188538.1| SWIB complex BAF60b domain-containing protein [Arabidopsis thaliana]
 gb|AEE76191.1| SWIB complex BAF60b domain-containing protein [Arabidopsis thaliana]
Length=462

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 141/192 (73%), Gaps = 13/192 (7%)
 Frame = -2

Query  942  ELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI  763
            ELARTEVVK +W YI+ENNLQDP  K+ IICDE+   +F V++I+MF+MN+ L+KHIWP+
Sbjct  282  ELARTEVVKLLWKYIKENNLQDPNDKRSIICDESFRSLFPVESINMFQMNKQLTKHIWPL  341

Query  762  EKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLS  583
            E      V S    +  K G+ ++ +D DS+   EP +++K+Q+         LAP+ LS
Sbjct  342  EDNAGESVSS----KSPKNGKQKMESDGDSE---EPNEKDKKQK------KEVLAPLPLS  388

Query  582  DSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFT  403
            D+LVKF G GEN+LSR DVVKR+W+YI  N+LQDPS+KRRVICD+KL+EL EVDSFE  +
Sbjct  389  DALVKFLGDGENSLSRADVVKRLWEYINHNDLQDPSDKRRVICDEKLKELFEVDSFEDTS  448

Query  402  MTKLLTAHFIKT  367
            ++KLLT HFIK 
Sbjct  449  VSKLLTNHFIKA  460


 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 120/215 (56%), Gaps = 26/215 (12%)
 Frame = -2

Query  957  LVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSK  778
            +V   +L RTEVVK++WAYIRE +LQDPK +++I+CDE L  +FRVKTI+MF+MN+ L+K
Sbjct  129  VVGASQLGRTEVVKKMWAYIREKDLQDPKDRRKIVCDELLHSLFRVKTINMFQMNKALTK  188

Query  777  HIWPIEKED--VTLVK----STPKERQRKKGRDE---------------VYTDSDSDSDF  661
            HIWP+   D     VK        E   KKG                  V +        
Sbjct  189  HIWPLGDGDGCANDVKEEDEDEASEGTDKKGEQSEEVEENKEEESEEQEVRSLRKRKRKK  248

Query  660  EPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  481
              K  EK +R  KGGG GF     LS  L  F G  E  L+R +VVK +WKYIKEN LQD
Sbjct  249  PAKSVEKPKR--KGGG-GFAKVCSLSPELQAFTGVTE--LARTEVVKLLWKYIKENNLQD  303

Query  480  PSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            P++KR +ICD+  R L  V+S   F M K LT H 
Sbjct  304  PNDKRSIICDESFRSLFPVESINMFQMNKQLTKHI  338


 Score = 70.1 bits (170),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 2/80 (3%)
 Frame = -2

Query  615  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  436
            G G     QLS  L K  G  +  L R +VVK+MW YI+E +LQDP ++R+++CD+ L  
Sbjct  113  GGGITKVSQLSPQLEKVVGASQ--LGRTEVVKKMWAYIREKDLQDPKDRRKIVCDELLHS  170

Query  435  LLEVDSFEGFTMTKLLTAHF  376
            L  V +   F M K LT H 
Sbjct  171  LFRVKTINMFQMNKALTKHI  190


 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E  L+R +VVKR+W YI  N+LQDP  K+R+ICDE L  +F V + +   +++ L+ H  
Sbjct  399  ENSLSRADVVKRLWEYINHNDLQDPSDKRRVICDEKLKELFEVDSFEDTSVSKLLTNHFI  458

Query  768  PIEK  757
              E+
Sbjct  459  KAEQ  462



>ref|NP_001147426.1| LOC100281035 [Zea mays]
 gb|ACG27473.1| SWIB/MDM2 domain containing protein [Zea mays]
 gb|AFW67526.1| SWIB/MDM2 domain containing protein [Zea mays]
Length=328

 Score =   208 bits (530),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 144/200 (72%), Gaps = 16/200 (8%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V   ELARTEVVK++WAYIRENNLQD   +++I+ DE L  IF V +IDMF+MN+ L
Sbjct  143  QEFVGASELARTEVVKKLWAYIRENNLQDQNNRRKILPDERLKKIFNVNSIDMFQMNKAL  202

Query  783  SKHIWPIEKED-VTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTG  607
            +KHIWP+  E  V+  +STPKE+ +KK R+E                +K++ G  G G+G
Sbjct  203  TKHIWPLNSEGPVSPDRSTPKEKPQKKDRNE---------------GKKQKGGSSGAGSG  247

Query  606  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  427
             L P+QLSD L+KF GTGE+ LSR DVVKRMW YIKEN LQDPS++R++ICD+KL++LL 
Sbjct  248  LLVPLQLSDDLMKFIGTGESMLSRSDVVKRMWDYIKENNLQDPSDRRKIICDEKLKDLLG  307

Query  426  VDSFEGFTMTKLLTAHFIKT  367
            V++F GFT++KLL  HF KT
Sbjct  308  VETFTGFTVSKLLAPHFTKT  327



>ref|XP_002466401.1| hypothetical protein SORBIDRAFT_01g007140 [Sorghum bicolor]
 gb|EER93399.1| hypothetical protein SORBIDRAFT_01g007140 [Sorghum bicolor]
Length=326

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 144/200 (72%), Gaps = 16/200 (8%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V   ELARTEVVK++WAYIRENNLQD   +++I+ DE L  IF V +IDMF+MN+ L
Sbjct  141  QEFVGASELARTEVVKKLWAYIRENNLQDQNNRRKILPDERLRKIFNVNSIDMFQMNKAL  200

Query  783  SKHIWPIEKED-VTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTG  607
            +KHIWP+  E  V+  +STPKE+ +K+ R+E                +K++ G  G G+G
Sbjct  201  TKHIWPLNSEGPVSPDRSTPKEKPQKRDRNE---------------GKKQKGGSSGAGSG  245

Query  606  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  427
             L P+QLSD LVKF GTGE+ LSR DVVK+MW YIKEN LQDPS++R++ICD+KL++LL 
Sbjct  246  LLVPLQLSDDLVKFIGTGESMLSRSDVVKKMWDYIKENNLQDPSDRRKIICDEKLKDLLG  305

Query  426  VDSFEGFTMTKLLTAHFIKT  367
            V++F GFT++KLL  HF KT
Sbjct  306  VETFTGFTVSKLLAPHFTKT  325


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 62/104 (60%), Gaps = 8/104 (8%)
 Frame = -2

Query  681  SDSDSDFEPKQEEKRQRGLKGG--GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWK  508
             D DS        K+QRG  G   G GF     LS +L +F G  E  L+R +VVK++W 
Sbjct  107  EDGDS----SGARKKQRGNDGKKRGGGFTKLCSLSPALQEFVGASE--LARTEVVKKLWA  160

Query  507  YIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            YI+EN LQD +N+R+++ D++LR++  V+S + F M K LT H 
Sbjct  161  YIRENNLQDQNNRRKILPDERLRKIFNVNSIDMFQMNKALTKHI  204



>gb|AGT16365.1| SWIB/MDM2 domain containing protein [Saccharum hybrid cultivar 
R570]
 gb|AGT16695.1| SWIB/MDM2 domain containing protein [Saccharum hybrid cultivar 
R570]
Length=332

 Score =   206 bits (524),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 143/200 (72%), Gaps = 16/200 (8%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V   ELARTEVVK++WAYIRENNLQD   +++I+ DE L  IF V +IDMF+MN+ L
Sbjct  147  QEFVGASELARTEVVKKLWAYIRENNLQDQNNRRKILPDERLRKIFNVNSIDMFQMNKAL  206

Query  783  SKHIWPIEKED-VTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTG  607
            +KHIWP+  E  V+  +STPKE+ +K+ R+E                +K + G  G G+G
Sbjct  207  TKHIWPLNSEGPVSPDRSTPKEKPQKRDRNE---------------GKKPKGGSSGAGSG  251

Query  606  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  427
             L P+QLSD LVKF GTGE+ LSR DVVK+MW YIKEN LQDPS++R++ICD+KL++LL 
Sbjct  252  LLVPLQLSDDLVKFIGTGESMLSRSDVVKKMWDYIKENNLQDPSDRRKIICDEKLKDLLG  311

Query  426  VDSFEGFTMTKLLTAHFIKT  367
            V++F GFT++KLL  HF KT
Sbjct  312  VETFTGFTVSKLLAPHFTKT  331


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 62/104 (60%), Gaps = 8/104 (8%)
 Frame = -2

Query  681  SDSDSDFEPKQEEKRQRGLKGG--GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWK  508
             D DS        K+QRG  G   G GF     LS +L +F G  E  L+R +VVK++W 
Sbjct  113  EDGDSS----GARKKQRGNDGKKRGGGFTKLCSLSPALQEFVGASE--LARTEVVKKLWA  166

Query  507  YIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            YI+EN LQD +N+R+++ D++LR++  V+S + F M K LT H 
Sbjct  167  YIRENNLQDQNNRRKILPDERLRKIFNVNSIDMFQMNKALTKHI  210



>gb|AGT16808.1| SWIB/MDM2 domain containing protein [Saccharum hybrid cultivar 
R570]
Length=326

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 143/200 (72%), Gaps = 16/200 (8%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V   ELARTEVVK++WAYIRENNLQD   +++I+ DE L  +F V +IDMF+MN+ L
Sbjct  141  QEFVGASELARTEVVKKLWAYIRENNLQDQNNRRKILPDERLRKVFNVNSIDMFQMNKAL  200

Query  783  SKHIWPIEKED-VTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTG  607
            +KHIWP+  E  V+  +STPKE+ +K+ R+E                +K + G  G G+G
Sbjct  201  TKHIWPLNSEGPVSPDRSTPKEKPQKRDRNE---------------GKKPKGGSSGAGSG  245

Query  606  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  427
             L P+QLSD LVKF GTGE+ LSR DVVK+MW YIKEN LQDPS++R++ICD+KL++LL 
Sbjct  246  LLVPLQLSDDLVKFIGTGESMLSRSDVVKKMWDYIKENNLQDPSDRRKIICDEKLKDLLG  305

Query  426  VDSFEGFTMTKLLTAHFIKT  367
            V++F GFT++KLL  HF KT
Sbjct  306  VETFTGFTVSKLLAPHFTKT  325


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 62/104 (60%), Gaps = 8/104 (8%)
 Frame = -2

Query  681  SDSDSDFEPKQEEKRQRGLKGG--GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWK  508
             D DS        K+QRG  G   G GF     LS +L +F G  E  L+R +VVK++W 
Sbjct  107  EDGDSS----GARKKQRGNDGKKRGGGFTKLCSLSPALQEFVGASE--LARTEVVKKLWA  160

Query  507  YIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            YI+EN LQD +N+R+++ D++LR++  V+S + F M K LT H 
Sbjct  161  YIRENNLQDQNNRRKILPDERLRKVFNVNSIDMFQMNKALTKHI  204



>ref|NP_001148210.1| SWIB/MDM2 domain containing protein [Zea mays]
 gb|ACG30187.1| SWIB/MDM2 domain containing protein [Zea mays]
Length=329

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 142/200 (71%), Gaps = 16/200 (8%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V   ELARTEVVK++WAYIRENNLQD   +++I+ DE L  IF V +IDMF+MN+ L
Sbjct  144  QEFVGASELARTEVVKKLWAYIRENNLQDQNNRRKILPDERLKKIFNVNSIDMFQMNKAL  203

Query  783  SKHIWPIEKED-VTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTG  607
            +KHIWP+  E  V+  +STPKE+ +K+ R E                +K++ G  G G+G
Sbjct  204  TKHIWPLNSEGPVSPDRSTPKEKPQKRDRSE---------------GKKQKGGSSGAGSG  248

Query  606  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  427
            FL P+QLSD LVKF GTGE+ LSR DVVK+MW YIK N LQDPS++R++ICD+KL++L  
Sbjct  249  FLVPLQLSDDLVKFIGTGESMLSRSDVVKKMWDYIKGNNLQDPSDRRKIICDEKLKDLFG  308

Query  426  VDSFEGFTMTKLLTAHFIKT  367
            V++F GFT++KLL  HF KT
Sbjct  309  VETFTGFTVSKLLAPHFTKT  328



>emb|CDX99270.1| BnaC05g33850D [Brassica napus]
Length=464

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 148/201 (74%), Gaps = 13/201 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      +LARTEVVK +W YI+ENNLQDPK  + IICDE+L  +F +++I+MF+MN+ L
Sbjct  271  QAFTGMTKLARTEVVKMLWKYIKENNLQDPKDGRTIICDESLRSLFPLESINMFQMNKHL  330

Query  783  SKHIWPIE-KEDVTLVKSTPKERQRKKGRDEVYTDSD--SDSDFEPKQEEKRQRGLKGGG  613
            +KHIWP+E     +   S+PK  + K   ++  T+SD  +++D +PK+E          G
Sbjct  331  TKHIWPLEDNAGESGGSSSPKNGKLKMETEDGDTESDELNENDEKPKKE----------G  380

Query  612  TGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLREL  433
             G LAP+ LSD+L+KF G GE++LSR DVVKR+W+YI++N+LQDPS+K+R+ICD+KL+EL
Sbjct  381  CGLLAPLPLSDALIKFLGDGESSLSRADVVKRLWEYIEQNDLQDPSDKKRIICDEKLKEL  440

Query  432  LEVDSFEGFTMTKLLTAHFIK  370
             EVDSFE  +++KLLT+H+IK
Sbjct  441  FEVDSFEDISVSKLLTSHYIK  461


 Score =   157 bits (397),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 93/207 (45%), Positives = 119/207 (57%), Gaps = 23/207 (11%)
 Frame = -2

Query  942  ELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI  763
            +LARTEVVK++WAYI+E +LQDPK +++I+CDE+L  +F VK I+MF+MN+ L+KHIWP+
Sbjct  133  QLARTEVVKKMWAYIKEKDLQDPKDRRKILCDESLHSLFHVKAINMFQMNKALAKHIWPL  192

Query  762  EKED---VTLVKSTPKERQRKKGRDE---------------VYTDSDSDSDFEPKQEEKR  637
                   VT VK    E    + RDE               V            K EEK 
Sbjct  193  GDGGDGCVTSVKEEEDEGDASEERDEKGDKTEEMEEDDEEEVRNLRKRKRKKPAKSEEKP  252

Query  636  QRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVI  457
            +R  KGGG GF     LS  L  F  TG   L+R +VVK +WKYIKEN LQDP + R +I
Sbjct  253  KR--KGGG-GFAKVCSLSPELQAF--TGMTKLARTEVVKMLWKYIKENNLQDPKDGRTII  307

Query  456  CDDKLRELLEVDSFEGFTMTKLLTAHF  376
            CD+ LR L  ++S   F M K LT H 
Sbjct  308  CDESLRSLFPLESINMFQMNKHLTKHI  334


 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -2

Query  624  KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDK  445
            K GG GF    QLS  L KF GT +  L+R +VVK+MW YIKE +LQDP ++R+++CD+ 
Sbjct  109  KRGGGGFAKVCQLSPQLEKFIGTSQ--LARTEVVKKMWAYIKEKDLQDPKDRRKILCDES  166

Query  444  LRELLEVDSFEGFTMTKLLTAHF  376
            L  L  V +   F M K L  H 
Sbjct  167  LHSLFHVKAINMFQMNKALAKHI  189


 Score = 66.6 bits (161),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E  L+R +VVKR+W YI +N+LQDP  KKRIICDE L  +F V + +   +++ L+ H  
Sbjct  401  ESSLSRADVVKRLWEYIEQNDLQDPSDKKRIICDEKLKELFEVDSFEDISVSKLLTSHYI  460

Query  768  PIEK  757
             IE+
Sbjct  461  KIEQ  464



>ref|XP_009145829.1| PREDICTED: uncharacterized protein LOC103869495 [Brassica rapa]
Length=451

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 147/201 (73%), Gaps = 13/201 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      +LARTEVVK +W YI+ENNLQDPK  + IICDE+L  +F +++I+MF+MN+ L
Sbjct  258  QAFTGMTKLARTEVVKMLWKYIKENNLQDPKDGRTIICDESLRSLFPLESINMFQMNKHL  317

Query  783  SKHIWPIE-KEDVTLVKSTPKERQRKKGRDEVYTDSD--SDSDFEPKQEEKRQRGLKGGG  613
            SKHIWP+E     +   S+PK  + K   ++  T+SD  +++D +PK+E          G
Sbjct  318  SKHIWPLEDNAGESGGSSSPKNGKLKMETEDGDTESDELNENDEKPKKE----------G  367

Query  612  TGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLREL  433
             G LAP+ LSD+L+KF G GE++ SR DVVKR+W+YI++N+LQDPS+K+R+ICD+KL+EL
Sbjct  368  CGLLAPLPLSDALIKFLGDGESSFSRADVVKRLWEYIEQNDLQDPSDKKRIICDEKLKEL  427

Query  432  LEVDSFEGFTMTKLLTAHFIK  370
             EVDSFE  +++KLLT+H+IK
Sbjct  428  FEVDSFEDISVSKLLTSHYIK  448


 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 119/210 (57%), Gaps = 26/210 (12%)
 Frame = -2

Query  942  ELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI  763
            +LARTEVVK++WAYI+E +LQDPK +++I+CDE+L  +F VK I+MF+MN+ L+KHIWP+
Sbjct  117  QLARTEVVKKMWAYIKEKDLQDPKDRRKILCDESLHSLFHVKAINMFQMNKALAKHIWPL  176

Query  762  EKEDVTLVKS--------TPKERQRKKGR-------------DEVYTDSDSDSDFEPKQE  646
                   V S           ER  K G+             +EV            K E
Sbjct  177  GDGGDGCVTSLKEEDEADASGERDEKGGKAEEMEEDNEEESEEEVRNLRKRKRKKPAKSE  236

Query  645  EKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKR  466
            EK +R  KGGG GF     LS  L  F  TG   L+R +VVK +WKYIKEN LQDP + R
Sbjct  237  EKPKR--KGGG-GFAKVCSLSPELQAF--TGMTKLARTEVVKMLWKYIKENNLQDPKDGR  291

Query  465  RVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
             +ICD+ LR L  ++S   F M K L+ H 
Sbjct  292  TIICDESLRSLFPLESINMFQMNKHLSKHI  321


 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -2

Query  624  KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDK  445
            K GG GF    QLS  L KF GT +  L+R +VVK+MW YIKE +LQDP ++R+++CD+ 
Sbjct  93   KRGGGGFAKVCQLSPQLEKFIGTSQ--LARTEVVKKMWAYIKEKDLQDPKDRRKILCDES  150

Query  444  LRELLEVDSFEGFTMTKLLTAHF  376
            L  L  V +   F M K L  H 
Sbjct  151  LHSLFHVKAINMFQMNKALAKHI  173


 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E   +R +VVKR+W YI +N+LQDP  KKRIICDE L  +F V + +   +++ L+ H  
Sbjct  388  ESSFSRADVVKRLWEYIEQNDLQDPSDKKRIICDEKLKELFEVDSFEDISVSKLLTSHYI  447

Query  768  PIEK  757
             IE+
Sbjct  448  KIEQ  451



>emb|CDX92300.1| BnaA05g21070D [Brassica napus]
Length=452

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 147/201 (73%), Gaps = 13/201 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      +LARTEVVK +W YI+ENNLQDPK  + IICDE+L  +F +++I+MF+MN+ L
Sbjct  259  QAFTGMTKLARTEVVKMLWKYIKENNLQDPKDGRTIICDESLRSLFPLESINMFQMNKHL  318

Query  783  SKHIWPIE-KEDVTLVKSTPKERQRKKGRDEVYTDSD--SDSDFEPKQEEKRQRGLKGGG  613
            SKHIWP+E     +   S+PK  + K   ++  T+SD  +++D +PK+E          G
Sbjct  319  SKHIWPLEDNAGESGGSSSPKNGKLKMETEDGDTESDELNENDEKPKKE----------G  368

Query  612  TGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLREL  433
             G LAP+ LSD+L+KF G GE++ SR DVVKR+W+YI++N+LQDPS+K+R+ICD+KL+EL
Sbjct  369  CGLLAPLPLSDALIKFLGDGESSFSRADVVKRLWEYIEQNDLQDPSDKKRIICDEKLKEL  428

Query  432  LEVDSFEGFTMTKLLTAHFIK  370
             EVDSFE  +++KLLT+H+IK
Sbjct  429  FEVDSFEDISVSKLLTSHYIK  449


 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 118/216 (55%), Gaps = 27/216 (13%)
 Frame = -2

Query  957  LVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSK  778
             +   +LARTEVVK++W YI+E +LQDPK +++I+CDE+L  +F VK I+MF+MN+ L+K
Sbjct  112  FIGSSQLARTEVVKKMWVYIKEKDLQDPKDRRKILCDESLHSLFHVKAINMFQMNKALAK  171

Query  777  HIWPIEKED---VTLVKSTPKERQRKKGRDE-------------------VYTDSDSDSD  664
            HIWP+       VT VK    E      RDE                   V         
Sbjct  172  HIWPLGDGGDGCVTSVKEEEDEGDASGERDEKGEKAEEREEDNEEESEEEVRNLRKRKRK  231

Query  663  FEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  484
               K EEK +R  KGGG GF     LS  L  F  TG   L+R +VVK +WKYIKEN LQ
Sbjct  232  KPAKSEEKPKR--KGGG-GFAKVCSLSPELQAF--TGMTKLARTEVVKMLWKYIKENNLQ  286

Query  483  DPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            DP + R +ICD+ LR L  ++S   F M K L+ H 
Sbjct  287  DPKDGRTIICDESLRSLFPLESINMFQMNKHLSKHI  322


 Score = 79.0 bits (193),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -2

Query  624  KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDK  445
            K GG GF    QLS  L KF G+ +  L+R +VVK+MW YIKE +LQDP ++R+++CD+ 
Sbjct  93   KRGGGGFAKVCQLSPQLEKFIGSSQ--LARTEVVKKMWVYIKEKDLQDPKDRRKILCDES  150

Query  444  LRELLEVDSFEGFTMTKLLTAHF  376
            L  L  V +   F M K L  H 
Sbjct  151  LHSLFHVKAINMFQMNKALAKHI  173


 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E   +R +VVKR+W YI +N+LQDP  KKRIICDE L  +F V + +   +++ L+ H  
Sbjct  389  ESSFSRADVVKRLWEYIEQNDLQDPSDKKRIICDEKLKELFEVDSFEDISVSKLLTSHYI  448

Query  768  PIEK  757
             IE+
Sbjct  449  KIEQ  452



>gb|KFK39235.1| hypothetical protein AALP_AA3G218000 [Arabis alpina]
Length=470

 Score =   207 bits (528),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 145/200 (73%), Gaps = 12/200 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      ELARTEVVK +W YI+EN LQDP   +RIICDE+L  +F  ++I+MF+MN+ L
Sbjct  278  QAFTGVTELARTEVVKMLWRYIKENKLQDPNDGRRIICDESLQSLFSFESINMFQMNKLL  337

Query  783  SKHIWPIE-KEDVTLVKSTPK-ERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGT  610
            +KHIWP+E     ++  ++PK E+Q         T++D D++ +   E+ +++ +KG   
Sbjct  338  TKHIWPLEDNAGESVCSNSPKIEKQN--------TETDEDTESDKLNEKDKKQKIKG--C  387

Query  609  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  430
              LAP+ LSD+LVKF G  E++LSR DVVKR+W+YIK+N+LQDPS+KRR+ICD+KL+EL 
Sbjct  388  ALLAPLSLSDALVKFLGNEESSLSRADVVKRLWEYIKQNDLQDPSDKRRIICDEKLKELF  447

Query  429  EVDSFEGFTMTKLLTAHFIK  370
            EVDSFE  +++KLLT HFIK
Sbjct  448  EVDSFEDISVSKLLTNHFIK  467


 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/216 (41%), Positives = 129/216 (60%), Gaps = 29/216 (13%)
 Frame = -2

Query  942  ELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI  763
            +LARTEVVK++W YIRE  LQDPK ++RI+CDE+L  +F VK+I+MF+M++ LSKHIWP+
Sbjct  128  QLARTEVVKKMWVYIREKELQDPKDRRRILCDESLRSLFNVKSINMFQMSKALSKHIWPL  187

Query  762  EKED--VTLVK----------------STPKERQRKKGRDEVYTDSDSDSDFEPKQEEKR  637
               D  V  VK                ++ K+ ++ +  ++V   ++ +S+ E +   KR
Sbjct  188  GDGDGCVNSVKEEEDDDDDDEEEDEDIASVKKAEKVEENEQVEESTEEESEEEVRSLRKR  247

Query  636  QRG---------LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  484
            +R           + GG GF     LS  L  F G  E  L+R +VVK +W+YIKEN+LQ
Sbjct  248  KRKDPAKSVEKPKRKGGGGFTKVCSLSPELQAFTGVTE--LARTEVVKMLWRYIKENKLQ  305

Query  483  DPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            DP++ RR+ICD+ L+ L   +S   F M KLLT H 
Sbjct  306  DPNDGRRIICDESLQSLFSFESINMFQMNKLLTKHI  341


 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 71/119 (60%), Gaps = 10/119 (8%)
 Frame = -2

Query  732  TPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTG  553
            TPK +   +G DE+ ++SD D +  P + +KR       G GF    QLS  L  F GT 
Sbjct  76   TPKPKAETEG-DEIGSESDQDKEQRPVKAKKR-------GNGFTKVCQLSPKLGDFIGTS  127

Query  552  ENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            +  L+R +VVK+MW YI+E ELQDP ++RR++CD+ LR L  V S   F M+K L+ H 
Sbjct  128  Q--LARTEVVKKMWVYIREKELQDPKDRRRILCDESLRSLFNVKSINMFQMSKALSKHI  184


 Score = 67.0 bits (162),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  951  QEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHI  772
            +E  L+R +VVKR+W YI++N+LQDP  K+RIICDE L  +F V + +   +++ L+ H 
Sbjct  406  EESSLSRADVVKRLWEYIKQNDLQDPSDKRRIICDEKLKELFEVDSFEDISVSKLLTNHF  465

Query  771  WPIEK  757
              IE+
Sbjct  466  IKIEQ  470



>ref|XP_010680445.1| PREDICTED: uncharacterized protein LOC104895589 [Beta vulgaris 
subsp. vulgaris]
Length=320

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 138/192 (72%), Gaps = 18/192 (9%)
 Frame = -2

Query  945  PELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWP  766
            P + RTEVVKR+W+Y+R+ NLQDP   K I+CDETL  +  V +I++ ++N+ L+KHI P
Sbjct  146  PHMTRTEVVKRLWSYVRDKNLQDPHDGKSIMCDETLRELLGVGSINILQINKALTKHISP  205

Query  765  IEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQL  586
                    VKS  +++QRK+ R+E          +E + +EKRQ+ +    +GFLAP+ L
Sbjct  206  S-------VKSMKRDKQRKQEREEDL--------YEAELKEKRQKKVY---SGFLAPLPL  247

Query  585  SDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGF  406
            S +L+KF GTGE+AL+R DV+KR+W+YIK N LQDP NK+ VICD+KL+EL  VDSF GF
Sbjct  248  SHTLIKFLGTGESALTRADVIKRVWEYIKINNLQDPFNKKTVICDEKLKELFNVDSFHGF  307

Query  405  TMTKLLTAHFIK  370
            T++KLL+AHF+K
Sbjct  308  TVSKLLSAHFVK  319


 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHI  772
            E  L R +V+KR+W YI+ NNLQDP  KK +ICDE L  +F V +   F +++ LS H 
Sbjct  259  ESALTRADVIKRVWEYIKINNLQDPFNKKTVICDEKLKELFNVDSFHGFTVSKLLSAHF  317



>ref|XP_002977839.1| hypothetical protein SELMODRAFT_176439 [Selaginella moellendorffii]
 gb|EFJ21177.1| hypothetical protein SELMODRAFT_176439 [Selaginella moellendorffii]
Length=342

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 134/200 (67%), Gaps = 4/200 (2%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q ++ E  L RT+VVK++W YIR +NLQDP+ K+ IICD+ L  +F     DMF+MN+ L
Sbjct  147  QAIIGEESLPRTQVVKQLWVYIRAHNLQDPENKRNIICDDPLRELFGTDQTDMFQMNKLL  206

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIW I +E         +    K    + + D     D EPK + +++   KG  +GF
Sbjct  207  SKHIWTITEEGECFGFCASQNGDHK----DCFLDCAGAEDSEPKTKRQKKDSGKGKASGF  262

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            L P  +SD+L KFFGTGE+ ++R +VVKR+W YI+ N+LQDP++K++++CD+KL+EL E 
Sbjct  263  LVPSPISDALQKFFGTGESEVTRSEVVKRIWDYIRSNQLQDPTDKKKILCDNKLQELFEC  322

Query  423  DSFEGFTMTKLLTAHFIKTA  364
            DSF GFTM KLL +HF+ ++
Sbjct  323  DSFLGFTMPKLLASHFVTSS  342



>ref|XP_010536330.1| PREDICTED: synaptonemal complex protein 1 isoform X5 [Tarenaya 
hassleriana]
Length=1056

 Score =   209 bits (531),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 147/198 (74%), Gaps = 14/198 (7%)
 Frame = -2

Query  963   QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
             Q      ELARTEVVKR+W YI+ENNLQDP  K++IICDE L  +F V +I+MF+M + L
Sbjct  872   QAFTGVNELARTEVVKRLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHL  931

Query  783   SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
             SKHIWP+EK++         ++  K G+ ++ T+ +SD   E +++EKRQ   K GG+G 
Sbjct  932   SKHIWPLEKDE---------DKPLKNGKRKLETEEESDD--ETEEKEKRQ---KKGGSGL  977

Query  603   LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
             L P+ LSD+LVKF GTGEN+LSR DV KR W YIK+N+LQDPS+KRR++CD+KL+EL +V
Sbjct  978   LIPLPLSDALVKFLGTGENSLSRADVTKRFWDYIKQNDLQDPSDKRRILCDEKLKELFDV  1037

Query  423   DSFEGFTMTKLLTAHFIK  370
             D+F  F+++KLLT HFIK
Sbjct  1038  DTFNSFSVSKLLTNHFIK  1055


 Score =   168 bits (426),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 128/212 (60%), Gaps = 20/212 (9%)
 Frame = -2

Query  957  LVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSK  778
             +   +LARTEVVK+IWAYIRE NLQDPK K+ IICDE+L  +F+VK I+MF+M++ LSK
Sbjct  132  FIGSSQLARTEVVKKIWAYIREKNLQDPKNKRNIICDESLHSLFKVKAINMFQMSKALSK  191

Query  777  HIWP------------IEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQ  634
            HIWP            +E ED    ++  KE Q ++ ++     S+ + +    ++ KR+
Sbjct  192  HIWPLSDGDGGVNNEKVEDEDDVSDETEGKEEQNEEAKENDEEQSEEEEENRSVRKTKRR  251

Query  633  RGLKGG------GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSN  472
            +  K        G GF     LS  L  F  TG   L+R +VVK +WKYIKEN LQDPS+
Sbjct  252  KSAKSDQKTTKRGGGFAKVCGLSPELQAF--TGMTELARTEVVKMLWKYIKENNLQDPSD  309

Query  471  KRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            KR++ICD+ LR L  VDS   F MTK L+ H 
Sbjct  310  KRKIICDEALRSLFPVDSINMFQMTKHLSKHI  341


 Score =   155 bits (392),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 125/214 (58%), Gaps = 21/214 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      ELARTEVVKR+W YI+ENNLQDP  K++IICDE L  +F V +I+MF+M + L
Sbjct  576  QAFTGMNELARTEVVKRLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHL  635

Query  783  SKHIWPIEK------------EDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEK  640
            SKHIWP+EK            ED    ++  KE Q ++  +      + + +   ++ +K
Sbjct  636  SKHIWPLEKDEGGVDNVKVEDEDDVSDETEGKEEQNEEAEENGEEQREEEENRSVRKVKK  695

Query  639  R------QRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  478
            R      Q+  K GG GF     LS  L  F  TG   L+R +VVK +WKY KEN LQDP
Sbjct  696  RKSAKSDQKTTKKGG-GFAKVCGLSPELQAF--TGMTELARTEVVKMLWKYAKENNLQDP  752

Query  477  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            S+KR++ICD+ LR L  VDS   F MTK L+ H 
Sbjct  753  SDKRKIICDEALRSLFPVDSINMFQMTKHLSKHI  786


 Score =   153 bits (387),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 121/215 (56%), Gaps = 21/215 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      ELARTEVVK +W Y +ENNLQDP  K++IICDE L  +F V +I+MF+M + L
Sbjct  427  QAFTGMTELARTEVVKMLWKYAKENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHL  486

Query  783  SKHIWPIE-------------KEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEE  643
            SKHIW +E             ++DV+      +E+  +   +        + +   ++ +
Sbjct  487  SKHIWRLEEVNGGVNNVKVEDEDDVSDETEGKEEQNEEAEENGEEQSEKEEENRSVRKAK  546

Query  642  KRQRGLKGG------GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  481
            +R R  K        G GF     LS  L  F  TG N L+R +VVKR+WKYIKEN LQD
Sbjct  547  RRNRSAKSDQNTTKRGCGFAKVCCLSPELQAF--TGMNELARTEVVKRLWKYIKENNLQD  604

Query  480  PSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            PS+KR++ICD+ LR L  VDS   F MTK L+ H 
Sbjct  605  PSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHI  639


 Score =   152 bits (384),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 122/215 (57%), Gaps = 21/215 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      ELARTEVVK +W Y +ENNLQDP  K++IICDE L  +F V +I+MF+M + L
Sbjct  723  QAFTGMTELARTEVVKMLWKYAKENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHL  782

Query  783  SKHIWPIE-------------KEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEE  643
            SKHIW +E             ++DV+      +E+  +   +      + + +   ++ +
Sbjct  783  SKHIWRLEEVKGGVNNVKVEDEDDVSDETEGKEEQNEEAEENGEAQREEEEENRSVRKAQ  842

Query  642  KRQRGLKGG------GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  481
            +R R  K        G GF     LS  L  F  TG N L+R +VVKR+WKYIKEN LQD
Sbjct  843  RRNRPAKSDRKTTKRGGGFAKVCGLSPELQAF--TGVNELARTEVVKRLWKYIKENNLQD  900

Query  480  PSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            PS+KR++ICD+ LR L  VDS   F MTK L+ H 
Sbjct  901  PSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHI  935


 Score =   144 bits (362),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 89/215 (41%), Positives = 117/215 (54%), Gaps = 21/215 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      ELARTEVVK +W YI+ENNLQDP  K++IICDE L  +F V +I+MF+M + L
Sbjct  278  QAFTGMTELARTEVVKMLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHL  337

Query  783  SKHIWPIEK----------EDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQ  634
            SKHIW  E+          ED   V    + R+ +    E   +   + + + +   K +
Sbjct  338  SKHIWRPEEVKGGVNNVKVEDEDDVSDETEGREEQNEEAEENGEEQREEEEKNRSVRKAK  397

Query  633  RGLKGG---------GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  481
            R  +           G GF     LS  L  F  TG   L+R +VVK +WKY KEN LQD
Sbjct  398  RINRSAKSDEKTTKRGGGFAKVCGLSPELQAF--TGMTELARTEVVKMLWKYAKENNLQD  455

Query  480  PSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            PS+KR++ICD+ LR L  VDS   F MTK L+ H 
Sbjct  456  PSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHI  490


 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -2

Query  651  QEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSN  472
            ++E+  +  K  G GF    QLS  L  F G+ +  L+R +VVK++W YI+E  LQDP N
Sbjct  104  KKERAGKAKKRRGGGFSKLWQLSPQLENFIGSSQ--LARTEVVKKIWAYIREKNLQDPKN  161

Query  471  KRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            KR +ICD+ L  L +V +   F M+K L+ H 
Sbjct  162  KRNIICDESLHSLFKVKAINMFQMSKALSKHI  193



>ref|XP_010536329.1| PREDICTED: calponin homology domain-containing protein DDB_G0272472 
isoform X4 [Tarenaya hassleriana]
Length=1056

 Score =   209 bits (531),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 147/198 (74%), Gaps = 14/198 (7%)
 Frame = -2

Query  963   QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
             Q      ELARTEVVKR+W YI+ENNLQDP  K++IICDE L  +F V +I+MF+M + L
Sbjct  872   QAFTGVNELARTEVVKRLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHL  931

Query  783   SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
             SKHIWP+EK++         ++  K G+ ++ T+ +SD   E +++EKRQ   K GG+G 
Sbjct  932   SKHIWPLEKDE---------DKPLKNGKRKLETEEESDD--ETEEKEKRQ---KKGGSGL  977

Query  603   LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
             L P+ LSD+LVKF GTGEN+LSR DV KR W YIK+N+LQDPS+KRR++CD+KL+EL +V
Sbjct  978   LIPLPLSDALVKFLGTGENSLSRADVTKRFWDYIKQNDLQDPSDKRRILCDEKLKELFDV  1037

Query  423   DSFEGFTMTKLLTAHFIK  370
             D+F  F+++KLLT HFIK
Sbjct  1038  DTFNSFSVSKLLTNHFIK  1055


 Score =   166 bits (421),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 129/214 (60%), Gaps = 23/214 (11%)
 Frame = -2

Query  957  LVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSK  778
             +   +LARTEVVK+IWAYIRE NLQDPK K+ IICDE+L  +F+VK I+MF+M++ LSK
Sbjct  132  FIGSSQLARTEVVKKIWAYIREKNLQDPKNKRNIICDESLHSLFKVKAINMFQMSKALSK  191

Query  777  HIWP------------IEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKR-  637
            HIWP            +E ED    ++  KE Q ++ ++     S+ + +    ++ KR 
Sbjct  192  HIWPLSDGDGGVNNEKVEDEDDVSDETEGKEEQNEEAKENDEEQSEEEEENRSVRKTKRR  251

Query  636  -------QRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  478
                   Q+  K GG GF     LS  L  F  TG   L+R +VVK +WKYIKEN LQDP
Sbjct  252  NRSAKSDQKTTKRGG-GFAKVCGLSPELQAF--TGMTELARTEVVKMLWKYIKENNLQDP  308

Query  477  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            S+KR++ICD+ LR L  VDS   F MTK L+ H 
Sbjct  309  SDKRKIICDEALRSLFPVDSINMFQMTKHLSKHI  342


 Score =   155 bits (392),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 125/214 (58%), Gaps = 21/214 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      ELARTEVVKR+W YI+ENNLQDP  K++IICDE L  +F V +I+MF+M + L
Sbjct  576  QAFTGMNELARTEVVKRLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHL  635

Query  783  SKHIWPIEK------------EDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEK  640
            SKHIWP+EK            ED    ++  KE Q ++  +      + + +   ++ +K
Sbjct  636  SKHIWPLEKDEGGVDNVKVEDEDDVSDETEGKEEQNEEAEENGEEQREEEENRSVRKVKK  695

Query  639  R------QRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  478
            R      Q+  K GG GF     LS  L  F  TG   L+R +VVK +WKY KEN LQDP
Sbjct  696  RKSAKSDQKTTKKGG-GFAKVCGLSPELQAF--TGMTELARTEVVKMLWKYAKENNLQDP  752

Query  477  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            S+KR++ICD+ LR L  VDS   F MTK L+ H 
Sbjct  753  SDKRKIICDEALRSLFPVDSINMFQMTKHLSKHI  786


 Score =   153 bits (386),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 123/214 (57%), Gaps = 20/214 (9%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      ELARTEVVK +W Y +ENNLQDP  K++IICDE L  +F V +I+MF+M + L
Sbjct  428  QAFTGMTELARTEVVKMLWKYAKENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHL  487

Query  783  SKHIW------------PIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEK  640
            SKHIW             +E ED    ++  KE Q ++  +     S+ + +    ++ K
Sbjct  488  SKHIWRLEEVNGGVNNVKVEDEDDVSDETEGKEEQNEEAEENGEEQSEKEEENRSVRKAK  547

Query  639  RQRGLKGG------GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  478
            R++  K        G GF     LS  L  F  TG N L+R +VVKR+WKYIKEN LQDP
Sbjct  548  RRKSAKSDQNTTKRGCGFAKVCCLSPELQAF--TGMNELARTEVVKRLWKYIKENNLQDP  605

Query  477  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            S+KR++ICD+ LR L  VDS   F MTK L+ H 
Sbjct  606  SDKRKIICDEALRSLFPVDSINMFQMTKHLSKHI  639


 Score =   152 bits (384),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 122/215 (57%), Gaps = 21/215 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      ELARTEVVK +W Y +ENNLQDP  K++IICDE L  +F V +I+MF+M + L
Sbjct  723  QAFTGMTELARTEVVKMLWKYAKENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHL  782

Query  783  SKHIWPIE-------------KEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEE  643
            SKHIW +E             ++DV+      +E+  +   +      + + +   ++ +
Sbjct  783  SKHIWRLEEVKGGVNNVKVEDEDDVSDETEGKEEQNEEAEENGEAQREEEEENRSVRKAQ  842

Query  642  KRQRGLKGG------GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  481
            +R R  K        G GF     LS  L  F  TG N L+R +VVKR+WKYIKEN LQD
Sbjct  843  RRNRPAKSDRKTTKRGGGFAKVCGLSPELQAF--TGVNELARTEVVKRLWKYIKENNLQD  900

Query  480  PSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            PS+KR++ICD+ LR L  VDS   F MTK L+ H 
Sbjct  901  PSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHI  935


 Score =   144 bits (362),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 89/215 (41%), Positives = 117/215 (54%), Gaps = 21/215 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      ELARTEVVK +W YI+ENNLQDP  K++IICDE L  +F V +I+MF+M + L
Sbjct  279  QAFTGMTELARTEVVKMLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHL  338

Query  783  SKHIWPIEK----------EDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQ  634
            SKHIW  E+          ED   V    + R+ +    E   +   + + + +   K +
Sbjct  339  SKHIWRPEEVKGGVNNVKVEDEDDVSDETEGREEQNEEAEENGEEQREEEEKNRSVRKAK  398

Query  633  RGLKGG---------GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  481
            R  +           G GF     LS  L  F  TG   L+R +VVK +WKY KEN LQD
Sbjct  399  RINRSAKSDEKTTKRGGGFAKVCGLSPELQAF--TGMTELARTEVVKMLWKYAKENNLQD  456

Query  480  PSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            PS+KR++ICD+ LR L  VDS   F MTK L+ H 
Sbjct  457  PSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHI  491


 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -2

Query  651  QEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSN  472
            ++E+  +  K  G GF    QLS  L  F G+ +  L+R +VVK++W YI+E  LQDP N
Sbjct  104  KKERAGKAKKRRGGGFSKLWQLSPQLENFIGSSQ--LARTEVVKKIWAYIREKNLQDPKN  161

Query  471  KRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            KR +ICD+ L  L +V +   F M+K L+ H 
Sbjct  162  KRNIICDESLHSLFKVKAINMFQMSKALSKHI  193



>ref|XP_010536328.1| PREDICTED: golgin subfamily A member 6-like protein 22 isoform 
X3 [Tarenaya hassleriana]
Length=1056

 Score =   209 bits (531),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 147/198 (74%), Gaps = 14/198 (7%)
 Frame = -2

Query  963   QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
             Q      ELARTEVVKR+W YI+ENNLQDP  K++IICDE L  +F V +I+MF+M + L
Sbjct  872   QAFTGVNELARTEVVKRLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHL  931

Query  783   SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
             SKHIWP+EK++         ++  K G+ ++ T+ +SD   E +++EKRQ   K GG+G 
Sbjct  932   SKHIWPLEKDE---------DKPLKNGKRKLETEEESDD--ETEEKEKRQ---KKGGSGL  977

Query  603   LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
             L P+ LSD+LVKF GTGEN+LSR DV KR W YIK+N+LQDPS+KRR++CD+KL+EL +V
Sbjct  978   LIPLPLSDALVKFLGTGENSLSRADVTKRFWDYIKQNDLQDPSDKRRILCDEKLKELFDV  1037

Query  423   DSFEGFTMTKLLTAHFIK  370
             D+F  F+++KLLT HFIK
Sbjct  1038  DTFNSFSVSKLLTNHFIK  1055


 Score =   166 bits (421),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 129/214 (60%), Gaps = 23/214 (11%)
 Frame = -2

Query  957  LVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSK  778
             +   +LARTEVVK+IWAYIRE NLQDPK K+ IICDE+L  +F+VK I+MF+M++ LSK
Sbjct  132  FIGSSQLARTEVVKKIWAYIREKNLQDPKNKRNIICDESLHSLFKVKAINMFQMSKALSK  191

Query  777  HIWP------------IEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKR-  637
            HIWP            +E ED    ++  KE Q ++ ++     S+ + +    ++ KR 
Sbjct  192  HIWPLSDGDGGVNNEKVEDEDDVSDETEGKEEQNEEAKENDEEQSEEEEENRSVRKTKRR  251

Query  636  -------QRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  478
                   Q+  K GG GF     LS  L  F  TG   L+R +VVK +WKYIKEN LQDP
Sbjct  252  NRSAKSDQKTTKRGG-GFAKVCGLSPELQAF--TGMTELARTEVVKMLWKYIKENNLQDP  308

Query  477  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            S+KR++ICD+ LR L  VDS   F MTK L+ H 
Sbjct  309  SDKRKIICDEALRSLFPVDSINMFQMTKHLSKHI  342


 Score =   155 bits (392),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 125/214 (58%), Gaps = 21/214 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      ELARTEVVKR+W YI+ENNLQDP  K++IICDE L  +F V +I+MF+M + L
Sbjct  576  QAFTGMNELARTEVVKRLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHL  635

Query  783  SKHIWPIEK------------EDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEK  640
            SKHIWP+EK            ED    ++  KE Q ++  +      + + +   ++ +K
Sbjct  636  SKHIWPLEKDEGGVDNVKVEDEDDVSDETEGKEEQNEEAEENGEEQREEEENRSVRKVKK  695

Query  639  R------QRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  478
            R      Q+  K GG GF     LS  L  F  TG   L+R +VVK +WKY KEN LQDP
Sbjct  696  RKSAKSDQKTTKKGG-GFAKVCGLSPELQAF--TGMTELARTEVVKMLWKYAKENNLQDP  752

Query  477  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            S+KR++ICD+ LR L  VDS   F MTK L+ H 
Sbjct  753  SDKRKIICDEALRSLFPVDSINMFQMTKHLSKHI  786


 Score =   153 bits (387),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 121/215 (56%), Gaps = 21/215 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      ELARTEVVK +W Y +ENNLQDP  K++IICDE L  +F V +I+MF+M + L
Sbjct  427  QAFTGMTELARTEVVKMLWKYAKENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHL  486

Query  783  SKHIWPIE-------------KEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEE  643
            SKHIW +E             ++DV+      +E+  +   +        + +   ++ +
Sbjct  487  SKHIWRLEEVNGGVNNVKVEDEDDVSDETEGKEEQNEEAEENGEEQSEKEEENRSVRKAK  546

Query  642  KRQRGLKGG------GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  481
            +R R  K        G GF     LS  L  F  TG N L+R +VVKR+WKYIKEN LQD
Sbjct  547  RRNRSAKSDQNTTKRGCGFAKVCCLSPELQAF--TGMNELARTEVVKRLWKYIKENNLQD  604

Query  480  PSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            PS+KR++ICD+ LR L  VDS   F MTK L+ H 
Sbjct  605  PSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHI  639


 Score =   152 bits (384),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 122/215 (57%), Gaps = 21/215 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      ELARTEVVK +W Y +ENNLQDP  K++IICDE L  +F V +I+MF+M + L
Sbjct  723  QAFTGMTELARTEVVKMLWKYAKENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHL  782

Query  783  SKHIWPIE-------------KEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEE  643
            SKHIW +E             ++DV+      +E+  +   +      + + +   ++ +
Sbjct  783  SKHIWRLEEVKGGVNNVKVEDEDDVSDETEGKEEQNEEAEENGEAQREEEEENRSVRKAQ  842

Query  642  KRQRGLKGG------GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  481
            +R R  K        G GF     LS  L  F  TG N L+R +VVKR+WKYIKEN LQD
Sbjct  843  RRNRPAKSDRKTTKRGGGFAKVCGLSPELQAF--TGVNELARTEVVKRLWKYIKENNLQD  900

Query  480  PSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            PS+KR++ICD+ LR L  VDS   F MTK L+ H 
Sbjct  901  PSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHI  935


 Score =   145 bits (365),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 89/214 (42%), Positives = 118/214 (55%), Gaps = 20/214 (9%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      ELARTEVVK +W YI+ENNLQDP  K++IICDE L  +F V +I+MF+M + L
Sbjct  279  QAFTGMTELARTEVVKMLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHL  338

Query  783  SKHIW------------PIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEK  640
            SKHIW             +E ED    ++  +E Q ++  +      + +      ++ K
Sbjct  339  SKHIWRPEEVKGGVNNVKVEDEDDVSDETEGREEQNEEAEENGEEQREEEEKNRSVRKAK  398

Query  639  RQRGLKGG------GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  478
            R +  K        G GF     LS  L  F  TG   L+R +VVK +WKY KEN LQDP
Sbjct  399  RIKSAKSDEKTTKRGGGFAKVCGLSPELQAF--TGMTELARTEVVKMLWKYAKENNLQDP  456

Query  477  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            S+KR++ICD+ LR L  VDS   F MTK L+ H 
Sbjct  457  SDKRKIICDEALRSLFPVDSINMFQMTKHLSKHI  490


 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -2

Query  651  QEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSN  472
            ++E+  +  K  G GF    QLS  L  F G+ +  L+R +VVK++W YI+E  LQDP N
Sbjct  104  KKERAGKAKKRRGGGFSKLWQLSPQLENFIGSSQ--LARTEVVKKIWAYIREKNLQDPKN  161

Query  471  KRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            KR +ICD+ L  L +V +   F M+K L+ H 
Sbjct  162  KRNIICDESLHSLFKVKAINMFQMSKALSKHI  193



>ref|XP_010536327.1| PREDICTED: golgin subfamily A member 6-like protein 22 isoform 
X2 [Tarenaya hassleriana]
Length=1056

 Score =   209 bits (531),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 147/198 (74%), Gaps = 14/198 (7%)
 Frame = -2

Query  963   QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
             Q      ELARTEVVKR+W YI+ENNLQDP  K++IICDE L  +F V +I+MF+M + L
Sbjct  872   QAFTGVNELARTEVVKRLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHL  931

Query  783   SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
             SKHIWP+EK++         ++  K G+ ++ T+ +SD   E +++EKRQ   K GG+G 
Sbjct  932   SKHIWPLEKDE---------DKPLKNGKRKLETEEESDD--ETEEKEKRQ---KKGGSGL  977

Query  603   LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
             L P+ LSD+LVKF GTGEN+LSR DV KR W YIK+N+LQDPS+KRR++CD+KL+EL +V
Sbjct  978   LIPLPLSDALVKFLGTGENSLSRADVTKRFWDYIKQNDLQDPSDKRRILCDEKLKELFDV  1037

Query  423   DSFEGFTMTKLLTAHFIK  370
             D+F  F+++KLLT HFIK
Sbjct  1038  DTFNSFSVSKLLTNHFIK  1055


 Score =   166 bits (421),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 129/214 (60%), Gaps = 23/214 (11%)
 Frame = -2

Query  957  LVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSK  778
             +   +LARTEVVK+IWAYIRE NLQDPK K+ IICDE+L  +F+VK I+MF+M++ LSK
Sbjct  132  FIGSSQLARTEVVKKIWAYIREKNLQDPKNKRNIICDESLHSLFKVKAINMFQMSKALSK  191

Query  777  HIWP------------IEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKR-  637
            HIWP            +E ED    ++  KE Q ++ ++     S+ + +    ++ KR 
Sbjct  192  HIWPLSDGDGGVNNEKVEDEDDVSDETEGKEEQNEEAKENDEEQSEEEEENRSVRKTKRR  251

Query  636  -------QRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  478
                   Q+  K GG GF     LS  L  F  TG   L+R +VVK +WKYIKEN LQDP
Sbjct  252  NRSAKSDQKTTKRGG-GFAKVCGLSPELQAF--TGMTELARTEVVKMLWKYIKENNLQDP  308

Query  477  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            S+KR++ICD+ LR L  VDS   F MTK L+ H 
Sbjct  309  SDKRKIICDEALRSLFPVDSINMFQMTKHLSKHI  342


 Score =   155 bits (392),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 125/214 (58%), Gaps = 21/214 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      ELARTEVVKR+W YI+ENNLQDP  K++IICDE L  +F V +I+MF+M + L
Sbjct  577  QAFTGMNELARTEVVKRLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHL  636

Query  783  SKHIWPIEK------------EDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEK  640
            SKHIWP+EK            ED    ++  KE Q ++  +      + + +   ++ +K
Sbjct  637  SKHIWPLEKDEGGVDNVKVEDEDDVSDETEGKEEQNEEAEENGEEQREEEENRSVRKVKK  696

Query  639  R------QRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  478
            R      Q+  K GG GF     LS  L  F  TG   L+R +VVK +WKY KEN LQDP
Sbjct  697  RKSAKSDQKTTKKGG-GFAKVCGLSPELQAF--TGMTELARTEVVKMLWKYAKENNLQDP  753

Query  477  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            S+KR++ICD+ LR L  VDS   F MTK L+ H 
Sbjct  754  SDKRKIICDEALRSLFPVDSINMFQMTKHLSKHI  787


 Score =   153 bits (387),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 121/215 (56%), Gaps = 21/215 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      ELARTEVVK +W Y +ENNLQDP  K++IICDE L  +F V +I+MF+M + L
Sbjct  428  QAFTGMTELARTEVVKMLWKYAKENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHL  487

Query  783  SKHIWPIE-------------KEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEE  643
            SKHIW +E             ++DV+      +E+  +   +        + +   ++ +
Sbjct  488  SKHIWRLEEVNGGVNNVKVEDEDDVSDETEGKEEQNEEAEENGEEQSEKEEENRSVRKAK  547

Query  642  KRQRGLKGG------GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  481
            +R R  K        G GF     LS  L  F  TG N L+R +VVKR+WKYIKEN LQD
Sbjct  548  RRNRSAKSDQNTTKRGCGFAKVCCLSPELQAF--TGMNELARTEVVKRLWKYIKENNLQD  605

Query  480  PSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            PS+KR++ICD+ LR L  VDS   F MTK L+ H 
Sbjct  606  PSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHI  640


 Score =   150 bits (379),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 121/214 (57%), Gaps = 20/214 (9%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      ELARTEVVK +W Y +ENNLQDP  K++IICDE L  +F V +I+MF+M + L
Sbjct  724  QAFTGMTELARTEVVKMLWKYAKENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHL  783

Query  783  SKHIWPIE--KEDVTLVKSTPKE--RQRKKGRD--------------EVYTDSDSDSDFE  658
            SKHIW +E  K  V  VK   ++      +G++              E   ++ S    +
Sbjct  784  SKHIWRLEEVKGGVNNVKVEDEDDVSDETEGKEEQNEEAEENGEAQREEEEENRSVRKAQ  843

Query  657  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  478
             ++  K  R     G GF     LS  L  F  TG N L+R +VVKR+WKYIKEN LQDP
Sbjct  844  RRKPAKSDRKTTKRGGGFAKVCGLSPELQAF--TGVNELARTEVVKRLWKYIKENNLQDP  901

Query  477  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            S+KR++ICD+ LR L  VDS   F MTK L+ H 
Sbjct  902  SDKRKIICDEALRSLFPVDSINMFQMTKHLSKHI  935


 Score =   144 bits (362),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 89/215 (41%), Positives = 117/215 (54%), Gaps = 21/215 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      ELARTEVVK +W YI+ENNLQDP  K++IICDE L  +F V +I+MF+M + L
Sbjct  279  QAFTGMTELARTEVVKMLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHL  338

Query  783  SKHIWPIEK----------EDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQ  634
            SKHIW  E+          ED   V    + R+ +    E   +   + + + +   K +
Sbjct  339  SKHIWRPEEVKGGVNNVKVEDEDDVSDETEGREEQNEEAEENGEEQREEEEKNRSVRKAK  398

Query  633  RGLKGG---------GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  481
            R  +           G GF     LS  L  F  TG   L+R +VVK +WKY KEN LQD
Sbjct  399  RINRSAKSDEKTTKRGGGFAKVCGLSPELQAF--TGMTELARTEVVKMLWKYAKENNLQD  456

Query  480  PSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            PS+KR++ICD+ LR L  VDS   F MTK L+ H 
Sbjct  457  PSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHI  491


 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -2

Query  651  QEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSN  472
            ++E+  +  K  G GF    QLS  L  F G+ +  L+R +VVK++W YI+E  LQDP N
Sbjct  104  KKERAGKAKKRRGGGFSKLWQLSPQLENFIGSSQ--LARTEVVKKIWAYIREKNLQDPKN  161

Query  471  KRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            KR +ICD+ L  L +V +   F M+K L+ H 
Sbjct  162  KRNIICDESLHSLFKVKAINMFQMSKALSKHI  193



>ref|XP_010536324.1| PREDICTED: golgin subfamily A member 6-like protein 22 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010536326.1| PREDICTED: golgin subfamily A member 6-like protein 22 isoform 
X1 [Tarenaya hassleriana]
Length=1057

 Score =   209 bits (531),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 147/198 (74%), Gaps = 14/198 (7%)
 Frame = -2

Query  963   QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
             Q      ELARTEVVKR+W YI+ENNLQDP  K++IICDE L  +F V +I+MF+M + L
Sbjct  873   QAFTGVNELARTEVVKRLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHL  932

Query  783   SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
             SKHIWP+EK++         ++  K G+ ++ T+ +SD   E +++EKRQ   K GG+G 
Sbjct  933   SKHIWPLEKDE---------DKPLKNGKRKLETEEESDD--ETEEKEKRQ---KKGGSGL  978

Query  603   LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
             L P+ LSD+LVKF GTGEN+LSR DV KR W YIK+N+LQDPS+KRR++CD+KL+EL +V
Sbjct  979   LIPLPLSDALVKFLGTGENSLSRADVTKRFWDYIKQNDLQDPSDKRRILCDEKLKELFDV  1038

Query  423   DSFEGFTMTKLLTAHFIK  370
             D+F  F+++KLLT HFIK
Sbjct  1039  DTFNSFSVSKLLTNHFIK  1056


 Score =   166 bits (421),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 129/214 (60%), Gaps = 23/214 (11%)
 Frame = -2

Query  957  LVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSK  778
             +   +LARTEVVK+IWAYIRE NLQDPK K+ IICDE+L  +F+VK I+MF+M++ LSK
Sbjct  132  FIGSSQLARTEVVKKIWAYIREKNLQDPKNKRNIICDESLHSLFKVKAINMFQMSKALSK  191

Query  777  HIWP------------IEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKR-  637
            HIWP            +E ED    ++  KE Q ++ ++     S+ + +    ++ KR 
Sbjct  192  HIWPLSDGDGGVNNEKVEDEDDVSDETEGKEEQNEEAKENDEEQSEEEEENRSVRKTKRR  251

Query  636  -------QRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  478
                   Q+  K GG GF     LS  L  F  TG   L+R +VVK +WKYIKEN LQDP
Sbjct  252  NRSAKSDQKTTKRGG-GFAKVCGLSPELQAF--TGMTELARTEVVKMLWKYIKENNLQDP  308

Query  477  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            S+KR++ICD+ LR L  VDS   F MTK L+ H 
Sbjct  309  SDKRKIICDEALRSLFPVDSINMFQMTKHLSKHI  342


 Score =   155 bits (392),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 125/214 (58%), Gaps = 21/214 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      ELARTEVVKR+W YI+ENNLQDP  K++IICDE L  +F V +I+MF+M + L
Sbjct  577  QAFTGMNELARTEVVKRLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHL  636

Query  783  SKHIWPIEK------------EDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEK  640
            SKHIWP+EK            ED    ++  KE Q ++  +      + + +   ++ +K
Sbjct  637  SKHIWPLEKDEGGVDNVKVEDEDDVSDETEGKEEQNEEAEENGEEQREEEENRSVRKVKK  696

Query  639  R------QRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  478
            R      Q+  K GG GF     LS  L  F  TG   L+R +VVK +WKY KEN LQDP
Sbjct  697  RKSAKSDQKTTKKGG-GFAKVCGLSPELQAF--TGMTELARTEVVKMLWKYAKENNLQDP  753

Query  477  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            S+KR++ICD+ LR L  VDS   F MTK L+ H 
Sbjct  754  SDKRKIICDEALRSLFPVDSINMFQMTKHLSKHI  787


 Score =   153 bits (387),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 121/215 (56%), Gaps = 21/215 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      ELARTEVVK +W Y +ENNLQDP  K++IICDE L  +F V +I+MF+M + L
Sbjct  428  QAFTGMTELARTEVVKMLWKYAKENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHL  487

Query  783  SKHIWPIE-------------KEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEE  643
            SKHIW +E             ++DV+      +E+  +   +        + +   ++ +
Sbjct  488  SKHIWRLEEVNGGVNNVKVEDEDDVSDETEGKEEQNEEAEENGEEQSEKEEENRSVRKAK  547

Query  642  KRQRGLKGG------GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  481
            +R R  K        G GF     LS  L  F  TG N L+R +VVKR+WKYIKEN LQD
Sbjct  548  RRNRSAKSDQNTTKRGCGFAKVCCLSPELQAF--TGMNELARTEVVKRLWKYIKENNLQD  605

Query  480  PSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            PS+KR++ICD+ LR L  VDS   F MTK L+ H 
Sbjct  606  PSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHI  640


 Score =   152 bits (384),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 122/215 (57%), Gaps = 21/215 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      ELARTEVVK +W Y +ENNLQDP  K++IICDE L  +F V +I+MF+M + L
Sbjct  724  QAFTGMTELARTEVVKMLWKYAKENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHL  783

Query  783  SKHIWPIE-------------KEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEE  643
            SKHIW +E             ++DV+      +E+  +   +      + + +   ++ +
Sbjct  784  SKHIWRLEEVKGGVNNVKVEDEDDVSDETEGKEEQNEEAEENGEAQREEEEENRSVRKAQ  843

Query  642  KRQRGLKGG------GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  481
            +R R  K        G GF     LS  L  F  TG N L+R +VVKR+WKYIKEN LQD
Sbjct  844  RRNRPAKSDRKTTKRGGGFAKVCGLSPELQAF--TGVNELARTEVVKRLWKYIKENNLQD  901

Query  480  PSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            PS+KR++ICD+ LR L  VDS   F MTK L+ H 
Sbjct  902  PSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHI  936


 Score =   144 bits (362),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 89/215 (41%), Positives = 117/215 (54%), Gaps = 21/215 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      ELARTEVVK +W YI+ENNLQDP  K++IICDE L  +F V +I+MF+M + L
Sbjct  279  QAFTGMTELARTEVVKMLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHL  338

Query  783  SKHIWPIEK----------EDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQ  634
            SKHIW  E+          ED   V    + R+ +    E   +   + + + +   K +
Sbjct  339  SKHIWRPEEVKGGVNNVKVEDEDDVSDETEGREEQNEEAEENGEEQREEEEKNRSVRKAK  398

Query  633  RGLKGG---------GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  481
            R  +           G GF     LS  L  F  TG   L+R +VVK +WKY KEN LQD
Sbjct  399  RINRSAKSDEKTTKRGGGFAKVCGLSPELQAF--TGMTELARTEVVKMLWKYAKENNLQD  456

Query  480  PSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            PS+KR++ICD+ LR L  VDS   F MTK L+ H 
Sbjct  457  PSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHI  491


 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -2

Query  651  QEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSN  472
            ++E+  +  K  G GF    QLS  L  F G+ +  L+R +VVK++W YI+E  LQDP N
Sbjct  104  KKERAGKAKKRRGGGFSKLWQLSPQLENFIGSSQ--LARTEVVKKIWAYIREKNLQDPKN  161

Query  471  KRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            KR +ICD+ L  L +V +   F M+K L+ H 
Sbjct  162  KRNIICDESLHSLFKVKAINMFQMSKALSKHI  193



>gb|EYU44365.1| hypothetical protein MIMGU_mgv1a025674mg [Erythranthe guttata]
Length=305

 Score =   197 bits (502),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 131/192 (68%), Gaps = 32/192 (17%)
 Frame = -2

Query  945  PELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWP  766
            PELARTEVV+++W+YI+ENNLQDP  ++ IICD+TL  +F V +IDMF+MN++L+KHIWP
Sbjct  143  PELARTEVVRQLWSYIKENNLQDPSNRRTIICDDTLRNLFEVDSIDMFQMNKSLAKHIWP  202

Query  765  IEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQL  586
            +                             SDSD    +EE  ++  +  G  FL P++L
Sbjct  203  L----------------------------GSDSD----EEEPERKEKRPRGAAFLVPLKL  230

Query  585  SDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGF  406
            SD+LVKF GTGE+ L R +VVKR+W YIK N LQDPS+KR+++CD+KL+EL  VD+F GF
Sbjct  231  SDALVKFLGTGESELPRSNVVKRIWDYIKLNNLQDPSDKRQILCDEKLKELFNVDTFHGF  290

Query  405  TMTKLLTAHFIK  370
            T+ KLLTAH IK
Sbjct  291  TVAKLLTAHIIK  302


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 52/80 (65%), Gaps = 2/80 (3%)
 Frame = -2

Query  618  GGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLR  439
            GG GF     LS  L KF G  E  L+R +VV+++W YIKEN LQDPSN+R +ICDD LR
Sbjct  122  GGGGFTKLCTLSPELQKFTGVPE--LARTEVVRQLWSYIKENNLQDPSNRRTIICDDTLR  179

Query  438  ELLEVDSFEGFTMTKLLTAH  379
             L EVDS + F M K L  H
Sbjct  180  NLFEVDSIDMFQMNKSLAKH  199


 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E EL R+ VVKRIW YI+ NNLQDP  K++I+CDE L  +F V T   F + + L+ HI 
Sbjct  242  ESELPRSNVVKRIWDYIKLNNLQDPSDKRQILCDEKLKELFNVDTFHGFTVAKLLTAHII  301

Query  768  PIEK  757
              EK
Sbjct  302  KPEK  305



>gb|ACJ85465.1| unknown [Medicago truncatula]
Length=320

 Score =   195 bits (496),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 132/183 (72%), Gaps = 11/183 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V  PE+ARTEVVK++WAYIRE +LQDP  ++ IICDE L  +F V TI+MF+MN+ L
Sbjct  143  QEFVGAPEMARTEVVKQLWAYIREKDLQDPNNRRNIICDEPLRALFGVDTINMFQMNKVL  202

Query  783  SKHIWPIEKEDVTLVKSTPKER------QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLK  622
            +KHIWP++ +DV  VKS PKE+        +K + +     D D D EPK +EKRQ+   
Sbjct  203  AKHIWPLDSDDVIQVKSAPKEKPAPKEKPTRKEKKKKQEREDDDLD-EPKGKEKRQK--V  259

Query  621  GGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKL  442
            G G GF+AP+QLSD+L KF   GE+ LSR DV+KRMW YIK N LQDPS+KR+++CD+KL
Sbjct  260  GSGKGFIAPLQLSDALAKFL--GESELSRSDVIKRMWDYIKGNNLQDPSDKRQILCDEKL  317

Query  441  REL  433
            +EL
Sbjct  318  KEL  320


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 2/77 (3%)
 Frame = -2

Query  606  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  427
            F     LS  L +F G  E  ++R +VVK++W YI+E +LQDP+N+R +ICD+ LR L  
Sbjct  132  FCKICSLSPQLQEFVGAPE--MARTEVVKQLWAYIREKDLQDPNNRRNIICDEPLRALFG  189

Query  426  VDSFEGFTMTKLLTAHF  376
            VD+   F M K+L  H 
Sbjct  190  VDTINMFQMNKVLAKHI  206



>gb|KDO79318.1| hypothetical protein CISIN_1g0196442mg, partial [Citrus sinensis]
Length=180

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 120/160 (75%), Gaps = 11/160 (7%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  +   ELARTEVVK++WAYIRE +LQDP  ++ I+CDE L  +F V TI+MF+MN+ L
Sbjct  26   QEFIGVTELARTEVVKQLWAYIREKDLQDPNNRRNIVCDERLRALFGVDTINMFQMNKAL  85

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP++ +DV  VKSTPKE+QRK+ R E   D D     EP ++EKRQ   KGG +GF
Sbjct  86   SKHIWPLDSDDVISVKSTPKEKQRKQERTE---DLD-----EPTRKEKRQ---KGGKSGF  134

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  484
            LAP+QLSD+L+KF GTGE+AL R DV+KRMW YIKE  LQ
Sbjct  135  LAPLQLSDALIKFLGTGESALPRSDVIKRMWDYIKEKNLQ  174


 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = -2

Query  627  LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDD  448
            +K  G GF     LS  L +F G  E  L+R +VVK++W YI+E +LQDP+N+R ++CD+
Sbjct  8    VKKRGGGFSKLCALSPQLQEFIGVTE--LARTEVVKQLWAYIREKDLQDPNNRRNIVCDE  65

Query  447  KLRELLEVDSFEGFTMTKLLTAHF  376
            +LR L  VD+   F M K L+ H 
Sbjct  66   RLRALFGVDTINMFQMNKALSKHI  89



>gb|KDO79319.1| hypothetical protein CISIN_1g0196442mg, partial [Citrus sinensis]
Length=179

 Score =   189 bits (480),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 120/160 (75%), Gaps = 11/160 (7%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  +   ELARTEVVK++WAYIRE +LQDP  ++ I+CDE L  +F V TI+MF+MN+ L
Sbjct  26   QEFIGVTELARTEVVKQLWAYIREKDLQDPNNRRNIVCDERLRALFGVDTINMFQMNKAL  85

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP++ +DV  VKSTPKE+QRK+ R E   D D     EP ++EKRQ   KGG +GF
Sbjct  86   SKHIWPLDSDDVISVKSTPKEKQRKQERTE---DLD-----EPTRKEKRQ---KGGKSGF  134

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  484
            LAP+QLSD+L+KF GTGE+AL R DV+KRMW YIKE  LQ
Sbjct  135  LAPLQLSDALIKFLGTGESALPRSDVIKRMWDYIKEKNLQ  174


 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = -2

Query  627  LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDD  448
            +K  G GF     LS  L +F G  E  L+R +VVK++W YI+E +LQDP+N+R ++CD+
Sbjct  8    VKKRGGGFSKLCALSPQLQEFIGVTE--LARTEVVKQLWAYIREKDLQDPNNRRNIVCDE  65

Query  447  KLRELLEVDSFEGFTMTKLLTAHF  376
            +LR L  VD+   F M K L+ H 
Sbjct  66   RLRALFGVDTINMFQMNKALSKHI  89



>gb|AFW67527.1| hypothetical protein ZEAMMB73_352797 [Zea mays]
Length=316

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 128/199 (64%), Gaps = 26/199 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V   ELARTEVVK++WAYIRENNLQD   +++I+ DE L  IF V +IDMF+MN+ L
Sbjct  143  QEFVGASELARTEVVKKLWAYIRENNLQDQNNRRKILPDERLKKIFNVNSIDMFQMNKAL  202

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHIWP+  E       +P    RKK +                             +G 
Sbjct  203  TKHIWPLNSEGPV----SPDRSTRKKQKGGSSGAG----------------------SGL  236

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            L P+QLSD L+KF GTGE+ LSR DVVKRMW YIKEN LQDPS++R++ICD+KL++LL V
Sbjct  237  LVPLQLSDDLMKFIGTGESMLSRSDVVKRMWDYIKENNLQDPSDRRKIICDEKLKDLLGV  296

Query  423  DSFEGFTMTKLLTAHFIKT  367
            ++F GFT++KLL  HF KT
Sbjct  297  ETFTGFTVSKLLAPHFTKT  315



>ref|XP_002883161.1| SWIB complex BAF60b domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH59420.1| SWIB complex BAF60b domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=463

 Score =   196 bits (499),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 139/200 (70%), Gaps = 14/200 (7%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      ELARTEVVK +W YI+ENNLQDP  K+ IICDE+L  +F  ++I+MF+M++ L
Sbjct  275  QAFTGVTELARTEVVKMLWKYIKENNLQDPNDKRIIICDESLRSLFPFESINMFQMSKLL  334

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHIWP+E      V S       K G+ ++ +D DS+   EP +++K+Q+         
Sbjct  335  TKHIWPLEDNAGESVSSN----SPKNGKQKMESDGDSE---EPNEKDKKQK------KEV  381

Query  603  LAPIQLSDSLVKFFG-TGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  427
            LAP+ LS +LVKF G  GE++LSR DV KR+W+YIK+N+LQDPS+KRR+ICD+KL+EL E
Sbjct  382  LAPLPLSVALVKFLGNNGESSLSRADVGKRLWEYIKQNDLQDPSDKRRIICDEKLKELFE  441

Query  426  VDSFEGFTMTKLLTAHFIKT  367
            VDSFE  + + LLT HFIK 
Sbjct  442  VDSFEDTSFSTLLTNHFIKA  461


 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 126/215 (59%), Gaps = 26/215 (12%)
 Frame = -2

Query  957  LVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSK  778
            +V   +L RTEVVK++WAYIREN+LQDPK +++I+CDE L  +FRVKTI+MF+M++ L+K
Sbjct  129  VVGASQLGRTEVVKKMWAYIRENDLQDPKDRRKIVCDELLHSLFRVKTINMFQMSKALTK  188

Query  777  HIWPIEKED--VTLVKSTPKERQR----KKG---------------RDEVYTDSDSDSDF  661
            HIWP+   D     VK   +E       KKG                +EV +        
Sbjct  189  HIWPLGDGDGCANNVKEEDEEEASEGTDKKGDQSEEVEENKEEESEEEEVRSLRKRKRKK  248

Query  660  EPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  481
              K  EK +R  KGGG GF     LS  L  F G  E  L+R +VVK +WKYIKEN LQD
Sbjct  249  PAKSVEKPKR--KGGG-GFAKVCSLSPELQAFTGVTE--LARTEVVKMLWKYIKENNLQD  303

Query  480  PSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            P++KR +ICD+ LR L   +S   F M+KLLT H 
Sbjct  304  PNDKRIIICDESLRSLFPFESINMFQMSKLLTKHI  338


 Score = 75.5 bits (184),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = -2

Query  615  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  436
            G GF    QLS  L K  G  +  L R +VVK+MW YI+EN+LQDP ++R+++CD+ L  
Sbjct  113  GGGFTKVSQLSPQLEKVVGASQ--LGRTEVVKKMWAYIRENDLQDPKDRRKIVCDELLHS  170

Query  435  LLEVDSFEGFTMTKLLTAHF  376
            L  V +   F M+K LT H 
Sbjct  171  LFRVKTINMFQMSKALTKHI  190


 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -2

Query  948  EPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW  769
            E  L+R +V KR+W YI++N+LQDP  K+RIICDE L  +F V + +    +  L+ H  
Sbjct  400  ESSLSRADVGKRLWEYIKQNDLQDPSDKRRIICDEKLKELFEVDSFEDTSFSTLLTNHFI  459

Query  768  PIEK  757
              E+
Sbjct  460  KAEQ  463



>ref|XP_002979488.1| hypothetical protein SELMODRAFT_419232 [Selaginella moellendorffii]
 gb|EFJ19377.1| hypothetical protein SELMODRAFT_419232 [Selaginella moellendorffii]
Length=320

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 129/200 (65%), Gaps = 26/200 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q ++ E  L RT+VVK++W YIR +NLQDP+ K+ IICD+ L  +F     DMF+MN+ L
Sbjct  147  QAIIGEESLPRTQVVKQLWVYIRAHNLQDPENKRNIICDDPLRELFGTDQTDMFQMNKLL  206

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIW I +E                             D EPK + +++   KG  +GF
Sbjct  207  SKHIWTITEEGA--------------------------EDSEPKTKRQKKDSGKGKASGF  240

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            L P  +SD+L KFFGTGE+ ++R +VVKR+W YI+ N+LQDP++K++++CD+KL+EL E 
Sbjct  241  LVPSPISDALQKFFGTGESEVTRSEVVKRIWDYIRSNQLQDPTDKKKILCDNKLQELFEC  300

Query  423  DSFEGFTMTKLLTAHFIKTA  364
            DSF GFTM KLL +HF+ ++
Sbjct  301  DSFLGFTMPKLLASHFVTSS  320



>ref|XP_001768652.1| predicted protein [Physcomitrella patens]
 gb|EDQ66590.1| predicted protein [Physcomitrella patens]
Length=308

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 135/203 (67%), Gaps = 20/203 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q ++ E EL RT+VVK++WAYIRE+NLQDP  K++IIC++ L  +    + DMF+MN+ L
Sbjct  117  QAIIGEAELPRTQVVKQLWAYIREHNLQDPDDKRKIICNDALRNLLGTNSTDMFKMNKLL  176

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGG---  613
            SKHI+P++       +ST       KGRD    D+D++ D EPK   K+Q+  K GG   
Sbjct  177  SKHIFPLDN------RSTGAA---AKGRDR---DTDTE-DAEPK--AKKQKADKSGGGKG  221

Query  612  --TGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLR  439
               GFLAP  +S+ L KF    +  +SR D VKR+W YIKEN LQDPSNK+ ++CD++L+
Sbjct  222  KIVGFLAPCPISEQLAKFLDAEDGKVSRADAVKRLWIYIKENNLQDPSNKKMIVCDEQLQ  281

Query  438  ELLEVDSFEGFTMTKLLTAHFIK  370
            +L + D F GF +TKLLT HFIK
Sbjct  282  DLFDCDHFVGFDLTKLLTRHFIK  304



>ref|XP_008236631.1| PREDICTED: upstream activation factor subunit UAF30 isoform X1 
[Prunus mume]
Length=364

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 135/226 (60%), Gaps = 34/226 (15%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V EPE+ARTEVVKRIWAYIRE +LQDPK ++ I CDE+L  +FRV +I+MF+MN+ L
Sbjct  125  QEFVGEPEMARTEVVKRIWAYIREKDLQDPKNRRNIRCDESLHSLFRVNSINMFQMNKVL  184

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSD------------------FE  658
            SKHIWP+ +ED  +       +Q+KKG +  ++ S+ D +                    
Sbjct  185  SKHIWPLSREDEPV-------KQKKKGEESDHSVSEGDVNNVAQEEEEVEEEEEEEEKVS  237

Query  657  PKQEEKRQRGL-------KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIK  499
             ++E K++R         K GG GF     LS  L KF G  E  L+R +VVK++W YI+
Sbjct  238  KQKESKKRRAAKVDKEVKKRGGGGFTKLCSLSPELQKFMGVPE--LARTEVVKKLWSYIR  295

Query  498  ENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG  361
            EN LQDP+NKR +ICD+ LR L +VDS   F M K L+ H +   G
Sbjct  296  ENNLQDPNNKREIICDESLRALFDVDSINMFQMNKALSKHILPLNG  341


 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -2

Query  945  PELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWP  766
            PELARTEVVK++W+YIRENNLQDP  K+ IICDE+L  +F V +I+MF+MN+ LSKHI P
Sbjct  279  PELARTEVVKKLWSYIRENNLQDPNNKREIICDESLRALFDVDSINMFQMNKALSKHILP  338

Query  765  IEKE  754
            +  E
Sbjct  339  LNGE  342



>ref|XP_008236632.1| PREDICTED: upstream activation factor subunit UAF30 isoform X2 
[Prunus mume]
Length=363

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 135/226 (60%), Gaps = 34/226 (15%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V EPE+ARTEVVKRIWAYIRE +LQDPK ++ I CDE+L  +FRV +I+MF+MN+ L
Sbjct  125  QEFVGEPEMARTEVVKRIWAYIREKDLQDPKNRRNIRCDESLHSLFRVNSINMFQMNKVL  184

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSD------------------FE  658
            SKHIWP+ +ED  +       +Q+KKG +  ++ S+ D +                    
Sbjct  185  SKHIWPLSREDEPV-------KQKKKGEESDHSVSEGDVNNVAQEEEEVEEEEEEEEKVS  237

Query  657  PKQEEKRQRGL-------KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIK  499
             ++E K++R         K GG GF     LS  L KF G  E  L+R +VVK++W YI+
Sbjct  238  KQKESKKRRAAKVDKEVKKRGGGGFTKLCSLSPELQKFMGVPE--LARTEVVKKLWSYIR  295

Query  498  ENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG  361
            EN LQDP+NKR +ICD+ LR L +VDS   F M K L+ H +   G
Sbjct  296  ENNLQDPNNKREIICDESLRALFDVDSINMFQMNKALSKHILPLNG  341


 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 61/83 (73%), Gaps = 2/83 (2%)
 Frame = -2

Query  945  PELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWP  766
            PELARTEVVK++W+YIRENNLQDP  K+ IICDE+L  +F V +I+MF+MN+ LSKHI P
Sbjct  279  PELARTEVVKKLWSYIRENNLQDPNNKREIICDESLRALFDVDSINMFQMNKALSKHILP  338

Query  765  IEKE--DVTLVKSTPKERQRKKG  703
            +  E  D    K    E++ ++G
Sbjct  339  LNGEAPDTASRKDKQSEQEHEEG  361



>ref|XP_007199917.1| hypothetical protein PRUPE_ppa007326mg [Prunus persica]
 gb|EMJ01116.1| hypothetical protein PRUPE_ppa007326mg [Prunus persica]
Length=373

 Score =   186 bits (473),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 100/227 (44%), Positives = 135/227 (59%), Gaps = 35/227 (15%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V EPE+ARTEVVKRIWAYIRE +LQDPK ++ I CDE+L  +FRV +I+MF+MN+ L
Sbjct  125  QEFVGEPEMARTEVVKRIWAYIREKDLQDPKNRRNIRCDESLHSLFRVNSINMFQMNKVL  184

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSD-------------------F  661
            SKHIWP+ +ED  +       +Q+KKG +  ++ S+ D +                    
Sbjct  185  SKHIWPLSREDEPV-------KQKKKGEESDHSVSEGDVNNVAQEEEEVEEEEEEEEEKV  237

Query  660  EPKQEEKRQRGL-------KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYI  502
              ++E K++R         K GG GF     LS  L KF G  E  L+R +VVK++W YI
Sbjct  238  SKQKESKKRRAAKVDKEVKKRGGGGFTKLCSLSPELQKFMGVPE--LARTEVVKKLWSYI  295

Query  501  KENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG  361
            +EN LQDP+NKR +ICD+ LR L +VDS   F M K L+ H +   G
Sbjct  296  RENNLQDPNNKREIICDESLRALFDVDSINMFQMNKALSKHILPLNG  342


 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 68/101 (67%), Gaps = 9/101 (9%)
 Frame = -2

Query  945  PELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWP  766
            PELARTEVVK++W+YIRENNLQDP  K+ IICDE+L  +F V +I+MF+MN+ LSKHI P
Sbjct  280  PELARTEVVKKLWSYIRENNLQDPNNKREIICDESLRALFDVDSINMFQMNKALSKHILP  339

Query  765  IEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEE  643
            +  E      + P    RK  + E   + DSD   +PKQ E
Sbjct  340  LNGE------AAPDNASRKDKQSEQEHEEDSD---DPKQNE  371



>gb|KDP38240.1| hypothetical protein JCGZ_04883 [Jatropha curcas]
Length=238

 Score =   182 bits (462),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 118/160 (74%), Gaps = 14/160 (9%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  + E ELARTEVVKR+WAYIRE NLQDPK K+ IICDE+L  +F V +I+MF+MN+ L
Sbjct  89   QEFIGESELARTEVVKRLWAYIRERNLQDPKNKQNIICDESLHALFHVNSINMFQMNKAL  148

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP+ +E      ++ KE++ K+ R+     SD     EPKQ+EKRQ   K G +G 
Sbjct  149  SKHIWPLNEEVPN--NTSEKEKRSKQPRE----GSD-----EPKQKEKRQ---KKGASGL  194

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  484
            LAP+ LSD+LVKFFGTGEN LSR DVVKRMW YIK+N+LQ
Sbjct  195  LAPLPLSDALVKFFGTGENELSRADVVKRMWGYIKQNDLQ  234


 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 48/80 (60%), Gaps = 2/80 (3%)
 Frame = -2

Query  615  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  436
            G GF     LS  L +F G  E+ L+R +VVKR+W YI+E  LQDP NK+ +ICD+ L  
Sbjct  75   GGGFTKLCSLSPQLQEFIG--ESELARTEVVKRLWAYIRERNLQDPKNKQNIICDESLHA  132

Query  435  LLEVDSFEGFTMTKLLTAHF  376
            L  V+S   F M K L+ H 
Sbjct  133  LFHVNSINMFQMNKALSKHI  152



>emb|CBI23284.3| unnamed protein product [Vitis vinifera]
Length=303

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 123/171 (72%), Gaps = 20/171 (12%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  +  PELARTEVVK++W +IRE +LQDP  ++ IICDETL  +F V +I+MF+MN+ L
Sbjct  144  QKFIGVPELARTEVVKQLWVHIREKDLQDPNNRRNIICDETLRALFGVDSINMFQMNKAL  203

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP++ +D   VK TPKE+QRK+ RD    DSD     EPK+++KRQ   KGG +GF
Sbjct  204  SKHIWPLDSDDAAPVKPTPKEKQRKQERD----DSD-----EPKRKQKRQ---KGGNSGF  251

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICD  451
            LAP+ LSD+LVKF    E+ALSR +VVK++W+YIK+N LQ        +CD
Sbjct  252  LAPLPLSDALVKFLNIEESALSRAEVVKKIWEYIKQNNLQ--------VCD  294


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = -2

Query  645  EKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKR  466
            +K  + +K  G GF     LS  L KF G  E  L+R +VVK++W +I+E +LQDP+N+R
Sbjct  120  KKSNKEVKKRGGGFCKLCSLSPELQKFIGVPE--LARTEVVKQLWVHIREKDLQDPNNRR  177

Query  465  RVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
             +ICD+ LR L  VDS   F M K L+ H 
Sbjct  178  NIICDETLRALFGVDSINMFQMNKALSKHI  207



>ref|XP_010317157.1| PREDICTED: LOW QUALITY PROTEIN: upstream activation factor subunit 
spp27-like [Solanum lycopersicum]
Length=324

 Score =   182 bits (463),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 136/197 (69%), Gaps = 21/197 (11%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +  E ELARTEVVKR+W YI  N L++P  K+ I CD+TL  +F V++I+MF MN+ L
Sbjct  134  QKITGEAELARTEVVKRMWQYINANELKNPSDKRIINCDDTLRELFGVESINMFAMNKAL  193

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHIWP++ +          ++QRK+  DE       D D EPK+EE+++       +G 
Sbjct  194  TKHIWPLDSD-------AANKKQRKQEEDE-------DLD-EPKKEEQQK------NSGM  232

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
             AP++LS++L+ F GTGE+ +SR  VVKR+W+YIK+N LQDPS++RRVICD+KL+E+  V
Sbjct  233  HAPLRLSNALINFLGTGESXISRPIVVKRIWEYIKQNGLQDPSDERRVICDEKLKEVFHV  292

Query  423  DSFEGFTMTKLLTAHFI  373
            ++  G  +TKLL+ HFI
Sbjct  293  ETHRGIGVTKLLSPHFI  309



>ref|XP_010263743.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Nelumbo nucifera]
Length=365

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 118/158 (75%), Gaps = 12/158 (8%)
 Frame = -2

Query  957  LVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSK  778
             V  PE+ARTEVVK++W YIRE NLQDP  K+ I+CDE L  +F V +I+MF+MN+ LSK
Sbjct  144  FVGVPEMARTEVVKQLWVYIREKNLQDPNNKRNIMCDEKLRSLFGVDSINMFQMNKALSK  203

Query  777  HIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLA  598
            HI P++ ED   VKST KE+QRK+ R E   D++     EPKQ+EKRQ   KGG +GFLA
Sbjct  204  HIGPLDTEDAP-VKSTQKEKQRKQERKE---DTN-----EPKQKEKRQ---KGGNSGFLA  251

Query  597  PIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  484
            P+ LS +LVKF GTGEN+LSR  VVKRMW+YIK+N LQ
Sbjct  252  PLPLSGALVKFLGTGENSLSRASVVKRMWEYIKQNNLQ  289


 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -2

Query  654  KQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  475
            K   K  + +K  G GF     LS  L KF G  E  ++R +VVK++W YI+E  LQDP+
Sbjct  115  KSSNKLSKEVKKRGGGFTKLCTLSPQLKKFVGVPE--MARTEVVKQLWVYIREKNLQDPN  172

Query  474  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  379
            NKR ++CD+KLR L  VDS   F M K L+ H
Sbjct  173  NKRNIMCDEKLRSLFGVDSINMFQMNKALSKH  204



>ref|XP_010263742.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Nelumbo nucifera]
Length=366

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 118/158 (75%), Gaps = 12/158 (8%)
 Frame = -2

Query  957  LVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSK  778
             V  PE+ARTEVVK++W YIRE NLQDP  K+ I+CDE L  +F V +I+MF+MN+ LSK
Sbjct  145  FVGVPEMARTEVVKQLWVYIREKNLQDPNNKRNIMCDEKLRSLFGVDSINMFQMNKALSK  204

Query  777  HIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLA  598
            HI P++ ED   VKST KE+QRK+ R E   D++     EPKQ+EKRQ   KGG +GFLA
Sbjct  205  HIGPLDTEDAP-VKSTQKEKQRKQERKE---DTN-----EPKQKEKRQ---KGGNSGFLA  252

Query  597  PIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  484
            P+ LS +LVKF GTGEN+LSR  VVKRMW+YIK+N LQ
Sbjct  253  PLPLSGALVKFLGTGENSLSRASVVKRMWEYIKQNNLQ  290


 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 50/79 (63%), Gaps = 2/79 (3%)
 Frame = -2

Query  615  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  436
            G GF     LS  L KF G  E  ++R +VVK++W YI+E  LQDP+NKR ++CD+KLR 
Sbjct  129  GGGFTKLCTLSPQLKKFVGVPE--MARTEVVKQLWVYIREKNLQDPNNKRNIMCDEKLRS  186

Query  435  LLEVDSFEGFTMTKLLTAH  379
            L  VDS   F M K L+ H
Sbjct  187  LFGVDSINMFQMNKALSKH  205



>ref|XP_012072456.1| PREDICTED: DNA ligase 1 isoform X4 [Jatropha curcas]
Length=481

 Score =   183 bits (465),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 118/160 (74%), Gaps = 14/160 (9%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  + E ELARTEVVKR+WAYIRE NLQDPK K+ IICDE+L  +F V +I+MF+MN+ L
Sbjct  332  QEFIGESELARTEVVKRLWAYIRERNLQDPKNKQNIICDESLHALFHVNSINMFQMNKAL  391

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP+ +E      ++ KE++ K+ R+     SD     EPKQ+EKRQ   K G +G 
Sbjct  392  SKHIWPLNEEVPN--NTSEKEKRSKQPRE----GSD-----EPKQKEKRQ---KKGASGL  437

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  484
            LAP+ LSD+LVKFFGTGEN LSR DVVKRMW YIK+N+LQ
Sbjct  438  LAPLPLSDALVKFFGTGENELSRADVVKRMWGYIKQNDLQ  477


 Score =   156 bits (395),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 91/218 (42%), Positives = 124/218 (57%), Gaps = 33/218 (15%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V   ELARTEVVK++WAYIRENNLQDPK K+ I CD+    +FRV +I+MF+MN+ L
Sbjct  189  QKIVGVTELARTEVVKKLWAYIRENNLQDPKNKRNIKCDQAFRDLFRVNSINMFQMNKAL  248

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKR-----------  637
            SKHIWP+  E          E ++ K +DE  ++S S+ + E + + +            
Sbjct  249  SKHIWPLTAE---------AENEKLKVKDEDGSNSVSEEEEEEEDQSEEEEEEEEEDMEK  299

Query  636  -----QRGLKGG------GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENE  490
                  R +KG       G GF     LS  L +F   GE+ L+R +VVKR+W YI+E  
Sbjct  300  KKKKGSRSIKGDKDGKKRGGGFTKLCSLSPQLQEFI--GESELARTEVVKRLWAYIRERN  357

Query  489  LQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            LQDP NK+ +ICD+ L  L  V+S   F M K L+ H 
Sbjct  358  LQDPKNKQNIICDESLHALFHVNSINMFQMNKALSKHI  395



>gb|EMS67367.1| Upstream activation factor subunit spp27 [Triticum urartu]
Length=489

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 126/181 (70%), Gaps = 11/181 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V   E ARTEVVK++WAYIRENNLQDP  +++I+CD+ L  IF V +IDMF+MN+ L
Sbjct  215  QEFVGASECARTEVVKKLWAYIRENNLQDPSNRRKILCDDNLKKIFNVNSIDMFQMNKAL  274

Query  783  SKHIWPIEKEDVTLVK--STPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGT  610
            +KHIWP++ +     K  STPKE+   KG+ +    S+ +         K++ G  G  +
Sbjct  275  TKHIWPLDSDGPVSPKEKSTPKEKSTPKGKPQKRDRSEGN---------KQKGGSSGSTS  325

Query  609  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  430
            G LAP+ LSD L KF GTGEN LSR DVVKRMW YIK+N LQDPS++R++ICD+KL++L 
Sbjct  326  GLLAPLVLSDDLAKFIGTGENMLSRSDVVKRMWDYIKDNNLQDPSDRRKIICDEKLKDLF  385

Query  429  E  427
            +
Sbjct  386  Q  386


 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 55/85 (65%), Gaps = 3/85 (4%)
 Frame = -2

Query  630  GLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICD  451
            G K  G GF     +S +L +F G  E A  R +VVK++W YI+EN LQDPSN+R+++CD
Sbjct  197  GKKKAG-GFTKLCSISPALQEFVGASECA--RTEVVKKLWAYIRENNLQDPSNRRKILCD  253

Query  450  DKLRELLEVDSFEGFTMTKLLTAHF  376
            D L+++  V+S + F M K LT H 
Sbjct  254  DNLKKIFNVNSIDMFQMNKALTKHI  278



>ref|XP_004290311.1| PREDICTED: upstream activation factor subunit spp27 isoform X3 
[Fragaria vesca subsp. vesca]
 ref|XP_011458332.1| PREDICTED: upstream activation factor subunit spp27 isoform X3 
[Fragaria vesca subsp. vesca]
Length=388

 Score =   179 bits (455),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/219 (46%), Positives = 132/219 (60%), Gaps = 29/219 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            QV+V EPE+AR EVVK+IWAYIRE +LQDPK ++ IICDETL  +F VK+IDMF+MN+ L
Sbjct  138  QVVVGEPEMARPEVVKKIWAYIREKDLQDPKNRRNIICDETLHAVFHVKSIDMFKMNKVL  197

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEP-----------------  655
            SKHIWP+  +D   VK T KE    +  D   ++ D  +  E                  
Sbjct  198  SKHIWPLNSQDGP-VKKTKKE----EDSDHSLSEGDVSNVDEQEVEEEEEDVEKEKGSNC  252

Query  654  KQEEKRQRG-----LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENE  490
            KQ +KR+       +K  G GF     LS  L KF G  E  L+R +VVKR+W YI+EN 
Sbjct  253  KQTKKRRSAKVDKEVKKRGGGFTKLSSLSPELQKFTGASE--LARTEVVKRLWNYIRENN  310

Query  489  LQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  373
            LQDP+N+R +ICD+  R L +VDS + F M K L+ H +
Sbjct  311  LQDPNNRRVIICDELFRTLFDVDSIDMFQMNKALSKHIL  349


 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 67/105 (64%), Gaps = 10/105 (10%)
 Frame = -2

Query  942  ELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI  763
            ELARTEVVKR+W YIRENNLQDP  ++ IICDE    +F V +IDMF+MN+ LSKHI P+
Sbjct  292  ELARTEVVKRLWNYIRENNLQDPNNRRVIICDELFRTLFDVDSIDMFQMNKALSKHILPL  351

Query  762  EKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRG  628
             +E   L  ++  E+Q +      +   DSD   E    EKRQ+ 
Sbjct  352  NQE-AALENASQTEKQSE------HEQEDSD---EADHNEKRQKN  386



>ref|XP_011458331.1| PREDICTED: upstream activation factor subunit spp27 isoform X2 
[Fragaria vesca subsp. vesca]
Length=393

 Score =   179 bits (455),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/219 (46%), Positives = 132/219 (60%), Gaps = 29/219 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            QV+V EPE+AR EVVK+IWAYIRE +LQDPK ++ IICDETL  +F VK+IDMF+MN+ L
Sbjct  138  QVVVGEPEMARPEVVKKIWAYIREKDLQDPKNRRNIICDETLHAVFHVKSIDMFKMNKVL  197

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEP-----------------  655
            SKHIWP+  +D   VK T KE    +  D   ++ D  +  E                  
Sbjct  198  SKHIWPLNSQDGP-VKKTKKE----EDSDHSLSEGDVSNVDEQEVEEEEEDVEKEKGSNC  252

Query  654  KQEEKRQRG-----LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENE  490
            KQ +KR+       +K  G GF     LS  L KF G  E  L+R +VVKR+W YI+EN 
Sbjct  253  KQTKKRRSAKVDKEVKKRGGGFTKLSSLSPELQKFTGASE--LARTEVVKRLWNYIRENN  310

Query  489  LQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  373
            LQDP+N+R +ICD+  R L +VDS + F M K L+ H +
Sbjct  311  LQDPNNRRVIICDELFRTLFDVDSIDMFQMNKALSKHIL  349


 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 67/105 (64%), Gaps = 5/105 (5%)
 Frame = -2

Query  942  ELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI  763
            ELARTEVVKR+W YIRENNLQDP  ++ IICDE    +F V +IDMF+MN+ LSKHI P+
Sbjct  292  ELARTEVVKRLWNYIRENNLQDPNNRRVIICDELFRTLFDVDSIDMFQMNKALSKHILPL  351

Query  762  EKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRG  628
             +E +     T K+ + ++     + DSD     E    EKRQ+ 
Sbjct  352  NQEALENASQTEKQSEHEQEASIQHPDSD-----EADHNEKRQKN  391



>ref|XP_011458329.1| PREDICTED: upstream activation factor subunit spp27 isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011458330.1| PREDICTED: upstream activation factor subunit spp27 isoform X1 
[Fragaria vesca subsp. vesca]
Length=394

 Score =   179 bits (455),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 99/221 (45%), Positives = 131/221 (59%), Gaps = 33/221 (15%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            QV+V EPE+AR EVVK+IWAYIRE +LQDPK ++ IICDETL  +F VK+IDMF+MN+ L
Sbjct  138  QVVVGEPEMARPEVVKKIWAYIREKDLQDPKNRRNIICDETLHAVFHVKSIDMFKMNKVL  197

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSD-------------------SDF  661
            SKHIWP+  +D  + K+       KK  D  ++ S+ D                      
Sbjct  198  SKHIWPLNSQDGPVKKT-------KKEEDSDHSLSEGDVSNVDEQEVEEEEEDVEKEKGS  250

Query  660  EPKQEEKRQRG-----LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKE  496
              KQ +KR+       +K  G GF     LS  L KF G  E  L+R +VVKR+W YI+E
Sbjct  251  NCKQTKKRRSAKVDKEVKKRGGGFTKLSSLSPELQKFTGASE--LARTEVVKRLWNYIRE  308

Query  495  NELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  373
            N LQDP+N+R +ICD+  R L +VDS + F M K L+ H +
Sbjct  309  NNLQDPNNRRVIICDELFRTLFDVDSIDMFQMNKALSKHIL  349


 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 68/105 (65%), Gaps = 4/105 (4%)
 Frame = -2

Query  942  ELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI  763
            ELARTEVVKR+W YIRENNLQDP  ++ IICDE    +F V +IDMF+MN+ LSKHI P+
Sbjct  292  ELARTEVVKRLWNYIRENNLQDPNNRRVIICDELFRTLFDVDSIDMFQMNKALSKHILPL  351

Query  762  EKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRG  628
             +E   L  ++  E+Q +  ++      DSD   E    EKRQ+ 
Sbjct  352  NQE-AALENASQTEKQSEHEQEASIQHPDSD---EADHNEKRQKN  392



>ref|XP_011458333.1| PREDICTED: upstream activation factor subunit spp27 isoform X4 
[Fragaria vesca subsp. vesca]
 ref|XP_011458334.1| PREDICTED: upstream activation factor subunit spp27 isoform X4 
[Fragaria vesca subsp. vesca]
Length=387

 Score =   179 bits (455),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/219 (46%), Positives = 132/219 (60%), Gaps = 29/219 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            QV+V EPE+AR EVVK+IWAYIRE +LQDPK ++ IICDETL  +F VK+IDMF+MN+ L
Sbjct  138  QVVVGEPEMARPEVVKKIWAYIREKDLQDPKNRRNIICDETLHAVFHVKSIDMFKMNKVL  197

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEP-----------------  655
            SKHIWP+  +D   VK T KE    +  D   ++ D  +  E                  
Sbjct  198  SKHIWPLNSQDGP-VKKTKKE----EDSDHSLSEGDVSNVDEQEVEEEEEDVEKEKGSNC  252

Query  654  KQEEKRQRG-----LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENE  490
            KQ +KR+       +K  G GF     LS  L KF G  E  L+R +VVKR+W YI+EN 
Sbjct  253  KQTKKRRSAKVDKEVKKRGGGFTKLSSLSPELQKFTGASE--LARTEVVKRLWNYIRENN  310

Query  489  LQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  373
            LQDP+N+R +ICD+  R L +VDS + F M K L+ H +
Sbjct  311  LQDPNNRRVIICDELFRTLFDVDSIDMFQMNKALSKHIL  349


 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 65/105 (62%), Gaps = 11/105 (10%)
 Frame = -2

Query  942  ELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI  763
            ELARTEVVKR+W YIRENNLQDP  ++ IICDE    +F V +IDMF+MN+ LSKHI P+
Sbjct  292  ELARTEVVKRLWNYIRENNLQDPNNRRVIICDELFRTLFDVDSIDMFQMNKALSKHILPL  351

Query  762  EKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRG  628
             +E +     T K+ +        +   DSD   E    EKRQ+ 
Sbjct  352  NQEALENASQTEKQSE--------HEQEDSD---EADHNEKRQKN  385



>ref|XP_011458335.1| PREDICTED: upstream activation factor subunit spp27 isoform X5 
[Fragaria vesca subsp. vesca]
Length=381

 Score =   179 bits (453),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 100/219 (46%), Positives = 132/219 (60%), Gaps = 29/219 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            QV+V EPE+AR EVVK+IWAYIRE +LQDPK ++ IICDETL  +F VK+IDMF+MN+ L
Sbjct  138  QVVVGEPEMARPEVVKKIWAYIREKDLQDPKNRRNIICDETLHAVFHVKSIDMFKMNKVL  197

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDF-----------------EP  655
            SKHIWP+  +D   VK T KE    +  D   ++ D  +                     
Sbjct  198  SKHIWPLNSQDGP-VKKTKKE----EDSDHSLSEGDVSNVDEQEVEEEEEDVEKEKGSNC  252

Query  654  KQEEKRQRG-----LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENE  490
            KQ +KR+       +K  G GF     LS  L KF  TG + L+R +VVKR+W YI+EN 
Sbjct  253  KQTKKRRSAKVDKEVKKRGGGFTKLSSLSPELQKF--TGASELARTEVVKRLWNYIRENN  310

Query  489  LQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  373
            LQDP+N+R +ICD+  R L +VDS + F M K L+ H +
Sbjct  311  LQDPNNRRVIICDELFRTLFDVDSIDMFQMNKALSKHIL  349


 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -2

Query  942  ELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI  763
            ELARTEVVKR+W YIRENNLQDP  ++ IICDE    +F V +IDMF+MN+ LSKHI P+
Sbjct  292  ELARTEVVKRLWNYIRENNLQDPNNRRVIICDELFRTLFDVDSIDMFQMNKALSKHILPL  351

Query  762  EKEDVTL  742
             +ED  L
Sbjct  352  NQEDHLL  358



>ref|XP_009345973.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Pyrus x bretschneideri]
Length=363

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/220 (45%), Positives = 132/220 (60%), Gaps = 32/220 (15%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V  PE+ARTEVVKRIWAYIRE +LQDPK ++ I CDE+L  +FRV +I+MF+MN+ L
Sbjct  132  QEFVGVPEMARTEVVKRIWAYIREKDLQDPKNRRNIRCDESLHSLFRVNSINMFQMNKVL  191

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSD---------------SDFEPKQ  649
            SKHIWP+ +ED  +       +Q+KK  +  ++ S+ D                    ++
Sbjct  192  SKHIWPLSREDEPV-------KQKKKVEESDHSISEGDVSNVAEQEEEEEVEVKKVSRQK  244

Query  648  EEKRQRGLK--------GGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKEN  493
            E K++R  K        GGG GF     LS  L KF  TG +AL+R +VVK++W YI+EN
Sbjct  245  ENKKRRSTKVDKEVKKRGGGGGFTKLCSLSPELQKF--TGVSALARTEVVKKLWIYIREN  302

Query  492  ELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  373
             LQDP NKR +ICD+ LR L +VD    F M K L+ H +
Sbjct  303  NLQDPKNKRDIICDESLRGLFDVDCINMFQMNKALSKHIL  342


 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -2

Query  939  LARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIE  760
            LARTEVVK++W YIRENNLQDPK K+ IICDE+L G+F V  I+MF+MN+ LSKHI P+ 
Sbjct  286  LARTEVVKKLWIYIRENNLQDPKNKRDIICDESLRGLFDVDCINMFQMNKALSKHILPLS  345

Query  759  KEDVTL  742
            +E + +
Sbjct  346  EEGLVI  351



>ref|XP_009345972.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Pyrus x bretschneideri]
Length=368

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/220 (45%), Positives = 132/220 (60%), Gaps = 32/220 (15%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V  PE+ARTEVVKRIWAYIRE +LQDPK ++ I CDE+L  +FRV +I+MF+MN+ L
Sbjct  132  QEFVGVPEMARTEVVKRIWAYIREKDLQDPKNRRNIRCDESLHSLFRVNSINMFQMNKVL  191

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSD---------------SDFEPKQ  649
            SKHIWP+ +ED  +       +Q+KK  +  ++ S+ D                    ++
Sbjct  192  SKHIWPLSREDEPV-------KQKKKVEESDHSISEGDVSNVAEQEEEEEVEVKKVSRQK  244

Query  648  EEKRQRGLK--------GGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKEN  493
            E K++R  K        GGG GF     LS  L KF  TG +AL+R +VVK++W YI+EN
Sbjct  245  ENKKRRSTKVDKEVKKRGGGGGFTKLCSLSPELQKF--TGVSALARTEVVKKLWIYIREN  302

Query  492  ELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  373
             LQDP NKR +ICD+ LR L +VD    F M K L+ H +
Sbjct  303  NLQDPKNKRDIICDESLRGLFDVDCINMFQMNKALSKHIL  342


 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -2

Query  939  LARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIE  760
            LARTEVVK++W YIRENNLQDPK K+ IICDE+L G+F V  I+MF+MN+ LSKHI P+ 
Sbjct  286  LARTEVVKKLWIYIRENNLQDPKNKRDIICDESLRGLFDVDCINMFQMNKALSKHILPLS  345

Query  759  KE  754
            +E
Sbjct  346  EE  347



>ref|XP_009345971.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Pyrus x bretschneideri]
Length=369

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/220 (45%), Positives = 132/220 (60%), Gaps = 32/220 (15%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V  PE+ARTEVVKRIWAYIRE +LQDPK ++ I CDE+L  +FRV +I+MF+MN+ L
Sbjct  132  QEFVGVPEMARTEVVKRIWAYIREKDLQDPKNRRNIRCDESLHSLFRVNSINMFQMNKVL  191

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSD---------------SDFEPKQ  649
            SKHIWP+ +ED  +       +Q+KK  +  ++ S+ D                    ++
Sbjct  192  SKHIWPLSREDEPV-------KQKKKVEESDHSISEGDVSNVAEQEEEEEVEVKKVSRQK  244

Query  648  EEKRQRGLK--------GGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKEN  493
            E K++R  K        GGG GF     LS  L KF  TG +AL+R +VVK++W YI+EN
Sbjct  245  ENKKRRSTKVDKEVKKRGGGGGFTKLCSLSPELQKF--TGVSALARTEVVKKLWIYIREN  302

Query  492  ELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  373
             LQDP NKR +ICD+ LR L +VD    F M K L+ H +
Sbjct  303  NLQDPKNKRDIICDESLRGLFDVDCINMFQMNKALSKHIL  342


 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -2

Query  939  LARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIE  760
            LARTEVVK++W YIRENNLQDPK K+ IICDE+L G+F V  I+MF+MN+ LSKHI P+ 
Sbjct  286  LARTEVVKKLWIYIRENNLQDPKNKRDIICDESLRGLFDVDCINMFQMNKALSKHILPLS  345

Query  759  KE  754
            +E
Sbjct  346  EE  347



>ref|XP_010941848.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Elaeis guineensis]
Length=302

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 109/163 (67%), Gaps = 10/163 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V E ELARTEVVK++WAYIR+N+LQDP  +K IICD+TL  IF V TIDMF+MN+ L
Sbjct  141  QQFVGESELARTEVVKKLWAYIRQNSLQDPNNRKNIICDDTLQNIFNVSTIDMFQMNKAL  200

Query  783  SKHIWPIEKE--DVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGT  610
            SKHIWP++ E    T V+S P        R E           +P ++E+  +  KGG +
Sbjct  201  SKHIWPLDSEGGSSTTVRSEPTGGSSTTVRSEPKA--------KPHKKEREVKRQKGGSS  252

Query  609  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  481
            G L P+ LSD LVKF GTGEN LSR D VKRMW+YIK+N LQD
Sbjct  253  GLLVPLPLSDDLVKFIGTGENTLSRSDAVKRMWEYIKQNNLQD  295


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 52/80 (65%), Gaps = 2/80 (3%)
 Frame = -2

Query  615  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  436
            G GF     LS +L +F   GE+ L+R +VVK++W YI++N LQDP+N++ +ICDD L+ 
Sbjct  127  GGGFTKLCSLSPALQQF--VGESELARTEVVKKLWAYIRQNSLQDPNNRKNIICDDTLQN  184

Query  435  LLEVDSFEGFTMTKLLTAHF  376
            +  V + + F M K L+ H 
Sbjct  185  IFNVSTIDMFQMNKALSKHI  204



>ref|XP_010999905.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X6 [Populus euphratica]
Length=393

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 130/216 (60%), Gaps = 31/216 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V  PELARTEVVKR+WAYIRENNLQDPK +K+I CDE L  +F V +IDMF+MN+ L
Sbjct  132  QAVVGVPELARTEVVKRLWAYIRENNLQDPKNRKKIKCDEALRAVFHVNSIDMFQMNKAL  191

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSD-----------FEPKQEEKR  637
            SKHIWP+  E+ ++       +Q++K +D    DS S+ D            + +  E+ 
Sbjct  192  SKHIWPLTGENESV-------KQKEKSKD--INDSGSEGDNGGEQEDDEEEVKKESNERS  242

Query  636  QRG---------LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  484
            ++G         +K  G GF     LS  L +F G  E  L+R  VVK++W YI+E  LQ
Sbjct  243  KKGRRSAKVDEDVKKRGGGFTKLCSLSPQLQEFVGVPE--LARTGVVKKLWAYIREKNLQ  300

Query  483  DPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            DP NKR +ICD+ LR + +VDS + F M K LT H 
Sbjct  301  DPKNKRNIICDESLRSIFDVDSIDMFQMNKALTKHI  336


 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 78/111 (70%), Gaps = 9/111 (8%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V  PELART VVK++WAYIRE NLQDPK K+ IICDE+L  IF V +IDMF+MN+ L
Sbjct  273  QEFVGVPELARTGVVKKLWAYIREKNLQDPKNKRNIICDESLRSIFDVDSIDMFQMNKAL  332

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQR  631
            +KHIW + +ED     S+PK++  K+GR+E           EPKQ+EKRQ+
Sbjct  333  TKHIWAVSEEDAP-SNSSPKKKGIKQGREE--------GPDEPKQKEKRQK  374


 Score = 72.8 bits (177),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 55/98 (56%), Gaps = 8/98 (8%)
 Frame = -2

Query  654  KQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  475
            K E+ R+RG      GF     LS  L    G  E  L+R +VVKR+W YI+EN LQDP 
Sbjct  111  KIEKVRKRG------GFAKLSNLSPQLQAVVGVPE--LARTEVVKRLWAYIRENNLQDPK  162

Query  474  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG  361
            N++++ CD+ LR +  V+S + F M K L+ H     G
Sbjct  163  NRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTG  200



>ref|XP_010999877.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X5 [Populus euphratica]
Length=407

 Score =   177 bits (449),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 130/216 (60%), Gaps = 31/216 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V  PELARTEVVKR+WAYIRENNLQDPK +K+I CDE L  +F V +IDMF+MN+ L
Sbjct  132  QAVVGVPELARTEVVKRLWAYIRENNLQDPKNRKKIKCDEALRAVFHVNSIDMFQMNKAL  191

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSD-----------FEPKQEEKR  637
            SKHIWP+  E+ ++       +Q++K +D    DS S+ D            + +  E+ 
Sbjct  192  SKHIWPLTGENESV-------KQKEKSKD--INDSGSEGDNGGEQEDDEEEVKKESNERS  242

Query  636  QRG---------LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  484
            ++G         +K  G GF     LS  L +F G  E  L+R  VVK++W YI+E  LQ
Sbjct  243  KKGRRSAKVDEDVKKRGGGFTKLCSLSPQLQEFVGVPE--LARTGVVKKLWAYIREKNLQ  300

Query  483  DPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            DP NKR +ICD+ LR + +VDS + F M K LT H 
Sbjct  301  DPKNKRNIICDESLRSIFDVDSIDMFQMNKALTKHI  336


 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 78/111 (70%), Gaps = 9/111 (8%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V  PELART VVK++WAYIRE NLQDPK K+ IICDE+L  IF V +IDMF+MN+ L
Sbjct  273  QEFVGVPELARTGVVKKLWAYIREKNLQDPKNKRNIICDESLRSIFDVDSIDMFQMNKAL  332

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQR  631
            +KHIW + +ED     S+PK++  K+GR+E           EPKQ+EKRQ+
Sbjct  333  TKHIWAVSEEDAP-SNSSPKKKGIKQGREE--------GPDEPKQKEKRQK  374


 Score = 72.8 bits (177),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 55/98 (56%), Gaps = 8/98 (8%)
 Frame = -2

Query  654  KQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  475
            K E+ R+RG      GF     LS  L    G  E  L+R +VVKR+W YI+EN LQDP 
Sbjct  111  KIEKVRKRG------GFAKLSNLSPQLQAVVGVPE--LARTEVVKRLWAYIRENNLQDPK  162

Query  474  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG  361
            N++++ CD+ LR +  V+S + F M K L+ H     G
Sbjct  163  NRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTG  200



>ref|XP_010999862.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Populus euphratica]
Length=438

 Score =   177 bits (450),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 130/216 (60%), Gaps = 31/216 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V  PELARTEVVKR+WAYIRENNLQDPK +K+I CDE L  +F V +IDMF+MN+ L
Sbjct  132  QAVVGVPELARTEVVKRLWAYIRENNLQDPKNRKKIKCDEALRAVFHVNSIDMFQMNKAL  191

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSD-----------FEPKQEEKR  637
            SKHIWP+  E+ ++       +Q++K +D    DS S+ D            + +  E+ 
Sbjct  192  SKHIWPLTGENESV-------KQKEKSKD--INDSGSEGDNGGEQEDDEEEVKKESNERS  242

Query  636  QRG---------LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  484
            ++G         +K  G GF     LS  L +F G  E  L+R  VVK++W YI+E  LQ
Sbjct  243  KKGRRSAKVDEDVKKRGGGFTKLCSLSPQLQEFVGVPE--LARTGVVKKLWAYIREKNLQ  300

Query  483  DPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            DP NKR +ICD+ LR + +VDS + F M K LT H 
Sbjct  301  DPKNKRNIICDESLRSIFDVDSIDMFQMNKALTKHI  336


 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 118/213 (55%), Gaps = 47/213 (22%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V  PELART VVK++WAYIRE NLQDPK K+ IICDE+L  IF V +IDMF+MN+ L
Sbjct  273  QEFVGVPELARTGVVKKLWAYIREKNLQDPKNKRNIICDESLRSIFDVDSIDMFQMNKAL  332

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHIW + +ED     S+PK++  K+GR+E           EPKQ+EKRQ+ +       
Sbjct  333  TKHIWAVSEEDAP-SNSSPKKKGIKQGREE--------GPDEPKQKEKRQKKV-------  376

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
              P +      +    G                           KRR++CD KL+E+ EV
Sbjct  377  --PHEPKKKEKQQKKAG---------------------------KRRIVCDKKLKEISEV  407

Query  423  DSFEGFTMTKLLTAHFIKTAG*CYLTFLAT*KC  325
            DSF GFT +KLL+ HFIKT     LT LA   C
Sbjct  408  DSFNGFTASKLLSLHFIKTEH--KLTSLACHTC  438


 Score = 72.8 bits (177),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 55/98 (56%), Gaps = 8/98 (8%)
 Frame = -2

Query  654  KQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  475
            K E+ R+RG      GF     LS  L    G  E  L+R +VVKR+W YI+EN LQDP 
Sbjct  111  KIEKVRKRG------GFAKLSNLSPQLQAVVGVPE--LARTEVVKRLWAYIRENNLQDPK  162

Query  474  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG  361
            N++++ CD+ LR +  V+S + F M K L+ H     G
Sbjct  163  NRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTG  200



>ref|XP_010999870.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X4 [Populus euphratica]
Length=428

 Score =   177 bits (449),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 130/216 (60%), Gaps = 31/216 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V  PELARTEVVKR+WAYIRENNLQDPK +K+I CDE L  +F V +IDMF+MN+ L
Sbjct  132  QAVVGVPELARTEVVKRLWAYIRENNLQDPKNRKKIKCDEALRAVFHVNSIDMFQMNKAL  191

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSD-----------FEPKQEEKR  637
            SKHIWP+  E+ ++       +Q++K +D    DS S+ D            + +  E+ 
Sbjct  192  SKHIWPLTGENESV-------KQKEKSKD--INDSGSEGDNGGEQEDDEEEVKKESNERS  242

Query  636  QRG---------LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  484
            ++G         +K  G GF     LS  L +F G  E  L+R  VVK++W YI+E  LQ
Sbjct  243  KKGRRSAKVDEDVKKRGGGFTKLCSLSPQLQEFVGVPE--LARTGVVKKLWAYIREKNLQ  300

Query  483  DPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            DP NKR +ICD+ LR + +VDS + F M K LT H 
Sbjct  301  DPKNKRNIICDESLRSIFDVDSIDMFQMNKALTKHI  336


 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 113/199 (57%), Gaps = 45/199 (23%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V  PELART VVK++WAYIRE NLQDPK K+ IICDE+L  IF V +IDMF+MN+ L
Sbjct  273  QEFVGVPELARTGVVKKLWAYIREKNLQDPKNKRNIICDESLRSIFDVDSIDMFQMNKAL  332

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHIW + +ED     S+PK++  K+GR+E           EPKQ+EKRQ+ +       
Sbjct  333  TKHIWAVSEEDAP-SNSSPKKKGIKQGREE--------GPDEPKQKEKRQKKV-------  376

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
              P +      +    G                           KRR++CD KL+E+ EV
Sbjct  377  --PHEPKKKEKQQKKAG---------------------------KRRIVCDKKLKEISEV  407

Query  423  DSFEGFTMTKLLTAHFIKT  367
            DSF GFT +KLL+ HFIKT
Sbjct  408  DSFNGFTASKLLSLHFIKT  426


 Score = 72.8 bits (177),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 55/98 (56%), Gaps = 8/98 (8%)
 Frame = -2

Query  654  KQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  475
            K E+ R+RG      GF     LS  L    G  E  L+R +VVKR+W YI+EN LQDP 
Sbjct  111  KIEKVRKRG------GFAKLSNLSPQLQAVVGVPE--LARTEVVKRLWAYIRENNLQDPK  162

Query  474  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG  361
            N++++ CD+ LR +  V+S + F M K L+ H     G
Sbjct  163  NRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTG  200



>ref|XP_010999856.1| PREDICTED: uncharacterized protein PFB0145c-like isoform X2 [Populus 
euphratica]
Length=448

 Score =   177 bits (449),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 130/215 (60%), Gaps = 30/215 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V  PELARTEVVKR+WAYIRENNLQDPK +K+I CDE L  +F V +IDMF+MN+ L
Sbjct  132  QAVVGVPELARTEVVKRLWAYIRENNLQDPKNRKKIKCDEALRAVFHVNSIDMFQMNKAL  191

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSD-----------FEPKQEEKR  637
            SKHIWP+  E+ ++       +Q++K +D    DS S+ D            + +  E+ 
Sbjct  192  SKHIWPLTGENESV-------KQKEKSKD--INDSGSEGDNGGEQEDDEEEVKKESNERS  242

Query  636  QRG--------LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  481
            ++G        +K  G GF     LS  L +F G  E  L+R  VVK++W YI+E  LQD
Sbjct  243  KKGRSAKVDEDVKKRGGGFTKLCSLSPQLQEFVGVPE--LARTGVVKKLWAYIREKNLQD  300

Query  480  PSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            P NKR +ICD+ LR + +VDS + F M K LT H 
Sbjct  301  PKNKRNIICDESLRSIFDVDSIDMFQMNKALTKHI  335


 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 113/199 (57%), Gaps = 45/199 (23%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V  PELART VVK++WAYIRE NLQDPK K+ IICDE+L  IF V +IDMF+MN+ L
Sbjct  272  QEFVGVPELARTGVVKKLWAYIREKNLQDPKNKRNIICDESLRSIFDVDSIDMFQMNKAL  331

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHIW + +ED     S+PK++  K+GR+E           EPKQ+EKRQ+ +       
Sbjct  332  TKHIWAVSEEDAP-SNSSPKKKGIKQGREE--------GPDEPKQKEKRQKKV-------  375

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
              P +      +    G                           KRR++CD KL+E+ EV
Sbjct  376  --PHEPKKKEKQQKKAG---------------------------KRRIVCDKKLKEISEV  406

Query  423  DSFEGFTMTKLLTAHFIKT  367
            DSF GFT +KLL+ HFIKT
Sbjct  407  DSFNGFTASKLLSLHFIKT  425


 Score = 72.8 bits (177),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 55/98 (56%), Gaps = 8/98 (8%)
 Frame = -2

Query  654  KQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  475
            K E+ R+RG      GF     LS  L    G  E  L+R +VVKR+W YI+EN LQDP 
Sbjct  111  KIEKVRKRG------GFAKLSNLSPQLQAVVGVPE--LARTEVVKRLWAYIRENNLQDPK  162

Query  474  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG  361
            N++++ CD+ LR +  V+S + F M K L+ H     G
Sbjct  163  NRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTG  200



>ref|XP_001767040.1| predicted protein [Physcomitrella patens]
 gb|EDQ68206.1| predicted protein [Physcomitrella patens]
Length=380

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 128/203 (63%), Gaps = 20/203 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q ++ E EL RT+VVK++WAYIRE+NLQDP+ K++IICD+ L  +    + DMF+MN+ L
Sbjct  189  QTIIGESELPRTQVVKQLWAYIREHNLQDPEDKRKIICDDALRNLLGTNSTDMFKMNKLL  248

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGG---  613
            S+HIWP+   D  + ++  K R R               D EPK   K+Q+ +  GG   
Sbjct  249  SRHIWPL---DNGVTEAAAKVRDRDT----------DTDDVEPK--PKKQKTVSSGGGKS  293

Query  612  --TGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLR  439
               GFLAP  +SD L KF    +  +SR +  KRMW YIK++ LQDP+NK++++CD  L+
Sbjct  294  KTQGFLAPYPISDQLAKFLDVEDGKVSRAEAAKRMWAYIKDHNLQDPTNKKKILCDQPLQ  353

Query  438  ELLEVDSFEGFTMTKLLTAHFIK  370
            +LL+ D F GF ++KLL  HFIK
Sbjct  354  DLLDCDHFVGFDLSKLLKRHFIK  376



>ref|XP_010941846.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Elaeis guineensis]
 ref|XP_010941847.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Elaeis guineensis]
Length=323

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 109/162 (67%), Gaps = 10/162 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V E ELARTEVVK++WAYIR+N+LQDP  +K IICD+TL  IF V TIDMF+MN+ L
Sbjct  141  QQFVGESELARTEVVKKLWAYIRQNSLQDPNNRKNIICDDTLQNIFNVSTIDMFQMNKAL  200

Query  783  SKHIWPIEKE--DVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGT  610
            SKHIWP++ E    T V+S P        R        S+   +P ++E+  +  KGG +
Sbjct  201  SKHIWPLDSEGGSSTTVRSEPTGGSSTTVR--------SEPKAKPHKKEREVKRQKGGSS  252

Query  609  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  484
            G L P+ LSD LVKF GTGEN LSR D VKRMW+YIK+N LQ
Sbjct  253  GLLVPLPLSDDLVKFIGTGENTLSRSDAVKRMWEYIKQNNLQ  294


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 52/80 (65%), Gaps = 2/80 (3%)
 Frame = -2

Query  615  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  436
            G GF     LS +L +F   GE+ L+R +VVK++W YI++N LQDP+N++ +ICDD L+ 
Sbjct  127  GGGFTKLCSLSPALQQF--VGESELARTEVVKKLWAYIRQNSLQDPNNRKNIICDDTLQN  184

Query  435  LLEVDSFEGFTMTKLLTAHF  376
            +  V + + F M K L+ H 
Sbjct  185  IFNVSTIDMFQMNKALSKHI  204



>ref|XP_010999846.1| PREDICTED: uncharacterized protein PFB0145c-like isoform X1 [Populus 
euphratica]
Length=449

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 130/216 (60%), Gaps = 31/216 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V  PELARTEVVKR+WAYIRENNLQDPK +K+I CDE L  +F V +IDMF+MN+ L
Sbjct  132  QAVVGVPELARTEVVKRLWAYIRENNLQDPKNRKKIKCDEALRAVFHVNSIDMFQMNKAL  191

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSD-----------FEPKQEEKR  637
            SKHIWP+  E+ ++       +Q++K +D    DS S+ D            + +  E+ 
Sbjct  192  SKHIWPLTGENESV-------KQKEKSKD--INDSGSEGDNGGEQEDDEEEVKKESNERS  242

Query  636  QRG---------LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  484
            ++G         +K  G GF     LS  L +F G  E  L+R  VVK++W YI+E  LQ
Sbjct  243  KKGRRSAKVDEDVKKRGGGFTKLCSLSPQLQEFVGVPE--LARTGVVKKLWAYIREKNLQ  300

Query  483  DPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            DP NKR +ICD+ LR + +VDS + F M K LT H 
Sbjct  301  DPKNKRNIICDESLRSIFDVDSIDMFQMNKALTKHI  336


 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 113/199 (57%), Gaps = 45/199 (23%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V  PELART VVK++WAYIRE NLQDPK K+ IICDE+L  IF V +IDMF+MN+ L
Sbjct  273  QEFVGVPELARTGVVKKLWAYIREKNLQDPKNKRNIICDESLRSIFDVDSIDMFQMNKAL  332

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHIW + +ED     S+PK++  K+GR+E           EPKQ+EKRQ+ +       
Sbjct  333  TKHIWAVSEEDAP-SNSSPKKKGIKQGREE--------GPDEPKQKEKRQKKV-------  376

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
              P +      +    G                           KRR++CD KL+E+ EV
Sbjct  377  --PHEPKKKEKQQKKAG---------------------------KRRIVCDKKLKEISEV  407

Query  423  DSFEGFTMTKLLTAHFIKT  367
            DSF GFT +KLL+ HFIKT
Sbjct  408  DSFNGFTASKLLSLHFIKT  426


 Score = 72.8 bits (177),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 55/98 (56%), Gaps = 8/98 (8%)
 Frame = -2

Query  654  KQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  475
            K E+ R+RG      GF     LS  L    G  E  L+R +VVKR+W YI+EN LQDP 
Sbjct  111  KIEKVRKRG------GFAKLSNLSPQLQAVVGVPE--LARTEVVKRLWAYIRENNLQDPK  162

Query  474  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG  361
            N++++ CD+ LR +  V+S + F M K L+ H     G
Sbjct  163  NRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTG  200



>ref|XP_009345974.1| PREDICTED: ABC transporter F family member 4 [Pyrus x bretschneideri]
Length=483

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/220 (45%), Positives = 132/220 (60%), Gaps = 32/220 (15%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V  PE+ARTEVVKRIWAYIRE +LQDPK ++ I CDE+L  +FRV +I+MF+MN+ L
Sbjct  132  QEFVGVPEMARTEVVKRIWAYIREKDLQDPKNRRNIRCDESLHSLFRVNSINMFQMNKVL  191

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSD---------------SDFEPKQ  649
            SKHIWP+ +ED  +       +Q+KK  +  ++ S+ D                    ++
Sbjct  192  SKHIWPLSREDEPV-------KQKKKVEESDHSISEGDVSNVAEQEEEEEVEVKKVSRQK  244

Query  648  EEKRQRGLK--------GGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKEN  493
            E K++R  K        GGG GF     LS  L KF  TG +AL+R +VVK++W YI+EN
Sbjct  245  ENKKRRSTKVDKEVKKRGGGGGFTKLCSLSPELQKF--TGVSALARTEVVKKLWIYIREN  302

Query  492  ELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  373
             LQDP NKR +ICD+ LR L +VD    F M K L+ H +
Sbjct  303  NLQDPKNKRDIICDESLRGLFDVDCINMFQMNKALSKHIL  342


 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 123/181 (68%), Gaps = 7/181 (4%)
 Frame = -2

Query  939  LARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIE  760
            LARTEVVK++W YIRENNLQDPK K+ IICDE+L G+F V  I+MF+MN+ LSKHI P+ 
Sbjct  286  LARTEVVKKLWIYIRENNLQDPKNKRDIICDESLRGLFDVDCINMFQMNKALSKHILPLS  345

Query  759  KE---DVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQ  589
            +E   D T  K    E + ++G    +  S  ++     ++ K+   +K G +G L+ + 
Sbjct  346  EEAAPDNTSQKEKQSEEEEEEGEINKFRSSGYETLLMTLRKTKKT--VKNGDSGLLSSLP  403

Query  588  LSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEG  409
            LS+S++KF    E  LSR  V  R W+Y+K+N+LQDP++KRR +CDDKL+EL EVDSF G
Sbjct  404  LSNSVLKFLNNWERLLSRAGV--RDWEYLKQNDLQDPTDKRRTVCDDKLKELFEVDSFNG  461

Query  408  F  406
            F
Sbjct  462  F  462



>gb|EMT28995.1| hypothetical protein F775_31871 [Aegilops tauschii]
Length=250

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 124/199 (62%), Gaps = 24/199 (12%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V   E ARTEVVK++WAYIRENNLQDP  +++I+CDE L  IF           + +
Sbjct  75   QEFVGASECARTEVVKKLWAYIRENNLQDPSNRRKILCDENLKKIFN-------SCRKIV  127

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +   W      V+  KSTPK + +K+ R E                 K++ G  G  +G 
Sbjct  128  ALLAW--SSGPVSPKKSTPKAKPQKRDRSEA---------------NKQKGGSSGSTSGL  170

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            LAP+ LSD L KF GTGE+ LSR DVVKRMW YIKEN LQDPS++R++ICD+KL++L +V
Sbjct  171  LAPLVLSDDLAKFIGTGESMLSRSDVVKRMWVYIKENNLQDPSDRRKIICDEKLKDLFQV  230

Query  423  DSFEGFTMTKLLTAHFIKT  367
            +SF GFT++KLL  HF K 
Sbjct  231  ESFTGFTVSKLLNPHFTKA  249



>gb|KHN36203.1| Upstream activation factor subunit spp27 [Glycine soja]
Length=354

 Score =   173 bits (438),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 111/160 (69%), Gaps = 20/160 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  ++ PE+ARTEVVK++W YIRE NLQDP  ++ IICDE L  +F V +I+MF+MN+ L
Sbjct  204  QEFMEAPEMARTEVVKQLWVYIREKNLQDPNNRRNIICDERLRSLFNVNSINMFQMNKAL  263

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIWP+E +D   + ++              TDSD     E K++EKRQ+G  GG +GF
Sbjct  264  SKHIWPLESDDAYCIITS-------------MTDSD-----EAKKKEKRQKG--GGKSGF  303

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  484
            LAP+QLSD+LV F GTGE+ L+R DV+KRMW YIK N LQ
Sbjct  304  LAPLQLSDALVNFLGTGESELARTDVIKRMWDYIKGNNLQ  343


 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = -2

Query  615  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  436
            G GF     LS  L +F    E  ++R +VVK++W YI+E  LQDP+N+R +ICD++LR 
Sbjct  190  GGGFCKLCSLSPQLQEFMEAPE--MARTEVVKQLWVYIREKNLQDPNNRRNIICDERLRS  247

Query  435  LLEVDSFEGFTMTKLLTAH  379
            L  V+S   F M K L+ H
Sbjct  248  LFNVNSINMFQMNKALSKH  266



>ref|XP_009375740.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X4 [Pyrus x bretschneideri]
Length=367

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 128/216 (59%), Gaps = 21/216 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V EPE+ARTEVV+RIWAYIRE +LQDPK ++ I CDE+L  +FRV +I+MF+MN+ L
Sbjct  129  QEFVGEPEMARTEVVRRIWAYIREKDLQDPKNRRNIRCDESLHSLFRVNSINMFQMNKVL  188

Query  783  SKHIWPIEKED---VTLVKSTPKERQRKKGRDEVYTDSDSDSDFEP--------KQEEKR  637
            SKHIWP+  ED       K    +    +G +    + +   + E         ++E K+
Sbjct  189  SKHIWPLSGEDEPVKKKKKVEESDHSVSEGSNVAEQEEEEVEEKEEVEVERGSRRKETKK  248

Query  636  QRGLK--------GGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  481
            QR  K        GGG GF     LS  L KF  TG +AL+R +VVK++W YI+EN LQD
Sbjct  249  QRSTKVDKEVKKRGGGGGFTKLCSLSPELQKF--TGVSALARTEVVKKLWIYIRENNLQD  306

Query  480  PSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  373
            P NKR +ICD+ LR L +VD    F M K L  H +
Sbjct  307  PKNKRDIICDESLRALFDVDCINMFQMNKALCKHIL  342


 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -2

Query  939  LARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIE  760
            LARTEVVK++W YIRENNLQDPK K+ IICDE+L  +F V  I+MF+MN+ L KHI P+ 
Sbjct  286  LARTEVVKKLWIYIRENNLQDPKNKRDIICDESLRALFDVDCINMFQMNKALCKHILPLN  345

Query  759  KE  754
            +E
Sbjct  346  EE  347


 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = -2

Query  609  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  430
            GF     LS  L +F G  E  ++R +VV+R+W YI+E +LQDP N+R + CD+ L  L 
Sbjct  117  GFNKICSLSPQLQEFVGEPE--MARTEVVRRIWAYIREKDLQDPKNRRNIRCDESLHSLF  174

Query  429  EVDSFEGFTMTKLLTAHFIKTAG  361
             V+S   F M K+L+ H    +G
Sbjct  175  RVNSINMFQMNKVLSKHIWPLSG  197



>ref|XP_009375739.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X3 [Pyrus x bretschneideri]
Length=368

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 128/216 (59%), Gaps = 21/216 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V EPE+ARTEVV+RIWAYIRE +LQDPK ++ I CDE+L  +FRV +I+MF+MN+ L
Sbjct  129  QEFVGEPEMARTEVVRRIWAYIREKDLQDPKNRRNIRCDESLHSLFRVNSINMFQMNKVL  188

Query  783  SKHIWPIEKED---VTLVKSTPKERQRKKGRDEVYTDSDSDSDFEP--------KQEEKR  637
            SKHIWP+  ED       K    +    +G +    + +   + E         ++E K+
Sbjct  189  SKHIWPLSGEDEPVKKKKKVEESDHSVSEGSNVAEQEEEEVEEKEEVEVERGSRRKETKK  248

Query  636  QRGLK--------GGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  481
            QR  K        GGG GF     LS  L KF  TG +AL+R +VVK++W YI+EN LQD
Sbjct  249  QRSTKVDKEVKKRGGGGGFTKLCSLSPELQKF--TGVSALARTEVVKKLWIYIRENNLQD  306

Query  480  PSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  373
            P NKR +ICD+ LR L +VD    F M K L  H +
Sbjct  307  PKNKRDIICDESLRALFDVDCINMFQMNKALCKHIL  342


 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -2

Query  939  LARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIE  760
            LARTEVVK++W YIRENNLQDPK K+ IICDE+L  +F V  I+MF+MN+ L KHI P+ 
Sbjct  286  LARTEVVKKLWIYIRENNLQDPKNKRDIICDESLRALFDVDCINMFQMNKALCKHILPLN  345

Query  759  KE  754
            +E
Sbjct  346  EE  347


 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = -2

Query  609  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  430
            GF     LS  L +F G  E  ++R +VV+R+W YI+E +LQDP N+R + CD+ L  L 
Sbjct  117  GFNKICSLSPQLQEFVGEPE--MARTEVVRRIWAYIREKDLQDPKNRRNIRCDESLHSLF  174

Query  429  EVDSFEGFTMTKLLTAHFIKTAG  361
             V+S   F M K+L+ H    +G
Sbjct  175  RVNSINMFQMNKVLSKHIWPLSG  197



>ref|XP_009375737.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X1 [Pyrus x bretschneideri]
Length=369

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 128/216 (59%), Gaps = 21/216 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V EPE+ARTEVV+RIWAYIRE +LQDPK ++ I CDE+L  +FRV +I+MF+MN+ L
Sbjct  129  QEFVGEPEMARTEVVRRIWAYIREKDLQDPKNRRNIRCDESLHSLFRVNSINMFQMNKVL  188

Query  783  SKHIWPIEKED---VTLVKSTPKERQRKKGRDEVYTDSDSDSDFEP--------KQEEKR  637
            SKHIWP+  ED       K    +    +G +    + +   + E         ++E K+
Sbjct  189  SKHIWPLSGEDEPVKKKKKVEESDHSVSEGSNVAEQEEEEVEEKEEVEVERGSRRKETKK  248

Query  636  QRGLK--------GGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  481
            QR  K        GGG GF     LS  L KF  TG +AL+R +VVK++W YI+EN LQD
Sbjct  249  QRSTKVDKEVKKRGGGGGFTKLCSLSPELQKF--TGVSALARTEVVKKLWIYIRENNLQD  306

Query  480  PSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  373
            P NKR +ICD+ LR L +VD    F M K L  H +
Sbjct  307  PKNKRDIICDESLRALFDVDCINMFQMNKALCKHIL  342


 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -2

Query  939  LARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIE  760
            LARTEVVK++W YIRENNLQDPK K+ IICDE+L  +F V  I+MF+MN+ L KHI P+ 
Sbjct  286  LARTEVVKKLWIYIRENNLQDPKNKRDIICDESLRALFDVDCINMFQMNKALCKHILPLN  345

Query  759  KE  754
            +E
Sbjct  346  EE  347


 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = -2

Query  609  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  430
            GF     LS  L +F G  E  ++R +VV+R+W YI+E +LQDP N+R + CD+ L  L 
Sbjct  117  GFNKICSLSPQLQEFVGEPE--MARTEVVRRIWAYIREKDLQDPKNRRNIRCDESLHSLF  174

Query  429  EVDSFEGFTMTKLLTAHFIKTAG  361
             V+S   F M K+L+ H    +G
Sbjct  175  RVNSINMFQMNKVLSKHIWPLSG  197



>ref|XP_009375738.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X2 [Pyrus x bretschneideri]
Length=368

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 128/216 (59%), Gaps = 21/216 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V EPE+ARTEVV+RIWAYIRE +LQDPK ++ I CDE+L  +FRV +I+MF+MN+ L
Sbjct  129  QEFVGEPEMARTEVVRRIWAYIREKDLQDPKNRRNIRCDESLHSLFRVNSINMFQMNKVL  188

Query  783  SKHIWPIEKED---VTLVKSTPKERQRKKGRDEVYTDSDSDSDFEP--------KQEEKR  637
            SKHIWP+  ED       K    +    +G +    + +   + E         ++E K+
Sbjct  189  SKHIWPLSGEDEPVKKKKKVEESDHSVSEGSNVAEQEEEEVEEKEEVEVERGSRRKETKK  248

Query  636  QRGLK--------GGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  481
            QR  K        GGG GF     LS  L KF  TG +AL+R +VVK++W YI+EN LQD
Sbjct  249  QRSTKVDKEVKKRGGGGGFTKLCSLSPELQKF--TGVSALARTEVVKKLWIYIRENNLQD  306

Query  480  PSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  373
            P NKR +ICD+ LR L +VD    F M K L  H +
Sbjct  307  PKNKRDIICDESLRALFDVDCINMFQMNKALCKHIL  342


 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -2

Query  939  LARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIE  760
            LARTEVVK++W YIRENNLQDPK K+ IICDE+L  +F V  I+MF+MN+ L KHI P+ 
Sbjct  286  LARTEVVKKLWIYIRENNLQDPKNKRDIICDESLRALFDVDCINMFQMNKALCKHILPLN  345

Query  759  KE  754
            +E
Sbjct  346  EE  347


 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = -2

Query  609  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  430
            GF     LS  L +F G  E  ++R +VV+R+W YI+E +LQDP N+R + CD+ L  L 
Sbjct  117  GFNKICSLSPQLQEFVGEPE--MARTEVVRRIWAYIREKDLQDPKNRRNIRCDESLHSLF  174

Query  429  EVDSFEGFTMTKLLTAHFIKTAG  361
             V+S   F M K+L+ H    +G
Sbjct  175  RVNSINMFQMNKVLSKHIWPLSG  197



>ref|XP_006384456.1| SWIB complex BAF60b domain-containing family protein [Populus 
trichocarpa]
 gb|ERP62253.1| SWIB complex BAF60b domain-containing family protein [Populus 
trichocarpa]
Length=384

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 93/217 (43%), Positives = 129/217 (59%), Gaps = 24/217 (11%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V  PELARTEVVK++WAYIRENNLQDPK +K+I CDE L  +FRV +IDMF+M++ L
Sbjct  129  QAVVGVPELARTEVVKKLWAYIRENNLQDPKNRKKIKCDEALRAVFRVNSIDMFQMSKAL  188

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDS------------------DSDFE  658
            SKHIWP+  ED T   +  K++++ +  ++   + D+                  +S+  
Sbjct  189  SKHIWPLTGEDGTFFNNV-KQKEKCEDSNDFGNEGDNGGEEEEEQEEEEEEEVKKESNGR  247

Query  657  PKQEEKRQR---GLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENEL  487
             K+  K  +    +K  G GF     LS  L +  G  E  L+R  VVK++W YI+E  L
Sbjct  248  SKKGRKSAKVDENVKKRGGGFTKLCSLSPQLQELVGVPE--LARTGVVKKLWAYIREKNL  305

Query  486  QDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            QDP NKR +ICD+ LR L +VDS + F M K L+ H 
Sbjct  306  QDPKNKRNIICDESLRALFDVDSIDMFQMNKALSKHI  342


 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 81/111 (73%), Gaps = 9/111 (8%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q LV  PELART VVK++WAYIRE NLQDPK K+ IICDE+L  +F V +IDMF+MN+ L
Sbjct  279  QELVGVPELARTGVVKKLWAYIREKNLQDPKNKRNIICDESLRALFDVDSIDMFQMNKAL  338

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQR  631
            SKHIW + +ED     S+PKE+  K+GR+E   D D     EPKQ+EKRQ+
Sbjct  339  SKHIWAVCEEDAP-SNSSPKEKGAKQGREE---DPD-----EPKQKEKRQK  380


 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 53/93 (57%), Gaps = 8/93 (9%)
 Frame = -2

Query  639  RQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRV  460
            R+RG      GF     LS  L    G  E  L+R +VVK++W YI+EN LQDP N++++
Sbjct  113  RKRG------GFTKLSSLSPQLQAVVGVPE--LARTEVVKKLWAYIRENNLQDPKNRKKI  164

Query  459  ICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG  361
             CD+ LR +  V+S + F M+K L+ H     G
Sbjct  165  KCDEALRAVFRVNSIDMFQMSKALSKHIWPLTG  197



>ref|XP_010229398.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Brachypodium distachyon]
Length=299

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 109/161 (68%), Gaps = 16/161 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V   ELARTEVVK++WAYIRENNLQDP  K++I+CDETL  +F+V +IDMF+MN+ L
Sbjct  149  QEFVGASELARTEVVKKLWAYIRENNLQDPSNKRKILCDETLKKLFKVNSIDMFQMNKAL  208

Query  783  SKHIWPIEKED-VTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTG  607
            +KHIWP+  E   +  KSTPKE+ +K+ ++E                +K++ G    GTG
Sbjct  209  TKHIWPLNSEGPASPKKSTPKEKPQKREKNE---------------GKKQKVGSSRPGTG  253

Query  606  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  484
              AP+QLSD L  F GTGE+ LSR DVVK MW YIKEN LQ
Sbjct  254  LNAPLQLSDDLANFIGTGESMLSRSDVVKIMWDYIKENNLQ  294


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 61/97 (63%), Gaps = 9/97 (9%)
 Frame = -2

Query  645  EKRQRGLKGG-------GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENEL  487
             KR+R L  G       G GF     +S +L +F G  E  L+R +VVK++W YI+EN L
Sbjct  118  HKRKRRLDKGNSDGKRKGGGFTKLCSISPTLQEFVGASE--LARTEVVKKLWAYIRENNL  175

Query  486  QDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            QDPSNKR+++CD+ L++L +V+S + F M K LT H 
Sbjct  176  QDPSNKRKILCDETLKKLFKVNSIDMFQMNKALTKHI  212



>ref|XP_011001193.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Populus euphratica]
Length=361

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 94/216 (44%), Positives = 123/216 (57%), Gaps = 23/216 (11%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V  PELARTEVVK++WAYIR+NNLQDPK +K+I CDE L  +F V +IDMF+MN+ L
Sbjct  129  QAVVGVPELARTEVVKKLWAYIRDNNLQDPKNRKKIKCDEALRAVFHVNSIDMFQMNKAL  188

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRD--------------------EVYTDSDSDSD  664
            SKHIWP+  ED ++ +    E     G +                    EV  +S+  S 
Sbjct  189  SKHIWPLTGEDESVKQKEKCEDSNDFGNEGDNGGEEEEEQEEEEEAEEEEVKKESNGRSK  248

Query  663  FEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  484
             + ++  K    +K  G GF     LS  L  F G  E  L+R  VVK++W YI+E  LQ
Sbjct  249  -KGRKSTKVDENVKKRGGGFTKLCSLSPQLQDFVGVPE--LARTGVVKKLWAYIREKNLQ  305

Query  483  DPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            DP NKR +ICD+ LR L  VDS + F M K L+ H 
Sbjct  306  DPKNKRNIICDESLRALFNVDSIDMFQMNKALSKHI  341


 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V  PELART VVK++WAYIRE NLQDPK K+ IICDE+L  +F V +IDMF+MN+ L
Sbjct  278  QDFVGVPELARTGVVKKLWAYIREKNLQDPKNKRNIICDESLRALFNVDSIDMFQMNKAL  337

Query  783  SKHIWPIEKEDVT  745
            SKHIW + +EDV 
Sbjct  338  SKHIWAVCEEDVV  350


 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 55/98 (56%), Gaps = 8/98 (8%)
 Frame = -2

Query  654  KQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  475
            K E+ R+RG      GF     LS  L    G  E  L+R +VVK++W YI++N LQDP 
Sbjct  108  KTEKVRKRG------GFAKLSSLSPQLQAVVGVPE--LARTEVVKKLWAYIRDNNLQDPK  159

Query  474  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG  361
            N++++ CD+ LR +  V+S + F M K L+ H     G
Sbjct  160  NRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTG  197



>ref|XP_006393249.1| hypothetical protein EUTSA_v10011568mg [Eutrema salsugineum]
 gb|ESQ30535.1| hypothetical protein EUTSA_v10011568mg [Eutrema salsugineum]
Length=384

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 128/210 (61%), Gaps = 29/210 (14%)
 Frame = -2

Query  942  ELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI  763
            +LARTEVVK++WAYIRE+ LQDPK ++ IICDE+L  +FRVKTI+MF+MN+ L+KHIWP+
Sbjct  122  QLARTEVVKKMWAYIREHELQDPKNRRNIICDESLYSLFRVKTINMFQMNKALAKHIWPL  181

Query  762  EKEDVTLVKSTPKERQRKKG---RDEVYTDSDSDSDFE------------------PKQE  646
              +    V ++ KE    +    RDE   D+  +++ E                   K E
Sbjct  182  NGDGC--VNNSVKEENEDESSGERDEQNEDAGKNNEEEESDEEVDRSSRKRKKRKPAKSE  239

Query  645  EKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKR  466
            EK ++  KGG  GF     LS  L  F GT +  L+R +VVK +W YIKEN LQDPS+KR
Sbjct  240  EKPKK--KGG--GFTKICSLSPELQAFTGTPQ--LARTEVVKMLWSYIKENNLQDPSDKR  293

Query  465  RVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
             +ICD+ LR L  VDS   F M KLLT H 
Sbjct  294  TIICDESLRSLFPVDSINMFQMNKLLTKHI  323


 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 74/116 (64%), Gaps = 14/116 (12%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q     P+LARTEVVK +W+YI+ENNLQDP  K+ IICDE+L  +F V +I+MF+MN+ L
Sbjct  260  QAFTGTPQLARTEVVKMLWSYIKENNLQDPSDKRTIICDESLRSLFPVDSINMFQMNKLL  319

Query  783  SKHIWPIEKEDVTLVKSTPKERQRK------------KGRD--EVYTDSDSDSDFE  658
            +KHIWP+ +E+       PK+ ++K            KG+   E+Y D+D  ++ E
Sbjct  320  TKHIWPLVQEEEVGTAHEPKKGKQKMEIDEGTANDPEKGKQKMEIYEDNDEAANEE  375


 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 54/91 (59%), Gaps = 8/91 (9%)
 Frame = -2

Query  648  EEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNK  469
            E K++RG      GF    QLS  L KF GT +  L+R +VVK+MW YI+E+ELQDP N+
Sbjct  96   EAKKRRG------GFNKICQLSPQLDKFLGTSQ--LARTEVVKKMWAYIREHELQDPKNR  147

Query  468  RRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            R +ICD+ L  L  V +   F M K L  H 
Sbjct  148  RNIICDESLYSLFRVKTINMFQMNKALAKHI  178



>ref|XP_011001192.1| PREDICTED: protein TRI1-like isoform X2 [Populus euphratica]
Length=383

 Score =   168 bits (425),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 92/220 (42%), Positives = 127/220 (58%), Gaps = 31/220 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V  PELARTEVVK++WAYIR+NNLQDPK +K+I CDE L  +F V +IDMF+MN+ L
Sbjct  129  QAVVGVPELARTEVVKKLWAYIRDNNLQDPKNRKKIKCDEALRAVFHVNSIDMFQMNKAL  188

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDS---------------------DS  667
            SKHIWP+  ED ++     K++++ +  ++   + D+                     +S
Sbjct  189  SKHIWPLTGEDESV-----KQKEKCEDSNDFGNEGDNGGEEEEEQEEEEEAEEEEVKKES  243

Query  666  DFEPKQEEKRQR---GLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKE  496
            +   K+  K  +    +K  G GF     LS  L  F G  E  L+R  VVK++W YI+E
Sbjct  244  NGRSKKGRKSTKVDENVKKRGGGFTKLCSLSPQLQDFVGVPE--LARTGVVKKLWAYIRE  301

Query  495  NELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
              LQDP NKR +ICD+ LR L  VDS + F M K L+ H 
Sbjct  302  KNLQDPKNKRNIICDESLRALFNVDSIDMFQMNKALSKHI  341


 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 80/111 (72%), Gaps = 9/111 (8%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V  PELART VVK++WAYIRE NLQDPK K+ IICDE+L  +F V +IDMF+MN+ L
Sbjct  278  QDFVGVPELARTGVVKKLWAYIREKNLQDPKNKRNIICDESLRALFNVDSIDMFQMNKAL  337

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQR  631
            SKHIW + +ED     S+PKE+  K+GR+E   D D     EPKQ+EKRQ+
Sbjct  338  SKHIWAVCEEDAP-SNSSPKEKGAKQGREE---DPD-----EPKQKEKRQK  379


 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 55/98 (56%), Gaps = 8/98 (8%)
 Frame = -2

Query  654  KQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  475
            K E+ R+RG      GF     LS  L    G  E  L+R +VVK++W YI++N LQDP 
Sbjct  108  KTEKVRKRG------GFAKLSSLSPQLQAVVGVPE--LARTEVVKKLWAYIRDNNLQDPK  159

Query  474  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG  361
            N++++ CD+ LR +  V+S + F M K L+ H     G
Sbjct  160  NRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTG  197



>ref|XP_011001190.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Populus euphratica]
Length=411

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/220 (42%), Positives = 127/220 (58%), Gaps = 31/220 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V  PELARTEVVK++WAYIR+NNLQDPK +K+I CDE L  +F V +IDMF+MN+ L
Sbjct  129  QAVVGVPELARTEVVKKLWAYIRDNNLQDPKNRKKIKCDEALRAVFHVNSIDMFQMNKAL  188

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDS---------------------DS  667
            SKHIWP+  ED ++     K++++ +  ++   + D+                     +S
Sbjct  189  SKHIWPLTGEDESV-----KQKEKCEDSNDFGNEGDNGGEEEEEQEEEEEAEEEEVKKES  243

Query  666  DFEPKQEEKRQR---GLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKE  496
            +   K+  K  +    +K  G GF     LS  L  F G  E  L+R  VVK++W YI+E
Sbjct  244  NGRSKKGRKSTKVDENVKKRGGGFTKLCSLSPQLQDFVGVPE--LARTGVVKKLWAYIRE  301

Query  495  NELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
              LQDP NKR +ICD+ LR L  VDS + F M K L+ H 
Sbjct  302  KNLQDPKNKRNIICDESLRALFNVDSIDMFQMNKALSKHI  341


 Score =   164 bits (414),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 104/146 (71%), Gaps = 12/146 (8%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V  PELART VVK++WAYIRE NLQDPK K+ IICDE+L  +F V +IDMF+MN+ L
Sbjct  278  QDFVGVPELARTGVVKKLWAYIREKNLQDPKNKRNIICDESLRALFNVDSIDMFQMNKAL  337

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHIW + +ED     S+PKE+  K+GR+E   D D     EPKQ+EKRQ   K G  G 
Sbjct  338  SKHIWAVCEEDAP-SNSSPKEKGAKQGREE---DPD-----EPKQKEKRQ---KKGAYGL  385

Query  603  LAPIQLSDSLVKFFGTGENALSRGDV  526
            LAP+Q+ D+ VKFFGTGENA SR DV
Sbjct  386  LAPLQILDAFVKFFGTGENAFSRSDV  411


 Score = 70.1 bits (170),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 55/98 (56%), Gaps = 8/98 (8%)
 Frame = -2

Query  654  KQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  475
            K E+ R+RG      GF     LS  L    G  E  L+R +VVK++W YI++N LQDP 
Sbjct  108  KTEKVRKRG------GFAKLSSLSPQLQAVVGVPE--LARTEVVKKLWAYIRDNNLQDPK  159

Query  474  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG  361
            N++++ CD+ LR +  V+S + F M K L+ H     G
Sbjct  160  NRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTG  197



>ref|XP_009803137.1| PREDICTED: protein TRI1-like isoform X2 [Nicotiana sylvestris]
Length=319

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 112/166 (67%), Gaps = 13/166 (8%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q    E ELARTEVVKR+W YIREN+LQ+P  ++ I CD+TL  +F V  IDMF+MN+ L
Sbjct  141  QKFTGEAELARTEVVKRMWNYIRENDLQEPSNRRNINCDDTLRELFGVDKIDMFQMNKAL  200

Query  783  SKHIWPIEKEDVTL------VKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLK  622
            +KHIWP++ + V+       V ST +E+     +     + D DSD EPK++EKR     
Sbjct  201  AKHIWPLDSDGVSTITTSGSVNSTAREKNSTAKKKRQKQEEDEDSD-EPKRKEKRH----  255

Query  621  GGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  484
               +G LAP+QLSD+L+KF GTGE+ L RG+VVKR+W YIK+N LQ
Sbjct  256  --NSGILAPLQLSDALIKFLGTGESELPRGNVVKRIWDYIKQNNLQ  299


 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = -2

Query  609  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  430
            GF     LS  L KF  TGE  L+R +VVKRMW YI+EN+LQ+PSN+R + CDD LREL 
Sbjct  129  GFTKICSLSPQLQKF--TGEAELARTEVVKRMWNYIRENDLQEPSNRRNINCDDTLRELF  186

Query  429  EVDSFEGFTMTKLLTAHF  376
             VD  + F M K L  H 
Sbjct  187  GVDKIDMFQMNKALAKHI  204



>gb|KFK36005.1| hypothetical protein AALP_AA4G065400 [Arabis alpina]
Length=371

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/216 (44%), Positives = 120/216 (56%), Gaps = 39/216 (18%)
 Frame = -2

Query  942  ELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI  763
            +LARTEVVK++W YIRE+NLQDPK K+ I+CDE L  +FRVK IDMF+MN+ LSKHIWP+
Sbjct  113  QLARTEVVKKMWVYIREHNLQDPKNKRNIVCDELLHSLFRVKKIDMFQMNKALSKHIWPL  172

Query  762  EKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFE-------------------------  658
               DV +         +++  DE   + D   +                           
Sbjct  173  NDGDVCV------NNVKEEDEDETSVEKDVKEEQHEETEENNEEESKEEKEPRVRKRKKR  226

Query  657  --PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  484
               K EEK ++  KGG  GF     LS  L  F G  E  L+R +VVK +WKYIKEN LQ
Sbjct  227  KLAKSEEKPKK--KGG--GFTKVCSLSPELQAFTGIPE--LARTEVVKMLWKYIKENNLQ  280

Query  483  DPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            DPS+KR +ICD+ LR L  V+S   F M K LT H 
Sbjct  281  DPSDKRTIICDETLRSLFPVESINMFQMNKFLTKHI  316


 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 76/116 (66%), Gaps = 14/116 (12%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q     PELARTEVVK +W YI+ENNLQDP  K+ IICDETL  +F V++I+MF+MN+ L
Sbjct  253  QAFTGIPELARTEVVKMLWKYIKENNLQDPSDKRTIICDETLRSLFPVESINMFQMNKFL  312

Query  783  SKHIWPI--EKEDVTLV--KSTPKE-----RQRKKGRDEVYTDSDSDSDFEPKQEE  643
            +KHIWP+  ++E +  V   + PKE        +KG+ ++  D+D     EP ++E
Sbjct  313  TKHIWPLVPKEEGIARVGCSTIPKEEAGTSNDPEKGKQKIDEDND-----EPNEKE  363


 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 51/89 (57%), Gaps = 8/89 (9%)
 Frame = -2

Query  642  KRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRR  463
            K++RG      GF    QLS  L    GT +  L+R +VVK+MW YI+E+ LQDP NKR 
Sbjct  89   KKRRG------GFNKVSQLSPQLENVLGTSQ--LARTEVVKKMWVYIREHNLQDPKNKRN  140

Query  462  VICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            ++CD+ L  L  V   + F M K L+ H 
Sbjct  141  IVCDELLHSLFRVKKIDMFQMNKALSKHI  169



>gb|KFK36004.1| hypothetical protein AALP_AA4G065400 [Arabis alpina]
Length=370

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/216 (44%), Positives = 120/216 (56%), Gaps = 39/216 (18%)
 Frame = -2

Query  942  ELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI  763
            +LARTEVVK++W YIRE+NLQDPK K+ I+CDE L  +FRVK IDMF+MN+ LSKHIWP+
Sbjct  113  QLARTEVVKKMWVYIREHNLQDPKNKRNIVCDELLHSLFRVKKIDMFQMNKALSKHIWPL  172

Query  762  EKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFE-------------------------  658
               DV +         +++  DE   + D   +                           
Sbjct  173  NDGDVCV------NNVKEEDEDETSVEKDVKEEQHEETEENNEEESKEEKEPRVRKRKKR  226

Query  657  --PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  484
               K EEK ++  KGG  GF     LS  L  F G  E  L+R +VVK +WKYIKEN LQ
Sbjct  227  KLAKSEEKPKK--KGG--GFTKVCSLSPELQAFTGIPE--LARTEVVKMLWKYIKENNLQ  280

Query  483  DPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            DPS+KR +ICD+ LR L  V+S   F M K LT H 
Sbjct  281  DPSDKRTIICDETLRSLFPVESINMFQMNKFLTKHI  316


 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 76/115 (66%), Gaps = 13/115 (11%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q     PELARTEVVK +W YI+ENNLQDP  K+ IICDETL  +F V++I+MF+MN+ L
Sbjct  253  QAFTGIPELARTEVVKMLWKYIKENNLQDPSDKRTIICDETLRSLFPVESINMFQMNKFL  312

Query  783  SKHIWPI--EKEDVTLV--KSTPKE----RQRKKGRDEVYTDSDSDSDFEPKQEE  643
            +KHIWP+  ++E +  V   + PKE       +KG+ ++  D+D     EP ++E
Sbjct  313  TKHIWPLVPKEEGIARVGCSTIPKEEGTSNDPEKGKQKIDEDND-----EPNEKE  362


 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 51/89 (57%), Gaps = 8/89 (9%)
 Frame = -2

Query  642  KRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRR  463
            K++RG      GF    QLS  L    GT +  L+R +VVK+MW YI+E+ LQDP NKR 
Sbjct  89   KKRRG------GFNKVSQLSPQLENVLGTSQ--LARTEVVKKMWVYIREHNLQDPKNKRN  140

Query  462  VICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            ++CD+ L  L  V   + F M K L+ H 
Sbjct  141  IVCDELLHSLFRVKKIDMFQMNKALSKHI  169



>ref|XP_002891515.1| SWIB complex BAF60b domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH67774.1| SWIB complex BAF60b domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=372

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 127/212 (60%), Gaps = 29/212 (14%)
 Frame = -2

Query  942  ELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI  763
            +LARTEVVK++WAYIR+++LQDPK ++ I+CD++L  +FRVKTIDMF+MN+ L+KHIWP+
Sbjct  120  QLARTEVVKKMWAYIRQHDLQDPKNRRNILCDDSLHSLFRVKTIDMFQMNKALAKHIWPL  179

Query  762  ------------EKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSD-----------FEPK  652
                        E ED T  +   KE + ++  +     S  + D              K
Sbjct  180  NDGDGCVKNVKGEDEDETSGERYEKEVKIEEAVENNEEVSGEEEDRSVRKRKRKKRKPAK  239

Query  651  QEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSN  472
             EEK ++  KGG  GF     LS  L  F GT +  L+R +VV+ +WKYIKEN LQDPS+
Sbjct  240  SEEKPKK--KGG--GFTKVCSLSPELQAFTGTAQ--LARTEVVRMLWKYIKENNLQDPSD  293

Query  471  KRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            KR +ICD+ LR L  V+S   F M K LT H 
Sbjct  294  KRTIICDESLRSLFPVESINMFQMNKQLTKHI  325


 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 69/100 (69%), Gaps = 1/100 (1%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      +LARTEVV+ +W YI+ENNLQDP  K+ IICDE+L  +F V++I+MF+MN+ L
Sbjct  262  QAFTGTAQLARTEVVRMLWKYIKENNLQDPSDKRTIICDESLRSLFPVESINMFQMNKQL  321

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSD  664
            +KHIWP+ +ED     +   E+ ++K + E+  D+D  +D
Sbjct  322  TKHIWPLVQEDEAGT-TNDSEKGKQKMKMEIDADNDEAND  360


 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 62/108 (57%), Gaps = 9/108 (8%)
 Frame = -2

Query  699  DEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVK  520
            DE  +++D D    P + +KR       G GF    QLS  L KF GT +  L+R +VVK
Sbjct  78   DEEGSENDDDKTEPPVKAKKR-------GGGFNKICQLSPQLEKFLGTSQ--LARTEVVK  128

Query  519  RMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            +MW YI++++LQDP N+R ++CDD L  L  V + + F M K L  H 
Sbjct  129  KMWAYIRQHDLQDPKNRRNILCDDSLHSLFRVKTIDMFQMNKALAKHI  176



>ref|XP_010461791.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Camelina sativa]
Length=380

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 119/212 (56%), Gaps = 29/212 (14%)
 Frame = -2

Query  942  ELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI  763
            +LARTEVVK+IWAYIR+++LQDPK ++ I+CDE L  +FRVK IDMF+MN+ L+KHIWP+
Sbjct  129  QLARTEVVKKIWAYIRDHDLQDPKNRRNILCDEALHSLFRVKAIDMFQMNKALAKHIWPL  188

Query  762  EKEDVTLVKSTPKERQRKKG-RDE----------------------VYTDSDSDSDFEPK  652
               D ++     ++     G +DE                                   K
Sbjct  189  NDGDGSVKDVKEEDEGEASGEKDEKEEQNEEAVENNEEESGEEEGPSLRKRKRKKRKPAK  248

Query  651  QEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSN  472
             EEK ++  KGG  GF     LS  L  F GT +  L+R +VVK +WKYIKEN LQDPS+
Sbjct  249  SEEKPKK--KGG--GFTKVCSLSPELQAFTGTSQ--LARTEVVKMLWKYIKENNLQDPSD  302

Query  471  KRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            KR +ICD+ LR L  VDS   F M K L  H 
Sbjct  303  KRTIICDESLRSLFPVDSINMFQMNKQLAKHI  334


 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      +LARTEVVK +W YI+ENNLQDP  K+ IICDE+L  +F V +I+MF+MN+ L
Sbjct  271  QAFTGTSQLARTEVVKMLWKYIKENNLQDPSDKRTIICDESLRSLFPVDSINMFQMNKQL  330

Query  783  SKHIWPIEKEDVTLVKSTPKERQR  712
            +KHIWP+ +ED        K +Q+
Sbjct  331  AKHIWPLVQEDEGTTNDPEKGKQK  354


 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 65/110 (59%), Gaps = 10/110 (9%)
 Frame = -2

Query  699  DEVYTDSDSDSDFEPKQ--EEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDV  526
            D+ Y +    ++ +P++  E K++RG      GF    QLS  L KF GT +  L+R +V
Sbjct  84   DQNYEEGSESNNEKPERPVEAKKRRG------GFNKICQLSPQLDKFLGTCQ--LARTEV  135

Query  525  VKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            VK++W YI++++LQDP N+R ++CD+ L  L  V + + F M K L  H 
Sbjct  136  VKKIWAYIRDHDLQDPKNRRNILCDEALHSLFRVKAIDMFQMNKALAKHI  185



>ref|XP_010461790.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X1 [Camelina sativa]
Length=381

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 119/212 (56%), Gaps = 29/212 (14%)
 Frame = -2

Query  942  ELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI  763
            +LARTEVVK+IWAYIR+++LQDPK ++ I+CDE L  +FRVK IDMF+MN+ L+KHIWP+
Sbjct  129  QLARTEVVKKIWAYIRDHDLQDPKNRRNILCDEALHSLFRVKAIDMFQMNKALAKHIWPL  188

Query  762  EKEDVTLVKSTPKERQRKKG-RDE----------------------VYTDSDSDSDFEPK  652
               D ++     ++     G +DE                                   K
Sbjct  189  NDGDGSVKDVKEEDEGEASGEKDEKEEQNEEAVENNEEESGEEEGPSLRKRKRKKRKPAK  248

Query  651  QEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSN  472
             EEK ++  KGG  GF     LS  L  F GT +  L+R +VVK +WKYIKEN LQDPS+
Sbjct  249  SEEKPKK--KGG--GFTKVCSLSPELQAFTGTSQ--LARTEVVKMLWKYIKENNLQDPSD  302

Query  471  KRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            KR +ICD+ LR L  VDS   F M K L  H 
Sbjct  303  KRTIICDESLRSLFPVDSINMFQMNKQLAKHI  334


 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      +LARTEVVK +W YI+ENNLQDP  K+ IICDE+L  +F V +I+MF+MN+ L
Sbjct  271  QAFTGTSQLARTEVVKMLWKYIKENNLQDPSDKRTIICDESLRSLFPVDSINMFQMNKQL  330

Query  783  SKHIWPIEKEDVTLVKSTPKERQRK  709
            +KHIWP+ +ED     + P++ ++K
Sbjct  331  AKHIWPLVQEDEAGTTNDPEKGKQK  355


 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 65/110 (59%), Gaps = 10/110 (9%)
 Frame = -2

Query  699  DEVYTDSDSDSDFEPKQ--EEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDV  526
            D+ Y +    ++ +P++  E K++RG      GF    QLS  L KF GT +  L+R +V
Sbjct  84   DQNYEEGSESNNEKPERPVEAKKRRG------GFNKICQLSPQLDKFLGTCQ--LARTEV  135

Query  525  VKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            VK++W YI++++LQDP N+R ++CD+ L  L  V + + F M K L  H 
Sbjct  136  VKKIWAYIRDHDLQDPKNRRNILCDEALHSLFRVKAIDMFQMNKALAKHI  185



>emb|CDO97141.1| unnamed protein product [Coffea canephora]
Length=553

 Score =   161 bits (407),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 88/227 (39%), Positives = 128/227 (56%), Gaps = 33/227 (15%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V  PE+ARTEVVKR+WAYIRENNLQ+PK K++IICDE L GIF+VK+I+MF+MN+ L
Sbjct  148  QEIVGVPEMARTEVVKRMWAYIRENNLQNPKDKRKIICDENLRGIFQVKSINMFQMNKAL  207

Query  783  SKHIWPIEKEDVTLVKSTPK-------------------------ERQRKKGRDEVYTDS  679
            SKH+WP++ ED     +T +                         +++  +G      D 
Sbjct  208  SKHMWPVDSEDEPQKHNTQQHQQDQEEAEEEDSNGEEMKQEFENLKQELNEGSVHQEVDV  267

Query  678  DSDSDFEPKQEEKRQRGLKGGG------TGFLAPIQLSDSLVKFFGTGENALSRGDVVKR  517
            + + +    + +KR R  K         +GF  P  +S  L K  G   N ++R +VVK+
Sbjct  268  EHEEESHGVRNKKRSRSYKMDNNDKKKRSGFNKPWAISPQLQKIVGV--NQMARPEVVKK  325

Query  516  MWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            MW YI+E  LQ+P +KR++ICD  L  + +V +   F M K L+ H 
Sbjct  326  MWVYIREKNLQNPKDKRKIICDQTLHGIFQVKNINMFQMNKALSKHM  372


 Score =   153 bits (387),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 129/222 (58%), Gaps = 28/222 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V   ++AR EVVK++W YIRE NLQ+PK K++IICD+TL GIF+VK I+MF+MN+ L
Sbjct  309  QKIVGVNQMARPEVVKKMWVYIREKNLQNPKDKRKIICDQTLHGIFQVKNINMFQMNKAL  368

Query  783  SKHIWPIEKED-------VTLVKSTPKERQRKKGRDEVYTDSD----------------S  673
            SKH+WPI+ ED        +  + T ++ +  K  +  Y+ S+                S
Sbjct  369  SKHMWPIDAEDDHQEAEEDSNGEETEEQSEDVKQEENEYSGSNEVDIGGEGEGEGEEEES  428

Query  672  DSDFEPKQEEKRQRG---LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYI  502
            D     K+  + QR        G+GF  P  +S  L +  G  E  ++R +VVK++W YI
Sbjct  429  DGIRNKKKRYRSQRMDAIQNKKGSGFSKPCAISPQLQELVGVPE--MARTEVVKKVWAYI  486

Query  501  KENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            +E  LQ+P +KR++ICD+ LR +  V++   F M K+L+ H 
Sbjct  487  REKNLQNPKDKRKIICDEALRAIFRVNTINMFQMNKVLSKHI  528


 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q LV  PE+ARTEVVK++WAYIRE NLQ+PK K++IICDE L  IFRV TI+MF+MN+ L
Sbjct  465  QELVGVPEMARTEVVKKVWAYIREKNLQNPKDKRKIICDEALRAIFRVNTINMFQMNKVL  524

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGR  700
            SKHIWPI+ E  T +KS+ K+RQR+K R
Sbjct  525  SKHIWPIDIEYATPIKSSQKKRQREKDR  552



>ref|XP_010500494.1| PREDICTED: upstream activation factor subunit UAF30-like [Camelina 
sativa]
Length=379

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 91/212 (43%), Positives = 119/212 (56%), Gaps = 29/212 (14%)
 Frame = -2

Query  942  ELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI  763
            +LARTEVVK+IWAYIR+++LQDPK ++ I+CDE L  +FRVK IDMF+MN+ L+KHIWP+
Sbjct  127  QLARTEVVKKIWAYIRDHDLQDPKNRRNILCDEALHSLFRVKAIDMFQMNKALAKHIWPL  186

Query  762  EKEDVTLVKSTPKERQRKKG-RDE----------------------VYTDSDSDSDFEPK  652
               D ++     ++     G +DE                                   K
Sbjct  187  NDGDGSVKDVKEEDEGEASGEKDEKEEQNEEAVENNEEESGEEEGPSLRKRKRKKRKPAK  246

Query  651  QEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSN  472
             EEK ++  KGG  GF     LS  L  F GT +  L+R +VVK +WKYIKEN LQDPS+
Sbjct  247  SEEKPKK--KGG--GFTKVCSLSPELQAFTGTSQ--LARTEVVKMLWKYIKENNLQDPSD  300

Query  471  KRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            KR +ICD+ LR L  V+S   F M K L  H 
Sbjct  301  KRTIICDESLRSLFPVESINMFQMNKQLAKHI  332


 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      +LARTEVVK +W YI+ENNLQDP  K+ IICDE+L  +F V++I+MF+MN+ L
Sbjct  269  QAFTGTSQLARTEVVKMLWKYIKENNLQDPSDKRTIICDESLRSLFPVESINMFQMNKQL  328

Query  783  SKHIWPIEKEDVTLVKSTPKERQRK  709
            +KHIWP+ +ED     + P++ ++K
Sbjct  329  AKHIWPLVQEDEAATTNDPEKGKQK  353


 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 60/103 (58%), Gaps = 9/103 (9%)
 Frame = -2

Query  681  SDS-DSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKY  505
            SDS D   E   E K++RG      GF    QLS  L KF GT +  L+R +VVK++W Y
Sbjct  89   SDSNDEKTERPVEAKKRRG------GFNKICQLSPQLDKFLGTSQ--LARTEVVKKIWAY  140

Query  504  IKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            I++++LQDP N+R ++CD+ L  L  V + + F M K L  H 
Sbjct  141  IRDHDLQDPKNRRNILCDEALHSLFRVKAIDMFQMNKALAKHI  183



>gb|ABK26533.1| unknown [Picea sitchensis]
Length=299

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 110/198 (56%), Gaps = 31/198 (16%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP L RT++VK++W YIR NNLQDP  K+ IIC++ L  +F   + DMF+MN+ L
Sbjct  132  QAIVGEPALPRTQIVKQLWTYIRANNLQDPSNKRNIICNDALRMVFDTDSTDMFQMNKLL  191

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHIW ++  D                              EP  +    R   G  +  
Sbjct  192  AKHIWALDSRD---------------------------DGSEPNAKRTANRNTSGPAS--  222

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
              P+ +SDSL  F GT +   S  +VVKR+  YIKENELQDP +K ++ICD KL++L   
Sbjct  223  --PVPISDSLALFLGTDKIETSHEEVVKRLSDYIKENELQDPLDKGKIICDAKLQKLFSC  280

Query  423  DSFEGFTMTKLLTAHFIK  370
            ++F  F MTKLL  HF+K
Sbjct  281  ENFVDFEMTKLLAPHFLK  298



>ref|XP_003574734.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15 [Brachypodium distachyon]
Length=416

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 119/200 (60%), Gaps = 24/200 (12%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            QV+V EP +ARTE+VK++WAYIR NNLQDP  K++IIC++ L  +F     DMF+MN+ L
Sbjct  238  QVIVGEPTMARTEIVKQLWAYIRRNNLQDPNNKRKIICNDELRLVFETDCTDMFKMNKLL  297

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E       K + ++ ++ K  D   ++  S ++ +P Q               
Sbjct  298  AKHIRPLEP-----AKDSNRDSKKLKPVD---SEPISPAESDPNQ---------------  334

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
              P+ +SD+L  FFGTGE  +   + VKR+W +IK N L+DPSN   ++CD KL++L   
Sbjct  335  -LPVIVSDALASFFGTGEREMPHSEAVKRVWDHIKSNNLEDPSNPTLILCDSKLKDLFGC  393

Query  423  DSFEGFTMTKLLTAHFIKTA  364
            +S     +++LL+ H  K A
Sbjct  394  ESLTALGVSELLSDHLFKQA  413



>ref|XP_010479385.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X1 [Camelina sativa]
Length=381

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 129/212 (61%), Gaps = 29/212 (14%)
 Frame = -2

Query  942  ELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI  763
            +LARTEVVK+IWAYIR+++LQDPK ++ I+CDE L  +FRVK IDMF+MN+ L+KHIWP+
Sbjct  129  QLARTEVVKKIWAYIRDHDLQDPKNRRNILCDEALHSLFRVKAIDMFQMNKALAKHIWPL  188

Query  762  EKEDVTL--VK-----STPKERQRKKGRDEVYTDSDSDSDFE----------------PK  652
               D ++  VK      T  E+  K+ ++E   +++ ++  E                 K
Sbjct  189  NDGDGSVKDVKEEDEGETSGEKDEKEEQNEEAVENNEEASGEEEGPSLRKRKRKKRKPAK  248

Query  651  QEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSN  472
             E+K ++  KGG  GF     LS  L  F GT +  L+R +VVK +WKYIKEN LQDPS+
Sbjct  249  SEDKPKK--KGG--GFTKVCSLSPELQAFTGTSQ--LARTEVVKMLWKYIKENNLQDPSD  302

Query  471  KRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            KR +IC++ LR L  V+S   F M K L  H 
Sbjct  303  KRTIICNESLRSLFPVESINMFQMNKQLAKHI  334


 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      +LARTEVVK +W YI+ENNLQDP  K+ IIC+E+L  +F V++I+MF+MN+ L
Sbjct  271  QAFTGTSQLARTEVVKMLWKYIKENNLQDPSDKRTIICNESLRSLFPVESINMFQMNKQL  330

Query  783  SKHIWPIEKEDVTLVKSTPKERQRK  709
            +KHIWP+ +ED     + P++ ++K
Sbjct  331  AKHIWPLVQEDEAGTTNDPEKGKQK  355


 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 55/91 (60%), Gaps = 8/91 (9%)
 Frame = -2

Query  648  EEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNK  469
            E K++RG      GF    QLS  L KF GT +  L+R +VVK++W YI++++LQDP N+
Sbjct  103  EAKKRRG------GFNKICQLSPQLDKFLGTSQ--LARTEVVKKIWAYIRDHDLQDPKNR  154

Query  468  RRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            R ++CD+ L  L  V + + F M K L  H 
Sbjct  155  RNILCDEALHSLFRVKAIDMFQMNKALAKHI  185



>ref|XP_010479386.1| PREDICTED: protein TRI1-like isoform X2 [Camelina sativa]
Length=380

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 129/212 (61%), Gaps = 29/212 (14%)
 Frame = -2

Query  942  ELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI  763
            +LARTEVVK+IWAYIR+++LQDPK ++ I+CDE L  +FRVK IDMF+MN+ L+KHIWP+
Sbjct  129  QLARTEVVKKIWAYIRDHDLQDPKNRRNILCDEALHSLFRVKAIDMFQMNKALAKHIWPL  188

Query  762  EKEDVTL--VK-----STPKERQRKKGRDEVYTDSDSDSDFE----------------PK  652
               D ++  VK      T  E+  K+ ++E   +++ ++  E                 K
Sbjct  189  NDGDGSVKDVKEEDEGETSGEKDEKEEQNEEAVENNEEASGEEEGPSLRKRKRKKRKPAK  248

Query  651  QEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSN  472
             E+K ++  KGG  GF     LS  L  F GT +  L+R +VVK +WKYIKEN LQDPS+
Sbjct  249  SEDKPKK--KGG--GFTKVCSLSPELQAFTGTSQ--LARTEVVKMLWKYIKENNLQDPSD  302

Query  471  KRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            KR +IC++ LR L  V+S   F M K L  H 
Sbjct  303  KRTIICNESLRSLFPVESINMFQMNKQLAKHI  334


 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      +LARTEVVK +W YI+ENNLQDP  K+ IIC+E+L  +F V++I+MF+MN+ L
Sbjct  271  QAFTGTSQLARTEVVKMLWKYIKENNLQDPSDKRTIICNESLRSLFPVESINMFQMNKQL  330

Query  783  SKHIWPIEKEDVTLVKSTPKERQR  712
            +KHIWP+ +ED        K +Q+
Sbjct  331  AKHIWPLVQEDEGTTNDPEKGKQK  354


 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 55/91 (60%), Gaps = 8/91 (9%)
 Frame = -2

Query  648  EEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNK  469
            E K++RG      GF    QLS  L KF GT +  L+R +VVK++W YI++++LQDP N+
Sbjct  103  EAKKRRG------GFNKICQLSPQLDKFLGTSQ--LARTEVVKKIWAYIRDHDLQDPKNR  154

Query  468  RRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            R ++CD+ L  L  V + + F M K L  H 
Sbjct  155  RNILCDEALHSLFRVKAIDMFQMNKALAKHI  185



>ref|XP_008806342.1| PREDICTED: uncharacterized protein LOC103719054 [Phoenix dactylifera]
Length=360

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 117/198 (59%), Gaps = 24/198 (12%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP +ART++VK++WAYIR+NNLQDP  K++IIC++ L  +F     DMF+MN+ L
Sbjct  185  QAIVGEPTMARTQIVKQLWAYIRKNNLQDPNNKRKIICNDELRMVFETDCTDMFKMNKLL  244

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E    +     P+ ++ K    E+ + ++ D+D                    
Sbjct  245  AKHIIPLE----STRDPGPESKKLKATTTELVSATEPDAD--------------------  280

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
              P+ +SD+L  FFGTGE+ + + + ++R+W YIK N+L+DP N   ++CD KL++L   
Sbjct  281  QYPVVISDALANFFGTGESEMLQSEALRRVWDYIKNNQLEDPMNGMMILCDSKLQQLFGC  340

Query  423  DSFEGFTMTKLLTAHFIK  370
             S     ++++L+ H  K
Sbjct  341  KSLSALGISEMLSHHLFK  358



>ref|XP_006480142.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Citrus sinensis]
Length=365

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/216 (39%), Positives = 120/216 (56%), Gaps = 28/216 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V  PELARTEVVK++W YI+EN LQDP  K++I+CDE+L  +F V +IDMF+MN+ L
Sbjct  120  QKVVGAPELARTEVVKKLWVYIKENKLQDPNNKRKILCDESLQALFGVNSIDMFKMNRAL  179

Query  783  SKHIWPIEKEDVTLVKSTPKE--------------------RQRKKGRDEVYTDSDSDSD  664
            SKHIWP+  ED  + +    E                     + ++    +   S  +  
Sbjct  180  SKHIWPLGAEDENVKQKIGVEDFKNSEEEEEKEQEQEQEHEEEEEEEETSIEQQSKENRS  239

Query  663  FEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  484
             +  ++ K++RG      GF     LS  L  F G  E  L+R +VVK++W YI+E  LQ
Sbjct  240  TKADKDVKKRRG------GFTKLCSLSPDLQTFVGVSE--LARTEVVKKLWAYIREKNLQ  291

Query  483  DPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            DP N+R +ICD+ L+ L  V+S   F M K LT H 
Sbjct  292  DPKNRRNIICDEALQVLFRVNSINMFQMNKALTRHI  327


 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 76/111 (68%), Gaps = 12/111 (11%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V   ELARTEVVK++WAYIRE NLQDPK ++ IICDE L  +FRV +I+MF+MN+ L
Sbjct  264  QTFVGVSELARTEVVKKLWAYIREKNLQDPKNRRNIICDEALQVLFRVNSINMFQMNKAL  323

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQR  631
            ++HIWP+++ D    KS  KE+Q     ++V   +D     EPK + KRQ+
Sbjct  324  TRHIWPLDEAD---AKSKEKEKQ----CEQVEEGTD-----EPKHKAKRQK  362



>ref|NP_001062171.1| Os08g0502800 [Oryza sativa Japonica Group]
 dbj|BAD08918.1| parathymosin-like [Oryza sativa Japonica Group]
 dbj|BAD09270.1| parathymosin-like [Oryza sativa Japonica Group]
 dbj|BAF24085.1| Os08g0502800 [Oryza sativa Japonica Group]
Length=406

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 111/198 (56%), Gaps = 24/198 (12%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP +ARTE+VK++WAYIR NNLQDP  K++IIC++ L  +F   + DMF+MN+ L
Sbjct  228  QAIVGEPTMARTEIVKQLWAYIRRNNLQDPNNKRKIICNDELRLVFETDSTDMFKMNKLL  287

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E              ++   RD             P + +  Q          
Sbjct  288  AKHIRPLEA-------------KKDSNRDSKKLKPVDSEPISPAETDVNQ----------  324

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
              PI LSD+L  FFGTGE  +   + VKR+W +IK N L+DP+N   ++CD KL++L   
Sbjct  325  -LPIILSDALASFFGTGEKEMPSSEAVKRVWDHIKSNNLEDPANPTMILCDSKLKQLFGC  383

Query  423  DSFEGFTMTKLLTAHFIK  370
            +S    ++++LL+ H  K
Sbjct  384  ESLTAVSVSELLSQHLFK  401



>ref|NP_175375.2| SWIB complex BAF60b domain-containing protein [Arabidopsis thaliana]
 gb|AAY25460.1| At1g49520 [Arabidopsis thaliana]
 gb|AEE32438.1| SWIB complex BAF60b domain-containing protein [Arabidopsis thaliana]
Length=372

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 118/212 (56%), Gaps = 29/212 (14%)
 Frame = -2

Query  942  ELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI  763
            +LARTEVVK++WAYIRE++LQDP  ++ I+CDE+L  +FRVKTI+MF+MN+ L+KHIW +
Sbjct  120  QLARTEVVKKMWAYIREHDLQDPTNRRNILCDESLHSLFRVKTINMFQMNKALAKHIWAL  179

Query  762  EKEDVTL-------VKSTPKERQRKKGR----------------DEVYTDSDSDSDFEPK  652
               D          V  T  ER  K  +                D              K
Sbjct  180  NDGDGCFKNVKEEDVDETSGERDEKDVKIEEALENNEEESREEEDRSVRKRKRKKRKPAK  239

Query  651  QEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSN  472
             EEK ++  KGG  GF     LS  L  F GT +  L+R +VVK +WKYIKEN LQDPS+
Sbjct  240  SEEKPKK--KGG--GFTKVCSLSPELQAFTGTPQ--LARTEVVKMLWKYIKENNLQDPSD  293

Query  471  KRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            KR +ICD+ LR L  V+S   F M K L  H 
Sbjct  294  KRTIICDESLRSLFPVESINMFQMNKQLAKHI  325


 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 70/100 (70%), Gaps = 5/100 (5%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q     P+LARTEVVK +W YI+ENNLQDP  K+ IICDE+L  +F V++I+MF+MN+ L
Sbjct  262  QAFTGTPQLARTEVVKMLWKYIKENNLQDPSDKRTIICDESLRSLFPVESINMFQMNKQL  321

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSD  664
            +KHIWP+ +ED     + P     +KG+ ++  ++D D+D
Sbjct  322  AKHIWPLVQEDEAGTTNDP-----EKGKQKMKMETDEDND  356


 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 71/130 (55%), Gaps = 12/130 (9%)
 Frame = -2

Query  756  EDVTLVKSTPKERQRKKG---RDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQL  586
            E   L++S P++ +        DE  +++D D    P + +KR       G GF    QL
Sbjct  56   ESDALLESKPEQEEEDCNGDQNDEEGSENDDDKTELPVKAKKR-------GGGFNKICQL  108

Query  585  SDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGF  406
            S  L KF GT +  L+R +VVK+MW YI+E++LQDP+N+R ++CD+ L  L  V +   F
Sbjct  109  SPQLEKFLGTSQ--LARTEVVKKMWAYIREHDLQDPTNRRNILCDESLHSLFRVKTINMF  166

Query  405  TMTKLLTAHF  376
             M K L  H 
Sbjct  167  QMNKALAKHI  176



>gb|ERN14421.1| hypothetical protein AMTR_s00033p00241730 [Amborella trichopoda]
Length=287

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 101/156 (65%), Gaps = 21/156 (13%)
 Frame = -2

Query  939  LARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIE  760
            L RTEVVKRIWA+IRE+NLQDP  K+ IICDE L  +F V +I MF+MN+ LSKHI P+ 
Sbjct  127  LPRTEVVKRIWAHIREHNLQDPANKRNIICDEQLRSLFDVDSIGMFQMNKVLSKHILPLA  186

Query  759  KE---DVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQ  589
             E   DV++ K  P                  D      + +K+++G  G G+  LAP+ 
Sbjct  187  TENGPDVSVPKVKP------------------DVSVPKVKRQKQEKGQGGKGSALLAPLP  228

Query  588  LSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  481
            LSD+L+KF GTGENAL R +V+KR+W +IK+NELQD
Sbjct  229  LSDALIKFIGTGENALPRSEVIKRIWNHIKQNELQD  264


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 55/85 (65%), Gaps = 2/85 (2%)
 Frame = -2

Query  618  GGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLR  439
            GG GF  P  LS  L  F G   + L R +VVKR+W +I+E+ LQDP+NKR +ICD++LR
Sbjct  104  GGGGFSKPCGLSPELQAFMGV--SVLPRTEVVKRIWAHIREHNLQDPANKRNIICDEQLR  161

Query  438  ELLEVDSFEGFTMTKLLTAHFIKTA  364
             L +VDS   F M K+L+ H +  A
Sbjct  162  SLFDVDSIGMFQMNKVLSKHILPLA  186



>gb|AAD43149.1|AC007504_4 Hypothetical Protein [Arabidopsis thaliana]
Length=386

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 118/212 (56%), Gaps = 29/212 (14%)
 Frame = -2

Query  942  ELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI  763
            +LARTEVVK++WAYIRE++LQDP  ++ I+CDE+L  +FRVKTI+MF+MN+ L+KHIW +
Sbjct  120  QLARTEVVKKMWAYIREHDLQDPTNRRNILCDESLHSLFRVKTINMFQMNKALAKHIWAL  179

Query  762  EKEDVTL-------VKSTPKERQRKKGR----------------DEVYTDSDSDSDFEPK  652
               D          V  T  ER  K  +                D              K
Sbjct  180  NDGDGCFKNVKEEDVDETSGERDEKDVKIEEALENNEEESREEEDRSVRKRKRKKRKPAK  239

Query  651  QEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSN  472
             EEK ++  KGG  GF     LS  L  F GT +  L+R +VVK +WKYIKEN LQDPS+
Sbjct  240  SEEKPKK--KGG--GFTKVCSLSPELQAFTGTPQ--LARTEVVKMLWKYIKENNLQDPSD  293

Query  471  KRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            KR +ICD+ LR L  V+S   F M K L  H 
Sbjct  294  KRTIICDESLRSLFPVESINMFQMNKQLAKHI  325


 Score =   100 bits (250),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q     P+LARTEVVK +W YI+ENNLQDP  K+ IICDE+L  +F V++I+MF+MN+ L
Sbjct  262  QAFTGTPQLARTEVVKMLWKYIKENNLQDPSDKRTIICDESLRSLFPVESINMFQMNKQL  321

Query  783  SKHIWPIEKEDVTLVKSTPKERQRK  709
            +KHIWP+ +ED     + P++ ++K
Sbjct  322  AKHIWPLVQEDEAGTTNDPEKGKQK  346


 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 71/130 (55%), Gaps = 12/130 (9%)
 Frame = -2

Query  756  EDVTLVKSTPKERQRKKG---RDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQL  586
            E   L++S P++ +        DE  +++D D    P + +KR       G GF    QL
Sbjct  56   ESDALLESKPEQEEEDCNGDQNDEEGSENDDDKTELPVKAKKR-------GGGFNKICQL  108

Query  585  SDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGF  406
            S  L KF GT +  L+R +VVK+MW YI+E++LQDP+N+R ++CD+ L  L  V +   F
Sbjct  109  SPQLEKFLGTSQ--LARTEVVKKMWAYIREHDLQDPTNRRNILCDESLHSLFRVKTINMF  166

Query  405  TMTKLLTAHF  376
             M K L  H 
Sbjct  167  QMNKALAKHI  176



>ref|XP_006423075.1| hypothetical protein CICLE_v10028659mg [Citrus clementina]
 gb|ESR36315.1| hypothetical protein CICLE_v10028659mg [Citrus clementina]
Length=378

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 120/214 (56%), Gaps = 26/214 (12%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V  PELARTEVVK++W YI+EN LQDP  K++I+CDE+L  +F V +IDMF+MN+ L
Sbjct  135  QKVVGAPELARTEVVKKLWVYIKENKLQDPTNKRKILCDESLQALFGVNSIDMFKMNRAL  194

Query  783  SKHIWPIEKEDVTLVKSTPKE------------------RQRKKGRDEVYTDSDSDSDFE  658
            SKHIWP+  ED  + +    E                   + ++    +   S  +   +
Sbjct  195  SKHIWPLGAEDENVKQKIGVEDFKNLEEEEEKEQEQEHEEEEEEEETSIEQQSKENRSTK  254

Query  657  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  478
              ++ K++RG      GF     LS  L  F G  E  L+R +VVK++W YI+E  LQDP
Sbjct  255  ADKDVKKRRG------GFTKLCSLSPDLQTFVGVSE--LARTEVVKKLWAYIREKNLQDP  306

Query  477  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
             N++ +ICD+ L+ L  V+S   F M K LT H 
Sbjct  307  KNRQNIICDEALQVLFRVNSINMFQMNKALTGHI  340


 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 72/111 (65%), Gaps = 12/111 (11%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V   ELARTEVVK++WAYIRE NLQDPK ++ IICDE L  +FRV +I+MF+MN+ L
Sbjct  277  QTFVGVSELARTEVVKKLWAYIREKNLQDPKNRQNIICDEALQVLFRVNSINMFQMNKAL  336

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQR  631
            + HIWP+++ D    ++  +  Q ++G D            EPK + KRQ+
Sbjct  337  TGHIWPLDEADAKSKETEKQCEQVEEGTD------------EPKHKAKRQK  375


 Score = 75.1 bits (183),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 70/132 (53%), Gaps = 24/132 (18%)
 Frame = -2

Query  705  GRDEVYTDSD---------------SDSDFEPKQEEKRQRGLK-------GGGTGFLAPI  592
            G D V  ++D                + + E + E KR++ +K        GG GF    
Sbjct  69   GNDAVEANADDKEEEEEEEEEEEEEEEEEEEEESERKREKSIKVGREVKRRGGGGFNKIC  128

Query  591  QLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFE  412
             LS  L K  G  E  L+R +VVK++W YIKEN+LQDP+NKR+++CD+ L+ L  V+S +
Sbjct  129  SLSTQLQKVVGAPE--LARTEVVKKLWVYIKENKLQDPTNKRKILCDESLQALFGVNSID  186

Query  411  GFTMTKLLTAHF  376
             F M + L+ H 
Sbjct  187  MFKMNRALSKHI  198



>ref|XP_010439338.1| PREDICTED: uncharacterized protein LOC104722801 [Camelina sativa]
Length=384

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 116/198 (59%), Gaps = 20/198 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            QV+V EP L RTE+V+++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  205  QVVVGEPALPRTEIVRQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  264

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P++              Q K+ + EV T +++  +  P                 
Sbjct  265  AKHILPLDPSK--------DSGQAKRAKAEVETKTET-PELTPV-----------SSAPV  304

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
             + I LS+SL KFFGTGE  ++  ++++R+W+YIK N L+DP N   + CD+KLR+LL  
Sbjct  305  SSTITLSESLSKFFGTGETEMTDEEIIRRVWEYIKLNNLEDPVNPMAIQCDEKLRDLLGC  364

Query  423  DSFEGFTMTKLLTAHFIK  370
            DS     + ++L  H  K
Sbjct  365  DSISAVGINEMLRRHMYK  382



>ref|XP_010448893.1| PREDICTED: uncharacterized protein LOC104731266 [Camelina sativa]
Length=388

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 117/198 (59%), Gaps = 20/198 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            QV+V EP L RTE+V+++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  209  QVVVGEPALPRTEIVRQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  268

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P++              Q K+ + EV T +++  +  P                 
Sbjct  269  AKHILPLDPSK--------DSGQAKRAKAEVETKTET-PELTPV-----------SSAPV  308

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
             + I LS+SL KFFGTGE  ++  ++++R+W+YIK N L+DP+N   + CD+KLR+LL  
Sbjct  309  SSTITLSESLSKFFGTGETEMTDEEIIRRVWEYIKLNNLEDPANPMAIQCDEKLRDLLGC  368

Query  423  DSFEGFTMTKLLTAHFIK  370
            +S     + ++L  H  K
Sbjct  369  ESISAVGINEMLRRHMYK  386



>ref|XP_010434052.1| PREDICTED: uncharacterized protein LOC104718075 [Camelina sativa]
Length=386

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 116/198 (59%), Gaps = 20/198 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            QV+V EP L RTE+V+++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  207  QVVVGEPALPRTEIVRQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  266

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P++              Q K+ + EV T +++  +  P                 
Sbjct  267  AKHILPLDPSK--------DSGQAKRAKAEVETKTET-PELTPV-----------SSAPV  306

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
             + I LS+SL KFFGTGE  ++  ++++R+W+YIK N L+DP N   + CD+KLR+LL  
Sbjct  307  SSTITLSESLSKFFGTGETEMTDEEIIRRVWEYIKLNNLEDPVNPMAIQCDEKLRDLLGC  366

Query  423  DSFEGFTMTKLLTAHFIK  370
            DS     + ++L  H  K
Sbjct  367  DSISAVGINEMLRRHMYK  384



>ref|XP_006480141.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Citrus sinensis]
Length=394

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/216 (39%), Positives = 120/216 (56%), Gaps = 28/216 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V  PELARTEVVK++W YI+EN LQDP  K++I+CDE+L  +F V +IDMF+MN+ L
Sbjct  120  QKVVGAPELARTEVVKKLWVYIKENKLQDPNNKRKILCDESLQALFGVNSIDMFKMNRAL  179

Query  783  SKHIWPIEKEDVTLVKSTPKE--------------------RQRKKGRDEVYTDSDSDSD  664
            SKHIWP+  ED  + +    E                     + ++    +   S  +  
Sbjct  180  SKHIWPLGAEDENVKQKIGVEDFKNSEEEEEKEQEQEQEHEEEEEEEETSIEQQSKENRS  239

Query  663  FEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  484
             +  ++ K++RG      GF     LS  L  F G  E  L+R +VVK++W YI+E  LQ
Sbjct  240  TKADKDVKKRRG------GFTKLCSLSPDLQTFVGVSE--LARTEVVKKLWAYIREKNLQ  291

Query  483  DPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            DP N+R +ICD+ L+ L  V+S   F M K LT H 
Sbjct  292  DPKNRRNIICDEALQVLFRVNSINMFQMNKALTRHI  327


 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 63/83 (76%), Gaps = 3/83 (4%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V   ELARTEVVK++WAYIRE NLQDPK ++ IICDE L  +FRV +I+MF+MN+ L
Sbjct  264  QTFVGVSELARTEVVKKLWAYIREKNLQDPKNRRNIICDEALQVLFRVNSINMFQMNKAL  323

Query  783  SKHIWPIEKEDVTLVKSTPKERQ  715
            ++HIWP+++ D    KS  KE+Q
Sbjct  324  TRHIWPLDEAD---AKSKEKEKQ  343



>ref|XP_006660252.1| PREDICTED: uncharacterized protein LOC102711373 [Oryza brachyantha]
Length=345

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 110/198 (56%), Gaps = 24/198 (12%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP +ARTE+VK++WAYIR NNLQDP  K++IIC++ L  +F   + DMF+MN+ L
Sbjct  166  QAIVGEPTMARTEIVKQLWAYIRRNNLQDPNNKRKIICNDELRLVFETDSTDMFKMNKLL  225

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E               +   RD             P + +  Q          
Sbjct  226  AKHIRPLEAA-------------KHSNRDSKKLKPVDSEPISPAETDVNQ----------  262

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
              PI +SD+L  FFGTGE  +   + VKR+W +IK N L+DP+N   ++CD KL++L   
Sbjct  263  -LPIIVSDALASFFGTGEKEMPSSEAVKRVWDHIKSNNLEDPANPAMILCDSKLKQLFGC  321

Query  423  DSFEGFTMTKLLTAHFIK  370
            +S    ++++LL+ H  K
Sbjct  322  ESLTTVSVSELLSHHLFK  339



>ref|XP_010928509.1| PREDICTED: uncharacterized protein LOC105050254 [Elaeis guineensis]
Length=361

 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 115/198 (58%), Gaps = 24/198 (12%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP +ART++VK++WAYIR+NNLQDP  K++IIC++ L  +F     DMF+MN+ L
Sbjct  186  QAIVGEPTMARTQIVKQLWAYIRKNNLQDPNNKRKIICNDELRLVFETDCTDMFKMNKLL  245

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E    +     P  ++ K    EV + ++ D D                    
Sbjct  246  AKHIIPLE----STRDPGPDSKKLKAPATEVVSATEPDVD--------------------  281

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
              P+ +SD+L  FFGTGE  + + + ++R+W YIK N+L+DP+N   ++CD KL++L   
Sbjct  282  QYPLVISDALANFFGTGEREMLQSEALRRIWDYIKHNQLEDPANTMVILCDTKLQQLFGC  341

Query  423  DSFEGFTMTKLLTAHFIK  370
            +S     ++ +L+ H  K
Sbjct  342  ESLSALGISDMLSRHLFK  359



>ref|XP_006303686.1| hypothetical protein CARUB_v10011771mg [Capsella rubella]
 gb|EOA36584.1| hypothetical protein CARUB_v10011771mg [Capsella rubella]
Length=376

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 116/208 (56%), Gaps = 21/208 (10%)
 Frame = -2

Query  942  ELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI  763
            +LARTEVVK IWAYI+E++LQDP+ ++ I+CDE L  +FRVKTI+MF+MN+ L+KHIWP+
Sbjct  124  QLARTEVVKNIWAYIKEHDLQDPENRRNILCDEALHSLFRVKTINMFQMNKALAKHIWPL  183

Query  762  EKEDVTLVKSTPKERQRKKG-RDE------------------VYTDSDSDSDFEPKQEEK  640
               D        ++     G RDE                      S      + ++  K
Sbjct  184  NDGDGCAKNVKEEDEDEASGERDEKEERNEEAVENNEEESGEEEDRSVRKRKSKKRKPAK  243

Query  639  RQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRV  460
             +   K  G GF     LS  L  F GT +  L+R +VVK +WKYIKEN LQDPS+KR +
Sbjct  244  SEDKPKKKGGGFTKVCSLSPELQAFTGTSQ--LARTEVVKMLWKYIKENNLQDPSDKRTI  301

Query  459  ICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            +CD+ LR L  V+S   F M K L  H 
Sbjct  302  LCDESLRSLFPVESINMFEMNKQLAKHI  329


 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 66/100 (66%), Gaps = 5/100 (5%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      +LARTEVVK +W YI+ENNLQDP  K+ I+CDE+L  +F V++I+MF MN+ L
Sbjct  266  QAFTGTSQLARTEVVKMLWKYIKENNLQDPSDKRTILCDESLRSLFPVESINMFEMNKQL  325

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSD  664
            +KHIWP+ +ED     + P     +KG+ ++    D D+D
Sbjct  326  AKHIWPLVQEDEAGTTNDP-----EKGKQKMDMKIDEDND  360


 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 66/126 (52%), Gaps = 6/126 (5%)
 Frame = -2

Query  747  TLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGG--TGFLAPIQLSDSL  574
             L++S P+    K+  DE      +D +      EK +R +K      GF    QLS  L
Sbjct  59   ALLESKPE--VHKEHEDEDCNGDQNDEEGSENDNEKTERPVKAKKRRGGFNKICQLSPQL  116

Query  573  VKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTK  394
             KF GT +  L+R +VVK +W YIKE++LQDP N+R ++CD+ L  L  V +   F M K
Sbjct  117  EKFIGTSQ--LARTEVVKNIWAYIKEHDLQDPENRRNILCDEALHSLFRVKTINMFQMNK  174

Query  393  LLTAHF  376
             L  H 
Sbjct  175  ALAKHI  180



>ref|XP_006297542.1| hypothetical protein CARUB_v10013568mg [Capsella rubella]
 gb|EOA30440.1| hypothetical protein CARUB_v10013568mg [Capsella rubella]
Length=483

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 95/219 (43%), Positives = 119/219 (54%), Gaps = 30/219 (14%)
 Frame = -2

Query  957  LVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSK  778
            LV   +LARTEVVK+IWAYI+   LQDPK +++I+CDE L  +FRVKTI+MF+MN+ L+K
Sbjct  202  LVGTSQLARTEVVKKIWAYIKGKGLQDPKDRRKIVCDELLHSLFRVKTINMFQMNKALTK  261

Query  777  HIWPIEKED----------VTLVKSTPKERQRKKG---------------RDEVYTDSDS  673
            HIWP+   D                   E   KKG                +EV +    
Sbjct  262  HIWPLGDGDGCANNVKEEDEDEDDDEASEGTDKKGEQNEEVEENKEEENEDEEVRSLRKR  321

Query  672  DSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKEN  493
                  K  EK +R  KGGG GF     LS  L  F G  E  L+R +VVK +WKYIKEN
Sbjct  322  KRKKPAKSVEKPKR--KGGG-GFAKVCSLSPELQAFTGVTE--LARTEVVKMLWKYIKEN  376

Query  492  ELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
             LQDP++ R +ICD+ L  L  V+S   F M KLLT H 
Sbjct  377  NLQDPNDGRTIICDESLLSLFPVESINMFQMNKLLTKHI  415


 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 98/145 (68%), Gaps = 14/145 (10%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      ELARTEVVK +W YI+ENNLQDP   + IICDE+LL +F V++I+MF+MN+ L
Sbjct  352  QAFTGVTELARTEVVKMLWKYIKENNLQDPNDGRTIICDESLLSLFPVESINMFQMNKLL  411

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHIWP++   V+   ++PK      G+ ++ +D D+DS+ EP +++K+ +      T  
Sbjct  412  TKHIWPLDNNAVS--PNSPKN-----GKQKMESDGDTDSE-EPNEKDKKLK------TED  457

Query  603  LAPIQLSDSLVKFFGTGENALSRGD  529
            L  + LSD+LVKF G GE++LSR D
Sbjct  458  LPSLPLSDALVKFLGNGESSLSRAD  482



>ref|XP_010539556.1| PREDICTED: uncharacterized protein LOC104813595 [Tarenaya hassleriana]
Length=361

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 115/198 (58%), Gaps = 26/198 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP+L RTE+VK++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  188  QAIVGEPDLPRTEIVKQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  247

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P++          P +   +  R +V        D E K EE  +          
Sbjct  248  AKHILPLD----------PTKETGQAKRVKV--------DVESKTEETTE--------AV  281

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
             + I LS+SL KFF TGE  +   +V+KR+W++IK N L+DPSN   + CD+KLR+LL  
Sbjct  282  SSTIVLSESLAKFFATGETEMVETEVMKRVWEHIKLNHLEDPSNPMAIQCDEKLRDLLGC  341

Query  423  DSFEGFTMTKLLTAHFIK  370
            +S     + ++L  H  K
Sbjct  342  ESISAVGINEMLRRHMYK  359



>ref|XP_003635018.1| PREDICTED: uncharacterized protein LOC100853436 [Vitis vinifera]
 emb|CBI33113.3| unnamed protein product [Vitis vinifera]
Length=344

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 114/197 (58%), Gaps = 27/197 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP + RT++VK++WAYIR+NNLQDP  K++IICD+ L  +F   + DMF+MN+ L
Sbjct  171  QAVVGEPTMPRTQIVKQLWAYIRKNNLQDPSNKRKIICDDALRLVFETDSTDMFKMNKLL  230

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E          P     +  R +V  +S ++S                     
Sbjct  231  AKHIIPLE----------PSRESSQAKRLKVDVESATES-----------------SEAS  263

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
             +P+ +SD+L  FFGTGE  + + + ++R+W+YIK N+L+DP N   ++CD KLREL   
Sbjct  264  PSPVMISDALATFFGTGEREMLQEEALRRVWEYIKVNQLEDPLNSMAILCDAKLRELFGC  323

Query  423  DSFEGFTMTKLLTAHFI  373
            +S     ++++L  H +
Sbjct  324  ESISALGVSEMLARHHL  340



>ref|XP_010419877.1| PREDICTED: uncharacterized protein LOC104705555 [Camelina sativa]
Length=541

 Score =   153 bits (387),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 94/207 (45%), Positives = 127/207 (61%), Gaps = 15/207 (7%)
 Frame = -2

Query  957  LVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSK  778
            +V   +LARTEVV+++W YI+E +LQDPK +++I+CDE L  +FRVKTI+MF+MN+ L+K
Sbjct  135  VVGTSQLARTEVVRKLWDYIKEKDLQDPKDRRKIVCDELLHSLFRVKTINMFQMNKALTK  194

Query  777  HIWPIEKEDVTLVKSTPKERQRKKG--RDEVYTDSDSDS-DFEPKQEEKRQRGL------  625
            HIWP+ + D    +    E   KKG   +EV  +   +S D E +   KR+R        
Sbjct  195  HIWPLGEGDEYDAEDEASEGTDKKGEQNEEVGENKVEESEDEEVRNLRKRKRKTPAKSVE  254

Query  624  ----KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVI  457
                KGGG GF     LS  L  F G  E  L+R +VVK +WKYIKEN+LQDP++ R +I
Sbjct  255  KPKRKGGGGGFAKICSLSPELQAFTGVTE--LARTEVVKLLWKYIKENKLQDPNDGRTII  312

Query  456  CDDKLRELLEVDSFEGFTMTKLLTAHF  376
            CD+ LR L   +S   F M KLLT H 
Sbjct  313  CDESLRSLFPFESINMFQMNKLLTKHI  339


 Score = 88.6 bits (218),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      ELARTEVVK +W YI+EN LQDP   + IICDE+L  +F  ++I+MF+MN+ L
Sbjct  276  QAFTGVTELARTEVVKLLWKYIKENKLQDPNDGRTIICDESLRSLFPFESINMFQMNKLL  335

Query  783  SKHIWPIE-KEDVTLVKSTPKERQRK  709
            +KHIWP+E     ++  ++PK  ++K
Sbjct  336  TKHIWPLEDNAGESISSNSPKNGKQK  361


 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 57/93 (61%), Gaps = 3/93 (3%)
 Frame = -2

Query  654  KQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  475
            ++EE+  +  K GG GF    QLS  L K  GT +  L+R +VV+++W YIKE +LQDP 
Sbjct  107  EKEERPVKAKKRGG-GFTKVSQLSPQLEKVVGTSQ--LARTEVVRKLWDYIKEKDLQDPK  163

Query  474  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            ++R+++CD+ L  L  V +   F M K LT H 
Sbjct  164  DRRKIVCDELLHSLFRVKTINMFQMNKALTKHI  196



>ref|XP_008792594.1| PREDICTED: upstream activation factor subunit spp27 isoform X4 
[Phoenix dactylifera]
Length=266

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 93/139 (67%), Gaps = 22/139 (16%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V E ELARTEVVK++WAYIREN+LQDP  +K+IICDE L  +F+V TIDMF+MN+ L
Sbjct  146  QQFVGESELARTEVVKKLWAYIRENSLQDPNNRKKIICDERLQNLFKVNTIDMFQMNKAL  205

Query  783  SKHIWPIEKED--VTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGT  610
            SKHIWP+  ED  VT VKS PK++Q KK R                 E KRQ   KGG +
Sbjct  206  SKHIWPLTSEDGPVTTVKSKPKDKQHKKER-----------------EGKRQ---KGGSS  245

Query  609  GFLAPIQLSDSLVKFFGTG  553
            G L P+ LSD LVKF GTG
Sbjct  246  GLLVPLPLSDDLVKFIGTG  264


 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = -2

Query  615  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  436
            G GF     LS +L +F   GE+ L+R +VVK++W YI+EN LQDP+N++++ICD++L+ 
Sbjct  132  GGGFTKLCSLSPALQQF--VGESELARTEVVKKLWAYIRENSLQDPNNRKKIICDERLQN  189

Query  435  LLEVDSFEGFTMTKLLTAHF  376
            L +V++ + F M K L+ H 
Sbjct  190  LFKVNTIDMFQMNKALSKHI  209



>ref|XP_008792593.1| PREDICTED: upstream activation factor subunit spp27 isoform X3 
[Phoenix dactylifera]
Length=267

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 93/140 (66%), Gaps = 23/140 (16%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q  V E ELARTEVVK++WAYIREN+LQDP  +K+IICDE L  +F+V TIDMF+MN+ L
Sbjct  146  QQFVGESELARTEVVKKLWAYIRENSLQDPNNRKKIICDERLQNLFKVNTIDMFQMNKAL  205

Query  783  SKHIWPIEKED---VTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGG  613
            SKHIWP+  ED   VT VKS PK++Q KK R                 E KRQ   KGG 
Sbjct  206  SKHIWPLTSEDAGPVTTVKSKPKDKQHKKER-----------------EGKRQ---KGGS  245

Query  612  TGFLAPIQLSDSLVKFFGTG  553
            +G L P+ LSD LVKF GTG
Sbjct  246  SGLLVPLPLSDDLVKFIGTG  265


 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = -2

Query  615  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  436
            G GF     LS +L +F   GE+ L+R +VVK++W YI+EN LQDP+N++++ICD++L+ 
Sbjct  132  GGGFTKLCSLSPALQQF--VGESELARTEVVKKLWAYIRENSLQDPNNRKKIICDERLQN  189

Query  435  LLEVDSFEGFTMTKLLTAHF  376
            L +V++ + F M K L+ H 
Sbjct  190  LFKVNTIDMFQMNKALSKHI  209



>ref|XP_010913182.1| PREDICTED: uncharacterized protein LOC105038945 isoform X2 [Elaeis 
guineensis]
Length=359

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/201 (37%), Positives = 115/201 (57%), Gaps = 30/201 (15%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP +ART++VK++WAYIR+NNLQDP  K++IIC++ L  +F     DMF+MN+ L
Sbjct  184  QAIVGEPTMARTQIVKQLWAYIRKNNLQDPNNKRKIICNDELRLVFETDCTDMFKMNKLL  243

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDE---VYTDSDSDSDFEPKQEEKRQRGLKGGG  613
            +KHI P+E               R  GRD      T ++  S  EP  ++          
Sbjct  244  AKHIIPLEST-------------RDPGRDSKKLKTTATEVVSATEPDADQYS--------  282

Query  612  TGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLREL  433
                  + +SD+L  FFGTGE  + + + ++R+W YIK N+L+DP N   ++CD KL++L
Sbjct  283  ------VVISDALANFFGTGEREMLQSEALRRVWDYIKNNQLEDPMNTMIILCDSKLQQL  336

Query  432  LEVDSFEGFTMTKLLTAHFIK  370
             E +S     ++++L+ H  K
Sbjct  337  FECESLSALGLSEMLSRHLFK  357



>ref|XP_002278125.1| PREDICTED: uncharacterized protein LOC100267408 [Vitis vinifera]
 emb|CBI33108.3| unnamed protein product [Vitis vinifera]
Length=347

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 114/197 (58%), Gaps = 27/197 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP + RT++VK++WAYIR+NNLQDP  K++IICD+ L  +F   + DMF+MN+ L
Sbjct  174  QAVVGEPTMPRTQIVKQLWAYIRKNNLQDPSNKRKIICDDALRLVFETDSTDMFKMNKLL  233

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E          P     +  R +V  +S ++S                     
Sbjct  234  AKHIIPLE----------PSRESSQAKRLKVDVESATES-----------------SEAS  266

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
             +P+ +SD+L  FFGTGE  + + + ++R+W+YIK N+L+DP N   ++CD KL+EL   
Sbjct  267  PSPVMISDALATFFGTGEREMLQEEALRRVWEYIKVNQLEDPLNSMAILCDAKLQELFGC  326

Query  423  DSFEGFTMTKLLTAHFI  373
            +S     ++++L  H +
Sbjct  327  ESISALGVSEMLARHHL  343



>ref|XP_002445921.1| hypothetical protein SORBIDRAFT_07g028070 [Sorghum bicolor]
 gb|EES15416.1| hypothetical protein SORBIDRAFT_07g028070 [Sorghum bicolor]
Length=427

 Score =   150 bits (379),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 117/198 (59%), Gaps = 24/198 (12%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP +ARTE+VK++WAYIR NNLQDP  K++IIC++ L  +F   + DMF+MN+ L
Sbjct  248  QAIVGEPAMARTEIVKQLWAYIRRNNLQDPNNKRKIICNDELRLVFETDSTDMFQMNKLL  307

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHI P+E ++ +       +R+ KK + E         +  PK E    +         
Sbjct  308  SKHIRPLESKNDS-------KREAKKLKPE-------GGEQIPKVETDVNQ---------  344

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
              P+ +SD+L  FFGTGE  +   + VKR+W++IK N L+DP N   ++CD KL++L   
Sbjct  345  -LPLTVSDALATFFGTGEREMVHSEAVKRVWEHIKSNNLEDPENPTVILCDSKLKQLFGC  403

Query  423  DSFEGFTMTKLLTAHFIK  370
            +S     +++LL+ H  K
Sbjct  404  ESLAAHGVSELLSDHLYK  421



>ref|XP_010913181.1| PREDICTED: uncharacterized protein LOC105038945 isoform X1 [Elaeis 
guineensis]
Length=385

 Score =   149 bits (377),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 74/201 (37%), Positives = 115/201 (57%), Gaps = 30/201 (15%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP +ART++VK++WAYIR+NNLQDP  K++IIC++ L  +F     DMF+MN+ L
Sbjct  210  QAIVGEPTMARTQIVKQLWAYIRKNNLQDPNNKRKIICNDELRLVFETDCTDMFKMNKLL  269

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDE---VYTDSDSDSDFEPKQEEKRQRGLKGGG  613
            +KHI P+E               R  GRD      T ++  S  EP  ++          
Sbjct  270  AKHIIPLEST-------------RDPGRDSKKLKTTATEVVSATEPDADQYS--------  308

Query  612  TGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLREL  433
                  + +SD+L  FFGTGE  + + + ++R+W YIK N+L+DP N   ++CD KL++L
Sbjct  309  ------VVISDALANFFGTGEREMLQSEALRRVWDYIKNNQLEDPMNTMIILCDSKLQQL  362

Query  432  LEVDSFEGFTMTKLLTAHFIK  370
             E +S     ++++L+ H  K
Sbjct  363  FECESLSALGLSEMLSRHLFK  383



>ref|XP_002985006.1| hypothetical protein SELMODRAFT_121478 [Selaginella moellendorffii]
 gb|EFJ13881.1| hypothetical protein SELMODRAFT_121478 [Selaginella moellendorffii]
Length=311

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 119/200 (60%), Gaps = 11/200 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            + +V  P+  R++VVK +WAYIRE+NLQ P+ K++I CDE L  +F    IDMF MNQ L
Sbjct  120  EAIVGIPQAPRSQVVKSLWAYIREHNLQVPEDKRKIKCDEALKKVFNSDYIDMFSMNQKL  179

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KH+ P++           +E +            +     E  ++ ++  G     +GF
Sbjct  180  TKHVIPLDD----------RETRAANRLARKRKAEERAEKKEEAKKARKAAGKSPKVSGF  229

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
              P+++S  L +F GT E+ LSR +V K++W YIK N+LQDPS++R+++CD+KL +LL+ 
Sbjct  230  TVPMKISPKLREFLGTEESQLSRPEVTKQLWDYIKSNQLQDPSDRRKILCDEKLEKLLDC  289

Query  423  DSFEGF-TMTKLLTAHFIKT  367
             SF GF  + KLL AH   T
Sbjct  290  KSFNGFGGLPKLLQAHLTST  309



>ref|XP_004973841.1| PREDICTED: centrosomal and chromosomal factor-like isoform X1 
[Setaria italica]
Length=427

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 116/198 (59%), Gaps = 21/198 (11%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP +ARTE+VK++WAYIR+NNLQDP  K++IIC++ L  +F   + DMF+MN+ L
Sbjct  246  QAIVGEPAMARTEIVKQLWAYIRKNNLQDPNNKRKIICNDELRLVFETDSTDMFKMNKLL  305

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHI P+E  + +       +R+ KK + E     +  S   P + + +Q          
Sbjct  306  SKHIRPLETTNDS-------KRESKKLKSE---GGEPISPVSPVETDVKQ----------  345

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
              P  +SD+L  F GTGE  +   + VKR+W +IK N L+DP N   ++CD KL++L   
Sbjct  346  -LPFVISDALATFLGTGEREMPHSEAVKRVWDHIKSNNLEDPENSTVILCDSKLKQLFGC  404

Query  423  DSFEGFTMTKLLTAHFIK  370
            +S     +++L++ H  K
Sbjct  405  ESLTAQGVSELVSDHLFK  422



>ref|XP_010529474.1| PREDICTED: uncharacterized protein LOC104806331 [Tarenaya hassleriana]
Length=365

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 114/200 (57%), Gaps = 29/200 (15%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            QV+V  P L RTE+VK++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  191  QVVVGGPALPRTEIVKQLWAYIRKNNLQDPNNKRKIICDDALRVVFETDCTDMFKMNKLL  250

Query  783  SKHIWPIE--KEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGT  610
            +KHI P++  KE V        + +R K   E  T++   +D EP               
Sbjct  251  AKHILPLDPTKESV--------QAKRVKADAECKTET---TDTEPVSST-----------  288

Query  609  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  430
                 I LS+ L KFFGTGE  +   +V +R+W+Y+K N L+DP N   + CD+KLR+LL
Sbjct  289  -----IVLSEPLAKFFGTGETEMEGTEVTQRVWEYVKLNHLEDPLNPMAIHCDEKLRDLL  343

Query  429  EVDSFEGFTMTKLLTAHFIK  370
              +S     + ++L  H  K
Sbjct  344  GCESISAVGINEMLRRHMYK  363



>ref|XP_004973842.1| PREDICTED: centrosomal and chromosomal factor-like isoform X2 
[Setaria italica]
Length=426

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 116/198 (59%), Gaps = 21/198 (11%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP +ARTE+VK++WAYIR+NNLQDP  K++IIC++ L  +F   + DMF+MN+ L
Sbjct  245  QAIVGEPAMARTEIVKQLWAYIRKNNLQDPNNKRKIICNDELRLVFETDSTDMFKMNKLL  304

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHI P+E  + +       +R+ KK + E     +  S   P + + +Q          
Sbjct  305  SKHIRPLETTNDS-------KRESKKLKSE---GGEPISPVSPVETDVKQ----------  344

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
              P  +SD+L  F GTGE  +   + VKR+W +IK N L+DP N   ++CD KL++L   
Sbjct  345  -LPFVISDALATFLGTGEREMPHSEAVKRVWDHIKSNNLEDPENSTVILCDSKLKQLFGC  403

Query  423  DSFEGFTMTKLLTAHFIK  370
            +S     +++L++ H  K
Sbjct  404  ESLTAQGVSELVSDHLFK  421



>ref|XP_006449863.1| hypothetical protein CICLE_v10015752mg [Citrus clementina]
 ref|XP_006449864.1| hypothetical protein CICLE_v10015752mg [Citrus clementina]
 gb|ESR63103.1| hypothetical protein CICLE_v10015752mg [Citrus clementina]
 gb|ESR63104.1| hypothetical protein CICLE_v10015752mg [Citrus clementina]
Length=355

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 113/199 (57%), Gaps = 30/199 (15%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V +P + RTE+VK++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  184  QAVVGQPAMPRTEIVKQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  243

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E                           +S   F+P  E   + G++ G +  
Sbjct  244  AKHIIPLE------------------------PTKESSKRFKPDAESTTE-GMESGPS--  276

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
              P+ +S++L KF GTG   + + +  KR+W+YIK N L+DP N   ++CD KLRELL  
Sbjct  277  --PVIISEALAKFLGTGGREMLQAEATKRVWEYIKVNHLEDPLNSMVILCDAKLRELLGC  334

Query  423  DSFEGFTMTKLLT-AHFIK  370
            +S     + ++L   HF++
Sbjct  335  ESISALGIQEMLARNHFLR  353



>ref|XP_011627948.1| PREDICTED: uncharacterized protein LOC18446666 [Amborella trichopoda]
Length=339

 Score =   145 bits (367),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 108/198 (55%), Gaps = 26/198 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            QV+V EP + RT++VK++WAYIR+NNLQDP  K++IIC++ L  +F     DMF+MN+ L
Sbjct  167  QVIVGEPTMPRTQIVKQLWAYIRKNNLQDPSNKRKIICNDALRLVFDTDCTDMFKMNKLL  226

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            S+HI P+E        S P  ++ K                EP+   K        GT  
Sbjct  227  SRHILPLEPSK----DSRPDAKRLKA---------------EPQSSTKFTEAGPPPGT--  265

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
                 +S +L KFFGTGE  +S  + V  +W+YIK N L+DP N   +ICD KL+EL   
Sbjct  266  -----ISGALAKFFGTGETEMSLSEAVTHVWEYIKANHLEDPVNPTSIICDAKLQELFGC  320

Query  423  DSFEGFTMTKLLTAHFIK  370
            ++F    +  +L  H  K
Sbjct  321  ENFSRLRLQDMLDRHIFK  338



>gb|ABK24867.1| unknown [Picea sitchensis]
Length=297

 Score =   144 bits (364),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 111/163 (68%), Gaps = 10/163 (6%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q ++   EL+RT+VVK++W YIREN+LQDP+ +++I+CD+ L  +FR  +IDMF MN+ L
Sbjct  137  QSVLGVSELSRTQVVKQLWVYIRENDLQDPQNRRKILCDDKLRSVFRKDSIDMFEMNKVL  196

Query  783  SKHIWPIEKEDVTLVKSTPK---ERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGG  613
            S HI  +E  +V    S PK   ++Q KKG      DS+S S    +Q+++++ G +   
Sbjct  197  SNHILRLENGNVVSEDSEPKSKRQKQEKKG----LEDSESKS---KRQKQEKKDGGRVKS  249

Query  612  TGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  484
            +GF +P+ LSD+LV F GTGE+ LSR +VVKR+W YIK+  LQ
Sbjct  250  SGFCSPLPLSDALVTFLGTGESQLSRAEVVKRIWGYIKDKNLQ  292


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = -2

Query  621  GGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKL  442
            G G GF     LS  L    G  E  LSR  VVK++W YI+EN+LQDP N+R+++CDDKL
Sbjct  121  GTGGGFNKLCGLSPELQSVLGVSE--LSRTQVVKQLWVYIRENDLQDPQNRRKILCDDKL  178

Query  441  RELLEVDSFEGFTMTKLLTAHFIK  370
            R +   DS + F M K+L+ H ++
Sbjct  179  RSVFRKDSIDMFEMNKVLSNHILR  202



>gb|EMT17610.1| Upstream activation factor subunit UAF30 [Aegilops tauschii]
Length=429

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/199 (38%), Positives = 117/199 (59%), Gaps = 25/199 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP +ARTE+VK++WAYIR N+LQDP  K++IIC++ L  +F     DMF+MN+ L
Sbjct  250  QAIVGEPTMARTEIVKQLWAYIRRNDLQDPNNKRKIICNDELRLVFETDCTDMFKMNKLL  309

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSD-SDFEPKQEEKRQRGLKGGGTG  607
            +KHI P+E       K + ++ ++ K  ++V      D +  +P                
Sbjct  310  AKHIKPLEP-----TKDSNRDMKKLKPVEDVPVPLAEDVATNQP----------------  348

Query  606  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  427
               P+ +SD+L  FFGTGE  +S+ +VVK +W +IK N L+DPSN   ++CD KL++L  
Sbjct  349  ---PLNVSDALASFFGTGEREMSQSEVVKCVWDHIKSNNLEDPSNPTMILCDSKLKDLFG  405

Query  426  VDSFEGFTMTKLLTAHFIK  370
             +S     +++LL+ H  K
Sbjct  406  CESVTASAVSELLSDHLFK  424



>ref|XP_006467332.1| PREDICTED: alpha/beta-gliadin A-III-like isoform X1 [Citrus sinensis]
 ref|XP_006467333.1| PREDICTED: alpha/beta-gliadin A-III-like isoform X2 [Citrus sinensis]
 gb|KDO78454.1| hypothetical protein CISIN_1g018463mg [Citrus sinensis]
 gb|KDO78455.1| hypothetical protein CISIN_1g018463mg [Citrus sinensis]
Length=355

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 112/199 (56%), Gaps = 30/199 (15%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V +P + RTE+VK++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  184  QAVVGQPAMPRTEIVKQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  243

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E                           +S   F+P  E   + G++ G +  
Sbjct  244  AKHIIPLE------------------------PTKESSKRFKPDAESTTE-GMESGPSSV  278

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            +    +S++L KF GTG   + + +  KR+W+YIK N L+DP N   ++CD KLRELL  
Sbjct  279  I----ISEALAKFLGTGGREMLQAEATKRVWEYIKVNHLEDPLNSMVILCDAKLRELLGC  334

Query  423  DSFEGFTMTKLLT-AHFIK  370
            +S     + ++L   HF++
Sbjct  335  ESISALGIQEMLARNHFLR  353



>ref|XP_006283894.1| hypothetical protein CARUB_v10005012mg [Capsella rubella]
 gb|EOA16792.1| hypothetical protein CARUB_v10005012mg [Capsella rubella]
Length=388

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 116/198 (59%), Gaps = 21/198 (11%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            QV+V EP L RTE+V+++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  210  QVVVGEPALPRTEIVRQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  269

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P++          P +   +  R +   ++ +++  EP         + G     
Sbjct  270  AKHILPLD----------PTKDSGQAKRAKAEVETKTETTTEPLST------VAGSSNA-  312

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
                 LS+SL KFFGTGE  ++  ++++R+W+YIK N L+DP N   + CD+KLRELL  
Sbjct  313  ----TLSESLSKFFGTGETEMTDEEIIRRVWEYIKLNNLEDPVNPMAIQCDEKLRELLGC  368

Query  423  DSFEGFTMTKLLTAHFIK  370
            +S     + ++L  H  K
Sbjct  369  ESISAVGINEMLRRHMYK  386



>ref|XP_010042645.1| PREDICTED: uncharacterized protein LOC104431786, partial [Eucalyptus 
grandis]
Length=227

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 112/197 (57%), Gaps = 28/197 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP L RTE+VK++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  55   QAIVGEPALPRTEIVKQLWAYIRKNNLQDPSNKRKIICDDALRLVFETDCTDMFKMNKLL  114

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHI P++          P +   +  R +V  +S + S          Q G        
Sbjct  115  SKHIIPLQ----------PTKESGQAKRLKVSAESPNISS---------QTG--------  147

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
             A + +S++L KF GTGE  + + +  +R+W+YIK ++L+DP N   + CD +LRELL  
Sbjct  148  -ASVIISEALAKFLGTGEREMLQTEAHRRVWEYIKIHQLEDPLNPMGIHCDARLRELLGC  206

Query  423  DSFEGFTMTKLLTAHFI  373
            +S     + +LL  H +
Sbjct  207  ESISALGVPELLERHHL  223



>ref|XP_010538758.1| PREDICTED: uncharacterized protein LOC104812994 [Tarenaya hassleriana]
Length=372

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 112/198 (57%), Gaps = 27/198 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP L RTE+VK++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  194  QAVVGEPFLPRTEIVKQLWAYIRKNNLQDPSNKRKIICDDPLRVVFETDCTDMFKMNKLL  253

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHI P++          P +   +  R +V  +S +++  EP                 
Sbjct  254  SKHILPLD----------PTKESGQAKRVKVDAESTTET-VEPVSST-------------  289

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
               + LS+ + KFFGTGE  +   +VV+R+W YIK N L+DP N   + CD+KLR+LL  
Sbjct  290  ---VVLSEPIAKFFGTGETEMVETEVVQRVWDYIKLNHLEDPVNPMAIQCDEKLRDLLGC  346

Query  423  DSFEGFTMTKLLTAHFIK  370
            +S     + ++L  H  K
Sbjct  347  ESISAVGINEMLRRHMYK  364



>ref|XP_010252656.1| PREDICTED: formin-G [Nelumbo nucifera]
 ref|XP_010252657.1| PREDICTED: formin-G [Nelumbo nucifera]
Length=348

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 112/199 (56%), Gaps = 28/199 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP + RT++VK++WAYIR++NLQDP  K++I+CD+ L  +F     DMF+MN+ L
Sbjct  175  QAIVGEPSMPRTQIVKQLWAYIRKHNLQDPSNKRKIVCDDALRLVFETDCTDMFKMNKLL  234

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E               ++ G+D      +++S  E               T  
Sbjct  235  AKHIIPLEPT-------------KEPGQDSKRVKLEAESTIE--------------STEA  267

Query  603  LAPIQ-LSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  427
              P+  +SD+L  FFGT E  + + + +KR+W YIK N L+DP N   ++CD KL+EL  
Sbjct  268  APPLLIISDALAMFFGTEEREMLQSEALKRVWDYIKLNHLEDPLNSMVILCDAKLQELFG  327

Query  426  VDSFEGFTMTKLLTAHFIK  370
             +SF    ++++L  HF K
Sbjct  328  CESFSALGISEMLAHHFFK  346



>ref|XP_011095959.1| PREDICTED: uncharacterized protein LOC105175270 [Sesamum indicum]
Length=331

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 111/197 (56%), Gaps = 27/197 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP L RTE+VK++WAYIR++NLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  159  QAIVGEPALPRTEIVKQLWAYIRKHNLQDPGNKRKIICDDALRMVFETDCTDMFKMNKLL  218

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P++             +Q  + +     D+  + + +P                 
Sbjct  219  AKHILPLD-----------PMKQSSQAKKSKLEDASPNQNSDPS----------------  251

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            L P+ +SD+L KFFGTG   + + + + R+W+YIK N+L+DP +   + CD KL+ELL  
Sbjct  252  LLPVIISDALAKFFGTGVREMLQSEALGRVWEYIKVNQLEDPLSSMVIHCDAKLQELLGC  311

Query  423  DSFEGFTMTKLLTAHFI  373
            +S     + ++L  H +
Sbjct  312  ESISALGIQEMLVRHHL  328



>ref|XP_010448899.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily D member 1-like [Camelina sativa]
 ref|XP_010448900.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily D member 1-like [Camelina sativa]
Length=246

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 129/229 (56%), Gaps = 35/229 (15%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            QV+V EP L RTE+V+++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  29   QVVVGEPALPRTEIVRQLWAYIRKNNLQDPSNKRKIICDDALRVVFET---DMFKMNKLL  85

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P++         +    Q K+ + EV T +++ ++  P                 
Sbjct  86   AKHILPLD--------PSKDSGQAKRAKAEVDTKNET-TELTPV-----------SSAPV  125

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
             + + LS+SL KFFGTGE  ++  +++ R+W+YIK N L+D  N   + CD+KLR+LL  
Sbjct  126  SSTVTLSESLSKFFGTGETEMTDEEIILRVWEYIKLNNLEDLVNPMAIQCDEKLRDLLGC  185

Query  423  DSFEGFTMTKLLTAHFIKTAG*CYLTFLAT*KCL-------LSCFSFPL  298
            +S     + ++L  H  K +  C ++++    CL       L C + PL
Sbjct  186  ESIAAAGINEMLRRHMYKQS--CSVSYVF---CLSMIYVITLRCLANPL  229



>ref|XP_012085022.1| PREDICTED: angiomotin-like [Jatropha curcas]
 gb|KDP26953.1| hypothetical protein JCGZ_22250 [Jatropha curcas]
Length=383

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/197 (38%), Positives = 114/197 (58%), Gaps = 27/197 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP L RTE+VK++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  210  QAVVGEPALPRTEIVKQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  269

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E          P +   +  R +V  +S ++ + EP                 
Sbjct  270  AKHIIPLE----------PSKEASQAKRVKVDVESTTE-NTEP----------------V  302

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
             + + +SD+L KF GTG   +++ +  +R+W+YIK N+L+DP N   ++CD KLRELL  
Sbjct  303  ASAVVISDALAKFLGTGVREMTQVEASRRVWEYIKVNQLEDPLNSMVILCDAKLRELLGC  362

Query  423  DSFEGFTMTKLLTAHFI  373
            +S     + ++L  H +
Sbjct  363  ESISAVGVEEMLARHHL  379



>ref|XP_010489932.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104767632 
[Camelina sativa]
Length=437

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 122/208 (59%), Gaps = 16/208 (8%)
 Frame = -2

Query  957  LVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSK  778
            +V   +LARTEVV+++W YI+E +LQDPK +++I+CDE L  +FRVKTI+MF+MN+ LSK
Sbjct  131  VVGTSQLARTEVVRKLWDYIKEKDLQDPKDRRKIVCDELLHSLFRVKTINMFQMNKALSK  190

Query  777  HIWPI-EKEDVTLVKSTPKERQRKKG-RDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            HIWP+ E ++    +    E   KKG ++E   ++  +   + +    R+R  K      
Sbjct  191  HIWPLGEGDEEYDAEDKASEGTDKKGEQNEQVGENKEEESEDEEVRNLRKRKRKTPAKSV  250

Query  603  LAP------------IQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRV  460
              P              LS  L  F G  E  L+R +VVK +WKYIKEN+LQDP++ R +
Sbjct  251  EKPKRKGGGGGFAKICSLSPELQSFTGVTE--LARTEVVKLLWKYIKENKLQDPNDGRTI  308

Query  459  ICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            ICD+ LR L   +S   F M KLLT H 
Sbjct  309  ICDESLRSLFPFESINMFQMNKLLTKHI  336


 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 111/194 (57%), Gaps = 40/194 (21%)
 Frame = -2

Query  942  ELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI  763
            ELARTEVVK +W YI+EN LQDP   + IICDE+L  +F  ++I+MF+MN+ L+KHIWP+
Sbjct  280  ELARTEVVKLLWKYIKENKLQDPNDGRTIICDESLRSLFPFESINMFQMNKLLTKHIWPL  339

Query  762  EKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLS  583
            E      + S       K G+ ++ +D DS+   EP +++KR +      T  LAP+ LS
Sbjct  340  EDNAGESISSNSP----KNGKQKMESDGDSE---EPDEQDKRXK------TEVLAPLPLS  386

Query  582  DSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV--DSFEG  409
            D++VK                            DPS KRRVICD+KL EL EV   S E 
Sbjct  387  DAVVKL-------------------------ETDPSGKRRVICDEKLLELFEVGTXSLED  421

Query  408  FTMTKLLTAHFIKT  367
             +++K LT HFIKT
Sbjct  422  ASVSKHLTNHFIKT  435


 Score = 69.7 bits (169),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (60%), Gaps = 4/89 (4%)
 Frame = -2

Query  636  QRGLKGG--GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRR  463
            +R +K    G GF    QLS  L K  GT +  L+R +VV+++W YIKE +LQDP ++R+
Sbjct  106  ERPVKAKKRGGGFAKVSQLSPQLEKVVGTSQ--LARTEVVRKLWDYIKEKDLQDPKDRRK  163

Query  462  VICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            ++CD+ L  L  V +   F M K L+ H 
Sbjct  164  IVCDELLHSLFRVKTINMFQMNKALSKHI  192



>emb|CDY27449.1| BnaC03g64890D [Brassica napus]
Length=324

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 110/196 (56%), Gaps = 26/196 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            QV+V EP L RTE+V+++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  154  QVVVGEPALPRTEIVRQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  213

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P++              Q K+ + EV T +      EP                 
Sbjct  214  AKHILPLDPSK--------DSSQSKRAKAEVETKTK-----EPVSSTSSTV---------  251

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
                 LS+ L KFFGTGE  ++  +++ R+W+YIK N L+DP+N   + CD+KLRELL  
Sbjct  252  ----SLSEPLAKFFGTGEMVMTDEEIICRVWEYIKLNHLEDPANPMAIQCDEKLRELLGC  307

Query  423  DSFEGFTMTKLLTAHF  376
            +S     + ++L  H 
Sbjct  308  ESISAVGINEMLRRHI  323


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = -2

Query  624  KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDK  445
            KGG  G     ++S  L      GE AL R ++V+++W YI++N LQDPSNKR++ICDD 
Sbjct  137  KGGPGGLNKVCRVSPELQVV--VGEPALPRTEIVRQLWAYIRKNNLQDPSNKRKIICDDA  194

Query  444  LRELLEVDSFEGFTMTKLLTAHFI  373
            LR + E D  + F M KLL  H +
Sbjct  195  LRVVFETDCTDMFKMNKLLAKHIL  218



>ref|XP_006406538.1| hypothetical protein EUTSA_v10020944mg [Eutrema salsugineum]
 gb|ESQ47991.1| hypothetical protein EUTSA_v10020944mg [Eutrema salsugineum]
Length=378

 Score =   144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 122/211 (58%), Gaps = 24/211 (11%)
 Frame = -2

Query  942  ELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI  763
            +LARTEV K++WAYI+E +LQDPK +++I+CDE+L  +FRVK+I+MF+M++ L+KHIWP+
Sbjct  138  QLARTEVTKKLWAYIKEKDLQDPKDRRKILCDESLHSLFRVKSINMFQMSKALTKHIWPL  197

Query  762  EKED--VTLVK---------STPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQ------  634
               D  V  VK             ER +K   +E   + + +   E  +   R+      
Sbjct  198  GDGDGCVNSVKEEDEDEDEDEASGERDKKGEENEEVEEENEEESEEEVRRTLRKRKRKKP  257

Query  633  -----RGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNK  469
                 +  + GG GF     LS  L  F G  E  L+R +V K +W YIKEN LQDP++K
Sbjct  258  VKSVDKPKRKGGGGFAKVCSLSPELQAFTGVTE--LARTEVTKMLWSYIKENNLQDPNDK  315

Query  468  RRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            R +ICD+ LR L   +S   F M+KLLT H 
Sbjct  316  RTIICDESLRSLFTFESVNMFQMSKLLTKHI  346


 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 62/94 (66%), Gaps = 4/94 (4%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q      ELARTEV K +W+YI+ENNLQDP  K+ IICDE+L  +F  ++++MF+M++ L
Sbjct  283  QAFTGVTELARTEVTKMLWSYIKENNLQDPNDKRTIICDESLRSLFTFESVNMFQMSKLL  342

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTD  682
            +KHIWP++      V S    +  K G+ E+ TD
Sbjct  343  TKHIWPLQDNAGESVGS----KSPKNGKQEMETD  372


 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 57/93 (61%), Gaps = 4/93 (4%)
 Frame = -2

Query  648  EEKRQRGLKGG--GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  475
            E+K +R +K     +GF    QLS  L KF GT +  L+R +V K++W YIKE +LQDP 
Sbjct  104  EDKEERPVKAKKRASGFTKVCQLSPQLEKFLGTSQ--LARTEVTKKLWAYIKEKDLQDPK  161

Query  474  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            ++R+++CD+ L  L  V S   F M+K LT H 
Sbjct  162  DRRKILCDESLHSLFRVKSINMFQMSKALTKHI  194



>gb|EEE68957.1| hypothetical protein OsJ_27851 [Oryza sativa Japonica Group]
Length=333

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 102/186 (55%), Gaps = 24/186 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP +ARTE+VK++WAYIR NNLQDP  K++IIC++ L  +F   + DMF+MN+ L
Sbjct  166  QAIVGEPTMARTEIVKQLWAYIRRNNLQDPNNKRKIICNDELRLVFETDSTDMFKMNKLL  225

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E              ++   RD             P + +  Q          
Sbjct  226  AKHIRPLEA-------------KKDSNRDSKKLKPVDSEPISPAETDVNQ----------  262

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
              PI LSD+L  FFGTGE  +   + VKR+W +IK N L+DP+N   ++CD KL++L   
Sbjct  263  -LPIILSDALASFFGTGEKEMPSSEAVKRVWDHIKSNNLEDPANPTMILCDSKLKQLFGC  321

Query  423  DSFEGF  406
            +S    
Sbjct  322  ESLTAM  327


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  555  GENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            GE  ++R ++VK++W YI+ N LQDP+NKR++IC+D+LR + E DS + F M KLL  H 
Sbjct  170  GEPTMARTEIVKQLWAYIRRNNLQDPNNKRKIICNDELRLVFETDSTDMFKMNKLLAKHI  229



>emb|CDX98747.1| BnaA03g45320D [Brassica napus]
Length=365

 Score =   143 bits (361),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 111/206 (54%), Gaps = 37/206 (18%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            +V+V EP L RTE+V+++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  191  EVVVGEPALPRTEIVRQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  250

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+                          D   DS      + KR +      T  
Sbjct  251  AKHILPL--------------------------DPSKDSG-----QAKRAKAEVETKTET  279

Query  603  LAPIQ------LSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKL  442
              P+       LS+ L KFFGTGE  ++   +++R+W+YIK N L+DP+N   + CD+KL
Sbjct  280  TEPVSSTSAVALSEPLAKFFGTGETEMTEEAIIRRVWEYIKLNNLEDPANPMAIQCDEKL  339

Query  441  RELLEVDSFEGFTMTKLLTAHFIKTA  364
            R+LL  +S     + ++L  H  K +
Sbjct  340  RDLLGCESISAVGINEMLRRHMYKPS  365



>ref|XP_009137258.1| PREDICTED: formin-like protein 4 [Brassica rapa]
Length=364

 Score =   143 bits (361),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 111/206 (54%), Gaps = 37/206 (18%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            +V+V EP L RTE+V+++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  190  EVVVGEPALPRTEIVRQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  249

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+                          D   DS      + KR +      T  
Sbjct  250  AKHILPL--------------------------DPSKDSG-----QAKRAKAEVETKTET  278

Query  603  LAPIQ------LSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKL  442
              P+       LS+ L KFFGTGE  ++   +++R+W+YIK N L+DP+N   + CD+KL
Sbjct  279  TEPVSSTSAVALSEPLAKFFGTGETEMTEEAIIRRVWEYIKLNNLEDPANPMAIQCDEKL  338

Query  441  RELLEVDSFEGFTMTKLLTAHFIKTA  364
            R+LL  +S     + ++L  H  K +
Sbjct  339  RDLLGCESISAVGINEMLRRHMYKPS  364



>gb|EEC83834.1| hypothetical protein OsI_29784 [Oryza sativa Indica Group]
Length=394

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 102/186 (55%), Gaps = 24/186 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP +ARTE+VK++WAYIR NNLQDP  K++IIC++ L  +F   + DMF+MN+ L
Sbjct  227  QAIVGEPTMARTEIVKQLWAYIRRNNLQDPNNKRKIICNDELRLVFETDSTDMFKMNKLL  286

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E              ++   RD             P + +  Q          
Sbjct  287  AKHIRPLEA-------------KKDSNRDSKKLKPVDSEPISPAETDVNQ----------  323

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
              PI LSD+L  FFGTGE  +   + VKR+W +IK N L+DP+N   ++CD KL++L   
Sbjct  324  -LPIILSDALASFFGTGEKEMPSSEAVKRVWDHIKSNNLEDPANPTMILCDSKLKQLFGC  382

Query  423  DSFEGF  406
            +S    
Sbjct  383  ESLTAM  388


 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  555  GENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  376
            GE  ++R ++VK++W YI+ N LQDP+NKR++IC+D+LR + E DS + F M KLL  H 
Sbjct  231  GEPTMARTEIVKQLWAYIRRNNLQDPNNKRKIICNDELRLVFETDSTDMFKMNKLLAKHI  290



>ref|XP_002520558.1| brg-1 associated factor, putative [Ricinus communis]
 gb|EEF41791.1| brg-1 associated factor, putative [Ricinus communis]
Length=397

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 114/197 (58%), Gaps = 27/197 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP L RTE+VK++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  224  QAIVGEPALPRTEIVKQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  283

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E         T +  Q K+ + +V + ++   + EP           G     
Sbjct  284  AKHIIPLE--------PTKESAQAKRAKVDVESTTE---NAEP-----------GASV--  319

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
               I +S++L KF GTG   +++ +  +R+W+YIK N L+DP N   ++CD KLRELL  
Sbjct  320  ---IVISEALAKFLGTGGREMTQLEASRRVWEYIKVNRLEDPLNSMVILCDAKLRELLGC  376

Query  423  DSFEGFTMTKLLTAHFI  373
            +S     + ++L  H +
Sbjct  377  ESISAVGVEEMLARHHL  393



>ref|XP_010270124.1| PREDICTED: uncharacterized protein LOC104606552 [Nelumbo nucifera]
 ref|XP_010270125.1| PREDICTED: uncharacterized protein LOC104606552 [Nelumbo nucifera]
Length=344

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 110/198 (56%), Gaps = 26/198 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP + RT++VK++WAYIR++NLQDP  K++IICD+ L  +F   + DMF+MN+ L
Sbjct  171  QAIVGEPAMPRTQIVKQLWAYIRKHNLQDPSNKRKIICDDALRLVFETDSTDMFKMNKLL  230

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E               ++ G+D      D +S  E  +           G   
Sbjct  231  AKHIIPLEP-------------TKESGQDSKRIKLDVESTTESAE----------AGQSL  267

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            +    +SD+L KFFGTGE  + + + ++ +W+YIK N L+DP N   ++CD KL+EL   
Sbjct  268  VV---ISDALAKFFGTGEREMIQAEALRCLWEYIKLNHLEDPLNSMVILCDAKLQELFGC  324

Query  423  DSFEGFTMTKLLTAHFIK  370
             S     + ++L  H  K
Sbjct  325  ASLAAMGIPEMLAHHLFK  342



>ref|XP_011095484.1| PREDICTED: uncharacterized protein LOC105174926 [Sesamum indicum]
 ref|XP_011095486.1| PREDICTED: uncharacterized protein LOC105174926 [Sesamum indicum]
Length=358

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/193 (38%), Positives = 112/193 (58%), Gaps = 21/193 (11%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V +P L RTE+VK++WAYIR+NNLQDP  K++IIC++ L  +F     DMF+MN+ L
Sbjct  179  QTIVGQPTLPRTEIVKQLWAYIRKNNLQDPNNKRKIICNDELRLVFETDCTDMFKMNKLL  238

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E       K T +  +R K        + SDS                 G   
Sbjct  239  AKHILPLEP-----TKQTAENAKRLKVAAVKVDVAGSDSK----------------GDDP  277

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            +  + +S++L  FFGT E  +S+ +V+++MW+YIK N+L+DP N   ++CD KL+ELL  
Sbjct  278  VPIVLISEALASFFGTEEREMSQAEVLRQMWEYIKVNQLEDPLNPAAIVCDAKLQELLGC  337

Query  423  DSFEGFTMTKLLT  385
            +S     + ++L 
Sbjct  338  ESISALGIPEMLA  350


 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 60/107 (56%), Gaps = 7/107 (7%)
 Frame = -2

Query  693  VYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRM  514
            V T S S  +  P  +++R     GG  G      +S  L      G+  L R ++VK++
Sbjct  144  VTTASVSAKESVPTAKKRR-----GGPGGLNKLCGVSPELQTI--VGQPTLPRTEIVKQL  196

Query  513  WKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  373
            W YI++N LQDP+NKR++IC+D+LR + E D  + F M KLL  H +
Sbjct  197  WAYIRKNNLQDPNNKRKIICNDELRLVFETDCTDMFKMNKLLAKHIL  243



>ref|XP_004150254.1| PREDICTED: angiomotin [Cucumis sativus]
 gb|KGN59077.1| hypothetical protein Csa_3G758990 [Cucumis sativus]
Length=342

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 106/197 (54%), Gaps = 25/197 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V +PEL RTE+VK++WAYIR+NNLQDP  K++IIC++ L  +F     DMF+MN+ L
Sbjct  167  QAIVGQPELPRTEIVKQLWAYIRKNNLQDPSNKRKIICNDELRLVFETDCTDMFKMNKLL  226

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E           K    KK R                 E +    +K      
Sbjct  227  AKHIIPLEPT---------KPSSSKKAR----------------VENESAVSVKSAEPSI  261

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
               + +S++L  FFG     + + +V++R+W+YIK N L+DP N   V+CD KLREL   
Sbjct  262  CPSVIISEALANFFGVDGREMLQSEVLRRIWEYIKVNHLEDPLNPMAVLCDAKLRELFGC  321

Query  423  DSFEGFTMTKLLTAHFI  373
            +S     + ++L  H I
Sbjct  322  ESISALGIPEVLGRHHI  338



>ref|XP_008447697.1| PREDICTED: uncharacterized protein LOC103490111 [Cucumis melo]
 ref|XP_008447700.1| PREDICTED: uncharacterized protein LOC103490111 [Cucumis melo]
Length=343

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 106/197 (54%), Gaps = 25/197 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V +PEL RTE+VK++WAYIR+NNLQDP  K++IIC++ L  +F     DMF+MN+ L
Sbjct  168  QAIVGQPELPRTEIVKQLWAYIRKNNLQDPSNKRKIICNDELRLVFETDCTDMFKMNKLL  227

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E           K    KK R                 E +    +K      
Sbjct  228  AKHIIPLEPT---------KPSSSKKAR----------------VENESAVSVKSAEPSI  262

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
               + +S++L  FFG     + + +V++R+W+YIK N L+DP N   V+CD KLREL   
Sbjct  263  CPSVIISEALANFFGVDGREMLQSEVLRRIWEYIKVNHLEDPLNPMAVLCDAKLRELFGC  322

Query  423  DSFEGFTMTKLLTAHFI  373
            +S     + ++L  H I
Sbjct  323  ESISALGIPEVLGRHHI  339



>ref|NP_567661.1| SWIB complex BAF60b domain-containing protein [Arabidopsis thaliana]
 gb|AAL24145.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14205.1| unknown protein [Arabidopsis thaliana]
 gb|AEE84600.1| SWIB complex BAF60b domain-containing protein [Arabidopsis thaliana]
Length=385

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 114/198 (58%), Gaps = 22/198 (11%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            +V+V EP L RTE+V+++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  208  EVVVGEPALPRTEIVRQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  267

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P++              Q KK + EV T +++                    T  
Sbjct  268  AKHILPLDPSK--------DSGQAKKAKTEVETKTETTEPIS--------------STAI  305

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
             + + LS+ L KFFGTGE  ++  ++++R+W+YIK N L+DP N   + CD+KLR+LL  
Sbjct  306  SSTVTLSEPLGKFFGTGETEMADEEIIRRVWEYIKLNNLEDPVNPMAIQCDEKLRDLLGC  365

Query  423  DSFEGFTMTKLLTAHFIK  370
            +S     + ++L  H  K
Sbjct  366  ESISAVGINEMLRRHMYK  383



>gb|AFW65191.1| hypothetical protein ZEAMMB73_350137 [Zea mays]
Length=802

 Score =   146 bits (368),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 114/198 (58%), Gaps = 33/198 (17%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP +ARTE+VK++WAYIR NNLQDP  K++IIC++ L  +F   + DMF+MN+ L
Sbjct  612  QAIVGEPAMARTEIVKQLWAYIRRNNLQDPNNKRKIICNDELRLVFETDSTDMFQMNKLL  671

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHI P+E ++     S P+ ++ K   DE  +  ++D +                    
Sbjct  672  SKHIRPLESKN----DSKPEAKKLKPQGDEPISSVETDVN--------------------  707

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
              P+ +SD+L  FFGTGE  +   + VKR+W +IK N+L+DP N   ++CD KL++L   
Sbjct  708  QLPLMVSDALATFFGTGEREMVHSEAVKRVWDHIKSNDLEDPENPTVILCDSKLKQLFGR  767

Query  423  DSFEGFTMTKLLTAHFIK  370
            +S         LTAH + 
Sbjct  768  ES---------LTAHGVS  776



>gb|AAM61516.1| unknown [Arabidopsis thaliana]
Length=385

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 114/198 (58%), Gaps = 22/198 (11%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            +V+V EP L RTE+V+++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  208  EVVVGEPALPRTEIVRQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  267

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P++              Q KK + EV T +++                    T  
Sbjct  268  AKHILPLDPSK--------DSGQAKKAKTEVETKTETTEPVS--------------STAI  305

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
             + + LS+ L KFFGTGE  ++  ++++R+W+YIK N L+DP N   + CD+KLR+LL  
Sbjct  306  SSTVTLSEPLGKFFGTGETEMADEEIIRRVWEYIKLNNLEDPVNPMAIQCDEKLRDLLGC  365

Query  423  DSFEGFTMTKLLTAHFIK  370
            +S     + ++L  H  K
Sbjct  366  ESISAVGINEMLRRHMYK  383



>gb|EYU27400.1| hypothetical protein MIMGU_mgv1a008947mg [Erythranthe guttata]
Length=357

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/194 (39%), Positives = 113/194 (58%), Gaps = 28/194 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V +P LARTE+VK++WAYIR+NNLQDP  K++IIC++ L  +F     DMF+MN+ L
Sbjct  183  QPIVGQPTLARTEIVKQLWAYIRKNNLQDPNNKRKIICNDELRLVFETDCTDMFKMNKLL  242

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGR-DEVYTDSDSDSDFEPKQEEKRQRGLKGGGTG  607
            +KHI       + L  + PK +  KK + D V + S  D D  P                
Sbjct  243  AKHI-------IALEPTKPKAQSAKKPKVDAVESGSKVD-DPVPH---------------  279

Query  606  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  427
                + +S++L  FFG  E  +S+ +V+++MW+YIK N L+DPSN   +ICD KL+ELL 
Sbjct  280  ----VIISEALASFFGIDEREMSQAEVLRQMWEYIKVNHLEDPSNPTAIICDAKLQELLG  335

Query  426  VDSFEGFTMTKLLT  385
             ++     + ++L 
Sbjct  336  CENISALGIPEMLA  349


 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 55/90 (61%), Gaps = 5/90 (6%)
 Frame = -2

Query  642  KRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRR  463
            K++RG  GG         L   +V     G+  L+R ++VK++W YI++N LQDP+NKR+
Sbjct  163  KKRRGGPGGLNKLCGVSPLLQPIV-----GQPTLARTEIVKQLWAYIRKNNLQDPNNKRK  217

Query  462  VICDDKLRELLEVDSFEGFTMTKLLTAHFI  373
            +IC+D+LR + E D  + F M KLL  H I
Sbjct  218  IICNDELRLVFETDCTDMFKMNKLLAKHII  247



>ref|XP_006413663.1| hypothetical protein EUTSA_v10025487mg [Eutrema salsugineum]
 gb|ESQ55116.1| hypothetical protein EUTSA_v10025487mg [Eutrema salsugineum]
Length=375

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 114/198 (58%), Gaps = 23/198 (12%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            QV+V EP L RTE+V+++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  199  QVVVGEPALPRTEIVRQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  258

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P++    +       + +R K   E  T++ +++                     
Sbjct  259  AKHILPLDPSKDS------GQAKRAKAEVETKTETQTETTEP-----------------V  295

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
             + I LS+ L  FFGTGE  ++  ++++R+W+YIK N L+DP N   + CD+KLRELL  
Sbjct  296  SSAIALSEPLANFFGTGETEMADDEIIRRVWEYIKLNNLEDPVNPMAIQCDEKLRELLGC  355

Query  423  DSFEGFTMTKLLTAHFIK  370
            +S     + ++L  H  K
Sbjct  356  ESISAVGINEMLRRHMYK  373



>gb|EYU27702.1| hypothetical protein MIMGU_mgv1a010230mg [Erythranthe guttata]
Length=318

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 114/197 (58%), Gaps = 27/197 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP L RTE+VK++WAYIR++NLQDP  +++IICD+ L  +F + + DMF+MN+ L
Sbjct  146  QAIVGEPALPRTEIVKQLWAYIRKHNLQDPGNRRKIICDDALRLVFEIDSTDMFKMNKLL  205

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P++    +      ++  + K  DE  T  + DS                     
Sbjct  206  AKHILPLDPTKQS------EQAMKLKNEDE-STKQNQDSS--------------------  238

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            L P+ +S+ L  FFGTGE  + + + ++R+W+Y+K N+L+DP +   + CD KL+ELL  
Sbjct  239  LVPVVISEPLSNFFGTGEKEMLQSEALERVWEYVKVNQLEDPLSSMVIHCDAKLQELLGC  298

Query  423  DSFEGFTMTKLLTAHFI  373
            +S     + ++L  H +
Sbjct  299  ESISALGIQEMLIRHHL  315



>ref|XP_006352354.1| PREDICTED: uncharacterized protein LOC102595561 [Solanum tuberosum]
Length=363

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 114/198 (58%), Gaps = 27/198 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V +P + RTE+VK++W YIR++NLQDP  K++IIC++ L  +F     DMF+MN+ L
Sbjct  192  QAIVGQPTMPRTEIVKQLWVYIRKHNLQDPGNKRKIICNDALRALFETDCTDMFKMNKLL  251

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI  ++          P ++  +  R +V  DS + +  +P                 
Sbjct  252  AKHITALD----------PSKQADQAKRLKVEADSVATNVEQPVSST-------------  288

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
               + +SD+L KFFG+ E  + + D VKR+W+YIK N+L+DP N   ++CD KL+ELL+ 
Sbjct  289  ---VTISDALAKFFGSEEKEILQTDAVKRIWEYIKLNQLEDPVNSSMIVCDAKLQELLQC  345

Query  423  DSFEGFTMTKLLTA-HFI  373
            +S     + ++L   HF+
Sbjct  346  ESVSATELPEMLAGRHFV  363



>ref|XP_004293361.1| PREDICTED: uncharacterized protein LOC101314347 [Fragaria vesca 
subsp. vesca]
Length=367

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 112/200 (56%), Gaps = 28/200 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            QV+V EP L RTE+VK++WAYIR++NLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  192  QVIVGEPALPRTEIVKQLWAYIRKHNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  251

Query  783  SKHIWPIEKEDVTL-VKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTG  607
            SKHI       +TL  K  P + +R K   E  TD+DS                 G  T 
Sbjct  252  SKHI-------ITLGPKKEPPQAKRVKLDVESATDTDSTQ--------------PGSST-  289

Query  606  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  427
                + +S++L KF G     + + + ++ +W+Y+K N L+DP N   ++CD KL ELL 
Sbjct  290  ----VTISEALAKFLGLEGREMLKSEAIRLVWEYVKANNLEDPVNSMVIVCDPKLHELLG  345

Query  426  VDSFEGFTMTKLLT-AHFIK  370
             DS     + ++L   HFIK
Sbjct  346  CDSISALGVQEMLDRYHFIK  365



>emb|CAN72895.1| hypothetical protein VITISV_022315 [Vitis vinifera]
Length=339

 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 110/197 (56%), Gaps = 32/197 (16%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP + RT++VK++WAYIR+NNLQDP  K++IICD+ L  +F   + DMF+MN+ L
Sbjct  171  QAVVGEPTMPRTQIVKQLWAYIRKNNLQDPSNKRKIICDDALRLVFETDSTDMFKMNKLL  230

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E          P     +  R +V  +S ++S                     
Sbjct  231  AKHIIPLE----------PSRESSQAKRLKVDVESATES-----------------SEAS  263

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
             +P+ +SD+L  FFGTGE  + + + ++R+W+YIK     DP N   ++CD KLREL   
Sbjct  264  PSPVMISDALATFFGTGEREMLQEEALRRVWEYIK-----DPLNSMAILCDAKLRELFGC  318

Query  423  DSFEGFTMTKLLTAHFI  373
            +S     ++++L  H +
Sbjct  319  ESISALGVSEMLARHHL  335



>gb|KHG15356.1| Upstream activation factor subunit spp27 [Gossypium arboreum]
Length=373

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/197 (38%), Positives = 109/197 (55%), Gaps = 27/197 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP L RTE+VK++WAYIR+N+LQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  200  QAIVGEPALPRTEIVKQLWAYIRKNSLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  259

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P++           +  Q +KG+ +V               E    G++ G    
Sbjct  260  AKHITPLDPSK--------ESSQTRKGKVKV---------------ESTTEGVEPGPK--  294

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
              P+ +S++L KF GTG   +   +   R+W+YIK N L+DPSN   V+CD  LRELL  
Sbjct  295  --PVIISEALAKFLGTGGREMLATEAENRVWEYIKANHLEDPSNSMVVLCDANLRELLGC  352

Query  423  DSFEGFTMTKLLTAHFI  373
            +S     + + L  H +
Sbjct  353  ESISVVGVRETLLRHHL  369



>gb|KJB68546.1| hypothetical protein B456_010G249800 [Gossypium raimondii]
 gb|KJB68548.1| hypothetical protein B456_010G249800 [Gossypium raimondii]
 gb|KJB68549.1| hypothetical protein B456_010G249800 [Gossypium raimondii]
Length=373

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 109/197 (55%), Gaps = 27/197 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP L RTE+VK++WAYIR+N+LQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  200  QAIVGEPALPRTEIVKQLWAYIRKNSLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  259

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P++           +  Q +KG+ +V               E    G++ G    
Sbjct  260  AKHITPLDPSK--------ESSQTRKGKVKV---------------ESTTEGVEPGPK--  294

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
              P+ LS++L KF GTG   +   +   R+W+YIK N L+DPSN   V+CD  LRELL  
Sbjct  295  --PVILSEALAKFLGTGGREMLATEAENRVWEYIKVNRLEDPSNSMVVLCDANLRELLGC  352

Query  423  DSFEGFTMTKLLTAHFI  373
            +S     + + L  H +
Sbjct  353  ESISVMGVRETLLRHHL  369



>ref|XP_008384272.1| PREDICTED: upstream activation factor subunit spp27-like [Malus 
domestica]
Length=213

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 112/192 (58%), Gaps = 16/192 (8%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP LARTE+VK++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  29   QAVVGEPALARTEIVKQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  88

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHI P+E          P +   +  R +V   S ++ + E + ++ + +   G  T  
Sbjct  89   SKHIIPLE----------PNKESSQAKRLKVEAKSTTE-NTEXQPQQPQPQPQPGSLT--  135

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
               + +S++L KF G G + +   +  + +W+Y+K N L+DP N   ++CD KL ELL  
Sbjct  136  ---VGISEALAKFLGFGGSEMLLSEATRLVWEYVKVNRLEDPLNSTVILCDTKLHELLGC  192

Query  423  DSFEGFTMTKLL  388
            +S     M ++L
Sbjct  193  ESISAAGMHEIL  204



>ref|XP_009770617.1| PREDICTED: uncharacterized protein LOC104221287 [Nicotiana sylvestris]
 ref|XP_009770618.1| PREDICTED: uncharacterized protein LOC104221287 [Nicotiana sylvestris]
Length=371

 Score =   138 bits (348),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/198 (35%), Positives = 116/198 (59%), Gaps = 7/198 (4%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V +P + RTE+VK++W YIR++NLQDP  K++IIC++ L  +F     DMF+MN+ L
Sbjct  180  QAIVGQPAMPRTEIVKQLWVYIRKHNLQDPGNKRKIICNDALRALFETDCTDMFKMNKLL  239

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI  +   D +  +   + ++ K   D +    ++ S     +       +K   +  
Sbjct  240  AKHITAL---DPSKAEQADQAKRLKVEADPMAAKVEAHSVAAKVEVHSTAAKVKQPDSST  296

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            +A   +SD+L KFFG+ E  + + +  KR+W+YIK N+L+DP N   ++CD KL+ELLE 
Sbjct  297  VA---ISDALAKFFGSEEKEIPQTEAFKRIWEYIKLNQLEDPVNSMVIVCDAKLQELLEC  353

Query  423  DSFEGFTMTKLLT-AHFI  373
            +S     + ++L   HF+
Sbjct  354  ESISALEIPQMLARRHFV  371



>ref|XP_011097816.1| PREDICTED: uncharacterized protein LOC105176645 [Sesamum indicum]
Length=347

 Score =   138 bits (347),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 117/198 (59%), Gaps = 29/198 (15%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V +P L RTE+VK++WAYIR+NNLQDP  K++IIC++ L  +F     DMF+MN+ L
Sbjct  174  QTIVGQPTLPRTEIVKQLWAYIRKNNLQDPNNKRKIICNDELRLVFETDCTDMFKMNKLL  233

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI  +E           K+  + K + +V  +S+ ++D +P                 
Sbjct  234  AKHITALEPT---------KQTTQNKKKLKVDVESEKNTD-DP-----------------  266

Query  603  LAPIQ-LSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  427
              PI  +S++L  FFGT E  +S+ +V+++MW+YIK ++L+DP N   ++C+ KL+ELL 
Sbjct  267  -VPIVIISEALANFFGTDEREMSQAEVLRQMWEYIKVHQLEDPLNSTTILCNAKLQELLG  325

Query  426  VDSFEGFTMTKLLTAHFI  373
             +S     + ++L  H +
Sbjct  326  CESISALGIPEMLAQHHL  343



>emb|CDX94096.1| BnaC07g37300D [Brassica napus]
Length=373

 Score =   138 bits (347),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 108/200 (54%), Gaps = 23/200 (12%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            +V+V EP L RTE+V+++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  197  EVVVGEPALPRTEIVRQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  256

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P++    +      K     K   E      S S                     
Sbjct  257  AKHILPLDPSKDSGQAKRAKAEVETKTETETTEPVSSSST--------------------  296

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
               + LS+ L +FFGTGE  +   ++++R+W+YIK N L+DP N   + C++KLR+LL  
Sbjct  297  ---VALSEPLARFFGTGETEMKDEEIIRRVWEYIKLNNLEDPENPMAIQCNEKLRDLLGC  353

Query  423  DSFEGFTMTKLLTAHFIKTA  364
            +S     + ++L  H  K +
Sbjct  354  ESISAVGINEMLRRHMYKPS  373



>ref|XP_009411861.1| PREDICTED: formin-like protein 18 [Musa acuminata subsp. malaccensis]
Length=369

 Score =   138 bits (347),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/198 (37%), Positives = 114/198 (58%), Gaps = 25/198 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V E  ++RT++VK++WAYIR+NNLQDP  K++IIC++ L  +F   + DMF+MN+ L
Sbjct  195  QPIVGEAAMSRTQIVKQLWAYIRQNNLQDPNNKRKIICNDELRRVFETDSTDMFKMNKLL  254

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P++       K T  E ++ K  D   T+       EP  +E             
Sbjct  255  AKHIIPLDDP-----KDTGPEPKKLKAADVAATEVT-----EPASDEY------------  292

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
              P+ +SD+LVKFFG+ E  + + + + R+W YIK N+L+D SN   ++CD KL+EL   
Sbjct  293  --PLFISDALVKFFGSDEREMLQSEALSRIWDYIKANQLEDSSNT-SILCDSKLQELFGC  349

Query  423  DSFEGFTMTKLLTAHFIK  370
            +S     ++ +L  H  K
Sbjct  350  ESLPISGISDMLANHLFK  367



>ref|XP_007146548.1| hypothetical protein PHAVU_006G049900g [Phaseolus vulgaris]
 gb|ESW18542.1| hypothetical protein PHAVU_006G049900g [Phaseolus vulgaris]
Length=336

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 108/198 (55%), Gaps = 31/198 (16%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            QV+V +P L+RTE+VK++WAYIR+NNLQDP  K++IIC+E L  +F     DMF+MN+ L
Sbjct  165  QVIVGQPALSRTEIVKQLWAYIRKNNLQDPSNKRKIICNEELRVVFETDCTDMFKMNKLL  224

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDF-EPKQEEKRQRGLKGGGTG  607
            +KHI P+E     + K                 D DS     EP                
Sbjct  225  AKHIIPLEPTKKPVPKKQ-------------KVDVDSGKRIAEPTPS-------------  258

Query  606  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  427
                + +SD+L  FFG  E  + + +V++R+W+YIK N+L+DP N   ++CD KL+E+  
Sbjct  259  ----VVISDALANFFGVTEREMLQSEVLRRIWEYIKVNQLEDPMNPMAILCDAKLQEIFG  314

Query  426  VDSFEGFTMTKLLTAHFI  373
             +S     + ++L  H I
Sbjct  315  CESISALGIPEVLGGHHI  332


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 62/101 (61%), Gaps = 5/101 (5%)
 Frame = -2

Query  675  SDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKE  496
            +D+  E  Q + ++RG  GG T       +S  L      G+ ALSR ++VK++W YI++
Sbjct  134  NDAPKESTQTKAKRRGGPGGLTKLCG---VSPELQVI--VGQPALSRTEIVKQLWAYIRK  188

Query  495  NELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  373
            N LQDPSNKR++IC+++LR + E D  + F M KLL  H I
Sbjct  189  NNLQDPSNKRKIICNEELRVVFETDCTDMFKMNKLLAKHII  229



>ref|XP_007026264.1| SWIB complex BAF60b domain-containing protein, putative isoform 
1 [Theobroma cacao]
 ref|XP_007026265.1| SWIB complex BAF60b domain-containing protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY28886.1| SWIB complex BAF60b domain-containing protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY28887.1| SWIB complex BAF60b domain-containing protein, putative isoform 
1 [Theobroma cacao]
Length=373

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/197 (38%), Positives = 109/197 (55%), Gaps = 27/197 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP L RTE+VK++WAYIR+N+LQDP  K++IICDE L  +F     DMF+MN+ L
Sbjct  200  QAIVGEPALPRTEIVKQLWAYIRKNSLQDPSNKRKIICDEALRLVFETDCTDMFKMNKLL  259

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E          P +   +  R +V  +S ++S          +RG        
Sbjct  260  AKHITPLE----------PSKESSQAKRVKVDVESTTES---------VERGPN------  294

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
              P+ +S++L KF G G   +   +  +R+W+YI+ N L+DP N   V+CD KLRELL  
Sbjct  295  --PVIISEALAKFLGAGGREMLATEAKRRVWEYIEVNRLEDPLNSTVVLCDAKLRELLGC  352

Query  423  DSFEGFTMTKLLTAHFI  373
            +S     +   L  H +
Sbjct  353  ESIPVMGIDDTLLRHHL  369



>emb|CDP13762.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 113/199 (57%), Gaps = 28/199 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V +  + RTE+VK++WAYIR+NNLQDP  K++IIC++ L  +F     DMF+MN+ L
Sbjct  186  QAVVGQATMPRTEIVKQLWAYIRKNNLQDPNNKRKIICNDELRVVFETDCTDMFKMNKLL  245

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E    T        +  KK + EV + S+S +                     
Sbjct  246  AKHIIPLEPTKQT-------AQNAKKAKIEVESGSESANT--------------------  278

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            +  + +S++L  FFGT E  +S+ +V++++W+YIK N+L+DP N   ++CD KL+EL   
Sbjct  279  VPVVVISEALANFFGTDEREMSQAEVLRQVWEYIKVNQLEDPLNSMAIMCDAKLQELFGC  338

Query  423  DSFEGFTMTKLLT-AHFIK  370
             S     + ++L   H +K
Sbjct  339  QSISALGIPEMLARLHLLK  357



>ref|XP_008358815.1| PREDICTED: uncharacterized protein LOC103422526 [Malus domestica]
Length=360

 Score =   135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 109/192 (57%), Gaps = 17/192 (9%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP LARTE+VK++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  177  QAVVGEPALARTEIVKQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  236

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHI P+E          P +   +  R +V   S +++       E + +       G 
Sbjct  237  SKHIIPLE----------PNKESSQAKRLKVEAKSTTENT------EXQPQPQPQPQPGS  280

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            L  + +S++L KF G G + +   +  + +W+Y+K N L+DP N   ++CD KL ELL  
Sbjct  281  LT-VGISEALAKFLGFGGSEMLLSEATRLVWEYVKVNRLEDPLNSTVILCDTKLHELLGC  339

Query  423  DSFEGFTMTKLL  388
            +S     M ++L
Sbjct  340  ESISAAGMHEIL  351



>ref|XP_003600192.1| Upstream activation factor subunit UAF30 [Medicago truncatula]
Length=350

 Score =   135 bits (339),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 108/197 (55%), Gaps = 21/197 (11%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            QV+V +P + RTE+VK++WAYI++NNLQDP  K++IIC++ L  +F     DMF+MN+ L
Sbjct  171  QVIVGQPAMPRTEIVKQLWAYIKKNNLQDPSNKRKIICNDELRVVFETDCTDMFKMNKLL  230

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI  +E     L    P  +                     KQ+ + + G +      
Sbjct  231  AKHIIALEPTSKCLGYEKPAPK---------------------KQKVEVEVGTRSAEPAP  269

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
               + +SDSL  FFG     + + +V++R+W+YIK N+L+DP N   ++CD KL+E+   
Sbjct  270  TPSVIISDSLANFFGVTGREMLQTEVLRRIWEYIKVNQLEDPVNPMAIMCDAKLQEIFGC  329

Query  423  DSFEGFTMTKLLTAHFI  373
            +S     + ++L  H I
Sbjct  330  ESISALGIPEVLGRHHI  346


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 59/100 (59%), Gaps = 2/100 (2%)
 Frame = -2

Query  672  DSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKEN  493
             ++  PK+  + +   +GG  G      +S  L      G+ A+ R ++VK++W YIK+N
Sbjct  138  SANVLPKESAQPKPKRRGGPGGLNKLCGVSPELQVI--VGQPAMPRTEIVKQLWAYIKKN  195

Query  492  ELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  373
             LQDPSNKR++IC+D+LR + E D  + F M KLL  H I
Sbjct  196  NLQDPSNKRKIICNDELRVVFETDCTDMFKMNKLLAKHII  235



>ref|XP_004250267.1| PREDICTED: uncharacterized protein LOC101256830 [Solanum lycopersicum]
Length=359

 Score =   135 bits (340),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 69/198 (35%), Positives = 111/198 (56%), Gaps = 27/198 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V +P + RTE+VK++W YIR++NLQDP  K++IIC++ L  +F     DMF+MN+ L
Sbjct  188  QAIVGQPAMPRTEIVKQLWVYIRKHNLQDPGNKRKIICNDALRALFETDCTDMFKMNKLL  247

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI  ++          P ++  +  R +V  DS +    +P                 
Sbjct  248  AKHITALD----------PSKQVDQAKRLKVEADSVATKVEQPVSST-------------  284

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
               + +SD+L KFF + E  + + D VKR+W YIK N+L+DP N   ++CD KL+ELL+ 
Sbjct  285  ---VTISDALAKFFESEEKEILQTDAVKRIWDYIKLNQLEDPVNSTMIVCDPKLQELLQC  341

Query  423  DSFEGFTMTKLLTA-HFI  373
            +S     + ++L   HF+
Sbjct  342  ESVSATELPEMLAGRHFV  359



>ref|XP_009623786.1| PREDICTED: protein TRI1 [Nicotiana tomentosiformis]
 ref|XP_009623787.1| PREDICTED: protein TRI1 [Nicotiana tomentosiformis]
Length=371

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 115/202 (57%), Gaps = 14/202 (7%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V +P + RTE+VK++W YIR++NLQDP  K++IIC++ L  +F     DMF+MN+ L
Sbjct  179  QAIVGQPAMPRTEIVKQLWVYIRKHNLQDPGNKRKIICNDALRALFETDCTDMFKMNKLL  238

Query  783  SKHIWPI----EKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGG  616
            +KHI  +    + E     K    E +    + E ++ +         + E      K  
Sbjct  239  AKHITALDPSKQAEQADQAKRLKVEAEPMAAKVEAHSVA--------AKVETHSMAAKVE  290

Query  615  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  436
               F + + +SD+L KFFG+ E  + + + +KR+W+YIK N+L+DP N   ++CD KL+E
Sbjct  291  QPVF-STVTISDALAKFFGSEEKEIPQTEALKRIWEYIKLNQLEDPVNSMVIMCDAKLQE  349

Query  435  LLEVDSFEGFTMTKLLT-AHFI  373
            LLE +S     + ++L   HF+
Sbjct  350  LLECESISASEIPQMLARRHFV  371



>ref|XP_008366453.1| PREDICTED: uncharacterized protein LOC103430100 [Malus domestica]
Length=246

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 105/197 (53%), Gaps = 26/197 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V  P L RTE+VK++WAYIR+NNLQDP  K++IIC++ L  +F     DMF+MN+ L
Sbjct  73   QAIVGHPTLPRTEIVKQLWAYIRKNNLQDPGNKRKIICNDELRVVFETDCTDMFKMNKLL  132

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E        + PK+ +  K   E  T S   S                     
Sbjct  133  AKHIIPLEPSK----PAVPKKPKVPKNAVESATKSTEPS---------------------  167

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
               + +S++L  FFG G   + + +VV R+W+YIK + L+DP N+  + CD KL+E+   
Sbjct  168  -PSLIISEALANFFGAGVREMIQSEVVMRIWEYIKVHHLEDPQNQMAIHCDAKLQEIFGC  226

Query  423  DSFEGFTMTKLLTAHFI  373
            ++     +  +L  H I
Sbjct  227  ETINALEIPDILEXHHI  243



>gb|EPS66203.1| hypothetical protein M569_08575, partial [Genlisea aurea]
Length=197

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 105/195 (54%), Gaps = 25/195 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V  P L RTE+VK++WAYIR+NNLQDP  K++IIC++ L  +F     DMF+MN+ L
Sbjct  28   QAIVGHPTLPRTEIVKQLWAYIRKNNLQDPNNKRKIICNDELRSVFETDCTDMFKMNKLL  87

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+                           S+ D+  +PK EE  +          
Sbjct  88   AKHILPLGSAH----------------------SSNDDAKKKPKVEEASESSKTDDRVTV  125

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
               + +S++L  FF   E  +S  +V+++MW+YI  ++L+DP N   + CD KL++LL  
Sbjct  126  ---VIISEALASFFECEEKEMSEAEVLRQMWEYINVHQLEDPMNPTTISCDAKLKDLLGC  182

Query  423  DSFEGFTMTKLLTAH  379
            ++     + ++L+ H
Sbjct  183  ETVSALGIPEMLSKH  197


 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -2

Query  558  TGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  379
             G   L R ++VK++W YI++N LQDP+NKR++IC+D+LR + E D  + F M KLL  H
Sbjct  31   VGHPTLPRTEIVKQLWAYIRKNNLQDPNNKRKIICNDELRSVFETDCTDMFKMNKLLAKH  90

Query  378  FI  373
             +
Sbjct  91   IL  92



>ref|XP_009361076.1| PREDICTED: upstream activation factor subunit spp27-like, partial 
[Pyrus x bretschneideri]
Length=271

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/197 (34%), Positives = 104/197 (53%), Gaps = 26/197 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V  P L RTE+VK++WAYIR+NNLQDP  K++IIC++ L  +F     DMF+MN+ L
Sbjct  98   QAIVGHPTLPRTEIVKQLWAYIRKNNLQDPGNKRKIICNDELRVVFETDCTDMFKMNKLL  157

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI       +TL  S P   ++ K        +   ++  P                 
Sbjct  158  AKHI-------ITLEPSKPAVPKKPKVPKNAMESATKSTEPSPS----------------  194

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
               + +S++L  FFG G   + + DV+ R+W+YIK + L+DP N+  + CD KL+E+   
Sbjct  195  ---LIISEALANFFGAGVREMIQSDVIMRIWEYIKAHHLEDPQNQMAIHCDAKLQEIFGC  251

Query  423  DSFEGFTMTKLLTAHFI  373
            ++     +  +L  H I
Sbjct  252  ETINALEIPDILERHHI  268



>ref|XP_009357601.1| PREDICTED: uncharacterized protein LOC103948320 [Pyrus x bretschneideri]
Length=294

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/192 (37%), Positives = 107/192 (56%), Gaps = 17/192 (9%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP LARTE+VK++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  111  QAVVGEPALARTEIVKQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  170

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHI P+           P +   +  R +V   S ++S       E + +       G 
Sbjct  171  SKHIIPL----------GPNKESSQAKRLKVEAKSTTEST------EPQPQPQPQPQLGS  214

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            L  + +S++L KF G G   +   +  + +W+Y+K N L+DP N   ++CD KL ELL  
Sbjct  215  LT-VGISEALAKFLGFGGREMLPSEATRLVWEYVKVNRLEDPLNSTVILCDAKLHELLGC  273

Query  423  DSFEGFTMTKLL  388
            +S     + ++L
Sbjct  274  ESISAAGLHEML  285



>ref|XP_003532156.1| PREDICTED: uncharacterized protein LOC100801960 [Glycine max]
 gb|KHM99505.1| Upstream activation factor subunit spp27 [Glycine soja]
Length=330

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 109/198 (55%), Gaps = 31/198 (16%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            QV+V +P L+RTE+VK++WAYIR+NNLQDP  K++IIC++ L  +F     DMF+MN+ L
Sbjct  159  QVIVGQPALSRTEIVKQLWAYIRKNNLQDPSNKRKIICNDELRVVFETDCTDMFKMNKLL  218

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDS-DFEPKQEEKRQRGLKGGGTG  607
            SKHI P+E     + K                 D +S +   EP                
Sbjct  219  SKHIIPLEPTKKPVPKKQ-------------KVDVESGTRSAEPTPS-------------  252

Query  606  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  427
                + +SD+L  FFG     + + +V++R+W+YIK N+L+DP+N   ++CD KL+E+  
Sbjct  253  ----VIISDALANFFGITGREMLQSEVLRRIWEYIKVNQLEDPANPMAIVCDGKLQEIFG  308

Query  426  VDSFEGFTMTKLLTAHFI  373
             +S     + ++L  H I
Sbjct  309  CESISALGIPEVLGRHHI  326


 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 59/95 (62%), Gaps = 2/95 (2%)
 Frame = -2

Query  657  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  478
            PK+  + +   +GG  G      +S  L      G+ ALSR ++VK++W YI++N LQDP
Sbjct  131  PKESTQTKVKRRGGPGGLTKICGVSPELQVI--VGQPALSRTEIVKQLWAYIRKNNLQDP  188

Query  477  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  373
            SNKR++IC+D+LR + E D  + F M KLL+ H I
Sbjct  189  SNKRKIICNDELRVVFETDCTDMFKMNKLLSKHII  223



>gb|AES70443.2| SWIB/MDM2 domain protein [Medicago truncatula]
Length=344

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 108/197 (55%), Gaps = 27/197 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            QV+V +P + RTE+VK++WAYI++NNLQDP  K++IIC++ L  +F     DMF+MN+ L
Sbjct  171  QVIVGQPAMPRTEIVKQLWAYIKKNNLQDPSNKRKIICNDELRVVFETDCTDMFKMNKLL  230

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI  +E       K  PK                       KQ+ + + G +      
Sbjct  231  AKHIIALEPTK----KPAPK-----------------------KQKVEVEVGTRSAEPAP  263

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
               + +SDSL  FFG     + + +V++R+W+YIK N+L+DP N   ++CD KL+E+   
Sbjct  264  TPSVIISDSLANFFGVTGREMLQTEVLRRIWEYIKVNQLEDPVNPMAIMCDAKLQEIFGC  323

Query  423  DSFEGFTMTKLLTAHFI  373
            +S     + ++L  H I
Sbjct  324  ESISALGIPEVLGRHHI  340



>ref|XP_007154015.1| hypothetical protein PHAVU_003G083900g [Phaseolus vulgaris]
 gb|ESW26009.1| hypothetical protein PHAVU_003G083900g [Phaseolus vulgaris]
Length=338

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 108/197 (55%), Gaps = 28/197 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP L RTE+V+++WAYI++NNLQDP  K++IICD+ L  +F     DMF+MNQ L
Sbjct  156  QAVVGEPALPRTEIVRQLWAYIKKNNLQDPGNKRKIICDDALRLVFETDCTDMFKMNQLL  215

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+            KE Q K+ + +V T  +S    EP                 
Sbjct  216  AKHIIPLGPT---------KESQAKRVKVDVETKIESA---EPASST-------------  250

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
               + +S++L KF GT    + + +  + +W+YIK + L+DP N   ++CD KL+ELL  
Sbjct  251  ---VVISEALAKFLGTEGKEMQQSEANRLVWEYIKHHHLEDPLNAMVILCDAKLQELLGC  307

Query  423  DSFEGFTMTKLLTAHFI  373
            +S     + ++L  H +
Sbjct  308  ESISALGIPEMLARHHL  324



>ref|XP_009335440.1| PREDICTED: uncharacterized protein LOC103928154 [Pyrus x bretschneideri]
Length=317

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 105/197 (53%), Gaps = 26/197 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V  P L RTE+VK++WAYIR+NNLQDP  K+RIIC++ L  +F     DMF+MN+ L
Sbjct  144  QAIVGHPTLPRTEIVKQLWAYIRKNNLQDPGNKRRIICNDELRVVFETDCTDMFKMNKLL  203

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E     +    P++ +  K   E  T S   S                     
Sbjct  204  AKHIIPLEPSKPVV----PRKPKVPKNAVESATKSTEPSPS-------------------  240

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
               + +S++L  FFG G   + + +VV R+W+YIK + L+DP N+  + CD KL+E+   
Sbjct  241  ---LIISEALANFFGVGVREMIQSEVVTRIWEYIKVHHLEDPQNQMAIHCDAKLQEIFGC  297

Query  423  DSFEGFTMTKLLTAHFI  373
            ++     +  +L  H I
Sbjct  298  ETINALEIPDILERHHI  314



>ref|XP_009339387.1| PREDICTED: uncharacterized protein LOC103931595 [Pyrus x bretschneideri]
 ref|XP_009339388.1| PREDICTED: uncharacterized protein LOC103931595 [Pyrus x bretschneideri]
Length=335

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 105/197 (53%), Gaps = 26/197 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V  P L RTE+VK++WAYIR+NNLQDP  K+RIIC++ L  +F     DMF+MN+ L
Sbjct  162  QAIVGHPTLPRTEIVKQLWAYIRKNNLQDPGNKRRIICNDELRVVFETDCTDMFKMNKLL  221

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E     +    P++ +  K   E  T S   S                     
Sbjct  222  AKHIIPLEPSKPVV----PRKPKVPKNAVESATKSTEPSPS-------------------  258

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
               + +S++L  FFG G   + + +VV R+W+YIK + L+DP N+  + CD KL+E+   
Sbjct  259  ---LIISEALANFFGVGVREMIQSEVVTRIWEYIKVHHLEDPQNQMAIHCDAKLQEIFGC  315

Query  423  DSFEGFTMTKLLTAHFI  373
            ++     +  +L  H I
Sbjct  316  ETINALEIPDILERHHI  332



>ref|XP_002275854.1| PREDICTED: uncharacterized protein LOC100264067 [Vitis vinifera]
 emb|CBI26717.3| unnamed protein product [Vitis vinifera]
Length=331

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/197 (34%), Positives = 108/197 (55%), Gaps = 27/197 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V +P L RTE+VK++WAYIR NNLQDP  K++IIC++ L  +F   + DMF+MN+ L
Sbjct  158  QTIVGQPALPRTEIVKQLWAYIRRNNLQDPSNKRKIICNDELRLVFETDSTDMFKMNKLL  217

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E       K + ++ ++ K      T S     +                   
Sbjct  218  AKHIIPLEP-----TKQSGEQSKKLKVDAGAGTKSSESGPY-------------------  253

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
               + +S++L  FFGT    + + +V++R+W+YIK N L+DP N   ++CD KL+E+   
Sbjct  254  ---VVISEALANFFGTSGREMLQSEVLRRVWEYIKVNHLEDPLNSMVILCDAKLQEIFGC  310

Query  423  DSFEGFTMTKLLTAHFI  373
            +S     + ++L  H +
Sbjct  311  ESISALGIPEILMRHHL  327


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 58/96 (60%), Gaps = 3/96 (3%)
 Frame = -2

Query  657  PKQEEKRQRGLKGGGTGFLAPI-QLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  481
            P QE  R    + GG G L  +  +S  L      G+ AL R ++VK++W YI+ N LQD
Sbjct  129  PPQESARAGTKRRGGPGGLNKVCGVSPELQTI--VGQPALPRTEIVKQLWAYIRRNNLQD  186

Query  480  PSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  373
            PSNKR++IC+D+LR + E DS + F M KLL  H I
Sbjct  187  PSNKRKIICNDELRLVFETDSTDMFKMNKLLAKHII  222



>ref|XP_009391890.1| PREDICTED: uncharacterized protein LOC103977949 [Musa acuminata 
subsp. malaccensis]
Length=365

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 112/199 (56%), Gaps = 27/199 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V E  ++RT++VK++WAYIR+NNLQDP  K++IIC++ L  +F   + DMF+MN+ L
Sbjct  191  QPIVGEAAMSRTQIVKQLWAYIRKNNLQDPNNKRKIICNDELRRVFETDSTDMFKMNKLL  250

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTD-SDSDSDFEPKQEEKRQRGLKGGGTG  607
            SKHI P++       K T  E ++ K  D   T+ +  DSD                   
Sbjct  251  SKHIIPLDYP-----KDTGAESKKLKAADVSATEITKPDSDEY-----------------  288

Query  606  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  427
               P+ +SDSL KFFG  E  + +   + R+W YIK N+L+D +N   ++CD KL+EL  
Sbjct  289  ---PMVISDSLAKFFGREEREILKSVALSRVWDYIKANQLEDSANS-SILCDPKLQELFG  344

Query  426  VDSFEGFTMTKLLTAHFIK  370
             +S     ++ LL  H +K
Sbjct  345  CESLPVSGISDLLANHLLK  363



>ref|XP_009348467.1| PREDICTED: upstream activation factor subunit spp27-like [Pyrus 
x bretschneideri]
Length=310

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/197 (34%), Positives = 104/197 (53%), Gaps = 26/197 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V  P L RTE+VK++WAYIR+NNLQDP  K++IIC++ L  +F     DMF+MN+ L
Sbjct  137  QAIVGHPTLPRTEIVKQLWAYIRKNNLQDPGNKRKIICNDELRVVFETDCTDMFKMNKLL  196

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI       +TL  S P   ++ K        +   ++  P                 
Sbjct  197  AKHI-------ITLEPSKPAVPKKPKVPKNAMESATKSTEPSPS----------------  233

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
               + +S++L  FFG G   + + DV+ R+W+YIK + L+DP N+  + CD KL+E+   
Sbjct  234  ---LIISEALANFFGAGVREMIQSDVIMRIWEYIKAHHLEDPQNQMAIHCDAKLQEIFGC  290

Query  423  DSFEGFTMTKLLTAHFI  373
            ++     +  +L  H I
Sbjct  291  ETINALEIPDILERHHI  307



>ref|XP_008385810.1| PREDICTED: formin-like protein 13, partial [Malus domestica]
Length=319

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 104/197 (53%), Gaps = 26/197 (13%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V  P L RTE+VK++WAYIR+NNLQDP  K+RIIC++ L  +F     DMF+MN+ L
Sbjct  146  QAIVGHPTLPRTEIVKQLWAYIRKNNLQDPGNKRRIICNDELRVVFETDCTDMFKMNKLL  205

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+E        + PK+ +  K   E  T S   S                     
Sbjct  206  AKHIIPLEPSK----PAVPKKPKVPKNAVESATKSTEPSPS-------------------  242

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
               + +S++L  FFG G   + + +V+ R+W+YI  + L+DP N+  + CD KL+E+   
Sbjct  243  ---LIISEALANFFGVGVREMIQSEVLMRIWEYINVHHLEDPQNQMAIHCDAKLQEIFGC  299

Query  423  DSFEGFTMTKLLTAHFI  373
            ++     +  +L  H I
Sbjct  300  ETINALEIPDILERHHI  316



>ref|XP_008355916.1| PREDICTED: uncharacterized protein LOC103419593 [Malus domestica]
Length=366

 Score =   132 bits (332),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 108/192 (56%), Gaps = 15/192 (8%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            + +V EP L RTE+VK++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  181  EAVVGEPALPRTEIVKQLWAYIRKNNLQDPTNKRKIICDDALRVVFETDCTDMFKMNKLL  240

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHI P+E          P +   +  R +V   S ++S     Q + + +   G  T  
Sbjct  241  SKHIIPLE----------PNKEPSQAKRLKVEAKSTTESTQPQPQPQPQAQAQPGSPT--  288

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
               + +S++L  F G G   +   +  + +W+Y+K N L+DPSN   ++CD KL +LL  
Sbjct  289  ---VGISEALANFLGFGGREMLLSEARRLLWEYVKVNRLEDPSNSTVILCDAKLHKLLGC  345

Query  423  DSFEGFTMTKLL  388
            +S     + ++L
Sbjct  346  ESISALGIHEML  357



>ref|XP_008371009.1| PREDICTED: uncharacterized protein LOC103434436 [Malus domestica]
Length=366

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 107/192 (56%), Gaps = 15/192 (8%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            + +V EP L RTE+VK++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  181  EAVVGEPALPRTEIVKQLWAYIRKNNLQDPTNKRKIICDDALRVVFETDCTDMFKMNKLL  240

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            SKHI P+E          P +   +  R +V   S ++S     Q + + +   G  T  
Sbjct  241  SKHIIPLE----------PNKEPSQAKRLKVEAKSTTESTQPQPQPQPQAQAQPGSPT--  288

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
               + +S++L  F G G   +   +  + +W+Y+K N L+DPSN   ++CD KL  LL  
Sbjct  289  ---VGISEALANFLGFGGREMLLSEARRLLWEYVKVNRLEDPSNSTVILCDAKLHXLLGC  345

Query  423  DSFEGFTMTKLL  388
            +S     + ++L
Sbjct  346  ESISALGIHEML  357



>gb|KJB69188.1| hypothetical protein B456_011G009800 [Gossypium raimondii]
Length=357

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 105/197 (53%), Gaps = 27/197 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            QV+V EP L RTE+VK++WAYIR+N+LQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  184  QVIVGEPALPRTEIVKQLWAYIRKNSLQDPSNKRKIICDDALRIVFETDCTDMFKMNKLL  243

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI   E          P +   +  R        + +D EPK E              
Sbjct  244  AKHITAFE----------PSKESSQSKR--------AQADAEPKTESVELSD--------  277

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
             +P+ +S++L +F       +   +  +R+W+YIK N L+DPSN   V+CD KLRELL  
Sbjct  278  -SPVVISEALAEFLDAEGREMQATEAERRVWEYIKLNHLEDPSNSMVVLCDAKLRELLGC  336

Query  423  DSFEGFTMTKLLTAHFI  373
            +S     +   L  H +
Sbjct  337  ESISVMGIHDSLQCHHL  353



>ref|XP_007047161.1| SWIB complex BAF60b domain-containing protein, putative isoform 
2, partial [Theobroma cacao]
 gb|EOX91318.1| SWIB complex BAF60b domain-containing protein, putative isoform 
2, partial [Theobroma cacao]
Length=241

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 81/108 (75%), Gaps = 5/108 (5%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q LV  P LARTEVVK+IWAYIRE NLQDP  KK IICDE LL +F V++IDMF+MN+ L
Sbjct  139  QELVGVPALARTEVVKQIWAYIREKNLQDPLNKKNIICDEPLLALFGVRSIDMFQMNKAL  198

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEK  640
            SKHIWP++ ++V  VKST +E+QRK  R+E   D D     EPK++EK
Sbjct  199  SKHIWPLDSDEVVSVKSTEREKQRKHVREEGRDDPD-----EPKRKEK  241


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = -2

Query  627  LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDD  448
            +K  G GF     LS  L +  G    AL+R +VVK++W YI+E  LQDP NK+ +ICD+
Sbjct  121  VKRRGGGFNKVCSLSPQLQELVGVP--ALARTEVVKQIWAYIREKNLQDPLNKKNIICDE  178

Query  447  KLRELLEVDSFEGFTMTKLLTAHF  376
             L  L  V S + F M K L+ H 
Sbjct  179  PLLALFGVRSIDMFQMNKALSKHI  202



>gb|KDO35066.1| hypothetical protein SPRG_01130 [Saprolegnia parasitica CBS 223.65]
Length=355

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 117/229 (51%), Gaps = 47/229 (21%)
 Frame = -2

Query  957  LVQEPELA---------RTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDM  805
            +V  PELA         R ++VK++W YIR++ LQDP  K+ I+ D+TL G+F+  +  M
Sbjct  109  MVLSPELAQVLGVDKSSRPQLVKKMWDYIRDHGLQDPSDKRTILLDDTLKGVFKRDSFTM  168

Query  804  FRMNQTLSKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEK-RQRG  628
            F MN+ L +H+               KE +   G D++  D +S  + E K  EK R++ 
Sbjct  169  FSMNKFLKRHV--------------KKESEVVNGWDDIIRDGESSEEDEAKTAEKERKKA  214

Query  627  LKGG---------------------GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMW  511
            +K                        TG  AP++LS  L    G  E+ LSR  VVKR+W
Sbjct  215  VKAARKSAAAGKEKGEKPKRAAPAPNTGINAPLELSKELGAILG--ESVLSRPQVVKRLW  272

Query  510  KYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTA  364
             YIKENELQ+P NK+ +IC++ L  L    S   F+M KLL  HF+  A
Sbjct  273  AYIKENELQNPENKQEIICNELLTSLFGEPSVTMFSMNKLLKPHFLGKA  321



>ref|XP_003549577.1| PREDICTED: uncharacterized protein LOC100804281 [Glycine max]
Length=329

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 110/197 (56%), Gaps = 28/197 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP + RTE+V+++WAYI++NNLQDP  K++IICD+ L  +F     DMF+MNQ L
Sbjct  154  QAVVGEPAMPRTEIVRQLWAYIKKNNLQDPGNKRKIICDDALRLVFETDCTDMFKMNQLL  213

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P+            KE Q K  R +V T+  ++S  EP                 
Sbjct  214  AKHIIPLGPT---------KESQAK--RVKVDTEIKTESA-EPAPST-------------  248

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
               + +S++L KF GT    + + + ++ +W+YIK + L+DP N   ++CD KL+ELL  
Sbjct  249  ---VAISEALAKFLGTEGREMQQSEAIRLVWEYIKLHHLEDPLNSMVILCDAKLQELLGC  305

Query  423  DSFEGFTMTKLLTAHFI  373
            +S     + ++L  H +
Sbjct  306  ESISALGIPEMLARHHL  322



>ref|XP_010090987.1| Upstream activation factor subunit spp27 [Morus notabilis]
 gb|EXB41572.1| Upstream activation factor subunit spp27 [Morus notabilis]
Length=466

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/196 (37%), Positives = 104/196 (53%), Gaps = 27/196 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP L RTE+VK++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  199  QAIVGEPALPRTEIVKQLWAYIRKNNLQDPSNKRKIICDDALRLVFETDCTDMFKMNKLL  258

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI  +E          P +   +  R +V        D EP              +  
Sbjct  259  AKHIIALE----------PTKGSSQAKRVKV--------DVEPTPVSNDNSSSSVVISEE  300

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            LA         KF GTGE  + R + ++R+W+YIK N L+DP N   ++CD  LRELL  
Sbjct  301  LA---------KFLGTGEKEMIRSEALRRVWEYIKVNHLEDPLNSMVILCDANLRELLGC  351

Query  423  DSFEGFTMTKLLTAHF  376
            +S     +++++   F
Sbjct  352  ESISALGISEMVQETF  367


 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 63/111 (57%), Gaps = 3/111 (3%)
 Frame = -2

Query  702  RDEVYTDSDSDSDFE-PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDV  526
            + E+++ + S +  + PK+        +GG  G      +S  L      GE AL R ++
Sbjct  155  KSEIFSHNASSATSDIPKESTPVGAKRRGGPGGLNKVCGVSPELQAI--VGEPALPRTEI  212

Query  525  VKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  373
            VK++W YI++N LQDPSNKR++ICDD LR + E D  + F M KLL  H I
Sbjct  213  VKQLWAYIRKNNLQDPSNKRKIICDDALRLVFETDCTDMFKMNKLLAKHII  263



>emb|CDX79150.1| BnaA01g12170D [Brassica napus]
Length=350

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/200 (38%), Positives = 115/200 (58%), Gaps = 28/200 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            QV+V EP L RTE+V+++WAYIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  179  QVVVGEPALPRTEIVRQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  238

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P++              Q K+ + EV T S++++  EP +               
Sbjct  239  AKHILPLDPSK--------DSSQVKRAKAEVETKSENETT-EPVRS--------------  275

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
                 LS+ L KFFGTGE  +   ++++R+W+YIK N L+D  N   + CD+KLR+LL  
Sbjct  276  -----LSEPLAKFFGTGETEIIEEEIIRRVWEYIKLNNLEDQVNPMAIQCDEKLRDLLGC  330

Query  423  DSFEGFTMTKLLTAHFIKTA  364
            +S     + ++L  H  K +
Sbjct  331  ESISAVGVNEMLRRHMYKPS  350



>gb|ABK94708.1| unknown [Populus trichocarpa]
Length=385

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 111/197 (56%), Gaps = 27/197 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP L RTE+VK++W YIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  212  QAIVGEPALPRTEIVKQLWQYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  271

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P++         + +  Q K+ + +V T ++   + EP             G   
Sbjct  272  AKHIIPLQ--------PSKESSQAKRAKVDVETPTE---NTEP-------------GASL  307

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            +    +S+ L +F GT E  +++ +  +R+W+YIK  +L+DP N   + CD KLR+LL  
Sbjct  308  VG---ISERLAEFLGTTEREMTQTEASRRVWEYIKLKQLEDPLNSMAIQCDTKLRDLLGC  364

Query  423  DSFEGFTMTKLLTAHFI  373
            +S     + ++L  H +
Sbjct  365  ESISAVGVGEVLARHHL  381



>ref|XP_002308782.2| hypothetical protein POPTR_0006s01230g [Populus trichocarpa]
 gb|EEE92305.2| hypothetical protein POPTR_0006s01230g [Populus trichocarpa]
Length=385

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 110/197 (56%), Gaps = 27/197 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP L RTE+VK++W YIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  212  QAIVGEPALPRTEIVKQLWQYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  271

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P++           +  Q K+ + +V T ++   + EP             G   
Sbjct  272  AKHIIPLQPSK--------ESSQTKRAKVDVETPTE---NTEP-------------GASL  307

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            +    +S+ L +F GT E  +++ +  +R+W+YIK  +L+DP N   + CD KLR+LL  
Sbjct  308  VG---ISERLAEFLGTTEREMTQTEASRRVWEYIKLKQLEDPLNSMAIQCDTKLRDLLGC  364

Query  423  DSFEGFTMTKLLTAHFI  373
            +S     + ++L  H +
Sbjct  365  ESISAVGVGEVLARHHL  381



>ref|XP_008604916.1| hypothetical protein SDRG_01178 [Saprolegnia diclina VS20]
 gb|EQC41202.1| hypothetical protein SDRG_01178 [Saprolegnia diclina VS20]
Length=356

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 114/229 (50%), Gaps = 47/229 (21%)
 Frame = -2

Query  957  LVQEPELA---------RTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDM  805
            +V  PELA         R ++VK++W YIR++ LQDP  K+ I+ D+TL G+F+  +  M
Sbjct  110  MVLSPELAQVLGVEKSSRPQLVKKMWDYIRDHGLQDPSDKRTILLDDTLKGVFKRDSFTM  169

Query  804  FRMNQTLSKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKR----  637
            F MN+ L +H+               KE +   G D++  D +S  + E K  EK     
Sbjct  170  FSMNKFLKRHV--------------KKESEVVNGWDDIIRDGESSEEDEAKTAEKERKKA  215

Query  636  ------------------QRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMW  511
                              +R      TG  AP++LS  L    G  E+ LSR  VVKR+W
Sbjct  216  VKAARKVAAAGKEKGEKPKRAAPAPNTGINAPLELSKELGAILG--ESVLSRPQVVKRLW  273

Query  510  KYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTA  364
             YIKENELQ+P NK+ ++C++ L  L    S   F+M KLL  HF+  A
Sbjct  274  AYIKENELQNPENKQEIVCNELLTSLFGEPSVTMFSMNKLLKPHFLGKA  322



>ref|XP_011008625.1| PREDICTED: uncharacterized protein LOC105113949 isoform X2 [Populus 
euphratica]
Length=387

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 111/197 (56%), Gaps = 27/197 (14%)
 Frame = -2

Query  963  QVLVQEPELARTEVVKRIWAYIRENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTL  784
            Q +V EP L RTE+VK++W YIR+NNLQDP  K++IICD+ L  +F     DMF+MN+ L
Sbjct  214  QAIVGEPALPRTEIVKQLWQYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLL  273

Query  783  SKHIWPIEKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  604
            +KHI P++         + +  Q K+ + +V T ++   + EP             G   
Sbjct  274  AKHIIPLQ--------PSKESSQAKRAKVDVETPTE---NTEP-------------GASL  309

Query  603  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  424
            +    +S+ L +F GT E  +++ +  +R+W+YIK  +L+DP N   + CD KLR+LL  
Sbjct  310  VV---ISERLAEFLGTTEREMTQTEASRRVWEYIKLKQLEDPLNSMAIQCDTKLRDLLGC  366

Query  423  DSFEGFTMTKLLTAHFI  373
            +S     + ++L  H +
Sbjct  367  ESISAVGVGEVLARHHL  383



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2350593015464