BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3823

Length=690
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011072734.1|  PREDICTED: uncharacterized protein At1g04910...    274   2e-86   Sesamum indicum [beniseed]
emb|CDO97753.1|  unnamed protein product                                262   7e-82   Coffea canephora [robusta coffee]
ref|XP_009587135.1|  PREDICTED: uncharacterized protein At1g04910...    261   2e-81   
ref|XP_009765354.1|  PREDICTED: uncharacterized protein At1g04910...    257   4e-80   Nicotiana sylvestris
gb|EYU21223.1|  hypothetical protein MIMGU_mgv1a007275mg                253   2e-78   Erythranthe guttata [common monkey flower]
ref|XP_004241868.1|  PREDICTED: uncharacterized protein At1g04910...    251   9e-78   Solanum lycopersicum
ref|XP_006357438.1|  PREDICTED: uncharacterized protein At1g04910...    251   2e-77   Solanum tuberosum [potatoes]
ref|XP_010322803.1|  PREDICTED: uncharacterized protein At1g04910...    248   1e-76   Solanum lycopersicum
ref|XP_006357439.1|  PREDICTED: uncharacterized protein At1g04910...    248   2e-76   Solanum tuberosum [potatoes]
ref|XP_010110886.1|  hypothetical protein L484_004969                   244   7e-75   Morus notabilis
gb|EPS57961.1|  hypothetical protein M569_16856                         243   2e-74   Genlisea aurea
ref|XP_002275416.1|  PREDICTED: uncharacterized protein LOC100250173    241   2e-73   Vitis vinifera
ref|XP_010696089.1|  PREDICTED: uncharacterized protein LOC104908...    240   7e-73   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO45578.1|  hypothetical protein CISIN_1g014966mg                   239   9e-73   Citrus sinensis [apfelsine]
ref|XP_006492037.1|  PREDICTED: uncharacterized protein LOC102630315    238   1e-72   Citrus sinensis [apfelsine]
ref|XP_006427746.1|  hypothetical protein CICLE_v10025717mg             238   1e-72   Citrus clementina [clementine]
ref|XP_010696090.1|  PREDICTED: uncharacterized protein LOC104908...    236   3e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009786113.1|  PREDICTED: uncharacterized protein At1g04910...    234   4e-71   Nicotiana sylvestris
ref|XP_007215446.1|  hypothetical protein PRUPE_ppa006341mg             233   2e-70   Prunus persica
ref|XP_009333975.1|  PREDICTED: uncharacterized protein At1g04910...    233   2e-70   Pyrus x bretschneideri [bai li]
ref|XP_008227941.1|  PREDICTED: uncharacterized protein At1g04910       231   6e-70   Prunus mume [ume]
ref|XP_009594206.1|  PREDICTED: uncharacterized protein At1g04910...    231   7e-70   Nicotiana tomentosiformis
ref|XP_007150835.1|  hypothetical protein PHAVU_005G184800g             231   8e-70   Phaseolus vulgaris [French bean]
ref|XP_008365624.1|  PREDICTED: uncharacterized protein At1g04910...    229   3e-69   
ref|XP_003543719.1|  PREDICTED: uncharacterized protein LOC100807...    229   4e-69   Glycine max [soybeans]
ref|XP_008353648.1|  PREDICTED: uncharacterized protein At1g04910...    228   1e-68   
ref|XP_004303832.1|  PREDICTED: uncharacterized protein LOC101293906    228   1e-68   Fragaria vesca subsp. vesca
gb|ACU23517.1|  unknown                                                 227   2e-68   Glycine max [soybeans]
gb|KHN31859.1|  DUF246 domain-containing protein                        227   3e-68   Glycine soja [wild soybean]
ref|XP_003546222.1|  PREDICTED: uncharacterized protein LOC100789...    227   3e-68   Glycine max [soybeans]
ref|XP_009349642.1|  PREDICTED: uncharacterized protein At1g04910...    227   4e-68   Pyrus x bretschneideri [bai li]
gb|KJB66475.1|  hypothetical protein B456_010G141100                    226   6e-68   Gossypium raimondii
gb|ACU20281.1|  unknown                                                 218   2e-67   Glycine max [soybeans]
gb|KHG26733.1|  hypothetical protein F383_08102                         225   2e-67   Gossypium arboreum [tree cotton]
gb|KJB56404.1|  hypothetical protein B456_009G118400                    225   2e-67   Gossypium raimondii
ref|XP_006595200.1|  PREDICTED: uncharacterized protein LOC100807...    224   5e-67   Glycine max [soybeans]
gb|KHG06209.1|  hypothetical protein F383_32398                         224   5e-67   Gossypium arboreum [tree cotton]
ref|XP_006427747.1|  hypothetical protein CICLE_v10025717mg             223   1e-66   
gb|KDO45579.1|  hypothetical protein CISIN_1g014966mg                   223   1e-66   Citrus sinensis [apfelsine]
ref|XP_006597087.1|  PREDICTED: uncharacterized protein LOC100789...    223   1e-66   Glycine max [soybeans]
ref|XP_012076081.1|  PREDICTED: uncharacterized protein LOC105637...    220   3e-66   
ref|XP_004507011.1|  PREDICTED: uncharacterized protein LOC101492011    221   6e-66   Cicer arietinum [garbanzo]
ref|XP_012076080.1|  PREDICTED: uncharacterized protein At1g04910...    221   1e-65   Jatropha curcas
gb|KHN39355.1|  DUF246 domain-containing protein                        220   1e-65   Glycine soja [wild soybean]
ref|XP_003529532.1|  PREDICTED: uncharacterized protein At1g04910       220   1e-65   Glycine max [soybeans]
ref|XP_007023804.1|  O-fucosyltransferase family protein                219   3e-65   
ref|XP_002528288.1|  conserved hypothetical protein                     219   3e-65   Ricinus communis
gb|KEH28615.1|  GDP-fucose protein O-fucosyltransferase                 218   1e-64   Medicago truncatula
ref|XP_010034072.1|  PREDICTED: uncharacterized protein LOC104423261    218   1e-64   Eucalyptus grandis [rose gum]
ref|XP_002316445.2|  hypothetical protein POPTR_0010s25710g             217   2e-64   Populus trichocarpa [western balsam poplar]
ref|XP_011033030.1|  PREDICTED: uncharacterized protein LOC105131655    216   6e-64   Populus euphratica
ref|XP_006379398.1|  hypothetical protein POPTR_0008s00860g             213   5e-63   Populus trichocarpa [western balsam poplar]
ref|XP_004141744.1|  PREDICTED: uncharacterized protein At1g04910...    213   7e-63   Cucumis sativus [cucumbers]
gb|KHN38079.1|  DUF246 domain-containing protein                        213   1e-62   Glycine soja [wild soybean]
ref|NP_001239923.1|  uncharacterized protein LOC100813879               211   4e-62   Glycine max [soybeans]
ref|XP_008462222.1|  PREDICTED: uncharacterized protein LOC103500628    211   4e-62   
ref|XP_006342865.1|  PREDICTED: uncharacterized protein LOC102606164    209   2e-61   Solanum tuberosum [potatoes]
ref|XP_010656876.1|  PREDICTED: uncharacterized protein At1g04910...    208   4e-61   Vitis vinifera
ref|XP_010656875.1|  PREDICTED: uncharacterized protein At1g04910...    208   6e-61   
ref|XP_007142132.1|  hypothetical protein PHAVU_008G255300g             208   7e-61   Phaseolus vulgaris [French bean]
emb|CAN79033.1|  hypothetical protein VITISV_027517                     207   9e-61   Vitis vinifera
ref|XP_010656874.1|  PREDICTED: uncharacterized protein At1g04910...    207   1e-60   Vitis vinifera
ref|XP_010276723.1|  PREDICTED: uncharacterized protein At1g04910...    207   1e-60   Nelumbo nucifera [Indian lotus]
ref|NP_566677.1|  O-fucosyltransferase family protein                   207   2e-60   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65575.1|  unknown                                                 207   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002885425.1|  hypothetical protein ARALYDRAFT_479639             207   2e-60   
emb|CDY43916.1|  BnaA05g15260D                                          202   7e-59   Brassica napus [oilseed rape]
emb|CDY27536.1|  BnaC01g32190D                                          202   8e-59   Brassica napus [oilseed rape]
emb|CDY50071.1|  BnaC05g30800D                                          202   8e-59   Brassica napus [oilseed rape]
ref|XP_009144893.1|  PREDICTED: uncharacterized protein LOC103868560    202   1e-58   Brassica rapa
emb|CDY37310.1|  BnaA01g25300D                                          202   2e-58   Brassica napus [oilseed rape]
ref|XP_010461997.1|  PREDICTED: uncharacterized protein LOC104742678    202   2e-58   Camelina sativa [gold-of-pleasure]
emb|CDX87826.1|  BnaC06g08880D                                          202   2e-58   
ref|XP_010479652.1|  PREDICTED: uncharacterized protein LOC104758474    202   2e-58   
ref|NP_001063569.1|  Os09g0498800                                       201   2e-58   
gb|KFK35833.1|  hypothetical protein AALP_AA4G043000                    201   3e-58   Arabis alpina [alpine rockcress]
ref|XP_008801515.1|  PREDICTED: uncharacterized protein LOC103715609    201   3e-58   Phoenix dactylifera
ref|XP_009145508.1|  PREDICTED: uncharacterized protein LOC103869200    201   4e-58   Brassica rapa
ref|XP_009381590.1|  PREDICTED: uncharacterized protein At1g04910...    200   5e-58   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY19573.1|  BnaA05g19810D                                          200   5e-58   Brassica napus [oilseed rape]
ref|XP_009109756.1|  PREDICTED: uncharacterized protein LOC103835351    200   6e-58   Brassica rapa
ref|XP_006307609.1|  hypothetical protein CARUB_v10009235mg             200   8e-58   Capsella rubella
ref|XP_002462607.1|  hypothetical protein SORBIDRAFT_02g028940          200   1e-57   Sorghum bicolor [broomcorn]
ref|XP_011046520.1|  PREDICTED: uncharacterized protein At1g04910       199   1e-57   Populus euphratica
ref|XP_002894326.1|  hypothetical protein ARALYDRAFT_892138             199   2e-57   Arabidopsis lyrata subsp. lyrata
ref|XP_006406304.1|  hypothetical protein EUTSA_v10020803mg             199   3e-57   Eutrema salsugineum [saltwater cress]
ref|XP_010466346.1|  PREDICTED: uncharacterized protein LOC104746536    198   3e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010500742.1|  PREDICTED: uncharacterized protein LOC104778073    197   6e-57   Camelina sativa [gold-of-pleasure]
ref|XP_009381592.1|  PREDICTED: uncharacterized protein At1g04910...    197   9e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010488108.1|  PREDICTED: uncharacterized protein LOC104766006    197   9e-57   Camelina sativa [gold-of-pleasure]
ref|XP_006393024.1|  hypothetical protein EUTSA_v10011516mg             197   1e-56   Eutrema salsugineum [saltwater cress]
ref|NP_001131433.1|  uncharacterized protein LOC100192765               197   1e-56   Zea mays [maize]
ref|NP_175574.2|  O-fucosyltransferase family protein                   197   1e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009410212.1|  PREDICTED: uncharacterized protein At1g04910...    196   1e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010509815.1|  PREDICTED: uncharacterized protein LOC104786164    197   2e-56   
ref|XP_011623883.1|  PREDICTED: uncharacterized protein LOC18435668     196   2e-56   Amborella trichopoda
ref|XP_010545614.1|  PREDICTED: uncharacterized protein LOC104817925    196   2e-56   Tarenaya hassleriana [spider flower]
ref|XP_008799452.1|  PREDICTED: uncharacterized protein At1g04910       196   3e-56   Phoenix dactylifera
ref|XP_010929324.1|  PREDICTED: uncharacterized protein LOC105050840    196   4e-56   Elaeis guineensis
ref|XP_006660799.1|  PREDICTED: uncharacterized protein At1g04910...    195   5e-56   Oryza brachyantha
ref|NP_001143681.1|  uncharacterized protein LOC100276406               194   1e-55   Zea mays [maize]
ref|XP_010550817.1|  PREDICTED: uncharacterized protein LOC104821598    194   1e-55   Tarenaya hassleriana [spider flower]
emb|CDY52950.1|  BnaC03g77880D                                          194   1e-55   Brassica napus [oilseed rape]
ref|XP_009147757.1|  PREDICTED: uncharacterized protein LOC103871274    193   2e-55   Brassica rapa
ref|XP_004957253.1|  PREDICTED: uncharacterized protein At1g04910...    193   3e-55   Setaria italica
gb|AAG50891.1|AC025294_29  unknown protein                              194   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009410213.1|  PREDICTED: uncharacterized protein At1g04910...    193   3e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006297757.1|  hypothetical protein CARUB_v10013792mg             192   7e-55   Capsella rubella
emb|CDY55666.1|  BnaC06g04700D                                          191   1e-54   Brassica napus [oilseed rape]
emb|CDY22855.1|  BnaA06g02220D                                          191   1e-54   Brassica napus [oilseed rape]
ref|XP_009107173.1|  PREDICTED: uncharacterized protein LOC103832835    191   2e-54   Brassica rapa
ref|XP_003578366.1|  PREDICTED: uncharacterized protein At1g04910...    191   2e-54   Brachypodium distachyon [annual false brome]
ref|XP_008645321.1|  PREDICTED: uncharacterized protein At1g04910...    187   7e-54   Zea mays [maize]
gb|EYU18195.1|  hypothetical protein MIMGU_mgv1a023399mg                189   1e-53   Erythranthe guttata [common monkey flower]
gb|EEC84820.1|  hypothetical protein OsI_31907                          189   3e-53   Oryza sativa Indica Group [Indian rice]
ref|XP_011077745.1|  PREDICTED: uncharacterized protein At1g04910...    185   4e-52   Sesamum indicum [beniseed]
dbj|BAK06813.1|  predicted protein                                      183   2e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU38735.1|  hypothetical protein MIMGU_mgv1a007007mg                175   2e-48   Erythranthe guttata [common monkey flower]
ref|XP_009617901.1|  PREDICTED: uncharacterized protein At1g04910...    174   3e-48   Nicotiana tomentosiformis
ref|XP_009785320.1|  PREDICTED: uncharacterized protein At1g04910...    173   1e-47   Nicotiana sylvestris
gb|KEH28614.1|  GDP-fucose protein O-fucosyltransferase                 171   2e-47   Medicago truncatula
ref|XP_004488019.1|  PREDICTED: uncharacterized protein At1g04910...    172   3e-47   Cicer arietinum [garbanzo]
gb|EMT00881.1|  hypothetical protein F775_06359                         171   1e-46   
ref|XP_003595107.1|  DUF246 domain-containing protein                   169   5e-46   Medicago truncatula
gb|KJB66474.1|  hypothetical protein B456_010G141100                    166   3e-45   Gossypium raimondii
ref|XP_004243033.1|  PREDICTED: uncharacterized protein LOC101261246    167   3e-45   Solanum lycopersicum
ref|NP_001242787.1|  uncharacterized protein LOC100818659               165   1e-44   
emb|CDP20249.1|  unnamed protein product                                165   1e-44   Coffea canephora [robusta coffee]
gb|ABR16242.1|  unknown                                                 164   2e-44   Picea sitchensis
ref|XP_003533745.1|  PREDICTED: uncharacterized protein At1g04910...    162   2e-43   Glycine max [soybeans]
gb|KHN35827.1|  DUF246 domain-containing protein                        160   1e-42   Glycine soja [wild soybean]
gb|ERN07449.1|  hypothetical protein AMTR_s00019p00251420               157   7e-42   Amborella trichopoda
gb|AFV79649.1|  mannan synthesis-related protein                        156   2e-41   Trigonella foenum-graecum [fenugreek]
ref|XP_010927269.1|  PREDICTED: uncharacterized protein LOC105049343    155   3e-41   
gb|EMS49507.1|  hypothetical protein TRIUR3_13058                       145   1e-37   Triticum urartu
gb|KJB66473.1|  hypothetical protein B456_010G141100                    122   2e-29   Gossypium raimondii
ref|XP_004959583.1|  PREDICTED: uncharacterized protein LOC101779953    118   2e-28   
ref|XP_010911218.1|  PREDICTED: uncharacterized protein LOC105037225    105   1e-24   Elaeis guineensis
gb|ABR18129.1|  unknown                                                 108   7e-24   Picea sitchensis
gb|EPS66825.1|  hypothetical protein M569_07951                       98.2    5e-22   Genlisea aurea
gb|KCW78621.1|  hypothetical protein EUGRSUZ_C00086                   99.0    5e-21   Eucalyptus grandis [rose gum]
ref|XP_001768259.1|  predicted protein                                97.4    4e-20   
gb|ERN01984.1|  hypothetical protein AMTR_s00045p00073910             85.9    5e-16   Amborella trichopoda
ref|XP_006840309.2|  PREDICTED: uncharacterized protein At1g04910     85.9    6e-16   Amborella trichopoda
tpg|DAA37712.1|  TPA: hypothetical protein ZEAMMB73_184782            84.3    2e-15   
gb|KHN24633.1|  hypothetical protein glysoja_032277                   79.3    6e-14   Glycine soja [wild soybean]
emb|CAN79661.1|  hypothetical protein VITISV_004325                   75.9    1e-12   Vitis vinifera
ref|XP_002965248.1|  hypothetical protein SELMODRAFT_63007            65.1    5e-09   
ref|XP_001769456.1|  predicted protein                                65.1    6e-09   
ref|XP_002986571.1|  hypothetical protein SELMODRAFT_43041            65.1    6e-09   
ref|XP_009389009.1|  PREDICTED: uncharacterized protein At1g04910     64.7    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004984508.1|  PREDICTED: uncharacterized protein At1g04910...  64.3    1e-08   Setaria italica
emb|CDX98087.1|  BnaA06g08380D                                        64.3    1e-08   
emb|CDY60713.1|  BnaC07g50120D                                        63.2    3e-08   Brassica napus [oilseed rape]
ref|XP_010677047.1|  PREDICTED: uncharacterized protein At1g04910     62.8    4e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010434789.1|  PREDICTED: uncharacterized protein At1g04910...  62.8    4e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010449737.1|  PREDICTED: uncharacterized protein At1g04910...  62.8    4e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010440121.1|  PREDICTED: uncharacterized protein At1g04910...  62.8    5e-08   Camelina sativa [gold-of-pleasure]
emb|CDY19543.1|  BnaC09g13600D                                        62.8    5e-08   Brassica napus [oilseed rape]
ref|NP_176423.3|  O-fucosyltransferase family protein                 62.4    6e-08   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD44565.1|  unnamed protein product                              62.4    6e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010227801.1|  PREDICTED: uncharacterized protein At1g04910...  62.4    6e-08   Brachypodium distachyon [annual false brome]
ref|XP_010473452.1|  PREDICTED: uncharacterized protein At1g04910...  62.4    6e-08   Camelina sativa [gold-of-pleasure]
gb|KFK40606.1|  hypothetical protein AALP_AA2G017600                  62.0    9e-08   Arabis alpina [alpine rockcress]
emb|CDY12942.1|  BnaA09g13320D                                        62.0    9e-08   Brassica napus [oilseed rape]
ref|XP_009782231.1|  PREDICTED: uncharacterized protein At1g04910...  61.6    1e-07   Nicotiana sylvestris
ref|XP_006414319.1|  hypothetical protein EUTSA_v10024831mg           61.6    1e-07   Eutrema salsugineum [saltwater cress]
ref|XP_010938112.1|  PREDICTED: uncharacterized protein At1g04910...  61.6    1e-07   Elaeis guineensis
ref|XP_010264336.1|  PREDICTED: uncharacterized protein At1g04910...  61.6    1e-07   Nelumbo nucifera [Indian lotus]
ref|XP_006300315.1|  hypothetical protein CARUB_v10019899mg           61.6    1e-07   
ref|XP_006465351.1|  PREDICTED: uncharacterized protein At1g04910...  61.2    1e-07   Citrus sinensis [apfelsine]
emb|CDY50845.1|  BnaC08g47910D                                        61.6    1e-07   Brassica napus [oilseed rape]
gb|KDO61426.1|  hypothetical protein CISIN_1g0081651mg                61.2    1e-07   Citrus sinensis [apfelsine]
ref|XP_010418221.1|  PREDICTED: uncharacterized protein At1g04910...  61.6    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006440300.1|  hypothetical protein CICLE_v10019483mg           61.2    1e-07   Citrus clementina [clementine]
gb|KHN23921.1|  Auxin response factor 8                               58.2    1e-07   Glycine soja [wild soybean]
ref|XP_009136801.1|  PREDICTED: uncharacterized protein At1g04910...  61.2    1e-07   Brassica rapa
ref|XP_010264337.1|  PREDICTED: uncharacterized protein At1g04910...  61.2    2e-07   Nelumbo nucifera [Indian lotus]
ref|XP_006477177.1|  PREDICTED: uncharacterized protein At1g04910...  61.2    2e-07   Citrus sinensis [apfelsine]
ref|XP_006391902.1|  hypothetical protein EUTSA_v10023332mg           61.2    2e-07   Eutrema salsugineum [saltwater cress]
emb|CDY40517.1|  BnaC01g19950D                                        61.2    2e-07   Brassica napus [oilseed rape]
dbj|BAJ99135.1|  predicted protein                                    61.2    2e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX90501.1|  BnaA03g42800D                                        60.8    2e-07   
ref|XP_009145647.1|  PREDICTED: uncharacterized protein At1g04910...  60.8    2e-07   Brassica rapa
gb|EMT23612.1|  hypothetical protein F775_09460                       60.8    2e-07   
emb|CDY53645.1|  BnaA08g30350D                                        60.8    2e-07   Brassica napus [oilseed rape]
ref|XP_009113085.1|  PREDICTED: uncharacterized protein At1g04910     60.8    2e-07   Brassica rapa
gb|KHN46676.1|  DUF246 domain-containing protein                      60.5    2e-07   Glycine soja [wild soybean]
ref|XP_009793270.1|  PREDICTED: uncharacterized protein At1g04910...  60.5    2e-07   Nicotiana sylvestris
ref|XP_002465327.1|  hypothetical protein SORBIDRAFT_01g036540        60.5    2e-07   Sorghum bicolor [broomcorn]
ref|XP_003551780.1|  PREDICTED: uncharacterized protein At1g04910...  60.5    3e-07   Glycine max [soybeans]
ref|XP_004508646.1|  PREDICTED: uncharacterized protein At1g04910...  60.5    3e-07   
gb|EPS63860.1|  hypothetical protein M569_10923                       60.1    3e-07   Genlisea aurea
ref|XP_004508647.1|  PREDICTED: uncharacterized protein At1g04910...  60.5    3e-07   Cicer arietinum [garbanzo]
ref|XP_003570464.2|  PREDICTED: uncharacterized protein At1g04910...  60.1    3e-07   Brachypodium distachyon [annual false brome]
gb|EMS46512.1|  hypothetical protein TRIUR3_15824                     60.5    3e-07   Triticum urartu
dbj|BAD37877.1|  putative auxin-independent growth promoter           60.1    3e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002979307.1|  hypothetical protein SELMODRAFT_110454           60.1    3e-07   
gb|KHN18388.1|  DUF246 domain-containing protein                      60.1    3e-07   Glycine soja [wild soybean]
ref|XP_010430282.1|  PREDICTED: uncharacterized protein At1g04910...  60.1    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006430964.1|  hypothetical protein CICLE_v10011493mg           60.1    3e-07   Citrus clementina [clementine]
gb|KDO72306.1|  hypothetical protein CISIN_1g036592mg                 60.1    4e-07   Citrus sinensis [apfelsine]
ref|XP_006408431.1|  hypothetical protein EUTSA_v10020530mg           60.1    4e-07   Eutrema salsugineum [saltwater cress]
ref|XP_006482442.1|  PREDICTED: uncharacterized protein At1g04910...  60.1    4e-07   Citrus sinensis [apfelsine]
ref|XP_007139392.1|  hypothetical protein PHAVU_008G025600g           59.7    4e-07   Phaseolus vulgaris [French bean]
ref|XP_002985325.1|  hypothetical protein SELMODRAFT_234769           59.7    4e-07   
ref|XP_002970137.1|  hypothetical protein SELMODRAFT_171255           59.7    4e-07   
ref|XP_002967060.1|  hypothetical protein SELMODRAFT_408430           59.7    4e-07   Selaginella moellendorffii
gb|KJB51854.1|  hypothetical protein B456_008G234600                  59.7    5e-07   Gossypium raimondii
ref|XP_003525629.1|  PREDICTED: uncharacterized protein At1g04910...  59.7    5e-07   Glycine max [soybeans]
gb|KHN15193.1|  DUF246 domain-containing protein                      59.3    5e-07   Glycine soja [wild soybean]
ref|NP_001049999.1|  Os03g0328100                                     59.3    5e-07   
ref|XP_004965235.1|  PREDICTED: uncharacterized protein At1g04910...  59.3    5e-07   Setaria italica
ref|NP_001159291.1|  hypothetical protein                             59.3    5e-07   Zea mays [maize]
ref|XP_008788918.1|  PREDICTED: uncharacterized protein At1g04910...  59.3    5e-07   Phoenix dactylifera
ref|XP_003522979.2|  PREDICTED: uncharacterized protein At1g04910...  59.3    6e-07   Glycine max [soybeans]
ref|XP_002438243.1|  hypothetical protein SORBIDRAFT_10g010460        59.3    6e-07   Sorghum bicolor [broomcorn]
ref|XP_002873739.1|  hypothetical protein ARALYDRAFT_488418           59.3    6e-07   
ref|XP_004957108.1|  PREDICTED: uncharacterized protein At1g04910...  59.3    6e-07   Setaria italica
ref|XP_011099050.1|  PREDICTED: uncharacterized protein At1g04910     59.3    6e-07   Sesamum indicum [beniseed]
ref|XP_010691586.1|  PREDICTED: uncharacterized protein At1g04910...  59.3    6e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006582034.1|  PREDICTED: uncharacterized protein At1g04910...  59.3    6e-07   Glycine max [soybeans]
gb|KJB51853.1|  hypothetical protein B456_008G234600                  59.3    6e-07   Gossypium raimondii
ref|XP_009148624.1|  PREDICTED: uncharacterized protein At1g04910     59.3    6e-07   Brassica rapa
ref|XP_008782753.1|  PREDICTED: uncharacterized protein At1g04910...  59.3    6e-07   Phoenix dactylifera
ref|XP_002267185.2|  PREDICTED: uncharacterized protein At1g04910     59.3    6e-07   Vitis vinifera
gb|EEE65417.1|  hypothetical protein OsJ_20764                        59.3    7e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011001504.1|  PREDICTED: uncharacterized protein At1g04910...  59.3    7e-07   Populus euphratica
ref|NP_197078.2|  O-fucosyltransferase family protein                 58.9    7e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008651776.1|  PREDICTED: uncharacterized protein LOC100384...  58.9    7e-07   
gb|EYU44245.1|  hypothetical protein MIMGU_mgv1a004661mg              58.9    7e-07   Erythranthe guttata [common monkey flower]
gb|KFK37682.1|  hypothetical protein AALP_AA3G015000                  58.9    8e-07   Arabis alpina [alpine rockcress]
gb|EEC80302.1|  hypothetical protein OsI_22331                        59.3    8e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_002462529.1|  hypothetical protein SORBIDRAFT_02g027470        58.9    8e-07   Sorghum bicolor [broomcorn]
ref|XP_006354743.1|  PREDICTED: uncharacterized protein At1g04910...  58.9    8e-07   Solanum tuberosum [potatoes]
ref|XP_010999426.1|  PREDICTED: uncharacterized protein At1g04910...  58.9    8e-07   Populus euphratica
ref|XP_009623754.1|  PREDICTED: uncharacterized protein At1g04910...  58.9    8e-07   Nicotiana tomentosiformis
ref|XP_003530456.1|  PREDICTED: uncharacterized protein At1g04910...  58.9    8e-07   Glycine max [soybeans]
ref|NP_001175885.1|  Os09g0475500                                     57.4    8e-07   
ref|XP_003563952.1|  PREDICTED: uncharacterized protein At1g04910...  58.9    8e-07   Brachypodium distachyon [annual false brome]
emb|CAC01773.1|  putative protein                                     58.9    8e-07   Arabidopsis thaliana [mouse-ear cress]
gb|KJB66472.1|  hypothetical protein B456_010G141100                  58.2    8e-07   Gossypium raimondii
ref|XP_010913449.1|  PREDICTED: uncharacterized protein At1g04910...  58.9    8e-07   Elaeis guineensis
ref|XP_006384269.1|  hypothetical protein POPTR_0004s11220g           58.9    8e-07   Populus trichocarpa [western balsam poplar]
ref|XP_008655269.1|  PREDICTED: uncharacterized protein At1g04910...  58.9    8e-07   
ref|XP_006373415.1|  hypothetical protein POPTR_0017s13570g           58.9    8e-07   
ref|XP_011021095.1|  PREDICTED: uncharacterized protein At1g04910     58.9    8e-07   Populus euphratica
ref|XP_002312261.1|  hypothetical protein POPTR_0008s09010g           58.9    8e-07   
gb|AES65954.2|  GDP-fucose O-fucosyltransferase-like protein          58.9    9e-07   Medicago truncatula
ref|XP_006650024.1|  PREDICTED: uncharacterized protein At1g04910...  58.9    9e-07   Oryza brachyantha
emb|CDY30045.1|  BnaC05g09750D                                        58.9    9e-07   Brassica napus [oilseed rape]
ref|XP_010913450.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    9e-07   
ref|XP_011072228.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    9e-07   Sesamum indicum [beniseed]
ref|XP_004236078.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    9e-07   Solanum lycopersicum
ref|XP_002514598.1|  conserved hypothetical protein                   58.5    9e-07   Ricinus communis
ref|XP_003595703.1|  ATP synthase subunit a chloroplastic             58.9    9e-07   
ref|XP_009147366.1|  PREDICTED: uncharacterized protein At1g04910     58.5    9e-07   Brassica rapa
ref|XP_010476149.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    1e-06   
gb|KJB10521.1|  hypothetical protein B456_001G206300                  58.5    1e-06   Gossypium raimondii
ref|XP_004241614.1|  PREDICTED: uncharacterized protein At1g04910     58.5    1e-06   Solanum lycopersicum
ref|XP_009395885.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004488503.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    1e-06   Cicer arietinum [garbanzo]
ref|XP_009757587.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    1e-06   Nicotiana sylvestris
ref|XP_006345092.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    1e-06   Solanum tuberosum [potatoes]
ref|XP_009611732.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    1e-06   Nicotiana tomentosiformis
ref|XP_009123029.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    1e-06   Brassica rapa
emb|CDY34715.1|  BnaA01g33100D                                        58.2    1e-06   Brassica napus [oilseed rape]
gb|KJB50369.1|  hypothetical protein B456_008G166900                  58.5    1e-06   Gossypium raimondii
emb|CDY43245.1|  BnaC05g48380D                                        58.5    1e-06   Brassica napus [oilseed rape]
gb|KHG19963.1|  hypothetical protein F383_04918                       58.5    1e-06   Gossypium arboreum [tree cotton]
ref|XP_006826849.1|  PREDICTED: uncharacterized protein At1g04910     58.5    1e-06   Amborella trichopoda
ref|XP_009402423.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010265849.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    1e-06   Nelumbo nucifera [Indian lotus]
emb|CDY60465.1|  BnaAnng16790D                                        58.5    1e-06   Brassica napus [oilseed rape]
ref|XP_010542225.1|  PREDICTED: uncharacterized protein At1g04910     58.5    1e-06   
gb|KDO64644.1|  hypothetical protein CISIN_1g008637mg                 58.2    1e-06   Citrus sinensis [apfelsine]
gb|EEE65780.1|  hypothetical protein OsJ_21469                        58.5    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007138389.1|  hypothetical protein PHAVU_009G204500g           58.5    1e-06   Phaseolus vulgaris [French bean]
emb|CDX91985.1|  BnaC03g32870D                                        58.5    1e-06   
ref|XP_010032572.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    1e-06   
dbj|BAJ98197.1|  predicted protein                                    58.5    1e-06   
ref|XP_004252254.1|  PREDICTED: uncharacterized protein At1g04910...  58.2    1e-06   
emb|CBI16925.3|  unnamed protein product                              58.2    1e-06   
ref|XP_002436782.1|  hypothetical protein SORBIDRAFT_10g008680        58.5    1e-06   
ref|XP_002278298.1|  PREDICTED: uncharacterized protein At1g04910     58.2    1e-06   
ref|XP_009378282.1|  PREDICTED: uncharacterized protein At1g04910     58.2    1e-06   
ref|XP_010476148.1|  PREDICTED: uncharacterized protein At1g04910...  58.2    1e-06   
ref|XP_010476147.1|  PREDICTED: uncharacterized protein At1g04910...  58.2    1e-06   
gb|EMT01904.1|  hypothetical protein F775_11025                       58.2    1e-06   
ref|XP_010464948.1|  PREDICTED: uncharacterized protein At1g04910...  58.2    1e-06   
ref|XP_009337866.1|  PREDICTED: uncharacterized protein At1g04910...  58.2    1e-06   
ref|XP_006353173.1|  PREDICTED: uncharacterized protein At1g04910...  58.2    1e-06   
gb|ERN02582.1|  hypothetical protein AMTR_s00087p00092870             58.2    1e-06   
ref|XP_006448248.1|  hypothetical protein CICLE_v10014776mg           58.2    1e-06   
ref|XP_006297456.1|  hypothetical protein CARUB_v10013476mg           58.2    1e-06   
ref|XP_002884311.1|  hypothetical protein ARALYDRAFT_896190           58.2    1e-06   
ref|XP_008393258.1|  PREDICTED: uncharacterized protein At1g04910...  58.2    1e-06   
ref|XP_006283475.1|  hypothetical protein CARUB_v10004523mg           58.2    1e-06   
ref|XP_002973304.1|  hypothetical protein SELMODRAFT_173189           57.8    1e-06   
ref|XP_010463624.1|  PREDICTED: uncharacterized protein At1g04910...  58.2    1e-06   
ref|XP_010485466.1|  PREDICTED: uncharacterized protein At1g04910...  58.2    1e-06   
ref|NP_566168.2|  O-fucosyltransferase-like protein                   58.2    1e-06   
ref|XP_010913447.1|  PREDICTED: uncharacterized protein At1g04910...  58.2    1e-06   
ref|XP_008374671.1|  PREDICTED: uncharacterized protein At1g04910...  58.2    1e-06   
ref|XP_010055484.1|  PREDICTED: uncharacterized protein At1g04910     58.2    1e-06   
gb|EEC81207.1|  hypothetical protein OsI_24239                        58.2    1e-06   
ref|XP_009604992.1|  PREDICTED: uncharacterized protein At1g04910...  58.2    1e-06   
ref|XP_006656834.1|  PREDICTED: uncharacterized protein At1g04910...  58.2    2e-06   
ref|XP_003520091.1|  PREDICTED: uncharacterized protein At1g04910...  58.2    2e-06   
gb|KJB10523.1|  hypothetical protein B456_001G206300                  58.2    2e-06   
gb|KHG10689.1|  hypothetical protein F383_03841                       58.2    2e-06   
emb|CDY24821.1|  BnaA08g14890D                                        58.2    2e-06   
gb|KDP31393.1|  hypothetical protein JCGZ_11769                       58.2    2e-06   
tpg|DAA43594.1|  TPA: hypothetical protein ZEAMMB73_319448            57.4    2e-06   
ref|XP_012080439.1|  PREDICTED: uncharacterized protein At1g04910...  58.2    2e-06   
ref|XP_010694231.1|  PREDICTED: uncharacterized protein At1g04910     58.2    2e-06   
dbj|BAK00855.1|  predicted protein                                    57.8    2e-06   
dbj|BAJ93464.1|  predicted protein                                    57.8    2e-06   
gb|ERN00770.1|  hypothetical protein AMTR_s00106p00146200             58.2    2e-06   
ref|XP_010257422.1|  PREDICTED: uncharacterized protein At1g04910...  58.2    2e-06   
gb|KDO64643.1|  hypothetical protein CISIN_1g008637mg                 57.8    2e-06   
emb|CDX74265.1|  BnaA03g27820D                                        57.8    2e-06   
ref|XP_010492421.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    2e-06   
gb|ERN05750.1|  hypothetical protein AMTR_s00006p00250170             57.8    2e-06   
gb|KDO64642.1|  hypothetical protein CISIN_1g008637mg                 57.8    2e-06   
ref|XP_009134657.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    2e-06   
ref|XP_008379462.1|  PREDICTED: uncharacterized protein At1g04910     57.8    2e-06   
ref|XP_006844075.2|  PREDICTED: uncharacterized protein At1g04910     57.8    2e-06   
ref|XP_002888034.1|  hypothetical protein ARALYDRAFT_475111           57.8    2e-06   
ref|XP_009121550.1|  PREDICTED: uncharacterized protein At1g04910     57.8    2e-06   
ref|XP_010492420.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    2e-06   
gb|EAZ09478.1|  hypothetical protein OsI_31750                        57.8    2e-06   
ref|XP_006469184.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    2e-06   
ref|XP_010691162.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    2e-06   
emb|CDX69504.1|  BnaA10g18530D                                        57.8    2e-06   
ref|XP_010553452.1|  PREDICTED: uncharacterized protein At1g04910     57.8    2e-06   
gb|KEH32061.1|  GDP-fucose O-fucosyltransferase-like protein          57.8    2e-06   
emb|CDY26456.1|  BnaC09g42120D                                        57.8    2e-06   
ref|XP_002265858.1|  PREDICTED: uncharacterized protein At1g04910     57.8    2e-06   
ref|XP_006358681.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    2e-06   
ref|XP_006852198.2|  PREDICTED: uncharacterized protein At1g04910     57.8    2e-06   
ref|XP_010663502.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    2e-06   
ref|XP_010261204.1|  PREDICTED: uncharacterized protein At1g04910     57.8    2e-06   
ref|XP_008798044.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    2e-06   
ref|XP_010928111.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    2e-06   
ref|XP_009802078.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    2e-06   
ref|XP_011622062.1|  PREDICTED: uncharacterized protein At1g04910     57.8    2e-06   
ref|XP_006440825.1|  hypothetical protein CICLE_v10019790mg           57.8    2e-06   
ref|XP_004507283.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    2e-06   
emb|CAN73548.1|  hypothetical protein VITISV_038182                   57.8    2e-06   
ref|XP_008659068.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    2e-06   
gb|KFK25799.1|  hypothetical protein AALP_AA8G162600                  57.8    2e-06   
gb|EMS52310.1|  hypothetical protein TRIUR3_22833                     57.4    2e-06   
ref|XP_008793370.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    2e-06   
gb|ERN13665.1|  hypothetical protein AMTR_s00049p00119840             57.4    2e-06   
ref|XP_002525944.1|  conserved hypothetical protein                   57.4    2e-06   
gb|KHN44375.1|  DUF246 domain-containing protein                      57.8    2e-06   
ref|XP_010453716.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    2e-06   
ref|XP_003538596.1|  PREDICTED: uncharacterized protein At1g04910...  57.8    2e-06   
ref|XP_009587252.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    2e-06   
ref|XP_009373763.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    2e-06   
emb|CDX78650.1|  BnaA03g05620D                                        57.4    2e-06   
ref|XP_006467631.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    2e-06   
ref|XP_011621383.1|  PREDICTED: uncharacterized protein At1g04910     57.4    2e-06   
ref|XP_010420248.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    2e-06   
ref|XP_006449523.1|  hypothetical protein CICLE_v10014718mg           57.4    2e-06   
ref|XP_004288516.2|  PREDICTED: uncharacterized protein At1g04910     57.4    2e-06   
gb|EMS67535.1|  hypothetical protein TRIUR3_24224                     57.4    2e-06   
ref|XP_002321469.2|  hypothetical protein POPTR_0015s03540g           57.4    2e-06   
ref|XP_010453715.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    2e-06   
gb|KJB06912.1|  hypothetical protein B456_001G066600                  57.4    2e-06   
ref|XP_003516276.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    3e-06   
ref|XP_009131494.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    3e-06   
ref|XP_006287551.1|  hypothetical protein CARUB_v10000760mg           57.4    3e-06   
ref|XP_011011552.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    3e-06   
ref|XP_008809674.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    3e-06   
ref|XP_009146206.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    3e-06   
ref|XP_006369018.1|  hypothetical protein POPTR_0001s15750g           57.4    3e-06   
ref|XP_007039815.1|  O-fucosyltransferase family protein isoform 2    57.4    3e-06   
ref|XP_006400095.1|  hypothetical protein EUTSA_v10013286mg           57.4    3e-06   
ref|XP_007214626.1|  hypothetical protein PRUPE_ppa002927mg           57.4    3e-06   
emb|CDX70647.1|  BnaC03g07310D                                        57.4    3e-06   
ref|XP_007037671.1|  O-fucosyltransferase family protein isoform 2    57.4    3e-06   
ref|XP_009381653.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    3e-06   
ref|XP_009146205.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    3e-06   
ref|XP_006661343.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    3e-06   
ref|XP_007039814.1|  O-fucosyltransferase family protein isoform 1    57.4    3e-06   
ref|XP_001757712.1|  predicted protein                                57.4    3e-06   
gb|KHN26036.1|  DUF246 domain-containing protein                      57.4    3e-06   
ref|XP_004965111.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    3e-06   
ref|XP_008455558.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    3e-06   
ref|XP_010943313.1|  PREDICTED: uncharacterized protein At1g04910     57.4    3e-06   
gb|EMT16495.1|  hypothetical protein F775_26167                       57.4    3e-06   
ref|XP_010274715.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    3e-06   
ref|XP_009625954.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    3e-06   
ref|XP_008651454.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    3e-06   
ref|XP_010262779.1|  PREDICTED: uncharacterized protein At1g04910...  57.4    3e-06   
gb|KJB19454.1|  hypothetical protein B456_003G103300                  57.0    3e-06   
ref|XP_010519195.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    3e-06   
ref|XP_004299271.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    3e-06   
ref|XP_007136338.1|  hypothetical protein PHAVU_009G0371000g          57.0    3e-06   
ref|XP_006417280.1|  hypothetical protein EUTSA_v10007119mg           57.0    3e-06   
ref|XP_007037670.1|  O-fucosyltransferase family protein isoform 1    57.0    3e-06   
ref|XP_010262851.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    3e-06   
gb|AGV54860.1|  O-fucosyltransferase family protein                   57.0    3e-06   
ref|XP_008357801.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    3e-06   
ref|XP_009410297.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    3e-06   
ref|XP_010262908.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    3e-06   
ref|XP_002973302.1|  hypothetical protein SELMODRAFT_413560           57.0    3e-06   
ref|XP_008243446.1|  PREDICTED: uncharacterized protein At1g04910     57.0    3e-06   
ref|XP_010318378.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    3e-06   
ref|XP_006341331.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    3e-06   
ref|XP_002976599.1|  hypothetical protein SELMODRAFT_268011           57.0    3e-06   
ref|XP_002517611.1|  conserved hypothetical protein                   57.0    3e-06   
ref|XP_008232354.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    4e-06   
ref|XP_010262705.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    4e-06   
ref|XP_009346329.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    4e-06   
ref|XP_008798042.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    4e-06   
gb|KJB06911.1|  hypothetical protein B456_001G066600                  57.0    4e-06   
ref|XP_009362530.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    4e-06   
ref|XP_007211132.1|  hypothetical protein PRUPE_ppa026241mg           57.0    4e-06   
ref|XP_004137143.1|  PREDICTED: uncharacterized protein At1g04910     57.0    4e-06   
ref|XP_010262622.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    4e-06   
ref|XP_010525131.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    4e-06   
ref|XP_011078675.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    4e-06   
gb|KHN24632.1|  hypothetical protein glysoja_032276                   52.4    4e-06   
ref|XP_010525130.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    4e-06   
gb|KHG17083.1|  hypothetical protein F383_22070                       57.0    4e-06   
ref|XP_007032895.1|  O-fucosyltransferase family protein isoform 2    56.6    4e-06   
ref|XP_010099296.1|  hypothetical protein L484_018158                 57.0    4e-06   
ref|XP_012081662.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    4e-06   
ref|XP_007225729.1|  hypothetical protein PRUPE_ppa003622mg           57.0    4e-06   
ref|XP_010678381.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    4e-06   
gb|KJB19455.1|  hypothetical protein B456_003G103300                  56.6    4e-06   
gb|AFW79318.1|  hypothetical protein ZEAMMB73_338758                  56.6    4e-06   
ref|XP_009348773.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    4e-06   
emb|CDX97697.1|  BnaA05g23820D                                        56.6    4e-06   
ref|XP_004981241.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    4e-06   
ref|XP_006596302.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    4e-06   
gb|EYU23639.1|  hypothetical protein MIMGU_mgv1a004971mg              56.6    4e-06   
ref|NP_001151533.1|  LOC100285167                                     56.6    4e-06   
gb|KHN47770.1|  DUF246 domain-containing protein                      56.6    4e-06   
ref|XP_008240072.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    4e-06   
ref|XP_002311505.2|  hypothetical protein POPTR_0008s12960g           56.6    4e-06   
ref|XP_008647318.1|  PREDICTED: uncharacterized protein LOC100191...  56.6    4e-06   
ref|NP_001057398.1|  Os06g0284200                                     56.6    4e-06   
ref|XP_010546573.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    4e-06   
ref|XP_008348101.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    4e-06   
dbj|BAJ90326.1|  predicted protein                                    56.6    5e-06   
gb|EAZ00539.1|  hypothetical protein OsI_22558                        56.6    5e-06   
gb|ACN34743.1|  unknown                                               56.6    5e-06   
gb|EAZ36643.1|  hypothetical protein OsJ_20989                        56.6    5e-06   
ref|XP_004306052.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    5e-06   
ref|XP_007215267.1|  hypothetical protein PRUPE_ppa004594mg           56.6    5e-06   
gb|EMS61270.1|  hypothetical protein TRIUR3_28898                     56.6    5e-06   
ref|XP_008454434.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    5e-06   
ref|XP_011023536.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    5e-06   
ref|XP_008354034.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    5e-06   
ref|XP_010312648.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    5e-06   
ref|XP_008647312.1|  PREDICTED: uncharacterized protein LOC100191...  56.6    5e-06   
gb|KHG20792.1|  hypothetical protein F383_01946                       56.6    5e-06   
emb|CDX70637.1|  BnaC03g07210D                                        56.6    5e-06   
ref|XP_011072875.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    5e-06   
ref|XP_008647317.1|  PREDICTED: uncharacterized protein LOC100191...  56.6    5e-06   
ref|XP_006406927.1|  hypothetical protein EUTSA_v10020754mg           56.2    5e-06   
ref|XP_010549977.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    5e-06   
ref|XP_011072874.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    5e-06   
ref|XP_010549974.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    5e-06   
emb|CDY30099.1|  BnaC05g37630D                                        56.2    5e-06   
gb|AFW85188.1|  hypothetical protein ZEAMMB73_421614                  56.6    5e-06   
ref|XP_008230306.1|  PREDICTED: uncharacterized protein At1g04910     56.6    5e-06   
gb|EMT03456.1|  hypothetical protein F775_30563                       56.6    5e-06   
ref|XP_009797995.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    5e-06   
ref|XP_008453320.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    5e-06   
ref|XP_004138213.1|  PREDICTED: uncharacterized protein At1g04910     56.6    5e-06   
ref|XP_002301007.2|  hypothetical protein POPTR_0002s08790g           56.6    5e-06   
ref|XP_011081267.1|  PREDICTED: uncharacterized protein At1g04910     56.6    5e-06   
ref|XP_006581140.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    6e-06   
gb|KHN20121.1|  DUF246 domain-containing protein                      56.2    6e-06   
gb|KFK28051.1|  hypothetical protein AALP_AA8G465200                  56.2    6e-06   
ref|XP_003533064.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    6e-06   
ref|XP_002960947.1|  hypothetical protein SELMODRAFT_402444           56.2    6e-06   
emb|CDP07710.1|  unnamed protein product                              56.2    6e-06   
gb|KHG01567.1|  hypothetical protein F383_21541                       56.2    6e-06   
ref|XP_007032894.1|  O-fucosyltransferase family protein isoform 1    56.2    6e-06   
dbj|BAD16083.1|  putative auxin-independent growth promoter           56.2    6e-06   
ref|XP_008461105.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    6e-06   
ref|XP_006850060.1|  PREDICTED: uncharacterized protein At1g04910     56.2    6e-06   
ref|XP_009413466.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    6e-06   
ref|XP_009800631.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    7e-06   
ref|XP_006645023.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    7e-06   
gb|KDO45226.1|  hypothetical protein CISIN_1g013805mg                 56.2    7e-06   
gb|KEH33186.1|  GDP-fucose protein O-fucosyltransferase               55.8    7e-06   
gb|EYU27099.1|  hypothetical protein MIMGU_mgv1a004188mg              56.2    7e-06   
gb|EEC73922.1|  hypothetical protein OsI_08773                        56.2    7e-06   
ref|XP_009391772.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    7e-06   
ref|XP_007045152.1|  O-fucosyltransferase family protein              56.2    7e-06   
ref|XP_009346524.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    7e-06   
gb|KJB30424.1|  hypothetical protein B456_005G142700                  55.8    7e-06   
ref|XP_004301193.1|  PREDICTED: uncharacterized protein At1g04910     56.2    7e-06   



>ref|XP_011072734.1| PREDICTED: uncharacterized protein At1g04910-like [Sesamum indicum]
Length=413

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 155/186 (83%), Gaps = 9/186 (5%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLP----GG  308
            MAVDPR ++AG+LT+TMF+MLG+MIKRDHFD+        T+HDT KASE +L     G 
Sbjct  1    MAVDPRHVLAGILTLTMFLMLGDMIKRDHFDSTH-----PTVHDTKKASEHTLASVAKGA  55

Query  309  DSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLV  488
            D  WK DGL++KPCW++P L + D S GYVTFSLTNGPEYHVSQI+DAVVVARYLRATLV
Sbjct  56   DGPWKEDGLTLKPCWQKPVLKEADESQGYVTFSLTNGPEYHVSQIADAVVVARYLRATLV  115

Query  489  IPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEH  668
            IPD+RGS PGDKR+FKD+YDV++F+ SLDGVVKV  S+PT +S++NLAVVKVPNRVTE +
Sbjct  116  IPDIRGSQPGDKRNFKDVYDVEKFIASLDGVVKVVRSQPTEISARNLAVVKVPNRVTEGY  175

Query  669  IAENIE  686
            IAENIE
Sbjct  176  IAENIE  181



>emb|CDO97753.1| unnamed protein product [Coffea canephora]
Length=420

 Score =   262 bits (670),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 156/190 (82%), Gaps = 8/190 (4%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQ--ESRLTSTIHDTNKASELSL-----  299
            MAVDPRQ+VAGVLTVTMFVMLGNMIKRDHFD+LQ  +S + S +HD+ KASE SL     
Sbjct  1    MAVDPRQVVAGVLTVTMFVMLGNMIKRDHFDSLQVNDSEIPS-LHDSTKASEQSLVTLPD  59

Query  300  PGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
             G D+ WK DG ++KPCW +P L + + S G+VTFS TNGPEYHVSQI+DAV VARYLRA
Sbjct  60   GGADAPWKKDGSTLKPCWTKPVLEEVEQSQGFVTFSFTNGPEYHVSQITDAVKVARYLRA  119

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVT  659
            TLV+PD+RGS PGDK +F++IYDV++ VKSLDGV+K+   +P+ +S++NLAVVKVPN VT
Sbjct  120  TLVLPDIRGSKPGDKWNFEEIYDVEKLVKSLDGVLKIATHQPSEISTRNLAVVKVPNLVT  179

Query  660  EEHIAENIEP  689
            EE IAENIEP
Sbjct  180  EEFIAENIEP  189



>ref|XP_009587135.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
tomentosiformis]
Length=408

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 150/183 (82%), Gaps = 6/183 (3%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSLW  320
            M VDPRQ+VAGVLTVTMFVMLGNMIK DHFD+L     TS IH  +K S      G+  W
Sbjct  1    MGVDPRQMVAGVLTVTMFVMLGNMIKNDHFDSLPVDSDTS-IHSISKQS-----IGNGPW  54

Query  321  KGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV  500
            K DG S+KPCW +P L + D S G+VTFSLTNGPEYHVSQI+DAV+VARYLRA LVIPD+
Sbjct  55   KQDGESLKPCWTKPVLQEADQSQGFVTFSLTNGPEYHVSQIADAVIVARYLRAILVIPDI  114

Query  501  RGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIAEN  680
            RGS PGDKR+F DIYDV+ FV+SLDGVVKV +++PT +S++NLAVVKVPNRV+E+++AEN
Sbjct  115  RGSKPGDKRNFDDIYDVEHFVRSLDGVVKVASTQPTEVSARNLAVVKVPNRVSEDYVAEN  174

Query  681  IEP  689
            IEP
Sbjct  175  IEP  177



>ref|XP_009765354.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=408

 Score =   257 bits (657),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 149/183 (81%), Gaps = 6/183 (3%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSLW  320
            M VDPRQ+VAGVLTVTMFVMLGNMIK DHFD+L     TS IH T+K S      G+  W
Sbjct  1    MGVDPRQMVAGVLTVTMFVMLGNMIKNDHFDSLPVDSDTS-IHTTSKQSL-----GNGPW  54

Query  321  KGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV  500
              DG S+K CW +P + + D S G+VTFSLTNGPEYHVSQI+DAV+VARYLRATLVIPD+
Sbjct  55   IHDGESLKSCWTKPVVQEADQSQGFVTFSLTNGPEYHVSQIADAVIVARYLRATLVIPDI  114

Query  501  RGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIAEN  680
            RGS PGDKR+F DIYDV+ FV+SLDGVVKV  ++PT +S++NLAVVKVPNRV+E++IAEN
Sbjct  115  RGSKPGDKRNFDDIYDVEHFVRSLDGVVKVATTQPTEVSARNLAVVKVPNRVSEDYIAEN  174

Query  681  IEP  689
            IEP
Sbjct  175  IEP  177



>gb|EYU21223.1| hypothetical protein MIMGU_mgv1a007275mg [Erythranthe guttata]
Length=412

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 154/186 (83%), Gaps = 10/186 (5%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLP----GG  308
            MAVDPRQ++AGVLT+TMFVMLGNMIKRDHFD+   +     +H+TNKAS+  L     G 
Sbjct  1    MAVDPRQVLAGVLTMTMFVMLGNMIKRDHFDSAHPA-----VHNTNKASDHGLASVTKGA  55

Query  309  DSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLV  488
            D  WK DGLS+K CW++P L +   S GYVTFSLTNGPEYHVSQISDAVVVARYLRATLV
Sbjct  56   DGPWKEDGLSLKQCWQKPILEEAIDSQGYVTFSLTNGPEYHVSQISDAVVVARYLRATLV  115

Query  489  IPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEH  668
            IP++RGS PGDKR+F+D+YDV++F+ SLDGVVKV  S+P + S+KNLAVVK+PNRVTEE+
Sbjct  116  IPEIRGSEPGDKRNFQDVYDVEKFIASLDGVVKVVKSKPKI-SAKNLAVVKIPNRVTEEY  174

Query  669  IAENIE  686
            IAENIE
Sbjct  175  IAENIE  180



>ref|XP_004241868.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum lycopersicum]
Length=406

 Score =   251 bits (642),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 147/183 (80%), Gaps = 8/183 (4%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSLW  320
            MAVDPRQIVAGVLTVTMFVMLGNMI RDHF  +       +IH T+K S ++ P     W
Sbjct  1    MAVDPRQIVAGVLTVTMFVMLGNMITRDHFYPVDSD---ISIHSTSKQSLVTGP-----W  52

Query  321  KGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV  500
               G S+KPCW +P   + D S G+VTFSLTNGPEYHVSQI+DAV+VARYLRATLVIPD+
Sbjct  53   MKGGESVKPCWTKPVPQEADQSQGFVTFSLTNGPEYHVSQIADAVIVARYLRATLVIPDI  112

Query  501  RGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIAEN  680
            RGS PGDKR F+DIY+V++FV+SLDGVVKV  ++P  +SS+NLAVVKVPNRV+E++IAEN
Sbjct  113  RGSKPGDKRKFEDIYNVERFVRSLDGVVKVETTQPAEVSSRNLAVVKVPNRVSEDYIAEN  172

Query  681  IEP  689
            IEP
Sbjct  173  IEP  175



>ref|XP_006357438.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum tuberosum]
Length=406

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 145/183 (79%), Gaps = 8/183 (4%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSLW  320
            MAVDPRQIVAGVLTVTMFVMLGNMI RDHF  +       +IH T+K S      G+  W
Sbjct  1    MAVDPRQIVAGVLTVTMFVMLGNMITRDHFYPVDSD---ISIHSTSKQSL-----GNGPW  52

Query  321  KGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV  500
               G S+K CW +P   + D S G+VTFSLTNGPEYHVSQI+DAV+VARYLRATLVIPD+
Sbjct  53   MKGGESLKTCWTKPVPQEADQSEGFVTFSLTNGPEYHVSQIADAVIVARYLRATLVIPDI  112

Query  501  RGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIAEN  680
            RGS PGDKR+F+DIYDV+ FV+SLDGVVKV  ++P  +S++NLAVVKVPNRV+EE+IAEN
Sbjct  113  RGSKPGDKRNFEDIYDVEHFVRSLDGVVKVATTQPAEVSARNLAVVKVPNRVSEEYIAEN  172

Query  681  IEP  689
            IEP
Sbjct  173  IEP  175



>ref|XP_010322803.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Solanum lycopersicum]
Length=405

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 147/183 (80%), Gaps = 9/183 (5%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSLW  320
            MAVDPRQIVAGVLTVTMFVMLGNMI RDHF  +       +IH T+K S ++ P     W
Sbjct  1    MAVDPRQIVAGVLTVTMFVMLGNMITRDHFYPVDSD---ISIHSTSKQSLVTGP-----W  52

Query  321  KGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV  500
               G S+KPCW +P +   D S G+VTFSLTNGPEYHVSQI+DAV+VARYLRATLVIPD+
Sbjct  53   MKGGESVKPCWTKP-VPQADQSQGFVTFSLTNGPEYHVSQIADAVIVARYLRATLVIPDI  111

Query  501  RGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIAEN  680
            RGS PGDKR F+DIY+V++FV+SLDGVVKV  ++P  +SS+NLAVVKVPNRV+E++IAEN
Sbjct  112  RGSKPGDKRKFEDIYNVERFVRSLDGVVKVETTQPAEVSSRNLAVVKVPNRVSEDYIAEN  171

Query  681  IEP  689
            IEP
Sbjct  172  IEP  174



>ref|XP_006357439.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Solanum tuberosum]
Length=405

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 145/183 (79%), Gaps = 9/183 (5%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSLW  320
            MAVDPRQIVAGVLTVTMFVMLGNMI RDHF  +       +IH T+K S      G+  W
Sbjct  1    MAVDPRQIVAGVLTVTMFVMLGNMITRDHFYPVDSD---ISIHSTSKQSL-----GNGPW  52

Query  321  KGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV  500
               G S+K CW +P +   D S G+VTFSLTNGPEYHVSQI+DAV+VARYLRATLVIPD+
Sbjct  53   MKGGESLKTCWTKP-VPQADQSEGFVTFSLTNGPEYHVSQIADAVIVARYLRATLVIPDI  111

Query  501  RGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIAEN  680
            RGS PGDKR+F+DIYDV+ FV+SLDGVVKV  ++P  +S++NLAVVKVPNRV+EE+IAEN
Sbjct  112  RGSKPGDKRNFEDIYDVEHFVRSLDGVVKVATTQPAEVSARNLAVVKVPNRVSEEYIAEN  171

Query  681  IEP  689
            IEP
Sbjct  172  IEP  174



>ref|XP_010110886.1| hypothetical protein L484_004969 [Morus notabilis]
 gb|EXC28839.1| hypothetical protein L484_004969 [Morus notabilis]
Length=420

 Score =   244 bits (623),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 148/191 (77%), Gaps = 10/191 (5%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQES-----RLTSTIHDTNKASELSLP-  302
            M VD RQ+VAG+LT+TMFVMLG MIKRDHFD+ QE+      +        K   ++LP 
Sbjct  1    MGVDLRQVVAGILTLTMFVMLGQMIKRDHFDSAQETFPGDRHVNLENAKIAKQGIVTLPE  60

Query  303  --GGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLR  476
              GG   WKGDG  +K CW +P+L D + +NG+V FSLTNGPEYHVSQISDAVVVARYL 
Sbjct  61   KSGGP--WKGDGEELKACWSKPALDDVEQTNGFVIFSLTNGPEYHVSQISDAVVVARYLG  118

Query  477  ATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRV  656
            ATLV+PD+RGSNPGD+R F++IYDV++FVKSLDGVV+VT   P  LS+KNLAVVKVPNRV
Sbjct  119  ATLVVPDIRGSNPGDQRSFEEIYDVEKFVKSLDGVVRVTKDPPAKLSTKNLAVVKVPNRV  178

Query  657  TEEHIAENIEP  689
            TE++I E+IEP
Sbjct  179  TEDYIVEHIEP  189



>gb|EPS57961.1| hypothetical protein M569_16856 [Genlisea aurea]
Length=409

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 143/183 (78%), Gaps = 6/183 (3%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGD-SL  317
            MAVDPR  +AGVLT+TMFVML +M+KRD  D+         IH++NKASE  + GGD   
Sbjct  1    MAVDPRHALAGVLTLTMFVMLADMVKRDLSDSAYPG-----IHNSNKASEGGVAGGDIGP  55

Query  318  WKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPD  497
            WK DG  +KPCWE+P++ + D S GYVTFSLT GPEYHVSQI+DAVVVARYLRA LVIPD
Sbjct  56   WKEDGSRLKPCWEKPAVEEADESQGYVTFSLTTGPEYHVSQIADAVVVARYLRANLVIPD  115

Query  498  VRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIAE  677
            +RGS PGDKR F+D+YD D+ + SLDGVVKV  S+P  +S+ +LAVVK+PNRVTEE+IA 
Sbjct  116  IRGSKPGDKRKFEDVYDTDKLIASLDGVVKVLKSQPASVSANDLAVVKIPNRVTEEYIAR  175

Query  678  NIE  686
            N+E
Sbjct  176  NVE  178



>ref|XP_002275416.1| PREDICTED: uncharacterized protein LOC100250173 [Vitis vinifera]
 emb|CBI25299.3| unnamed protein product [Vitis vinifera]
Length=417

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 146/189 (77%), Gaps = 6/189 (3%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSL---PGGD  311
            M VDPRQI+AG LTVTMFVML NMIKR+HFD+++     +   D N A E SL   PGG 
Sbjct  1    MGVDPRQILAGFLTVTMFVMLANMIKREHFDSVKTPAAANIRLDENPAVEQSLAKLPGGT  60

Query  312  SL--WKGDGLS-MKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRAT  482
            +   WK D    +KPCW +P L + + S G+VTFSLTNGPEYHVSQI+DAVVVARYL AT
Sbjct  61   TTGPWKEDEWQELKPCWAKPDLGNSEKSTGFVTFSLTNGPEYHVSQIADAVVVARYLGAT  120

Query  483  LVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTE  662
            LV+PD+RGS  GDKRDF++IYDV++F+KSL+GVV+VT  +P  LS++N+AVV+VPNRVTE
Sbjct  121  LVVPDIRGSKRGDKRDFEEIYDVEKFMKSLEGVVRVTKDQPAELSAQNIAVVRVPNRVTE  180

Query  663  EHIAENIEP  689
            EH+ E I P
Sbjct  181  EHVEEYIAP  189



>ref|XP_010696089.1| PREDICTED: uncharacterized protein LOC104908654 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=450

 Score =   240 bits (612),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 146/188 (78%), Gaps = 5/188 (3%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTS---TIHDTNKASELSLPGGD  311
            + VDPRQI+AG LTVTMFVML +MI+RDHF +  E R+T    T ++ +K  E +    D
Sbjct  31   IMVDPRQILAGFLTVTMFVMLAHMIRRDHFSSHSEVRMTPFPMTSYEGSKFEEHNTLSVD  90

Query  312  S--LWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATL  485
            S  LW+ D   +KPCW +PSL +G+LS+GYVTFSLT+GPEYHVSQI+DAVVVA+ L ATL
Sbjct  91   SSGLWRDDASELKPCWTKPSLEEGELSDGYVTFSLTDGPEYHVSQIADAVVVAKSLGATL  150

Query  486  VIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEE  665
            VIPD+RGS  GDKRDF D+YD ++F+ SLDGVV+V    PT +S+K LAVVKVPNRVT+E
Sbjct  151  VIPDIRGSKLGDKRDFDDVYDAEKFISSLDGVVRVVRQPPTKISTKKLAVVKVPNRVTKE  210

Query  666  HIAENIEP  689
            HI ENIEP
Sbjct  211  HIVENIEP  218



>gb|KDO45578.1| hypothetical protein CISIN_1g014966mg [Citrus sinensis]
Length=415

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 144/187 (77%), Gaps = 5/187 (3%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSLW  320
            M VD RQ+VAG+LT+TMFVMLGNMIKRDHFD++ E +L   + D  K +E  L     L 
Sbjct  1    MGVDLRQVVAGILTLTMFVMLGNMIKRDHFDSITE-KLPGDVQDVAKVAEEGLRTIAKLS  59

Query  321  KG----DGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLV  488
            KG    DG  +KPCW + +  + + S GYVTFSLTNGPEYHVSQI+DAVVVAR LRATLV
Sbjct  60   KGPWLEDGEQLKPCWSKTNFDEIEESRGYVTFSLTNGPEYHVSQIADAVVVARVLRATLV  119

Query  489  IPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEH  668
            +PD+RGS PGD+R F+D+YDV++F++SLDGVVKV    P  +S +NLAVVKVPNRVTE+H
Sbjct  120  VPDIRGSKPGDERKFEDVYDVNKFIRSLDGVVKVVKELPEEISFRNLAVVKVPNRVTEDH  179

Query  669  IAENIEP  689
            I ENI+P
Sbjct  180  IIENIQP  186



>ref|XP_006492037.1| PREDICTED: uncharacterized protein LOC102630315 [Citrus sinensis]
Length=415

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 144/187 (77%), Gaps = 5/187 (3%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSLW  320
            M VD RQ+VAG+LT+TMFVMLGNMIKRDHFD++ E +L   + D  K +E  L     L 
Sbjct  1    MGVDLRQVVAGILTLTMFVMLGNMIKRDHFDSITE-KLPGDVQDVAKVAEEGLRTIAKLS  59

Query  321  KG----DGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLV  488
            KG    DG  +KPCW + +  + + S GYVTFSLTNGPEYHVSQI+DAVVVAR LRATLV
Sbjct  60   KGPWLEDGEQLKPCWSKTNFDEIEESRGYVTFSLTNGPEYHVSQIADAVVVARVLRATLV  119

Query  489  IPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEH  668
            +PD+RGS PGD+R F+D+YDV++F++SLDGVVKV    P  +S +NLAVVKVPNRVTE+H
Sbjct  120  VPDIRGSKPGDERKFEDVYDVNKFIRSLDGVVKVVKELPEEISFRNLAVVKVPNRVTEDH  179

Query  669  IAENIEP  689
            I ENI+P
Sbjct  180  IIENIQP  186



>ref|XP_006427746.1| hypothetical protein CICLE_v10025717mg [Citrus clementina]
 gb|ESR40986.1| hypothetical protein CICLE_v10025717mg [Citrus clementina]
Length=415

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 144/187 (77%), Gaps = 5/187 (3%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSLW  320
            M VD RQ+VAG+LT+TMFVMLGNMIKRDHFD++ E +L   + D  K +E  L     L 
Sbjct  1    MGVDLRQVVAGILTLTMFVMLGNMIKRDHFDSITE-KLPGDVQDVAKVAEEGLRTIAKLS  59

Query  321  KG----DGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLV  488
            KG    DG  +KPCW + +  + + S GYVTFSLTNGPEYHVSQI+DAVVVAR LRATLV
Sbjct  60   KGPWLEDGEQLKPCWSKTNFDEIEESRGYVTFSLTNGPEYHVSQIADAVVVARVLRATLV  119

Query  489  IPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEH  668
            +PD+RGS PGD+R F+D+YDV++F++SLDGVVKV    P  +S +NLAVVKVPNRVTE+H
Sbjct  120  VPDIRGSKPGDERKFEDVYDVNKFIRSLDGVVKVVKELPEEISFRNLAVVKVPNRVTEDH  179

Query  669  IAENIEP  689
            I ENI+P
Sbjct  180  IIENIQP  186



>ref|XP_010696090.1| PREDICTED: uncharacterized protein LOC104908654 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=449

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 146/188 (78%), Gaps = 6/188 (3%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTS---TIHDTNKASELSLPGGD  311
            + VDPRQI+AG LTVTMFVML +MI+RDHF +  E R+T    T ++ +K  E +    D
Sbjct  31   IMVDPRQILAGFLTVTMFVMLAHMIRRDHFSSHSEVRMTPFPMTSYEGSKFEEHNTLSVD  90

Query  312  S--LWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATL  485
            S  LW+ D   +KPCW +PSL +G+LS+GYVTFSLT+GPEYHVSQI+DAVVVA+ L ATL
Sbjct  91   SSGLWRDDASELKPCWTKPSL-EGELSDGYVTFSLTDGPEYHVSQIADAVVVAKSLGATL  149

Query  486  VIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEE  665
            VIPD+RGS  GDKRDF D+YD ++F+ SLDGVV+V    PT +S+K LAVVKVPNRVT+E
Sbjct  150  VIPDIRGSKLGDKRDFDDVYDAEKFISSLDGVVRVVRQPPTKISTKKLAVVKVPNRVTKE  209

Query  666  HIAENIEP  689
            HI ENIEP
Sbjct  210  HIVENIEP  217



>ref|XP_009786113.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=403

 Score =   234 bits (597),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 143/183 (78%), Gaps = 11/183 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSLW  320
            M VDPRQ++AGVLT+TMFVMLG+MIKRDHFD+       ++IH T K S         + 
Sbjct  1    MGVDPRQVLAGVLTITMFVMLGDMIKRDHFDSQLPVDSDTSIHSTRKQS--------LVI  52

Query  321  KGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV  500
             GDG S+KPC     + + D S G+VTFSLTNGPEYHVSQI+DAVV+ARYLRA LV+PD+
Sbjct  53   DGDGPSLKPCRPISLIEEADESQGFVTFSLTNGPEYHVSQIADAVVIARYLRANLVLPDI  112

Query  501  RGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIAEN  680
            RGS PGDKR+F+++YDV+ FVKSL+GVVKVT S+P   S +NLAVVKVP+RVTEE+IA+N
Sbjct  113  RGSEPGDKRNFEEVYDVEHFVKSLNGVVKVTKSQP---SKRNLAVVKVPSRVTEEYIADN  169

Query  681  IEP  689
            IEP
Sbjct  170  IEP  172



>ref|XP_007215446.1| hypothetical protein PRUPE_ppa006341mg [Prunus persica]
 gb|EMJ16645.1| hypothetical protein PRUPE_ppa006341mg [Prunus persica]
Length=416

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 145/187 (78%), Gaps = 6/187 (3%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPG----G  308
            M VD RQ+VAG+LT+ MFVMLGNMIKRDHFD+++E +   +  DT + +++S  G     
Sbjct  1    MGVDLRQVVAGILTLAMFVMLGNMIKRDHFDSVEE-KFPGSERDTLENAKISKEGLSKKN  59

Query  309  DSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLV  488
               WK DG  +KPCW +PS  D + + GYV FSLTNGPEYHVSQI+DAVVVARYL ATLV
Sbjct  60   SGPWKDDGQELKPCWSKPS-DDVEQTEGYVLFSLTNGPEYHVSQIADAVVVARYLGATLV  118

Query  489  IPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEH  668
            +PD+RG+ PGD+R+F++IYDV++F+ SLDGVV+V    P  LS+KNLA VKVPNRVTE++
Sbjct  119  LPDIRGTKPGDERNFEEIYDVEKFISSLDGVVRVAKERPGKLSTKNLAAVKVPNRVTEDY  178

Query  669  IAENIEP  689
            I E++EP
Sbjct  179  IVEHVEP  185



>ref|XP_009333975.1| PREDICTED: uncharacterized protein At1g04910-like [Pyrus x bretschneideri]
Length=420

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 142/190 (75%), Gaps = 8/190 (4%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSL-  317
            M VD RQ+VAGVLT+TMFVMLGNMIKRDHFD+++E        DT + SE S  G  S  
Sbjct  1    MGVDLRQVVAGVLTLTMFVMLGNMIKRDHFDSVEEKFPGGGGRDTLETSEYSKEGLGSFA  60

Query  318  ------WKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
                  WK DG  +K CW +PS  D + + GYV FSLTNGPEYHVSQ++DAVVVARYL A
Sbjct  61   KKNGGPWKDDGEELKQCWSKPS-DDVEQTEGYVLFSLTNGPEYHVSQVADAVVVARYLGA  119

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVT  659
            TLV+PD+RG+ PGD+R+F +IYDV++F+ SLDGVVKV    P  LS++NLA VKVPNRVT
Sbjct  120  TLVLPDIRGTKPGDERNFDEIYDVEKFISSLDGVVKVVKKRPGKLSTRNLAAVKVPNRVT  179

Query  660  EEHIAENIEP  689
            E++I E++EP
Sbjct  180  EDYIVEHVEP  189



>ref|XP_008227941.1| PREDICTED: uncharacterized protein At1g04910 [Prunus mume]
Length=416

 Score =   231 bits (590),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 145/187 (78%), Gaps = 6/187 (3%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPG----G  308
            M VD RQ+VAG+LT+ MFVMLGNMIKRDHFD+++E +   +  DT + +++S  G     
Sbjct  1    MGVDLRQVVAGILTLAMFVMLGNMIKRDHFDSVEE-KFPGSGRDTLENAKISKEGLSKKN  59

Query  309  DSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLV  488
               WK DG  +KPCW +PS  D + + GYV FSLTNGPEYHVSQI+DAVVVARYL ATLV
Sbjct  60   SGPWKDDGQELKPCWSKPS-DDVEQTEGYVLFSLTNGPEYHVSQIADAVVVARYLGATLV  118

Query  489  IPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEH  668
            +PD+RG+ PGD+R+F++IYDV++F+ SLDGVV+V    P  LS++NLA VKVPNRVTE++
Sbjct  119  LPDIRGTKPGDERNFEEIYDVEKFISSLDGVVRVVKERPGKLSTRNLAAVKVPNRVTEDY  178

Query  669  IAENIEP  689
            I E++EP
Sbjct  179  IVEHVEP  185



>ref|XP_009594206.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
tomentosiformis]
Length=403

 Score =   231 bits (588),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 142/183 (78%), Gaps = 11/183 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSLW  320
            M VDPRQ++AGVLT+TMFVMLG+MIKRDHFD+       ++IH T K +         + 
Sbjct  1    MGVDPRQVLAGVLTITMFVMLGDMIKRDHFDSQLPVDSDTSIHSTRKQT--------LVI  52

Query  321  KGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV  500
             GDG S+KPC   P + + D S G+VTFSLTNGPEYHVSQI+DAVV+ARYLRA LV+PD+
Sbjct  53   DGDGPSLKPCLPIPLIEEADESQGFVTFSLTNGPEYHVSQIADAVVIARYLRANLVLPDI  112

Query  501  RGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIAEN  680
            RGS PGDKR+F+++YDV+  VKSL+GVVKVT S+P   S +NLAVVKVP+RV+EE+I +N
Sbjct  113  RGSEPGDKRNFEEVYDVEHLVKSLNGVVKVTKSQP---SKRNLAVVKVPSRVSEEYIVDN  169

Query  681  IEP  689
            IEP
Sbjct  170  IEP  172



>ref|XP_007150835.1| hypothetical protein PHAVU_005G184800g [Phaseolus vulgaris]
 gb|ESW22829.1| hypothetical protein PHAVU_005G184800g [Phaseolus vulgaris]
Length=410

 Score =   231 bits (589),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 143/187 (76%), Gaps = 5/187 (3%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTN----KASELSLPGG  308
            M VD RQ+VA  LT+TMFVMLGNMIKRDHFD+LQE +L     D+N    K     +   
Sbjct  1    MGVDLRQVVAAALTLTMFVMLGNMIKRDHFDSLQE-KLPGGSEDSNFENAKFDATHVRKN  59

Query  309  DSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLV  488
              LWKGD   +KPCW +PS  D + + G+VTF+LTNGPEYH+SQI+DAV+VAR L ATLV
Sbjct  60   IGLWKGDMDDLKPCWVKPSADDVERTEGFVTFALTNGPEYHISQIADAVIVARSLGATLV  119

Query  489  IPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEH  668
            IPD+RGS PGD+R+F+DIYD+D F+KS++GVV+V    P  +S++N+A VKVPNRVTE++
Sbjct  120  IPDIRGSQPGDRRNFEDIYDIDVFMKSMEGVVRVVKDLPAHISTRNIAAVKVPNRVTEDY  179

Query  669  IAENIEP  689
            IAE++EP
Sbjct  180  IAEHVEP  186



>ref|XP_008365624.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=420

 Score =   229 bits (585),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 141/190 (74%), Gaps = 8/190 (4%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSL-  317
            M VD RQ+VAGVLT+ MFVMLGNMIKRDHFD+++E        DT + SE S  G  S  
Sbjct  1    MGVDLRQVVAGVLTLAMFVMLGNMIKRDHFDSVEEKFPGGGGRDTLETSEYSKEGLGSFA  60

Query  318  ------WKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
                  WK DG  +K CW +PS  D + + GYV FSLTNGPEYHVSQ++DAVVVARYL A
Sbjct  61   KKNGGPWKDDGEELKQCWSKPS-DDVEQTEGYVLFSLTNGPEYHVSQVADAVVVARYLGA  119

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVT  659
            TLV+PD+RG+ PGD+R+  +IYDV++F+ SLDGVVKV    P  LS++NLA VKVPNRVT
Sbjct  120  TLVLPDIRGTKPGDERNXDEIYDVEKFISSLDGVVKVVKKRPGKLSTRNLAAVKVPNRVT  179

Query  660  EEHIAENIEP  689
            E++IAE++EP
Sbjct  180  EDYIAEHVEP  189



>ref|XP_003543719.1| PREDICTED: uncharacterized protein LOC100807062 isoform X1 [Glycine 
max]
Length=409

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 140/187 (75%), Gaps = 4/187 (2%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTN----KASELSLPGG  308
            M +D RQ+VA VLT+TMFVMLGNMIKRDHFD   + +L     D N    K     +   
Sbjct  1    MGLDLRQVVAAVLTLTMFVMLGNMIKRDHFDNSLQEKLPGGSEDANFETAKFDATHVRKN  60

Query  309  DSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLV  488
              LWKGD   +KPCW +PS  D + + G+VTF+LTNGPEYH+SQI+DAV+VAR L ATLV
Sbjct  61   IGLWKGDADGLKPCWVKPSADDVEQTQGFVTFALTNGPEYHISQIADAVIVARSLGATLV  120

Query  489  IPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEH  668
            IPD+RGS PGDK +F+DIYDVD F+KS++GVV+V    PT +S++N+A VKVPNRVTE++
Sbjct  121  IPDIRGSQPGDKWNFEDIYDVDVFMKSMEGVVRVAKDLPTHISTRNIAAVKVPNRVTEDY  180

Query  669  IAENIEP  689
            IAE++EP
Sbjct  181  IAEHVEP  187



>ref|XP_008353648.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=420

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 141/190 (74%), Gaps = 8/190 (4%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSL-  317
            M VD RQ+VAG+LT+ MFVMLGNMIKRDHFD+++E        DT + S+ S  G  S  
Sbjct  1    MGVDLRQVVAGILTLAMFVMLGNMIKRDHFDSVEEKFPGGGGRDTLETSKYSKEGLVSFA  60

Query  318  ------WKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
                  WK DG  +K CW +PS  D + + GYV FSLTNGPEYHVSQ++DAVVVARYL A
Sbjct  61   KKNGGPWKDDGEELKQCWSKPS-DDVEQTEGYVLFSLTNGPEYHVSQVADAVVVARYLGA  119

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVT  659
            TLV+PD+RG+NPGD+R+F +IYD ++F+ SLDGVV+V    P  LS++NLA VKVPNRVT
Sbjct  120  TLVLPDIRGTNPGDERNFDEIYDAEKFISSLDGVVRVVKERPGKLSTRNLAAVKVPNRVT  179

Query  660  EEHIAENIEP  689
            E++I E++EP
Sbjct  180  EDYIVEHVEP  189



>ref|XP_004303832.1| PREDICTED: uncharacterized protein LOC101293906 [Fragaria vesca 
subsp. vesca]
Length=417

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 145/188 (77%), Gaps = 6/188 (3%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSLW  320
            M VD RQ+VAG+LTVTMFVMLG+MIKRDHFD ++E +         + +++S  G  SL 
Sbjct  1    MGVDLRQVVAGILTVTMFVMLGHMIKRDHFDYVEE-KFPGDGRGALENAKISKEGLFSLA  59

Query  321  KGDGLS-----MKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATL  485
            K  G++     +KPCW +P+L D + + G+V FSLTNGPEYHVSQI+DAVVVARYL ATL
Sbjct  60   KKGGITDDDQELKPCWSKPALDDVEQTEGFVLFSLTNGPEYHVSQIADAVVVARYLGATL  119

Query  486  VIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEE  665
            V+PD+RGS PGD+R+F++IYDV++F+ SLDGVV+V    P  LSS+NLA VKVPNRVTE+
Sbjct  120  VVPDIRGSKPGDERNFEEIYDVEKFILSLDGVVRVAKERPGKLSSRNLAAVKVPNRVTED  179

Query  666  HIAENIEP  689
            +I E++EP
Sbjct  180  YIVEHVEP  187



>gb|ACU23517.1| unknown [Glycine max]
Length=411

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 141/187 (75%), Gaps = 4/187 (2%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASEL----SLPGG  308
            M VD RQ+VAGVLT+TMFVMLGNMIKRDHFD   + +L     D N  +       +   
Sbjct  1    MGVDLRQVVAGVLTLTMFVMLGNMIKRDHFDNSLQEKLPGGSEDANFETATFDATHVRKN  60

Query  309  DSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLV  488
              LWKGD   +KPCW +PS  D + + G+VTF+LTNGPEYH+SQI+DAV+VAR L ATLV
Sbjct  61   IGLWKGDVDDLKPCWVKPSSDDVEQTQGFVTFALTNGPEYHISQIADAVIVARNLGATLV  120

Query  489  IPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEH  668
            +PD+RGS PGDK +F+DIYDVD F+KS++GVV+V    PT +S++N+A VKVPNRVTE++
Sbjct  121  MPDIRGSQPGDKWNFEDIYDVDVFMKSMEGVVRVVKDLPTRISTRNIAAVKVPNRVTEDY  180

Query  669  IAENIEP  689
            IAE++EP
Sbjct  181  IAEHVEP  187



>gb|KHN31859.1| DUF246 domain-containing protein [Glycine soja]
Length=409

 Score =   227 bits (578),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 139/187 (74%), Gaps = 4/187 (2%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTN----KASELSLPGG  308
            M +D RQ+VA VLT+TMFVMLGNMIKRDHFD   + +L     D N    K     +   
Sbjct  1    MGLDLRQVVAAVLTLTMFVMLGNMIKRDHFDNSLQEKLPGGSEDANFETAKFDATHVRKN  60

Query  309  DSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLV  488
              LWKGD   +KPCW +PS  D + + G+VTF+LTNGPEYH+SQI+DAV+VAR L ATLV
Sbjct  61   IGLWKGDADGLKPCWVKPSADDVEQTQGFVTFALTNGPEYHISQIADAVIVARSLGATLV  120

Query  489  IPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEH  668
            IPD+RGS PGDK +F+DIYDVD F+KS++GVV+V    PT +S++N+A VKVPNRV E++
Sbjct  121  IPDIRGSQPGDKWNFEDIYDVDVFMKSMEGVVRVAKDLPTHISTRNIAAVKVPNRVKEDY  180

Query  669  IAENIEP  689
            IAE++EP
Sbjct  181  IAEHVEP  187



>ref|XP_003546222.1| PREDICTED: uncharacterized protein LOC100789772 isoform X1 [Glycine 
max]
 gb|KHN22386.1| DUF246 domain-containing protein [Glycine soja]
Length=411

 Score =   227 bits (578),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 141/187 (75%), Gaps = 4/187 (2%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASEL----SLPGG  308
            M VD RQ+VAGVLT+TMFVMLGNMIKRDHFD   + +L     D N  +       +   
Sbjct  1    MGVDLRQVVAGVLTLTMFVMLGNMIKRDHFDNSLQEKLPGGSEDANFETATFDATHVRKN  60

Query  309  DSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLV  488
              LWKGD   +KPCW +PS  D + + G+VTF+LTNGPEYH+SQI+DAV+VAR L ATLV
Sbjct  61   IGLWKGDVDDLKPCWVKPSSDDVEQTQGFVTFALTNGPEYHISQIADAVIVARNLGATLV  120

Query  489  IPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEH  668
            +PD+RGS PGDK +F+DIYDVD F+KS++GVV+V    PT +S++N+A VKVPNRVTE++
Sbjct  121  MPDIRGSQPGDKWNFEDIYDVDVFMKSMEGVVRVVKDLPTRISTRNIAAVKVPNRVTEDY  180

Query  669  IAENIEP  689
            IAE++EP
Sbjct  181  IAEHVEP  187



>ref|XP_009349642.1| PREDICTED: uncharacterized protein At1g04910-like [Pyrus x bretschneideri]
Length=420

 Score =   227 bits (578),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 141/190 (74%), Gaps = 8/190 (4%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSL-  317
            M VD RQ+VAG+LT+ MFVMLGNMIKRDHFD+++E        DT + S+ S  G  S  
Sbjct  1    MGVDLRQVVAGILTLAMFVMLGNMIKRDHFDSVEEKFPGGGGRDTLETSKYSKEGLVSFA  60

Query  318  ------WKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
                  WK DG  +K CW +PS  D + + GYV FSLTNGPEYHVSQ++DAVVVARYL A
Sbjct  61   KKNGGPWKDDGEELKQCWSKPS-DDVEQTEGYVLFSLTNGPEYHVSQVADAVVVARYLGA  119

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVT  659
            TLV+PD+RG+NPGD+R+F +IYD ++F+ SLDGVV+V    P  LS++N+A VKVPNRVT
Sbjct  120  TLVLPDIRGTNPGDERNFDEIYDAEKFISSLDGVVRVVKERPGKLSTRNIAAVKVPNRVT  179

Query  660  EEHIAENIEP  689
            E++I E++EP
Sbjct  180  EDYIVEHVEP  189



>gb|KJB66475.1| hypothetical protein B456_010G141100 [Gossypium raimondii]
 gb|KJB66476.1| hypothetical protein B456_010G141100 [Gossypium raimondii]
Length=422

 Score =   226 bits (577),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 139/193 (72%), Gaps = 12/193 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKAS----------E  290
            M +D RQ+VAG+LT+TMFVMLG MIKRDHFD+LQ+ +L     D    +          +
Sbjct  1    MGIDLRQVVAGILTLTMFVMLGQMIKRDHFDSLQD-KLPGEAQDVQVGNANVIEKDGLVK  59

Query  291  LSLPGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARY  470
            LS  G    W  D   +KPCW R +    + S GYVTFSLTNGPEYHVSQ++DAV+VARY
Sbjct  60   LS-KGSKGPWMKDSQELKPCWSRTTFDGIEQSRGYVTFSLTNGPEYHVSQMADAVIVARY  118

Query  471  LRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPN  650
            L A LV+PD+RGS PGD+R+FKDIYDV++F+KSLDGVVKV    P  +S ++LA VKVPN
Sbjct  119  LAAALVLPDIRGSRPGDERNFKDIYDVEKFMKSLDGVVKVVKQLPNEISIRDLAAVKVPN  178

Query  651  RVTEEHIAENIEP  689
            RVTE+HI EN++P
Sbjct  179  RVTEDHIVENVQP  191



>gb|ACU20281.1| unknown [Glycine max]
Length=211

 Score =   218 bits (556),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 141/190 (74%), Gaps = 12/190 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTL-------QESRLTSTIHDTNKASELSL  299
            M VD RQ+VAGVLT+TMFVML +MIKRDHFD +       ++    ST  DT    +   
Sbjct  1    MGVDLRQVVAGVLTLTMFVMLIHMIKRDHFDAVDDKLPGTEDVSFESTNFDTTHVRK---  57

Query  300  PGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
                 +WKGDG  +KPCW +PS  + D + G+VTFSLTNGPEYH+SQI+DAV+VAR L A
Sbjct  58   --NIGIWKGDGDELKPCWLKPSEDNVDQTEGFVTFSLTNGPEYHISQIADAVLVARSLGA  115

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVT  659
            TLVIPD+RGS PGDKR+F+DIYDVD F+KS++GVV+V    P+ +S+  +A VKVPNRVT
Sbjct  116  TLVIPDIRGSQPGDKRNFEDIYDVDVFMKSMEGVVRVLKDLPSHVSTHKIAAVKVPNRVT  175

Query  660  EEHIAENIEP  689
            E++IA+++EP
Sbjct  176  EDYIAQHVEP  185



>gb|KHG26733.1| hypothetical protein F383_08102 [Gossypium arboreum]
Length=422

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/193 (60%), Positives = 141/193 (73%), Gaps = 12/193 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSL-  317
            M VD RQ+VAG+LT+TMFVMLG MIKRDHFD+LQ+ +L     D +  S  ++   D L 
Sbjct  1    MGVDLRQVVAGILTLTMFVMLGQMIKRDHFDSLQD-KLPGEGEDAHFESVNAIEN-DGLV  58

Query  318  ---------WKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARY  470
                     W  D   +KPCW R  L + + S GYVTFSLTNGPEYHVSQ++DAVVVARY
Sbjct  59   KLSKRSKGPWMEDIQELKPCWSRTDLDELEQSRGYVTFSLTNGPEYHVSQVADAVVVARY  118

Query  471  LRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPN  650
            L ATLV+PD+RGS PGD R+F+DIYDVD+F+KSLDGVVKV    P  +S ++LA VKVPN
Sbjct  119  LTATLVLPDIRGSKPGDVRNFEDIYDVDKFMKSLDGVVKVAKELPNEISIRDLAAVKVPN  178

Query  651  RVTEEHIAENIEP  689
            RVTE+HI E++EP
Sbjct  179  RVTEDHIVESVEP  191



>gb|KJB56404.1| hypothetical protein B456_009G118400 [Gossypium raimondii]
Length=422

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/193 (60%), Positives = 141/193 (73%), Gaps = 12/193 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSL-  317
            M VD RQ+VAG+LT+TMFVMLG MIKRDHFD+LQ+ +L     D +  S  ++   D L 
Sbjct  1    MGVDLRQVVAGILTLTMFVMLGQMIKRDHFDSLQD-KLPGDGEDAHFESVNAIEN-DGLV  58

Query  318  ---------WKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARY  470
                     W  D   +KPCW R  L + + S GYVTFSLTNGPEYHVSQI+DAVVVARY
Sbjct  59   KLSKRSKGPWMEDIQELKPCWSRTDLDEIEQSRGYVTFSLTNGPEYHVSQIADAVVVARY  118

Query  471  LRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPN  650
            L ATLV+PD+RGS PGD R+F+DIYDVD+F+KSLDG+VKV    P  +S ++LA VKVPN
Sbjct  119  LTATLVLPDIRGSKPGDVRNFEDIYDVDKFMKSLDGIVKVAKELPNEISIRDLAAVKVPN  178

Query  651  RVTEEHIAENIEP  689
            RVTE+HI E++EP
Sbjct  179  RVTEDHIVESVEP  191



>ref|XP_006595200.1| PREDICTED: uncharacterized protein LOC100807062 isoform X2 [Glycine 
max]
Length=407

 Score =   224 bits (570),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 142/185 (77%), Gaps = 2/185 (1%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFD-TLQESRLTSTIH-DTNKASELSLPGGDS  314
            M +D RQ+VA VLT+TMFVMLGNMIKRDHFD +LQ    +   + +T K     +     
Sbjct  1    MGLDLRQVVAAVLTLTMFVMLGNMIKRDHFDNSLQLPGGSEDANFETAKFDATHVRKNIG  60

Query  315  LWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIP  494
            LWKGD   +KPCW +PS  D + + G+VTF+LTNGPEYH+SQI+DAV+VAR L ATLVIP
Sbjct  61   LWKGDADGLKPCWVKPSADDVEQTQGFVTFALTNGPEYHISQIADAVIVARSLGATLVIP  120

Query  495  DVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIA  674
            D+RGS PGDK +F+DIYDVD F+KS++GVV+V    PT +S++N+A VKVPNRVTE++IA
Sbjct  121  DIRGSQPGDKWNFEDIYDVDVFMKSMEGVVRVAKDLPTHISTRNIAAVKVPNRVTEDYIA  180

Query  675  ENIEP  689
            E++EP
Sbjct  181  EHVEP  185



>gb|KHG06209.1| hypothetical protein F383_32398 [Gossypium arboreum]
Length=422

 Score =   224 bits (570),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 138/192 (72%), Gaps = 10/192 (5%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTN-------KASELSL  299
            M +D RQ+VAG+LT+TMFVMLG MIKRDHFD+LQ+ +L     D         +   L  
Sbjct  1    MGIDLRQVVAGILTLTMFVMLGQMIKRDHFDSLQD-KLPGEAQDVQVDNANVIEKDGLVK  59

Query  300  P--GGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYL  473
            P  G    W  D   +KPCW R +    + S GYVTFSLTNGPEYHVSQ++DAVVVARYL
Sbjct  60   PSKGSKGPWMKDSQELKPCWSRTTFDGIEQSRGYVTFSLTNGPEYHVSQMADAVVVARYL  119

Query  474  RATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNR  653
             A LV+PD+RGS PGD+R+F+DIYDV++F+KSL+GVVKV    P  +S ++LA VKVPNR
Sbjct  120  EAALVLPDIRGSRPGDERNFEDIYDVEKFMKSLNGVVKVVKELPNEISIRDLAAVKVPNR  179

Query  654  VTEEHIAENIEP  689
            VTE+HI EN++P
Sbjct  180  VTEDHIVENVQP  191



>ref|XP_006427747.1| hypothetical protein CICLE_v10025717mg [Citrus clementina]
 gb|ESR40987.1| hypothetical protein CICLE_v10025717mg [Citrus clementina]
Length=408

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 140/187 (75%), Gaps = 12/187 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSLW  320
            M VD RQ+VAG+LT+TMFVMLGNMIKRDHFD++ E +L   + D  K +E  L     L 
Sbjct  1    MGVDLRQVVAGILTLTMFVMLGNMIKRDHFDSITE-KLPGDVQDVAKVAEEGLRTIAKLS  59

Query  321  KG----DGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLV  488
            KG    DG  +KP        + + S GYVTFSLTNGPEYHVSQI+DAVVVAR LRATLV
Sbjct  60   KGPWLEDGEQLKP-------YEIEESRGYVTFSLTNGPEYHVSQIADAVVVARVLRATLV  112

Query  489  IPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEH  668
            +PD+RGS PGD+R F+D+YDV++F++SLDGVVKV    P  +S +NLAVVKVPNRVTE+H
Sbjct  113  VPDIRGSKPGDERKFEDVYDVNKFIRSLDGVVKVVKELPEEISFRNLAVVKVPNRVTEDH  172

Query  669  IAENIEP  689
            I ENI+P
Sbjct  173  IIENIQP  179



>gb|KDO45579.1| hypothetical protein CISIN_1g014966mg [Citrus sinensis]
Length=408

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 140/187 (75%), Gaps = 12/187 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSLW  320
            M VD RQ+VAG+LT+TMFVMLGNMIKRDHFD++ E +L   + D  K +E  L     L 
Sbjct  1    MGVDLRQVVAGILTLTMFVMLGNMIKRDHFDSITE-KLPGDVQDVAKVAEEGLRTIAKLS  59

Query  321  KG----DGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLV  488
            KG    DG  +KP        + + S GYVTFSLTNGPEYHVSQI+DAVVVAR LRATLV
Sbjct  60   KGPWLEDGEQLKP-------YEIEESRGYVTFSLTNGPEYHVSQIADAVVVARVLRATLV  112

Query  489  IPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEH  668
            +PD+RGS PGD+R F+D+YDV++F++SLDGVVKV    P  +S +NLAVVKVPNRVTE+H
Sbjct  113  VPDIRGSKPGDERKFEDVYDVNKFIRSLDGVVKVVKELPEEISFRNLAVVKVPNRVTEDH  172

Query  669  IAENIEP  689
            I ENI+P
Sbjct  173  IIENIQP  179



>ref|XP_006597087.1| PREDICTED: uncharacterized protein LOC100789772 isoform X2 [Glycine 
max]
Length=409

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 140/202 (69%), Gaps = 36/202 (18%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDS--  314
            M VD RQ+VAGVLT+TMFVMLGNMIKRDHFD                 + L LPGG    
Sbjct  1    MGVDLRQVVAGVLTLTMFVMLGNMIKRDHFD-----------------NSLQLPGGSEDA  43

Query  315  -----------------LWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQI  443
                             LWKGD   +KPCW +PS  D + + G+VTF+LTNGPEYH+SQI
Sbjct  44   NFETATFDATHVRKNIGLWKGDVDDLKPCWVKPSSDDVEQTQGFVTFALTNGPEYHISQI  103

Query  444  SDAVVVARYLRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSK  623
            +DAV+VAR L ATLV+PD+RGS PGDK +F+DIYDVD F+KS++GVV+V    PT +S++
Sbjct  104  ADAVIVARNLGATLVMPDIRGSQPGDKWNFEDIYDVDVFMKSMEGVVRVVKDLPTRISTR  163

Query  624  NLAVVKVPNRVTEEHIAENIEP  689
            N+A VKVPNRVTE++IAE++EP
Sbjct  164  NIAAVKVPNRVTEDYIAEHVEP  185



>ref|XP_012076081.1| PREDICTED: uncharacterized protein LOC105637266 isoform X2 [Jatropha 
curcas]
Length=352

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 138/190 (73%), Gaps = 7/190 (4%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESR---LTSTIHDTNKASELSLPG--  305
            M VD RQ+VAG+LT+TMFVMLGNMIKRDHFD+++E      T    D+ K +E  L    
Sbjct  1    MGVDLRQVVAGILTLTMFVMLGNMIKRDHFDSVEEKFPGGATDAEFDSGKVTEHGLVAFS  60

Query  306  --GDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
               +  W  +   +KPCW        + S G++TFSLTNGPEYH+SQI+DAVVVARY+ A
Sbjct  61   KTSNGPWMENAQELKPCWTESKFDQAERSKGFITFSLTNGPEYHISQIADAVVVARYVGA  120

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVT  659
            TLV+PD+RG+ PGD+R F++IYDVD+FV SLDGVVKV    P  +S ++ AVVK+PNRV+
Sbjct  121  TLVLPDIRGTKPGDERKFEEIYDVDKFVTSLDGVVKVAKDLPDDVSIRDFAVVKIPNRVS  180

Query  660  EEHIAENIEP  689
            E+HIAE+I+P
Sbjct  181  EDHIAESIDP  190



>ref|XP_004507011.1| PREDICTED: uncharacterized protein LOC101492011 [Cicer arietinum]
Length=419

 Score =   221 bits (563),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 142/187 (76%), Gaps = 4/187 (2%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRL----TSTIHDTNKASELSLPGG  308
            M  D RQ+VAG+LT+TMFVML +MIKRDHFD++Q+++L      TI+++ K     +   
Sbjct  1    MGFDLRQVVAGILTLTMFVMLIHMIKRDHFDSVQDNKLPGVTEDTIYESVKVDSTHVRKN  60

Query  309  DSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLV  488
              LWKGD   +K CW +PS  + + + G+VTFSLTNGPEYH+SQI+DAV+VAR L ATLV
Sbjct  61   IGLWKGDTDGLKACWVKPSGDEVEQTKGFVTFSLTNGPEYHLSQIADAVIVARSLGATLV  120

Query  489  IPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEH  668
            IPD+RGS PGDKR+F+DIYD+D F KS++GVV V    P  +++KN+A VKVPNRVTE++
Sbjct  121  IPDIRGSQPGDKRNFEDIYDIDVFKKSMEGVVSVVTDLPAQVTTKNIAAVKVPNRVTEDY  180

Query  669  IAENIEP  689
            I+ ++EP
Sbjct  181  ISRHVEP  187



>ref|XP_012076080.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Jatropha 
curcas]
 gb|KDP34445.1| hypothetical protein JCGZ_11916 [Jatropha curcas]
Length=421

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 138/190 (73%), Gaps = 7/190 (4%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESR---LTSTIHDTNKASELSLPG--  305
            M VD RQ+VAG+LT+TMFVMLGNMIKRDHFD+++E      T    D+ K +E  L    
Sbjct  1    MGVDLRQVVAGILTLTMFVMLGNMIKRDHFDSVEEKFPGGATDAEFDSGKVTEHGLVAFS  60

Query  306  --GDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
               +  W  +   +KPCW        + S G++TFSLTNGPEYH+SQI+DAVVVARY+ A
Sbjct  61   KTSNGPWMENAQELKPCWTESKFDQAERSKGFITFSLTNGPEYHISQIADAVVVARYVGA  120

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVT  659
            TLV+PD+RG+ PGD+R F++IYDVD+FV SLDGVVKV    P  +S ++ AVVK+PNRV+
Sbjct  121  TLVLPDIRGTKPGDERKFEEIYDVDKFVTSLDGVVKVAKDLPDDVSIRDFAVVKIPNRVS  180

Query  660  EEHIAENIEP  689
            E+HIAE+I+P
Sbjct  181  EDHIAESIDP  190



>gb|KHN39355.1| DUF246 domain-containing protein [Glycine soja]
Length=416

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 141/190 (74%), Gaps = 12/190 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTL-------QESRLTSTIHDTNKASELSL  299
            M VD RQ+VAGVLT+TMFVML +MIKRDHFD +       ++    ST  DT    +   
Sbjct  1    MGVDLRQVVAGVLTLTMFVMLIHMIKRDHFDAVDDKLPGTEDVGFESTNFDTTHVRK---  57

Query  300  PGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
                 +WKGDG  +KPCW +PS  + D + G+VTFSLTNGPEYH+SQI+DAV+VAR L A
Sbjct  58   --NIGIWKGDGDELKPCWLKPSEDNVDQTEGFVTFSLTNGPEYHISQIADAVLVARSLGA  115

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVT  659
            TLVIPD+RGS PGDKR+F+DIYDVD F+KS++GVV+V    P+ +SS  +A VKVPNRVT
Sbjct  116  TLVIPDIRGSQPGDKRNFEDIYDVDVFMKSMEGVVRVLKDLPSHVSSHKIAAVKVPNRVT  175

Query  660  EEHIAENIEP  689
            E++IA+++EP
Sbjct  176  EDYIAQHVEP  185



>ref|XP_003529532.1| PREDICTED: uncharacterized protein At1g04910 [Glycine max]
Length=416

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 141/190 (74%), Gaps = 12/190 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTL-------QESRLTSTIHDTNKASELSL  299
            M VD RQ+VAGVLT+TMFVML +MIKRDHFD +       ++    ST  DT    +   
Sbjct  1    MGVDLRQVVAGVLTLTMFVMLIHMIKRDHFDAVDDKLPGTEDVSFESTNFDTTHVRK---  57

Query  300  PGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
                 +WKGDG  +KPCW +PS  + D + G+VTFSLTNGPEYH+SQI+DAV+VAR L A
Sbjct  58   --NIGIWKGDGDELKPCWLKPSEDNVDQTEGFVTFSLTNGPEYHISQIADAVLVARSLGA  115

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVT  659
            TLVIPD+RGS PGDKR+F+DIYDVD F+KS++GVV+V    P+ +S+  +A VKVPNRVT
Sbjct  116  TLVIPDIRGSQPGDKRNFEDIYDVDVFMKSMEGVVRVLKDLPSHVSTHKIAAVKVPNRVT  175

Query  660  EEHIAENIEP  689
            E++IA+++EP
Sbjct  176  EDYIAQHVEP  185



>ref|XP_007023804.1| O-fucosyltransferase family protein [Theobroma cacao]
 gb|EOY26426.1| O-fucosyltransferase family protein [Theobroma cacao]
Length=422

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 138/193 (72%), Gaps = 12/193 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSL-  317
            M VD RQ+VA +LT+TMFVMLG MIKRDHFD+LQ+ +L     D+ +    ++   D L 
Sbjct  1    MGVDLRQVVAAILTLTMFVMLGQMIKRDHFDSLQD-KLPGEAQDS-QFDNTNVIENDGLV  58

Query  318  ---------WKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARY  470
                     W  D   +KPCW + +  + +   GYVTFSLTNGPEYHVSQI+DAVVVARY
Sbjct  59   KLSKRSKGPWIDDSQELKPCWSKTAFDEIEQPRGYVTFSLTNGPEYHVSQIADAVVVARY  118

Query  471  LRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPN  650
            L ATLV+PD+RGS PGD  +F+DIYDV++F+KSLDGVVKV    P  +S ++LA VKVPN
Sbjct  119  LGATLVLPDIRGSKPGDVNNFQDIYDVEKFMKSLDGVVKVAKELPNEISIRDLAAVKVPN  178

Query  651  RVTEEHIAENIEP  689
            RVTE+HI EN+EP
Sbjct  179  RVTEDHIVENVEP  191



>ref|XP_002528288.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34090.1| conserved hypothetical protein [Ricinus communis]
Length=421

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 141/189 (75%), Gaps = 7/189 (4%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESR---LTSTIHDTNKASELSL----  299
            M VD RQ++AG+LT+TMFVMLGNMIKRDHFD+++E      T    D+ K +E  L    
Sbjct  1    MGVDLRQVIAGILTLTMFVMLGNMIKRDHFDSVEEKFPGGATDVEFDSGKVTEHGLVTFA  60

Query  300  PGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
               +  W  D   +KPCW + +  + + S G+VTFSLTNGPEYH+SQI+DAVVVARYL A
Sbjct  61   KSTNGPWIEDAQELKPCWSKSNFDEVEQSKGFVTFSLTNGPEYHISQIADAVVVARYLGA  120

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVT  659
            T+V+PD+RG+ PGD+R F++IYDV++FV+SLDGVVKV    P  +S ++ AVVKVPNRVT
Sbjct  121  TIVLPDIRGNKPGDERKFEEIYDVEKFVQSLDGVVKVVKYLPDDISIRDFAVVKVPNRVT  180

Query  660  EEHIAENIE  686
            E+HI+++IE
Sbjct  181  EDHISKSIE  189



>gb|KEH28615.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=419

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 141/187 (75%), Gaps = 4/187 (2%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTN----KASELSLPGG  308
            M  D RQ+VAG+LT+TMFVML +MIKRDHFD++Q+++   +  D      K     +   
Sbjct  1    MGFDLRQVVAGILTLTMFVMLIHMIKRDHFDSVQDNKFPGSTDDVTYENVKMDTTHVRKN  60

Query  309  DSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLV  488
              LWKGD   +K CW +PS  + + ++G+VTFSLTNGPEYH+SQI+DAV+VAR L A+LV
Sbjct  61   IGLWKGDTDELKQCWVKPSGDEVEQTDGFVTFSLTNGPEYHLSQIADAVIVARNLGASLV  120

Query  489  IPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEH  668
            IPD+RGS PGDKR+F+DIYDVD F+KS++GVVKV    P+ +++K +A VKVPNRVTE++
Sbjct  121  IPDIRGSQPGDKRNFEDIYDVDVFMKSMEGVVKVVKDLPSHVTTKKIAAVKVPNRVTEDY  180

Query  669  IAENIEP  689
            IA ++EP
Sbjct  181  IARHVEP  187



>ref|XP_010034072.1| PREDICTED: uncharacterized protein LOC104423261 [Eucalyptus grandis]
 gb|KCW53954.1| hypothetical protein EUGRSUZ_J03159 [Eucalyptus grandis]
Length=416

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 139/192 (72%), Gaps = 11/192 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSL-  317
            M VD RQ+VAG+LT+TMFVMLG MIKRDHFD+++E      + D  +  +  L G   + 
Sbjct  1    MGVDLRQVVAGILTITMFVMLGQMIKRDHFDSVEEK--LPGLSDDARFDDSKLEGKSLVS  58

Query  318  --------WKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYL  473
                    WK +   +K CW RP+    + S G+VTFSLTNGPEYHVSQI+ AVVVA+YL
Sbjct  59   LSKRNKGPWKEESQELKQCWSRPTSDLVEDSKGFVTFSLTNGPEYHVSQIAAAVVVAKYL  118

Query  474  RATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNR  653
             ATLV+PD+RGS PGD+R F +IYDVD+FV+SLDG+V+V    P+ +S++NLAVVKVPN 
Sbjct  119  GATLVLPDIRGSKPGDRRSFGEIYDVDKFVRSLDGIVRVAKETPSGISARNLAVVKVPNT  178

Query  654  VTEEHIAENIEP  689
            VTEE+I +++EP
Sbjct  179  VTEEYIVDHVEP  190



>ref|XP_002316445.2| hypothetical protein POPTR_0010s25710g [Populus trichocarpa]
 gb|EEF02616.2| hypothetical protein POPTR_0010s25710g [Populus trichocarpa]
Length=420

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 139/191 (73%), Gaps = 10/191 (5%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTI---HDTNKASE-----LS  296
            M VD RQ+VAGVLT+TMFVMLGNMIKRDHFD++ E +         D  K SE      S
Sbjct  1    MGVDLRQVVAGVLTLTMFVMLGNMIKRDHFDSV-EGKFPGARDVEFDGEKVSEQGLVTFS  59

Query  297  LPGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLR  476
                +  W   GL +KPCW+  +  D + S G+VTFSLTNGPEYHVSQI+DAVVVARY+ 
Sbjct  60   KKSTNGPWVEGGLELKPCWKESNFDDVE-SKGFVTFSLTNGPEYHVSQIADAVVVARYIG  118

Query  477  ATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRV  656
            ATLV+PD+RG+ PGD+R F++IYDV++FVKSL GVVKV    P  +S ++ AVVKVPNRV
Sbjct  119  ATLVLPDIRGNKPGDERKFEEIYDVEKFVKSLVGVVKVVKRLPEDVSIRDFAVVKVPNRV  178

Query  657  TEEHIAENIEP  689
            +E+HIAE IEP
Sbjct  179  SEDHIAEQIEP  189



>ref|XP_011033030.1| PREDICTED: uncharacterized protein LOC105131655 [Populus euphratica]
Length=421

 Score =   216 bits (550),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 139/190 (73%), Gaps = 8/190 (4%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESR--LTSTIHDTNKASE-----LSL  299
            M VD RQ+VAGVLT+TMFVMLGNMIKRDHFD+++     +     D+ K S+      S 
Sbjct  1    MGVDLRQVVAGVLTLTMFVMLGNMIKRDHFDSVEGKFPGVRDVEFDSEKVSDQGLETFSK  60

Query  300  PGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
               +  W   G  +KPCW + S +D     G+VTFSLTNGPEYHVSQI+DAVVVARY+ A
Sbjct  61   KSTNGPWIESGQELKPCW-KESTSDEVEPKGFVTFSLTNGPEYHVSQIADAVVVARYIGA  119

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVT  659
            TLV+PD+RGS PGD+R F++IYDVD+FVKSLDGVVKV    P  +S ++ AVVKVPNR++
Sbjct  120  TLVLPDIRGSKPGDERKFEEIYDVDKFVKSLDGVVKVVKGLPDDVSIRDFAVVKVPNRIS  179

Query  660  EEHIAENIEP  689
            ++HIAE I+P
Sbjct  180  DDHIAEQIKP  189



>ref|XP_006379398.1| hypothetical protein POPTR_0008s00860g [Populus trichocarpa]
 gb|ABK93128.1| unknown [Populus trichocarpa]
 gb|ERP57195.1| hypothetical protein POPTR_0008s00860g [Populus trichocarpa]
Length=421

 Score =   213 bits (543),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 139/190 (73%), Gaps = 8/190 (4%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESR--LTSTIHDTNKASE-----LSL  299
            M VD RQ+VAGVLT+TMFVMLGNMIKRDHFD+++     +     D+ K S+      S 
Sbjct  1    MGVDLRQVVAGVLTLTMFVMLGNMIKRDHFDSVEGKFPGVRDVEFDSEKVSDQGLVTFSK  60

Query  300  PGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
               +  W   G  +KPCW+  +L + +   G+VT SLTNGPEYHVSQI+DAVVVARY+ A
Sbjct  61   KSTNGPWIESGQELKPCWKESTLDEVE-PKGFVTLSLTNGPEYHVSQIADAVVVARYIGA  119

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVT  659
            TLV+PD+RGS PGD+R F++IYDVD+FVKSLDGVVKV    P  +S ++ AVVKVPNR++
Sbjct  120  TLVLPDIRGSKPGDERKFEEIYDVDKFVKSLDGVVKVVKGLPDDVSIRDFAVVKVPNRIS  179

Query  660  EEHIAENIEP  689
            ++HIAE I+P
Sbjct  180  DDHIAEQIKP  189



>ref|XP_004141744.1| PREDICTED: uncharacterized protein At1g04910-like [Cucumis sativus]
 gb|KGN45424.1| hypothetical protein Csa_7G447860 [Cucumis sativus]
Length=413

 Score =   213 bits (542),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 140/190 (74%), Gaps = 15/190 (8%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQE--------SRLTSTIHDTNKASELS  296
            M VD RQ++AG+LT+TMFVMLG+MIKRDHFD++QE        +   +T+   +K S++ 
Sbjct  1    MGVDLRQVLAGILTLTMFVMLGHMIKRDHFDSVQEKFPGPTKDAVKVTTMRSIHKKSDVQ  60

Query  297  LPGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLR  476
            L       K D L +K CW +P   +G  S GYVTFSLT+GPEYHVSQI+DAVVVARYL 
Sbjct  61   L-------KNDVLELKQCWSKPESDEGQESKGYVTFSLTDGPEYHVSQITDAVVVARYLG  113

Query  477  ATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRV  656
            ATLV+PD+RG   GDK +F+DIYDV++F+ SL+GVVKV    P+ +S K ++ VKVPNRV
Sbjct  114  ATLVVPDIRGKEVGDKWNFEDIYDVEKFIGSLEGVVKVVKQMPSDISPKKISAVKVPNRV  173

Query  657  TEEHIAENIE  686
            TE++I+E++E
Sbjct  174  TEDYISEHVE  183



>gb|KHN38079.1| DUF246 domain-containing protein [Glycine soja]
Length=415

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 137/190 (72%), Gaps = 13/190 (7%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESR-------LTSTIHDTNKASELSL  299
            M VD RQ+VAGVLT+TMFVML +MIKRDHFD + +           ST  DT    +   
Sbjct  1    MGVDLRQVVAGVLTLTMFVMLIHMIKRDHFDAVHDKLPGTEDVGFESTNFDTTHVRK---  57

Query  300  PGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
                 +WKGD   + PCW +PS  D   + G+VTFSLTNGPEYH+SQI+DAV+VAR L A
Sbjct  58   --NIGIWKGDADELNPCWAKPS-EDNAETEGFVTFSLTNGPEYHISQIADAVLVARSLGA  114

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVT  659
            TLVIPD+RGS PGDKR+F+DIYDV+ F+KS++GVV+V    P+ +++  +A VKVPNRVT
Sbjct  115  TLVIPDIRGSQPGDKRNFEDIYDVNVFMKSMEGVVRVVKDLPSHVTTHKIAAVKVPNRVT  174

Query  660  EEHIAENIEP  689
            EE+IA+++EP
Sbjct  175  EEYIAQHVEP  184



>ref|NP_001239923.1| uncharacterized protein LOC100813879 [Glycine max]
 gb|ACU20870.1| unknown [Glycine max]
Length=415

 Score =   211 bits (537),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 136/190 (72%), Gaps = 13/190 (7%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESR-------LTSTIHDTNKASELSL  299
            M VD RQ+VAGVLT+TMFVML +MIKRDHFD + +           ST  DT    +   
Sbjct  1    MGVDLRQVVAGVLTLTMFVMLIHMIKRDHFDAVHDKLPGTEDVGFESTNFDTTHVRK---  57

Query  300  PGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
                 +WKGD   + PCW +PS  D   + G+VTFSLTNGPEYH+SQI+DAV+VAR L A
Sbjct  58   --NIGIWKGDADELNPCWAKPS-EDNAETEGFVTFSLTNGPEYHISQIADAVLVARSLGA  114

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVT  659
            TLVIPD+RGS PGDKR+F+DIYD + F+KS++GVV+V    P+ +++  +A VKVPNRVT
Sbjct  115  TLVIPDIRGSQPGDKRNFEDIYDANVFMKSMEGVVRVVKDLPSHVTTHKIAAVKVPNRVT  174

Query  660  EEHIAENIEP  689
            EE+IA+++EP
Sbjct  175  EEYIAQHVEP  184



>ref|XP_008462222.1| PREDICTED: uncharacterized protein LOC103500628 [Cucumis melo]
Length=413

 Score =   211 bits (537),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 139/190 (73%), Gaps = 15/190 (8%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQE--------SRLTSTIHDTNKASELS  296
            M VD RQ++AG+LT+TMFVMLG+MIKRDHFD++QE        +   +T+   +K S++ 
Sbjct  1    MGVDLRQVLAGILTLTMFVMLGHMIKRDHFDSVQEKFPGPTKDATKVTTMRSIHKKSDVQ  60

Query  297  LPGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLR  476
            L       K D L +K CW +P   +G  S GYVTFSLT+GPEYHVSQI+DAVVVARYL 
Sbjct  61   L-------KNDVLELKQCWSKPESDEGQESKGYVTFSLTDGPEYHVSQIADAVVVARYLG  113

Query  477  ATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRV  656
            ATLV+PD+RG   GDK +F+DIYDV++F+ SL+GVVKV    P+ +S K ++ VKVPNRV
Sbjct  114  ATLVVPDIRGKELGDKWNFEDIYDVEKFIGSLEGVVKVVKQLPSDISPKKISAVKVPNRV  173

Query  657  TEEHIAENIE  686
            T ++I+E++E
Sbjct  174  TADYISEHVE  183



>ref|XP_006342865.1| PREDICTED: uncharacterized protein LOC102606164 [Solanum tuberosum]
Length=402

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 134/181 (74%), Gaps = 10/181 (6%)
 Frame = +3

Query  147  VDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSLWKG  326
            +D RQ++AGVLT+TMFVMLG+MIKRDHFD   E+    +IH T K S L+   G   WK 
Sbjct  1    MDARQVLAGVLTITMFVMLGDMIKRDHFDVDSEA----SIHATRKQSLLT--NGAGPWKQ  54

Query  327  DGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDVRG  506
            D  S+  CW +P + +   S GYVTFSLTNGPEYH+SQI+DAVV+ARYLRATL++PD+RG
Sbjct  55   DAQSLTSCWSKPLIGEAHESQGYVTFSLTNGPEYHLSQIADAVVIARYLRATLLLPDIRG  114

Query  507  SNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIAENIE  686
                ++R F+ +YDV+QFVK LDGVVKV  S P+ + +    VVKVP+RVTEE+I +NIE
Sbjct  115  GT--EQRKFEHVYDVEQFVKKLDGVVKVAKSLPSKVVTG--PVVKVPSRVTEEYITDNIE  170

Query  687  P  689
            P
Sbjct  171  P  171



>ref|XP_010656876.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Vitis vinifera]
 ref|XP_010656877.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Vitis vinifera]
Length=398

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 136/190 (72%), Gaps = 8/190 (4%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIH---DTNKASE---LSLP  302
            MA+D RQ++A +LT++MF MLGNMIK+DHFDT Q  +  +T H   DT K +E   + LP
Sbjct  1    MAMDARQVIAAILTLSMFAMLGNMIKKDHFDTFQ-MKFPATSHVQYDTIKIAEKNIIDLP  59

Query  303  G-GDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
                  WK D  ++KPCW +P+L + + S G++TFS +NGPEYHVSQ++DAVV+ARYL A
Sbjct  60   TIRRGPWKNDSEALKPCWNKPALEEREQSTGFITFSFSNGPEYHVSQLADAVVIARYLGA  119

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVT  659
            TLV+PD+R S  G KR F++IYD  + VK+L  VV+V   +P+  S+  L VV+VPNRV+
Sbjct  120  TLVLPDIRKSERGQKRKFEEIYDAKKCVKNLGSVVRVALDQPSQASTGKLTVVRVPNRVS  179

Query  660  EEHIAENIEP  689
            EE+IA  IEP
Sbjct  180  EEYIAAKIEP  189



>ref|XP_010656875.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Vitis vinifera]
 emb|CBI17883.3| unnamed protein product [Vitis vinifera]
Length=419

 Score =   208 bits (530),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 136/190 (72%), Gaps = 8/190 (4%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIH---DTNKASE---LSLP  302
            MA+D RQ++A +LT++MF MLGNMIK+DHFDT Q  +  +T H   DT K +E   + LP
Sbjct  1    MAMDARQVIAAILTLSMFAMLGNMIKKDHFDTFQ-MKFPATSHVQYDTIKIAEKNIIDLP  59

Query  303  G-GDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
                  WK D  ++KPCW +P+L + + S G++TFS +NGPEYHVSQ++DAVV+ARYL A
Sbjct  60   TIRRGPWKNDSEALKPCWNKPALEEREQSTGFITFSFSNGPEYHVSQLADAVVIARYLGA  119

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVT  659
            TLV+PD+R S  G KR F++IYD  + VK+L  VV+V   +P+  S+  L VV+VPNRV+
Sbjct  120  TLVLPDIRKSERGQKRKFEEIYDAKKCVKNLGSVVRVALDQPSQASTGKLTVVRVPNRVS  179

Query  660  EEHIAENIEP  689
            EE+IA  IEP
Sbjct  180  EEYIAAKIEP  189



>ref|XP_007142132.1| hypothetical protein PHAVU_008G255300g [Phaseolus vulgaris]
 gb|ESW14126.1| hypothetical protein PHAVU_008G255300g [Phaseolus vulgaris]
Length=417

 Score =   208 bits (529),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 142/187 (76%), Gaps = 5/187 (3%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELS---LPGGD  311
            M VD RQ+VAGVLT+TMFVML +MIKRDHFD + + +L  T   + +++      +    
Sbjct  1    MGVDLRQVVAGVLTLTMFVMLIHMIKRDHFDAVDD-KLPGTEDISFESTNFETTHVRKNI  59

Query  312  SLWKGDGLSMKPCWERPSL-ADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLV  488
             +WKGD   +KPCW +PS  ++ + + G+VTFSLTNGPEYH+SQI+DAV+VAR L ATLV
Sbjct  60   GIWKGDVDELKPCWVKPSEDSNVEQTEGFVTFSLTNGPEYHISQIADAVLVARSLGATLV  119

Query  489  IPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEH  668
            IPD+RGS PGDKR+F+DIYDVD F+KS++ VV+V    P+ +S+  +A VKVPNRVTE++
Sbjct  120  IPDIRGSQPGDKRNFEDIYDVDVFMKSMEAVVRVVKDLPSHISTHKIAAVKVPNRVTEDY  179

Query  669  IAENIEP  689
            IA+++EP
Sbjct  180  IAKHVEP  186



>emb|CAN79033.1| hypothetical protein VITISV_027517 [Vitis vinifera]
Length=415

 Score =   207 bits (528),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 136/190 (72%), Gaps = 8/190 (4%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIH---DTNKASE---LSLP  302
            MA+D RQ++A +LT++MF MLGNMIK+DHFDT Q  +  +T H   DT K +E   + LP
Sbjct  1    MAMDARQVIAAILTLSMFAMLGNMIKKDHFDTFQ-MKFPATSHVQYDTIKIAEKNIIDLP  59

Query  303  G-GDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
                  WK D  ++KPCW +P+L + + S G++TFS +NGPEYHVSQ++DAVV+ARYL A
Sbjct  60   TIRRGPWKNDSEALKPCWNKPALEEREQSTGFITFSFSNGPEYHVSQLADAVVIARYLGA  119

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVT  659
            TLV+PD+R S  G KR F++IYD  + VK+L  VV+V   +P+  S+  L VV+VPNRV+
Sbjct  120  TLVLPDIRKSERGQKRKFEEIYDAKKCVKNLGSVVRVALDQPSQASTGKLTVVRVPNRVS  179

Query  660  EEHIAENIEP  689
            EE+IA  IEP
Sbjct  180  EEYIAAKIEP  189



>ref|XP_010656874.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Vitis vinifera]
Length=422

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 136/190 (72%), Gaps = 8/190 (4%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIH---DTNKASE---LSLP  302
            MA+D RQ++A +LT++MF MLGNMIK+DHFDT Q  +  +T H   DT K +E   + LP
Sbjct  1    MAMDARQVIAAILTLSMFAMLGNMIKKDHFDTFQ-MKFPATSHVQYDTIKIAEKNIIDLP  59

Query  303  G-GDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
                  WK D  ++KPCW +P+L + + S G++TFS +NGPEYHVSQ++DAVV+ARYL A
Sbjct  60   TIRRGPWKNDSEALKPCWNKPALEEREQSTGFITFSFSNGPEYHVSQLADAVVIARYLGA  119

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVT  659
            TLV+PD+R S  G KR F++IYD  + VK+L  VV+V   +P+  S+  L VV+VPNRV+
Sbjct  120  TLVLPDIRKSERGQKRKFEEIYDAKKCVKNLGSVVRVALDQPSQASTGKLTVVRVPNRVS  179

Query  660  EEHIAENIEP  689
            EE+IA  IEP
Sbjct  180  EEYIAAKIEP  189



>ref|XP_010276723.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=413

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 137/188 (73%), Gaps = 6/188 (3%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHD----TNKASELSLPG-  305
            MAVDP+QI++  LT+TMF ++ NMIKRDHFD +++  L  T  D          +SL   
Sbjct  1    MAVDPKQILSAFLTLTMFGLIVNMIKRDHFDPVEKVTLPGTSGDQFDRVTDQRHVSLAKV  60

Query  306  GDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATL  485
            G++ WK D   +KPCW +P   D + S G++TFSLTNGPEYH+SQI DAVVVARYL ATL
Sbjct  61   GNAPWKEDSPELKPCWSKPEPKD-ERSKGFITFSLTNGPEYHISQIVDAVVVARYLGATL  119

Query  486  VIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEE  665
            V+PD+RG+  G+KR+F++IYDV++FVKSLDGV++++  +P  +S   LAVVKVPN VT++
Sbjct  120  VLPDIRGTKLGEKRNFQEIYDVEKFVKSLDGVIEISKDQPAQISKGKLAVVKVPNWVTKD  179

Query  666  HIAENIEP  689
             I E IEP
Sbjct  180  FIEEQIEP  187



>ref|NP_566677.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
 dbj|BAB01710.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO64166.1| unknown protein [Arabidopsis thaliana]
 gb|AAP04069.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00437.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE76474.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=422

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 136/193 (70%), Gaps = 12/193 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLP------  302
            M VD RQ+VAG+LT+TMFVMLG M+ RD+FD+LQE           + S++S+       
Sbjct  1    MGVDLRQVVAGILTITMFVMLGQMLHRDYFDSLQEKAQGDAQDIEFEGSKVSVKDGLVGT  60

Query  303  --GGDSLWKGDGLSMKPCWERPSLADGDL--SNGYVTFSLTNGPEYHVSQISDAVVVARY  470
              G   LW  D   + PCW  P+L   D   S GYVTFSLTNGPEYH+SQI+DAV+VA++
Sbjct  61   VEGSKGLWMEDNTDLTPCW--PTLLSDDAVSSKGYVTFSLTNGPEYHISQITDAVMVAKH  118

Query  471  LRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPN  650
            L ATLV+PD+RGS PGD+R+F+DIYD D+ +KSL+ VVKV    P  +S +N+A+VKVP 
Sbjct  119  LGATLVLPDIRGSKPGDERNFEDIYDADKLIKSLENVVKVVKKLPEEVSLRNMAIVKVPT  178

Query  651  RVTEEHIAENIEP  689
            RVTE++I E+I+P
Sbjct  179  RVTEDYIKEHIDP  191



>gb|AAM65575.1| unknown [Arabidopsis thaliana]
Length=422

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 136/193 (70%), Gaps = 12/193 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLP------  302
            M VD RQ+VAG+LT+TMFVMLG M+ RD+FD+LQE           + S++S+       
Sbjct  1    MGVDLRQVVAGILTITMFVMLGQMLHRDYFDSLQEKAQGDAQDIEFEGSKVSVKDGLVGT  60

Query  303  --GGDSLWKGDGLSMKPCWERPSLADGDL--SNGYVTFSLTNGPEYHVSQISDAVVVARY  470
              G   LW  D   + PCW  P+L   D   S GYVTFSLTNGPEYH+SQI+DAV+VA++
Sbjct  61   VEGSKGLWMEDNTDLTPCW--PTLLSDDAVSSKGYVTFSLTNGPEYHISQITDAVMVAKH  118

Query  471  LRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPN  650
            L ATLV+PD+RGS PGD+R+F+DIYD D+ +KSL+ VVKV    P  +S +N+A+VKVP 
Sbjct  119  LGATLVLPDIRGSKPGDERNFEDIYDADKLIKSLENVVKVVKKLPEEVSLRNMAIVKVPT  178

Query  651  RVTEEHIAENIEP  689
            RVTE++I E+I+P
Sbjct  179  RVTEDYIKEHIDP  191



>ref|XP_002885425.1| hypothetical protein ARALYDRAFT_479639 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61684.1| hypothetical protein ARALYDRAFT_479639 [Arabidopsis lyrata subsp. 
lyrata]
Length=422

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 136/193 (70%), Gaps = 12/193 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLP------  302
            M VD RQ+VAG+LT+TMFVMLG M+ RD+FD+LQE           + S++S+       
Sbjct  1    MGVDLRQVVAGILTITMFVMLGQMLHRDYFDSLQEKAQGDAQDIEFEGSKVSVKDGLVGT  60

Query  303  --GGDSLWKGDGLSMKPCWERPSLADGDL--SNGYVTFSLTNGPEYHVSQISDAVVVARY  470
              G   LW  D   + PCW  P+L   +   S GYVTFSLTNGPEYH+SQISDAV+VA++
Sbjct  61   VEGSKGLWMEDNTDLNPCW--PTLLSDEAVSSKGYVTFSLTNGPEYHISQISDAVMVAKH  118

Query  471  LRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPN  650
            L ATLV+PD+RGS PGD+R+F+DIYD D+ +KSL+ VVKV    P  +S +N+A+VKVP 
Sbjct  119  LGATLVLPDIRGSKPGDERNFEDIYDADKLIKSLENVVKVVKQLPEEVSLRNMAIVKVPT  178

Query  651  RVTEEHIAENIEP  689
            RVTE++I E+I+P
Sbjct  179  RVTEDYIKEHIDP  191



>emb|CDY43916.1| BnaA05g15260D [Brassica napus]
Length=411

 Score =   202 bits (515),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 135/185 (73%), Gaps = 3/185 (2%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTN-KASELSLPGG-DS  314
            M VD RQIVA +LT+TMFVMLG M+ RD+FD +QE ++    HD     S++++  G   
Sbjct  1    MGVDLRQIVAAILTITMFVMLGQMLHRDYFDAVQE-KVEGDAHDIEFHGSKVAVVEGIKG  59

Query  315  LWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIP  494
             W  D   +KPCW   S  +   S GYVTFSLTNGPEYH+SQI+DAV+VA++L ATLV+P
Sbjct  60   PWMHDSHDLKPCWSISSSDEAVSSKGYVTFSLTNGPEYHISQITDAVMVAKHLGATLVLP  119

Query  495  DVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIA  674
            D+RGS PGD+ +F DIYDVD+FVKSL+ VVKV    P+ +S +++A+VKVP RV E++I 
Sbjct  120  DIRGSKPGDEMNFDDIYDVDKFVKSLESVVKVVKKLPSHVSLRDIAIVKVPTRVAEDYIK  179

Query  675  ENIEP  689
            E+I+P
Sbjct  180  EHIDP  184



>emb|CDY27536.1| BnaC01g32190D [Brassica napus]
Length=422

 Score =   202 bits (515),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 136/194 (70%), Gaps = 14/194 (7%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTN-KASELS-------  296
            M VD RQ+VAG+LT+TMFVMLG M+ RD++D+LQE +     HD   + S +S       
Sbjct  1    MGVDLRQVVAGILTITMFVMLGQMLHRDYYDSLQE-KAQGDAHDIEFEGSRVSVKDSLVG  59

Query  297  -LPGGDSLWKGDGLSMKPCWERPSLADGDL--SNGYVTFSLTNGPEYHVSQISDAVVVAR  467
             L G    W  D   + PCW  P+L   +   S GYVTFSLTNGPEYH+SQI+DAV+VA 
Sbjct  60   ALEGNKGPWMDDNNDLNPCW--PTLLSDEAVSSKGYVTFSLTNGPEYHISQITDAVMVAN  117

Query  468  YLRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVP  647
            +L ATLV+PD+RGS PGD+R+FKDIYD D+ +KSL+ VVKV    P  +S +++A+VKVP
Sbjct  118  HLGATLVLPDIRGSKPGDERNFKDIYDADKLIKSLENVVKVVKQLPEQVSLRDIAIVKVP  177

Query  648  NRVTEEHIAENIEP  689
             RVTE++I E+IEP
Sbjct  178  TRVTEDYIKEHIEP  191



>emb|CDY50071.1| BnaC05g30800D [Brassica napus]
Length=422

 Score =   202 bits (515),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 137/194 (71%), Gaps = 14/194 (7%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTN-KASELS-------  296
            M VD RQ+VAG+LT+TMFVMLG M+ RD+FD+LQE +     HD   + S +S       
Sbjct  1    MGVDLRQVVAGILTITMFVMLGQMLHRDYFDSLQE-KAQGDAHDIEFEGSRVSVKDSLVG  59

Query  297  -LPGGDSLWKGDGLSMKPCWERPSLADGDL--SNGYVTFSLTNGPEYHVSQISDAVVVAR  467
             L G    W  D   + PCW  P+L   +   S GYVTFSLTNGPEYH+SQI+DAV+VA+
Sbjct  60   ALEGSKGPWMDDNNDLNPCW--PTLLSDEAVSSKGYVTFSLTNGPEYHISQITDAVMVAK  117

Query  468  YLRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVP  647
            +L ATLV+PD+RGS PGD+R+F+DIYD D+ +KSL+ V+KV    P  +S +++A++KVP
Sbjct  118  HLGATLVLPDIRGSKPGDERNFEDIYDADKLIKSLEKVIKVVKQLPEEVSLRDMAIIKVP  177

Query  648  NRVTEEHIAENIEP  689
             RVTE++I ENI+P
Sbjct  178  TRVTEDYIKENIDP  191



>ref|XP_009144893.1| PREDICTED: uncharacterized protein LOC103868560 [Brassica rapa]
Length=411

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDT--NKASELSLPGGDS  314
            M VD RQIVA +LT+TMFVMLG M+ RD+FD +QE ++    HD   +      + G   
Sbjct  1    MGVDLRQIVAAILTITMFVMLGQMLHRDYFDAVQE-KVEGDAHDIEFHGPKVAVVEGIKG  59

Query  315  LWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIP  494
             W  D   +KPCW   S  +   S GYVTFSLTNGPEYH+SQI+DAV+VA++L ATLV+P
Sbjct  60   PWMHDSHDLKPCWSISSSDEAVSSKGYVTFSLTNGPEYHISQITDAVMVAKHLGATLVLP  119

Query  495  DVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIA  674
            D+RGS PGD+ +F+DIYDVD+FVKSL+ VVKV    P+ +S +++A+VKVP RV E++I 
Sbjct  120  DIRGSKPGDEMNFEDIYDVDKFVKSLESVVKVVKKLPSHVSLRDIAIVKVPTRVAEDYIK  179

Query  675  ENIEP  689
            E+I+P
Sbjct  180  EHIDP  184



>emb|CDY37310.1| BnaA01g25300D [Brassica napus]
Length=422

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 137/194 (71%), Gaps = 14/194 (7%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTN-KASELS-------  296
            M VD RQ+VAG+LT+TMFVMLG M+ RD++D++QE +     HD   + S +S       
Sbjct  1    MGVDLRQVVAGILTITMFVMLGQMLHRDYYDSVQE-KAQGDAHDIEFEGSRVSVKDSLVG  59

Query  297  -LPGGDSLWKGDGLSMKPCWERPSLADGDL--SNGYVTFSLTNGPEYHVSQISDAVVVAR  467
             L G    W  D   + PCW  P+L   +   S GYVTFSLTNGPEYH+SQI+DAV+VA+
Sbjct  60   ALEGNKGPWMDDNNDLNPCW--PTLLSDEAVSSKGYVTFSLTNGPEYHISQITDAVMVAK  117

Query  468  YLRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVP  647
            +L ATLV+PD+RGS PGD+R+F+DIYD D+ +KSLD V+KV    P  +S +++A+VKVP
Sbjct  118  HLGATLVLPDIRGSKPGDERNFEDIYDADKLIKSLDNVIKVVKQLPEQVSLRDIAIVKVP  177

Query  648  NRVTEEHIAENIEP  689
             RVTE++I E+IEP
Sbjct  178  TRVTEDYIKEHIEP  191



>ref|XP_010461997.1| PREDICTED: uncharacterized protein LOC104742678 [Camelina sativa]
Length=423

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 136/193 (70%), Gaps = 11/193 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTN-KASELSLPGG---  308
            M VD RQ+VAG+LT+TMFVMLG M+ RD+FD LQE ++    HD   K S++++  G   
Sbjct  1    MGVDLRQVVAGILTITMFVMLGQMLHRDYFDALQE-KVQGDAHDIEFKGSKVAVEDGLVR  59

Query  309  ------DSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARY  470
                  +  W  D   +KPCW      +   S GYVTFSLTNGPEYHVSQI+DAV+VA++
Sbjct  60   AIQGVTNGPWMEDSHELKPCWSISQSDEAVSSKGYVTFSLTNGPEYHVSQITDAVMVAKH  119

Query  471  LRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPN  650
            L ATLV+PD+RGS PGD+ +F DIYDVD+ +KSL+ VVKV    P+ +S +++A+VKVP 
Sbjct  120  LGATLVLPDIRGSKPGDEMNFDDIYDVDKLIKSLESVVKVVRKLPSHVSLRDIAIVKVPT  179

Query  651  RVTEEHIAENIEP  689
            RV E++I E+I+P
Sbjct  180  RVAEDYIKEHIDP  192



>emb|CDX87826.1| BnaC06g08880D [Brassica napus]
Length=419

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 137/193 (71%), Gaps = 11/193 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTN-KASELSL------  299
            M VD RQIVAG+LT+TMFVMLG M+ RD+FD +QE ++    HD     S++++      
Sbjct  1    MGVDLRQIVAGILTITMFVMLGQMLHRDYFDAVQE-KVEGDAHDIEFHGSKVAVVEDGLV  59

Query  300  ---PGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARY  470
                G    W  D   +KPCW   S  +   S GYVTFSLTNGPEYH+SQI+DAV+VA++
Sbjct  60   RVSEGIKGPWMRDSHELKPCWSISSSDEAVSSKGYVTFSLTNGPEYHISQITDAVMVAKH  119

Query  471  LRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPN  650
            L ATLV+PD+RGS PGD+ +F+DIYDVD+FVKSL+ VVKV    P+ +S +++A+VK+P 
Sbjct  120  LGATLVLPDIRGSKPGDEMNFEDIYDVDKFVKSLESVVKVVKKLPSHVSLRDIAIVKIPT  179

Query  651  RVTEEHIAENIEP  689
            RV E++I E+I+P
Sbjct  180  RVAEDYIKEHIDP  192



>ref|XP_010479652.1| PREDICTED: uncharacterized protein LOC104758474 [Camelina sativa]
Length=423

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 136/193 (70%), Gaps = 11/193 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTN-KASELSLPGG---  308
            M VD RQ+VAG+LT+TMFVMLG M+ RD+FD LQE ++    HD   K S++++  G   
Sbjct  1    MGVDLRQVVAGILTITMFVMLGQMLHRDYFDALQE-KVQGDAHDIEFKGSKVAVEDGLVR  59

Query  309  ------DSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARY  470
                  +  W  D   +KPCW      +   S GYVTFSLTNGPEYHVSQI+DAV+VA++
Sbjct  60   AIQGVTNGPWMEDSHELKPCWSISQSDEAVSSKGYVTFSLTNGPEYHVSQITDAVMVAKH  119

Query  471  LRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPN  650
            L ATLV+PD+RGS PGD+ +F DIYDVD+ +KSL+ VVKV    P+ +S +++A+VKVP 
Sbjct  120  LGATLVLPDIRGSKPGDEMNFDDIYDVDKLIKSLESVVKVVRKLPSHVSLRDIAIVKVPT  179

Query  651  RVTEEHIAENIEP  689
            RV E++I E+I+P
Sbjct  180  RVAEDYIKEHIDP  192



>ref|NP_001063569.1| Os09g0498800 [Oryza sativa Japonica Group]
 dbj|BAF25483.1| Os09g0498800 [Oryza sativa Japonica Group]
 dbj|BAG92036.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE69988.1| hypothetical protein OsJ_29893 [Oryza sativa Japonica Group]
Length=425

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 138/195 (71%), Gaps = 14/195 (7%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTL----QESRLTST--------IHDTNKA  284
            MAVDPRQ+VAG LT++MFVMLGNMIK DHF  +    +E  L +T        I DT + 
Sbjct  1    MAVDPRQVVAGFLTLSMFVMLGNMIKHDHFTPVGAGQEELGLEATGIESNEIKIADTTEM  60

Query  285  SELSLPGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVA  464
            ++++  G D L K     ++PCW +P  ++   S G+VTFSLT GPEYH+SQI+DAVV+A
Sbjct  61   TKVNKAGVD-LPKETAEEIRPCWSKPR-SNVQESKGFVTFSLTMGPEYHISQITDAVVIA  118

Query  465  RYLRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKV  644
            RYL ATLV+P++RG+  G +R F+D+YDVD+F+ SLDGVVKV  S P  +SSK  AVV+V
Sbjct  119  RYLGATLVLPEIRGNELGKRRKFEDMYDVDKFMTSLDGVVKVVHSLPNAVSSKKPAVVRV  178

Query  645  PNRVTEEHIAENIEP  689
            PNRVTEE I   IEP
Sbjct  179  PNRVTEEFITGTIEP  193



>gb|KFK35833.1| hypothetical protein AALP_AA4G043000 [Arabis alpina]
Length=423

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 138/193 (72%), Gaps = 11/193 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTN-KASELSLPGG---  308
            M VD +QIVAG+LT+TMFVMLG M+ RD+FD+LQE ++   +HD   + S++++  G   
Sbjct  1    MGVDLKQIVAGILTITMFVMLGQMLHRDYFDSLQE-KVQGDVHDIEFQGSKVAVEDGLVR  59

Query  309  ------DSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARY  470
                     W  D   +KPCW      D   S GYVTFSLTNGPEYHVSQI+DAV+VA++
Sbjct  60   AIEGNNKGPWMEDSHELKPCWSISQSDDVVSSKGYVTFSLTNGPEYHVSQITDAVMVAKH  119

Query  471  LRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPN  650
            L ATLV+PD+RGS PGD+ +F+DIYDVD+ +K+L+ VVKV    P+ +S +++A+VKVP 
Sbjct  120  LGATLVLPDIRGSKPGDEMNFEDIYDVDKLIKTLESVVKVVKKLPSHVSFRDIAIVKVPT  179

Query  651  RVTEEHIAENIEP  689
            RV E++I E+I+P
Sbjct  180  RVAEDYIKEHIDP  192



>ref|XP_008801515.1| PREDICTED: uncharacterized protein LOC103715609 [Phoenix dactylifera]
Length=424

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 135/192 (70%), Gaps = 9/192 (5%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELS---LPG--  305
            MAVDPRQ++A  LT++MF MLGNMIK+DHFD ++ S    +    +K S +    L G  
Sbjct  1    MAVDPRQVLAAFLTLSMFAMLGNMIKKDHFDNVEVSLPMLSSQSDSKFSVMRVEDLEGRK  60

Query  306  ----GDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYL  473
                 +  W  +G  +K CW RP+  + + + G++TFSLT GPEYHVSQI+DAVV+ARYL
Sbjct  61   HSKVKEGPWSENGQELKTCWNRPAKMEAEQTKGFITFSLTGGPEYHVSQITDAVVIARYL  120

Query  474  RATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNR  653
             ATLV+PD+RGS  G K++F+D+YD D+F++S+DGV+K+    P  ++++  AVV+VPNR
Sbjct  121  GATLVLPDIRGSELGQKKNFEDLYDSDKFMRSMDGVIKIVKEVPAEVATEKPAVVRVPNR  180

Query  654  VTEEHIAENIEP  689
             +E+ IA NIEP
Sbjct  181  ASEDFIAANIEP  192



>ref|XP_009145508.1| PREDICTED: uncharacterized protein LOC103869200 [Brassica rapa]
 ref|XP_009145509.1| PREDICTED: uncharacterized protein LOC103869200 [Brassica rapa]
Length=422

 Score =   201 bits (510),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 136/194 (70%), Gaps = 14/194 (7%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTN-KASELSLP-----  302
            M VD RQ+VAG+LT+TMFVMLG M+ RD+FD+LQE +     HD   + S +S+      
Sbjct  1    MGVDLRQVVAGILTITMFVMLGQMLHRDYFDSLQE-KAQGDAHDIEFEGSRVSVKDSLVG  59

Query  303  ---GGDSLWKGDGLSMKPCWERPSLADGDL--SNGYVTFSLTNGPEYHVSQISDAVVVAR  467
               G    W  D   + PCW  P+L   +   S GYVTFSLTNGPEYH+SQI+DAV+VA+
Sbjct  60   AVEGSKGPWMDDTNDLNPCW--PTLLSDEAVSSKGYVTFSLTNGPEYHISQITDAVMVAK  117

Query  468  YLRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVP  647
            +L ATLV+PD+RGS PGD+R+F+DIYD D+ +KSL  V+KV    P  +S +++A+VKVP
Sbjct  118  HLGATLVLPDIRGSKPGDERNFEDIYDADKLIKSLKNVIKVVKQLPEEVSLRDIAIVKVP  177

Query  648  NRVTEEHIAENIEP  689
             RVTE++I ENI+P
Sbjct  178  TRVTEDYIKENIDP  191



>ref|XP_009381590.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=414

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 134/185 (72%), Gaps = 5/185 (3%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQES-RLTSTIH-DTNKASELSLPGGDS  314
            MAVDPRQ+VAG LT+ MF MLGNMIKRDHFD+++ S + TS +  D  K+ + S      
Sbjct  1    MAVDPRQLVAGFLTIAMFAMLGNMIKRDHFDSVKVSLQETSGVQFDALKSKDKS---ATQ  57

Query  315  LWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIP  494
            + K   L +KPCW +P   + + S G++TFSLT GPE+HVSQ++DAVV+ARYL A L++P
Sbjct  58   VSKESSLELKPCWAKPVPKETEQSKGFITFSLTGGPEHHVSQVTDAVVIARYLGAILLLP  117

Query  495  DVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIA  674
            D+RGS  G KR+F+D+YD D+F  SL GVVKV    P+ ++++N AVV+VPNRV ++ I 
Sbjct  118  DIRGSELGQKRNFEDLYDADKFTTSLIGVVKVVKELPSEVTAENPAVVRVPNRVAKDFII  177

Query  675  ENIEP  689
             NIEP
Sbjct  178  NNIEP  182



>emb|CDY19573.1| BnaA05g19810D [Brassica napus]
Length=422

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 133/192 (69%), Gaps = 10/192 (5%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTN-KASELSLP-----  302
            M VD RQ+VAG+LT+TMFVMLG M+ RD+FD+LQE +     HD   + S +S+      
Sbjct  1    MGVDLRQVVAGILTITMFVMLGQMLHRDYFDSLQE-KAQGDAHDIEFEGSRVSVKDSLVG  59

Query  303  ---GGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYL  473
               G    W  D   + PCW      +   S GYVTFSLTNGPEYH+SQI+DAV+VA++L
Sbjct  60   GVEGSKGPWMDDTNDLNPCWPTLLSEEAVSSKGYVTFSLTNGPEYHISQITDAVMVAKHL  119

Query  474  RATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNR  653
             ATLV+PD+RGS PGD+R+F+DIYD D+ +KSL  V+KV    P  +S +++A+VKVP R
Sbjct  120  GATLVLPDIRGSKPGDERNFEDIYDADKLIKSLKNVIKVVKQLPEEVSLRDIAIVKVPTR  179

Query  654  VTEEHIAENIEP  689
            VTE++I ENI+P
Sbjct  180  VTEDYIKENIDP  191



>ref|XP_009109756.1| PREDICTED: uncharacterized protein LOC103835351 [Brassica rapa]
Length=422

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 135/194 (70%), Gaps = 14/194 (7%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTN-KASELS-------  296
            M VD RQ+VAG+LT+TMFVMLG M+ RD++D+LQE +     HD   + S +S       
Sbjct  1    MGVDLRQVVAGILTITMFVMLGQMLHRDYYDSLQE-KAQGDAHDIEFEGSRVSVKDSLVG  59

Query  297  -LPGGDSLWKGDGLSMKPCWERPSLADGDL--SNGYVTFSLTNGPEYHVSQISDAVVVAR  467
             L G    W  D   + PCW  P+L   +   S GYVTFSLTNGPEYH+SQI+DAV+VA+
Sbjct  60   ALEGNKGPWMDDNNDLNPCW--PTLLSDEAVSSKGYVTFSLTNGPEYHISQITDAVMVAK  117

Query  468  YLRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVP  647
            +L ATLV+PD+RGS PGD+R F+DIYD D  +KSL+ V+KV    P  +S +++A+VKVP
Sbjct  118  HLGATLVLPDIRGSKPGDERSFEDIYDADNIIKSLENVIKVVKQLPEQVSLRDIAIVKVP  177

Query  648  NRVTEEHIAENIEP  689
             RVTE++I E+IEP
Sbjct  178  TRVTEDYIKEHIEP  191



>ref|XP_006307609.1| hypothetical protein CARUB_v10009235mg [Capsella rubella]
 gb|EOA40507.1| hypothetical protein CARUB_v10009235mg [Capsella rubella]
Length=423

 Score =   200 bits (508),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 135/193 (70%), Gaps = 11/193 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTN-KASELSLP-----  302
            M VD RQ+VAG+LT+TMFVMLG M+ RD+FD +QE ++    HD   K S++++      
Sbjct  1    MGVDLRQVVAGILTITMFVMLGQMLHRDYFDAVQE-KIQGDAHDIEFKGSKVAVEDGLVR  59

Query  303  ----GGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARY  470
                G    W  D   +KPCW      +   S GYVTFSLTNGPEYHVSQI+DAV+VA++
Sbjct  60   AIEGGNKGPWMEDSNELKPCWSISQSDEAVSSKGYVTFSLTNGPEYHVSQITDAVMVAKH  119

Query  471  LRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPN  650
            L ATLV+PD+RGS PGD+ +F DIYDVD+ +KSL+ VVKV    P+ +S +++A+VKVP 
Sbjct  120  LGATLVLPDIRGSKPGDEMNFDDIYDVDKLIKSLESVVKVVRKLPSHVSLRDIAIVKVPT  179

Query  651  RVTEEHIAENIEP  689
            RV E++I E+I+P
Sbjct  180  RVAEDYIKEHIDP  192



>ref|XP_002462607.1| hypothetical protein SORBIDRAFT_02g028940 [Sorghum bicolor]
 gb|EER99128.1| hypothetical protein SORBIDRAFT_02g028940 [Sorghum bicolor]
Length=422

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 141/194 (73%), Gaps = 14/194 (7%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDT--LQESRLTSTIHDTN--------KASE  290
            MAVDPRQ+VAG LT++MFVMLGNMIK DHF +   +E  L +T  ++N        + + 
Sbjct  1    MAVDPRQVVAGFLTLSMFVMLGNMIKHDHFSSPVTEELALEATGVESNTVKLDNNAEMNS  60

Query  291  LSLPGGDSLWKGDGLS-MKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVAR  467
            + + G + L   D +  +KPCW +PS  +   SNG+VTFSLT GPEYH+SQI+DAVVVAR
Sbjct  61   VDMAGVEDLM--DAIEDVKPCWTKPSQKNQP-SNGFVTFSLTMGPEYHISQITDAVVVAR  117

Query  468  YLRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVP  647
            YL ATLV+PD+RG+  G+KR F+D+Y+VD+FV+SLDGVV+V    P  +S+KN AV++VP
Sbjct  118  YLGATLVLPDIRGNELGNKRKFQDMYNVDKFVRSLDGVVEVIEEIPDEVSAKNPAVIRVP  177

Query  648  NRVTEEHIAENIEP  689
            NRVTE  I + I+P
Sbjct  178  NRVTESFITDTIQP  191



>ref|XP_011046520.1| PREDICTED: uncharacterized protein At1g04910 [Populus euphratica]
Length=420

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 140/191 (73%), Gaps = 10/191 (5%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTI---HDTNKASE-----LS  296
            M VD RQ+VAGVLT+TMFVMLGNMIKRDHFD++ E +         D+ K SE      S
Sbjct  1    MGVDLRQVVAGVLTLTMFVMLGNMIKRDHFDSV-EGKFPGARDVEFDSEKVSEQGLVTFS  59

Query  297  LPGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLR  476
                +  W   GL +KPCW+  +  D + S G+VTFSLTNGPEYHVSQI+DAVVVARY+ 
Sbjct  60   KKSTNGPWVEGGLELKPCWKESNFDDVE-SKGFVTFSLTNGPEYHVSQIADAVVVARYIG  118

Query  477  ATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRV  656
            ATLV+PD+RG+ PGD+R F++IYDV++FVKSL GVVKV    P  +S ++ AVVKVPNRV
Sbjct  119  ATLVLPDIRGNKPGDERKFEEIYDVEKFVKSLVGVVKVVKGLPEDVSIRDFAVVKVPNRV  178

Query  657  TEEHIAENIEP  689
            +E++IAE IEP
Sbjct  179  SEDYIAEQIEP  189



>ref|XP_002894326.1| hypothetical protein ARALYDRAFT_892138 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70585.1| hypothetical protein ARALYDRAFT_892138 [Arabidopsis lyrata subsp. 
lyrata]
Length=423

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 135/193 (70%), Gaps = 11/193 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTN-KASELSLP-----  302
            M VD RQ+VAG+LT+TMFVMLG M+ RD+FD +QE ++    HD   + S +++      
Sbjct  1    MGVDLRQVVAGILTITMFVMLGQMLHRDYFDAVQE-KVQGDAHDIEFQGSRVAVEDGLVR  59

Query  303  ----GGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARY  470
                G    W  D   +KPCW      +   S GYVTFSLTNGPEYHVSQI+DAV+VA++
Sbjct  60   AFEGGNKGPWMEDSHGLKPCWSISQSDEAVSSKGYVTFSLTNGPEYHVSQITDAVMVAKH  119

Query  471  LRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPN  650
            L ATLV+PD+RGS PGD+ +F+DIYDVD+ VKSL+ VVKV    P+ +S +++A+VKVP 
Sbjct  120  LGATLVLPDIRGSKPGDEMNFEDIYDVDKIVKSLESVVKVVRKLPSHVSLRDIAIVKVPT  179

Query  651  RVTEEHIAENIEP  689
            RV E++I E+I+P
Sbjct  180  RVAEDYIKEHIDP  192



>ref|XP_006406304.1| hypothetical protein EUTSA_v10020803mg [Eutrema salsugineum]
 gb|ESQ47757.1| hypothetical protein EUTSA_v10020803mg [Eutrema salsugineum]
Length=422

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 137/194 (71%), Gaps = 14/194 (7%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTN-KASELSLP-----  302
            M VD RQ+VAG+LT+TMFVMLG M+ RD++D+LQ+ ++    HD   + S +S+      
Sbjct  1    MGVDLRQVVAGILTITMFVMLGQMLHRDYYDSLQK-KVQGDAHDMEFEGSRVSVKDSLVG  59

Query  303  ---GGDSLWKGDGLSMKPCWERPSLADGDL--SNGYVTFSLTNGPEYHVSQISDAVVVAR  467
               G    W  D   + PCW  P+L   +   S GYVTFSLTNGPEYHVSQI+DAV+VA+
Sbjct  60   AVEGSKGPWMDDNSDLNPCW--PTLLPDEAVSSKGYVTFSLTNGPEYHVSQITDAVMVAK  117

Query  468  YLRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVP  647
            +L ATLV+PD+RGS PGD+R F+DIYD D+ +KSL+ VVKV    P  +S +N+A+VKVP
Sbjct  118  HLGATLVLPDIRGSKPGDERSFEDIYDSDKLIKSLENVVKVVKQLPEEVSLRNIAIVKVP  177

Query  648  NRVTEEHIAENIEP  689
             RVTE++I E+I+P
Sbjct  178  TRVTEDYIKEHIDP  191



>ref|XP_010466346.1| PREDICTED: uncharacterized protein LOC104746536 [Camelina sativa]
Length=423

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 133/194 (69%), Gaps = 13/194 (7%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGG----  308
            M  D RQ+VAG+LT+TMFVMLG M+ RD+FD+LQE           + S++++  G    
Sbjct  1    MGFDLRQVVAGILTITMFVMLGQMLHRDYFDSLQEKAQGDAQDIEFEGSKVAVRDGLVGT  60

Query  309  -----DSLWKGDGLSMKPCWERPSLADGDL--SNGYVTFSLTNGPEYHVSQISDAVVVAR  467
                 +  W  D   + PCW  P+L   +   S GYVTFSLTNGPEYH+SQI+DAV+VA+
Sbjct  61   VEGNSNGPWMEDNTDLNPCW--PTLLSDEAVSSKGYVTFSLTNGPEYHISQITDAVMVAK  118

Query  468  YLRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVP  647
            +L ATLV+PD+RGS PGD+R F+DIYD D+ +KSL+ VVKV    P  +S +N+A+VKVP
Sbjct  119  HLGATLVLPDIRGSKPGDERSFEDIYDADKLIKSLENVVKVVKQLPEEVSLRNMAIVKVP  178

Query  648  NRVTEEHIAENIEP  689
             RVTE+++ ENI P
Sbjct  179  TRVTEDYVKENIVP  192



>ref|XP_010500742.1| PREDICTED: uncharacterized protein LOC104778073 [Camelina sativa]
Length=423

 Score =   197 bits (502),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 134/193 (69%), Gaps = 11/193 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTN-KASELSLPGG---  308
            M VD RQ+VAG+LT+TMFVMLG M+ RD+FD LQE ++    HD   K S++++  G   
Sbjct  1    MGVDLRQVVAGILTITMFVMLGQMLHRDYFDALQE-KIQGDAHDIEFKGSKVAVEDGLVR  59

Query  309  ------DSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARY  470
                  +  W  D   +KPCW      +   S GYVTFSLTNGPEYHVSQI+DAV+VA++
Sbjct  60   AIQGVNNGPWMEDSHELKPCWSISQSDEAISSKGYVTFSLTNGPEYHVSQITDAVMVAKH  119

Query  471  LRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPN  650
            L ATLV+PD+RGS PGD+ +F DIYDVD+ +KSL+ VV V    P+ +S +++A+VKVP 
Sbjct  120  LGATLVLPDIRGSKPGDEMNFDDIYDVDKLIKSLESVVNVVRKLPSHVSLRDIAIVKVPT  179

Query  651  RVTEEHIAENIEP  689
            RV E++I  +I+P
Sbjct  180  RVAEDYIKAHIDP  192



>ref|XP_009381592.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=413

 Score =   197 bits (501),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 134/185 (72%), Gaps = 6/185 (3%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQES-RLTSTIH-DTNKASELSLPGGDS  314
            MAVDPRQ+VAG LT+ MF MLGNMIKRDHFD+++ S + TS +  D  K+ + S      
Sbjct  1    MAVDPRQLVAGFLTIAMFAMLGNMIKRDHFDSVKVSLQETSGVQFDALKSKDKS---ATQ  57

Query  315  LWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIP  494
            + K   L +KPCW +P +   + S G++TFSLT GPE+HVSQ++DAVV+ARYL A L++P
Sbjct  58   VSKESSLELKPCWAKP-VPKTEQSKGFITFSLTGGPEHHVSQVTDAVVIARYLGAILLLP  116

Query  495  DVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIA  674
            D+RGS  G KR+F+D+YD D+F  SL GVVKV    P+ ++++N AVV+VPNRV ++ I 
Sbjct  117  DIRGSELGQKRNFEDLYDADKFTTSLIGVVKVVKELPSEVTAENPAVVRVPNRVAKDFII  176

Query  675  ENIEP  689
             NIEP
Sbjct  177  NNIEP  181



>ref|XP_010488108.1| PREDICTED: uncharacterized protein LOC104766006 [Camelina sativa]
Length=423

 Score =   197 bits (501),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 133/194 (69%), Gaps = 13/194 (7%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGG----  308
            M  D RQ+VAG+LT+TMFVMLG M+ RD+FD+LQE           + S++++  G    
Sbjct  1    MGFDLRQVVAGILTITMFVMLGQMLHRDYFDSLQEKAQGDAQDIEFEGSKVAVKDGLVGT  60

Query  309  -----DSLWKGDGLSMKPCWERPSLADGDL--SNGYVTFSLTNGPEYHVSQISDAVVVAR  467
                 +  W  D   + PCW  P+L   +   S GYVTFSLTNGPEYH+SQI+DAV+VA+
Sbjct  61   VDGNRNGPWMEDNTDLNPCW--PTLLSDEAVSSKGYVTFSLTNGPEYHISQITDAVMVAK  118

Query  468  YLRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVP  647
            +L ATLV+PD+RGS PGD+R F+DIYD D+ +KSL+ VVKV    P  +S +N+A+VKVP
Sbjct  119  HLGATLVLPDIRGSKPGDERSFEDIYDADKLIKSLENVVKVVKQLPEEVSLRNMAIVKVP  178

Query  648  NRVTEEHIAENIEP  689
             RVTE++I E+I P
Sbjct  179  TRVTEDYIKEHIVP  192



>ref|XP_006393024.1| hypothetical protein EUTSA_v10011516mg [Eutrema salsugineum]
 gb|ESQ30310.1| hypothetical protein EUTSA_v10011516mg [Eutrema salsugineum]
Length=422

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 135/192 (70%), Gaps = 10/192 (5%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTN-KASELS-------  296
            M VD RQ+VAG+LT+TMFVMLG M+ RD+FD  QE ++    HD   + S+++       
Sbjct  1    MGVDLRQVVAGILTITMFVMLGQMLHRDYFDPAQE-KIQGDSHDIEFQGSKVAVEDGLVR  59

Query  297  -LPGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYL  473
               G    W  D   +KPCW      +   S G+VTFSLTNGPEYHVSQI+DAV+VA++L
Sbjct  60   TFEGNKGPWMEDCHELKPCWSISQPDEAVSSKGHVTFSLTNGPEYHVSQITDAVMVAKHL  119

Query  474  RATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNR  653
             ATLV+PD+RGS PGD+ +F+DIYDVD+ VKSL+ VVKV +  P+ +S +++A+VKVP R
Sbjct  120  GATLVLPDIRGSKPGDEMNFEDIYDVDKLVKSLESVVKVVSKLPSHVSLRDIAIVKVPTR  179

Query  654  VTEEHIAENIEP  689
            V E++I E+I+P
Sbjct  180  VAEDYIKEHIDP  191



>ref|NP_001131433.1| uncharacterized protein LOC100192765 [Zea mays]
 gb|ACF79838.1| unknown [Zea mays]
 tpg|DAA40441.1| TPA: hypothetical protein ZEAMMB73_044632 [Zea mays]
Length=421

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 134/193 (69%), Gaps = 13/193 (7%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQES---RLTSTIHDTNK------ASEL  293
            MAVDPRQ+VAG LT++MFVMLGNMIK DHF  + E      T  + +T K       S +
Sbjct  1    MAVDPRQVVAGFLTLSMFVMLGNMIKHDHFSPVTEELGFEATGVVSNTRKLDNDAEMSSV  60

Query  294  SLPGGDSLWKGDGLS-MKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARY  470
               G + L   D +  +KPCW +PS      SNG+VTFSLT GPEYH+SQI+DAVV+ARY
Sbjct  61   DTAGVEDLM--DAVEEVKPCWTKPS-PKNQPSNGFVTFSLTMGPEYHISQITDAVVIARY  117

Query  471  LRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPN  650
            L ATLV+PD+RG+  G+KR F+DIY+VD+FV+SLDGVV+V    P  +S+K  AV++VPN
Sbjct  118  LGATLVLPDIRGNELGNKRKFQDIYNVDKFVRSLDGVVEVIEDIPDEVSAKKPAVIRVPN  177

Query  651  RVTEEHIAENIEP  689
            RVTE  I   I+P
Sbjct  178  RVTESFITGTIQP  190



>ref|NP_175574.2| O-fucosyltransferase family protein [Arabidopsis thaliana]
 dbj|BAF01044.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32693.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=423

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 134/193 (69%), Gaps = 11/193 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTN-KASELSL------  299
            M VD RQ+VAG+LT+TMFVMLG M+ RD+FD +QE ++    HD     S++++      
Sbjct  1    MGVDLRQVVAGILTITMFVMLGQMLHRDYFDAVQE-KVQGDAHDIEFHGSKVAVEDGLVR  59

Query  300  ---PGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARY  470
                G    W  D   +KPCW      +   S GYVTFSLTNGPEYHVSQI+DAV+VA++
Sbjct  60   AFEAGTKGPWMEDSHELKPCWSISQSDEAVSSKGYVTFSLTNGPEYHVSQITDAVMVAKH  119

Query  471  LRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPN  650
            L ATLV+PD+RGS PGD+  F+DIYDVD+ +K+L+ VVKV    P+ +S +++A+VKVP 
Sbjct  120  LGATLVLPDIRGSKPGDEMKFEDIYDVDKLIKTLESVVKVVRKLPSHVSLRDIAIVKVPT  179

Query  651  RVTEEHIAENIEP  689
            RV E++I E+I+P
Sbjct  180  RVAEDYIKEHIDP  192



>ref|XP_009410212.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=413

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 133/185 (72%), Gaps = 5/185 (3%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQES-RLTSTIH-DTNKASELSLPGGDS  314
            MAVDPRQ+VAG LT++MF MLGNMIKRDHFD+++ S + TS +  D  KA E S+     
Sbjct  1    MAVDPRQVVAGFLTISMFAMLGNMIKRDHFDSIEVSIQETSVVQFDALKAEEKSV---TQ  57

Query  315  LWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIP  494
            +       +KPCW +P   + + S G++TFSLT GPE+H+SQ++DAVV+ARYL A LVIP
Sbjct  58   VSTESSPELKPCWAKPVPKEIEQSKGFITFSLTGGPEHHISQVTDAVVIARYLGAILVIP  117

Query  495  DVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIA  674
            D+RG+  G +R+F+D+YD D F  SL GV++V    P  ++++N AV++VPNRV+E+ I 
Sbjct  118  DIRGNEVGQRRNFEDMYDADNFTASLTGVIEVVRELPAEVTTENPAVIRVPNRVSEDFIK  177

Query  675  ENIEP  689
             NI+P
Sbjct  178  NNIQP  182



>ref|XP_010509815.1| PREDICTED: uncharacterized protein LOC104786164 [Camelina sativa]
Length=423

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 132/194 (68%), Gaps = 13/194 (7%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGG----  308
            M  D RQ+VAG+LT+TMFVMLG M+ RD+FD+LQE           + S++++  G    
Sbjct  1    MGFDLRQVVAGILTITMFVMLGQMLHRDYFDSLQEKAQGDAQDIEFEGSKVAVKDGLVGT  60

Query  309  -----DSLWKGDGLSMKPCWERPSLADGDL--SNGYVTFSLTNGPEYHVSQISDAVVVAR  467
                    W  D   + PCW  P+L   +   S GYVTFSLTNGPEYH+SQI+DAV+VA+
Sbjct  61   VEGNSKGPWMEDNTDLNPCW--PTLLSDEAVSSKGYVTFSLTNGPEYHISQITDAVMVAK  118

Query  468  YLRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVP  647
            +L ATLV+PD+RGS PGD+R F+DIYD D+ +KSL+ VVKV    P  +S +N+A+VKVP
Sbjct  119  HLGATLVLPDIRGSKPGDERSFEDIYDADKLIKSLENVVKVVQQLPEEVSLRNMAIVKVP  178

Query  648  NRVTEEHIAENIEP  689
             RVTE++I E+I P
Sbjct  179  TRVTEDYIKEHIVP  192



>ref|XP_011623883.1| PREDICTED: uncharacterized protein LOC18435668 [Amborella trichopoda]
Length=424

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 132/201 (66%), Gaps = 28/201 (14%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQ------------------ESRLTSTI  266
            MAVDPRQ+V   LT++MF ML NMIK+DHFDT++                  E R+  TI
Sbjct  1    MAVDPRQVVGAFLTLSMFAMLANMIKKDHFDTMEVKLPGTSGVHLDVFPSVAEGRI-ETI  59

Query  267  HDTNKASELSLPGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQIS  446
            H  N             WK     +KPCW  P   +GD + G++TFSL++GP YHVSQ++
Sbjct  60   HTANIV--------KGPWKQSNF-LKPCWTNPGSKEGDQAKGFITFSLSHGPHYHVSQVA  110

Query  447  DAVVVARYLRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKN  626
            DAVVVARYL ATLVIPD++G+  GDKR F++IY+VD+F+KSL+GVVK+    P  L +  
Sbjct  111  DAVVVARYLGATLVIPDIKGTKTGDKRKFEEIYNVDKFMKSLNGVVKIVREAPNELRTVK  170

Query  627  LAVVKVPNRVTEEHIAENIEP  689
             A VKVP++VTE++I+E+IEP
Sbjct  171  PAPVKVPSQVTEDYISEHIEP  191



>ref|XP_010545614.1| PREDICTED: uncharacterized protein LOC104817925 [Tarenaya hassleriana]
Length=425

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 133/193 (69%), Gaps = 11/193 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTN-KASEL--------  293
            M VD RQ+VAG+LT+TMFVMLG MI RD+FD  QE +     HD   + S++        
Sbjct  1    MGVDLRQVVAGILTITMFVMLGQMIHRDYFDPSQE-KFPGEGHDIEFEGSKVAVQEGLVR  59

Query  294  SLPGGDSLWKGD-GLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARY  470
            S+ G +  W  D    +KPCWE     +   S GYVTFSLTNGPEYHVSQI+DAV VA  
Sbjct  60   SVGGSNGPWMEDINNELKPCWEASMSDEAASSKGYVTFSLTNGPEYHVSQITDAVRVANR  119

Query  471  LRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPN  650
            L ATLV+PD+RG  PGD+R+F+DIY+ D+F+++L+GVVKV    P  +S +N+A+VKVP 
Sbjct  120  LGATLVLPDIRGRKPGDERNFEDIYNADKFIRNLEGVVKVVKQLPEEISLRNMAIVKVPA  179

Query  651  RVTEEHIAENIEP  689
            RV+E++I ENI P
Sbjct  180  RVSEDYIKENIIP  192



>ref|XP_008799452.1| PREDICTED: uncharacterized protein At1g04910 [Phoenix dactylifera]
Length=424

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 130/192 (68%), Gaps = 9/192 (5%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPG-----  305
            MAVDPRQ++A  LT++MF MLGNMIK+DHFD ++ S    +    +K   + +       
Sbjct  1    MAVDPRQVLAAFLTMSMFAMLGNMIKKDHFDNMELSFTMPSFPSESKVGIMRVEEMVGRQ  60

Query  306  ----GDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYL  473
                    W   G  +K CW +P++ +   S G++TFSLT GPEYHVSQI+DAVV+ARYL
Sbjct  61   ASTVKQGPWSERGQELKACWNKPAIKEEGQSKGFITFSLTGGPEYHVSQITDAVVIARYL  120

Query  474  RATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNR  653
             ATLV+PD+RGS  G K++F+D+YD D+F++SLDGV+K+    P  ++++   VV+VPN 
Sbjct  121  GATLVLPDIRGSELGQKKNFEDLYDADRFMRSLDGVIKMAKEVPAEVATEKPTVVRVPNG  180

Query  654  VTEEHIAENIEP  689
            V+E+ I EN+EP
Sbjct  181  VSEDFIMENVEP  192



>ref|XP_010929324.1| PREDICTED: uncharacterized protein LOC105050840 [Elaeis guineensis]
Length=426

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 134/197 (68%), Gaps = 18/197 (9%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTI-------------HDTNK  281
            MAVDPRQ++A  LT++MF MLGNMIK+DHFD ++ S  T  +              +  +
Sbjct  1    MAVDPRQVLAAFLTMSMFAMLGNMIKKDHFDNMELSLPTPWLPSGSNVNIMRVEEREGRQ  60

Query  282  ASELSLPGGDSLWKGDGLSMKPCWERPS-LADGDLSNGYVTFSLTNGPEYHVSQISDAVV  458
            ASE+        W   G   K CW +P+ + + + S G++TFSLT GPEYHVSQI+DAVV
Sbjct  61   ASEVKA----GPWSKRGQEQKTCWNKPAAIKEAEQSKGFITFSLTGGPEYHVSQITDAVV  116

Query  459  VARYLRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVV  638
            +ARYL ATLV+PDVRGS  G K++F+D+YD D+F++SLDGV+++    P  ++++   VV
Sbjct  117  IARYLGATLVLPDVRGSELGQKKNFEDMYDADKFMRSLDGVIRMVKEVPAEVATEKPPVV  176

Query  639  KVPNRVTEEHIAENIEP  689
            +VPNRV+E+ I ENIEP
Sbjct  177  RVPNRVSEDFIMENIEP  193



>ref|XP_006660799.1| PREDICTED: uncharacterized protein At1g04910-like [Oryza brachyantha]
Length=422

 Score =   195 bits (496),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 137/193 (71%), Gaps = 12/193 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTL--QESRLTST--------IHDTNKASE  290
            M VDPRQ+VAG LT++MFVMLGNMIK DHF  +  +E  L +         + DT + ++
Sbjct  1    MTVDPRQLVAGFLTLSMFVMLGNMIKHDHFTPVGGEELALETAGVDSNEIKVADTTEITK  60

Query  291  LSLPGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARY  470
            ++  G D L K     ++PCW +PS  +   S G+VTFSLT GPE+H+SQI+DAVV+ARY
Sbjct  61   VNTVGVD-LPKETAEEIRPCWSKPS-PNVQESKGFVTFSLTMGPEFHISQITDAVVIARY  118

Query  471  LRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPN  650
            L ATLV+P++RG+  G +R F+D+YDVD+F+ SLDGVVKV  S P  +S+K  AV++VPN
Sbjct  119  LGATLVLPEIRGNELGKRRKFEDMYDVDKFMTSLDGVVKVVHSLPNRVSAKKPAVIRVPN  178

Query  651  RVTEEHIAENIEP  689
            RVTEE I+  IEP
Sbjct  179  RVTEEFISGTIEP  191



>ref|NP_001143681.1| uncharacterized protein LOC100276406 [Zea mays]
 gb|ACG34025.1| hypothetical protein [Zea mays]
 gb|ACN29160.1| unknown [Zea mays]
 tpg|DAA62118.1| TPA: hypothetical protein ZEAMMB73_312698 [Zea mays]
Length=421

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 136/193 (70%), Gaps = 13/193 (7%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQE--------SRLTSTIHDTN-KASEL  293
            MAVDPRQ+VAG LT++MFVMLGNMIK DHF  + E        +R  +   D N + + +
Sbjct  1    MAVDPRQVVAGFLTLSMFVMLGNMIKHDHFSPVTEEMGLKATGARSNTMKLDNNAEMNSV  60

Query  294  SLPGGDSLWKGDGLS-MKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARY  470
             + G + L   D +  +KPCW +PS      SNG+VTFSLT GPEYH+SQI+DAVVVARY
Sbjct  61   DMAGVEDLM--DTIEEVKPCWTKPS-PKNQPSNGFVTFSLTMGPEYHISQITDAVVVARY  117

Query  471  LRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPN  650
            L AT V+PD+RG+  G+KR F+D+Y+VD+FV+SLDGVV+V    P  +S+K  AV++VPN
Sbjct  118  LGATFVLPDIRGNELGNKRKFQDMYNVDKFVRSLDGVVEVIDEIPDEVSAKKPAVIRVPN  177

Query  651  RVTEEHIAENIEP  689
            RVTE  I + I+P
Sbjct  178  RVTESFIMDTIQP  190



>ref|XP_010550817.1| PREDICTED: uncharacterized protein LOC104821598 [Tarenaya hassleriana]
Length=423

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 134/193 (69%), Gaps = 11/193 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASE---------L  293
            M VD RQ+VAG+LT+TMFVMLG M+ RD+FD+ QE + +   H                 
Sbjct  1    MGVDLRQVVAGILTITMFVMLGKMLHRDYFDSDQE-KFSGEEHGIEFGGSKVSVKDGLVR  59

Query  294  SLPGGDSLWKGDGLSMKPCW-ERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARY  470
            S+ GG   W  +   +KPCW    +  D   S GYVTFSLTNGPEYHVSQI+D V+VA++
Sbjct  60   SIGGGKGPWIENIHELKPCWTASSTSDDVSSSKGYVTFSLTNGPEYHVSQITDVVMVAKH  119

Query  471  LRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPN  650
            + ATLV+PD+RGS PGD+R+F+DIYD D+F+++L+GVVKV    P  +S +N+A+VKVP 
Sbjct  120  IGATLVLPDIRGSKPGDERNFEDIYDADKFIRNLEGVVKVVKQLPEEISLRNMAIVKVPT  179

Query  651  RVTEEHIAENIEP  689
            RV++++I E+IEP
Sbjct  180  RVSKDYIKESIEP  192



>emb|CDY52950.1| BnaC03g77880D [Brassica napus]
Length=418

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 132/192 (69%), Gaps = 12/192 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTN-KASELSLPGG---  308
            M VD RQ+VAG+LT+TMFVMLG M+ RD+FD  Q   +    HD     S++SL  G   
Sbjct  1    MGVDLRQVVAGILTITMFVMLGQMLHRDYFDANQ---VQGDAHDIEFHGSKVSLENGLVR  57

Query  309  -----DSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYL  473
                 +  W  D   +KPCW      +   S GYVTFSLTNGPEYHVSQI+DAV+VA++L
Sbjct  58   SSEGNNGPWMEDSNDLKPCWSISESDEAVSSKGYVTFSLTNGPEYHVSQITDAVMVAKHL  117

Query  474  RATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNR  653
             ATLV+PD+RGS PGD+ +F+DIY+VD+ VKSL+ V+KV    P+ +S +++A+VKVP R
Sbjct  118  GATLVLPDIRGSKPGDEMNFEDIYNVDKLVKSLESVIKVVKKLPSHVSLRDIAIVKVPTR  177

Query  654  VTEEHIAENIEP  689
            V E++I E+I P
Sbjct  178  VAEDYIKEHISP  189



>ref|XP_009147757.1| PREDICTED: uncharacterized protein LOC103871274 [Brassica rapa]
Length=414

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 134/190 (71%), Gaps = 10/190 (5%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHD-TNKASELSLP-----  302
            M VD RQ+VAG+LT+TMFVMLG M+ RD+FD +Q   +    HD     S++SL      
Sbjct  1    MGVDLRQVVAGILTITMFVMLGQMLHRDYFDAVQ---VQGDAHDIVFHGSKVSLEEDGLV  57

Query  303  -GGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
               +  W  +   +KPCW      +   S GYVTFSLTNGPEYH+SQI+DAV+VA++L A
Sbjct  58   RSSEGPWMENSHQLKPCWSLSQPDEEVSSKGYVTFSLTNGPEYHISQITDAVMVAKHLGA  117

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVT  659
            TLV+PD+RGS PGD+ +F+D+YDVD+ VKSL+ VVKV    P+ +S +++A+VKVP+RV 
Sbjct  118  TLVLPDIRGSKPGDEMNFEDVYDVDKLVKSLESVVKVVKKLPSHVSLRDIAIVKVPSRVA  177

Query  660  EEHIAENIEP  689
            E++I E+I+P
Sbjct  178  EDYIKEHIDP  187



>ref|XP_004957253.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=420

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 136/192 (71%), Gaps = 11/192 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDT------LQESRL---TSTIHDTNKASEL  293
            MAVDPRQ+VAG LT++MFVMLGNMIK DHF +      L+ +     T  + D  + S +
Sbjct  1    MAVDPRQVVAGFLTLSMFVMLGNMIKHDHFSSPGPQLGLEATGAEFNTMKLDDNAEMSNI  60

Query  294  SLPGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYL  473
            +  G ++L   D   +KPCW  PS      SNGYVTFSLT GPEYH+SQI+DAVVVARYL
Sbjct  61   NTGGVENLMDADE-EVKPCWTIPS-PKTQPSNGYVTFSLTMGPEYHISQITDAVVVARYL  118

Query  474  RATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNR  653
             ATLV+PD+RG+  G+KR F+D+Y+VD+F+++L+GVV+V    P  +S+K  A+++VPNR
Sbjct  119  GATLVLPDIRGNELGNKRKFQDMYNVDKFMRNLEGVVEVIEELPDEVSAKKPALIRVPNR  178

Query  654  VTEEHIAENIEP  689
            VTE  I + I+P
Sbjct  179  VTESFITDTIQP  190



>gb|AAG50891.1|AC025294_29 unknown protein [Arabidopsis thaliana]
Length=460

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 132/203 (65%), Gaps = 20/203 (10%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNK----ASELSLPGG  308
            M VD RQ+VAG+LT+TMFVMLG M+ RD+FD +Q   L   I    K    A ++   G 
Sbjct  1    MGVDLRQVVAGILTITMFVMLGQMLHRDYFDAVQVQTLERMIDSAEKVQGDAHDIEFHGS  60

Query  309  -----DSL-----------WKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQ  440
                 D L           W  D   +KPCW      +   S GYVTFSLTNGPEYHVSQ
Sbjct  61   KVAVEDGLVRAFEAGTKGPWMEDSHELKPCWSISQSDEAVSSKGYVTFSLTNGPEYHVSQ  120

Query  441  ISDAVVVARYLRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSS  620
            I+DAV+VA++L ATLV+PD+RGS PGD+  F+DIYDVD+ +K+L+ VVKV    P+ +S 
Sbjct  121  ITDAVMVAKHLGATLVLPDIRGSKPGDEMKFEDIYDVDKLIKTLESVVKVVRKLPSHVSL  180

Query  621  KNLAVVKVPNRVTEEHIAENIEP  689
            +++A+VKVP RV E++I E+I+P
Sbjct  181  RDIAIVKVPTRVAEDYIKEHIDP  203



>ref|XP_009410213.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=412

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 133/185 (72%), Gaps = 6/185 (3%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQES-RLTSTIH-DTNKASELSLPGGDS  314
            MAVDPRQ+VAG LT++MF MLGNMIKRDHFD+++ S + TS +  D  KA E S+     
Sbjct  1    MAVDPRQVVAGFLTISMFAMLGNMIKRDHFDSIEVSIQETSVVQFDALKAEEKSV---TQ  57

Query  315  LWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIP  494
            +       +KPCW +P +   + S G++TFSLT GPE+H+SQ++DAVV+ARYL A LVIP
Sbjct  58   VSTESSPELKPCWAKP-VPKIEQSKGFITFSLTGGPEHHISQVTDAVVIARYLGAILVIP  116

Query  495  DVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIA  674
            D+RG+  G +R+F+D+YD D F  SL GV++V    P  ++++N AV++VPNRV+E+ I 
Sbjct  117  DIRGNEVGQRRNFEDMYDADNFTASLTGVIEVVRELPAEVTTENPAVIRVPNRVSEDFIK  176

Query  675  ENIEP  689
             NI+P
Sbjct  177  NNIQP  181



>ref|XP_006297757.1| hypothetical protein CARUB_v10013792mg [Capsella rubella]
 ref|XP_006297758.1| hypothetical protein CARUB_v10013792mg [Capsella rubella]
 gb|EOA30655.1| hypothetical protein CARUB_v10013792mg [Capsella rubella]
 gb|EOA30656.1| hypothetical protein CARUB_v10013792mg [Capsella rubella]
Length=421

 Score =   192 bits (488),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 132/194 (68%), Gaps = 14/194 (7%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLP------  302
            M  D RQ+VAG+LT+TMFVMLG M+ RD++D+LQE           + S++++       
Sbjct  1    MGFDLRQVVAGILTITMFVMLGQMLHRDYYDSLQEKVQGDAQDIEFEGSKVAVKDGLVGT  60

Query  303  --GGDSLWKGDGLSMKPCWERPSL----ADGDLSNGYVTFSLTNGPEYHVSQISDAVVVA  464
              G    W  D   + PCW  P+L    A    S GYVTFSLTNGPEYH+SQI+DAV+VA
Sbjct  61   VEGSKGPWMEDNTDLNPCW--PTLLSDEAVSSSSKGYVTFSLTNGPEYHISQITDAVMVA  118

Query  465  RYLRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKV  644
            ++L ATLV+PD+RGS PGD++ F+DIYD D+ +KSL+ VVKV    P  +S +N+A+VKV
Sbjct  119  KHLGATLVLPDIRGSKPGDEKSFEDIYDADKLIKSLENVVKVVKQLPEEVSLRNIAIVKV  178

Query  645  PNRVTEEHIAENIE  686
            P RVTE++I E+I+
Sbjct  179  PTRVTEDYIKEHID  192



>emb|CDY55666.1| BnaC06g04700D [Brassica napus]
Length=414

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 134/190 (71%), Gaps = 10/190 (5%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHD-TNKASELSLP-----  302
            M VD RQ+VAG+LT+TMFVMLG M+ RD+FD +Q   +    HD     S+++L      
Sbjct  1    MGVDLRQVVAGILTITMFVMLGQMLHRDYFDAVQ---VQGDAHDIVFHGSKVALEEDGLV  57

Query  303  -GGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
               +  W  +   +KPCW      +   S GYVTFSLTNGPEYH+SQI+DAV+VA++L A
Sbjct  58   RTSEGPWMENSHQLKPCWSISQPDEAVSSKGYVTFSLTNGPEYHISQITDAVMVAKHLGA  117

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVT  659
            TLV+PD+RG+ PGD+ +F+D+YDVD+ VKSL+ VVKV    P+ +S +++A+VKVP+RV 
Sbjct  118  TLVLPDIRGTKPGDEMNFEDVYDVDKLVKSLESVVKVVKKLPSHVSLRDIAIVKVPSRVA  177

Query  660  EEHIAENIEP  689
            E++I E+I+P
Sbjct  178  EDYIKEHIDP  187



>emb|CDY22855.1| BnaA06g02220D [Brassica napus]
Length=414

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 133/190 (70%), Gaps = 10/190 (5%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHD-TNKASELSLP-----  302
            M VD RQ+VAG+LT+TMFVMLG M+ RD+FD +Q   +    HD     S++SL      
Sbjct  1    MGVDLRQVVAGILTITMFVMLGQMLHRDYFDAVQ---VQGDAHDIVFHGSKVSLEEDGLV  57

Query  303  -GGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
               +  W  +   +KPCW      +   S GYVTFSLTNGPEYH+SQI+DAV+VA++L A
Sbjct  58   RTSEGPWMENSHQLKPCWSLSQPDEEVSSKGYVTFSLTNGPEYHISQITDAVMVAKHLGA  117

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVT  659
            TLV+PD+RGS PGD+ +F+DIYDVD+ VKSL+ VV V    P+ +S +++A+VKVP+RV 
Sbjct  118  TLVLPDIRGSKPGDEMNFEDIYDVDKLVKSLESVVNVVKKLPSHVSLRDIAIVKVPSRVA  177

Query  660  EEHIAENIEP  689
            E++I E+I+P
Sbjct  178  EDYIKEHIDP  187



>ref|XP_009107173.1| PREDICTED: uncharacterized protein LOC103832835 [Brassica rapa]
 emb|CDY46550.1| BnaA08g01890D [Brassica napus]
Length=418

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 130/192 (68%), Gaps = 12/192 (6%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTN-KASELSLP-----  302
            M VD RQ+VAG+LT+TMFVMLG M+ RD+FD  Q   +    HD     S++SL      
Sbjct  1    MGVDLRQVVAGILTITMFVMLGQMLHRDYFDANQ---VQGDAHDIEFHGSKVSLEDGLVR  57

Query  303  ---GGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYL  473
               G    W  D   +K CW      +   S GYVTFSLTNGPEYHVSQI+DAV+VA++L
Sbjct  58   SSEGTKGPWMEDSNDLKSCWSISESDEAVSSKGYVTFSLTNGPEYHVSQITDAVMVAKHL  117

Query  474  RATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNR  653
             ATLV+PD+RGS PGD+ +F+DIYDVD+ VKSL+ V+KV    P+ +S +++A+VKVP R
Sbjct  118  GATLVLPDIRGSKPGDEMNFEDIYDVDKLVKSLESVIKVVKKLPSHVSLRDIAIVKVPTR  177

Query  654  VTEEHIAENIEP  689
            V E++I E+I P
Sbjct  178  VAEDYIKEHISP  189



>ref|XP_003578366.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=420

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 127/188 (68%), Gaps = 8/188 (4%)
 Frame = +3

Query  147  VDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNK-----ASELSLPGGD  311
            VDPRQ+VAG LT++MFVMLGNMIK DHF    E  L +T  + N       +E+S   GD
Sbjct  2    VDPRQVVAGFLTLSMFVMLGNMIKHDHFTPASELSLEATGAEFNAMKIADTAEMSKVDGD  61

Query  312  --SLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATL  485
               L K     +KPCW +PS      SNG+VT SLT GPEYH SQI+DAVV+ARYL ATL
Sbjct  62   GVELLKETNEEIKPCWTKPS-PKVQQSNGFVTLSLTIGPEYHTSQIADAVVIARYLGATL  120

Query  486  VIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEE  665
            V+P++RG+  G  R F+D+YDV++F  SL+GVVKV    P   ++K  AV++VPNRVTEE
Sbjct  121  VLPEIRGNELGKMRKFEDMYDVEKFTSSLNGVVKVVHKLPDEWTAKKPAVIRVPNRVTEE  180

Query  666  HIAENIEP  689
             I E I+P
Sbjct  181  FILETIQP  188



>ref|XP_008645321.1| PREDICTED: uncharacterized protein At1g04910-like [Zea mays]
Length=334

 Score =   187 bits (476),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 131/193 (68%), Gaps = 15/193 (8%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQES---RLTSTIHDTNK------ASEL  293
            MAVD +Q+VAG LT++MFVMLGNMIK DHF  + E      T  + +T K       S +
Sbjct  1    MAVDSQQVVAGFLTLSMFVMLGNMIKHDHFSPVTEELGLEATGVVSNTRKLDNNAEMSSV  60

Query  294  SLPGGDSLWKGDGLS-MKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARY  470
               G + L   D +  +KPCW +P       SNG+VTFSLT GPEYH+SQI+D VV+ARY
Sbjct  61   DTTGVEDLM--DAVEEVKPCWTKPK---NQSSNGFVTFSLTMGPEYHISQITDVVVIARY  115

Query  471  LRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPN  650
            L ATLV+PD+RG+  G+KR F+D+Y+VD+FV+SLDGVV+V    P  +S+K  AV++VPN
Sbjct  116  LGATLVLPDIRGNELGNKRKFQDMYNVDKFVRSLDGVVEVIEDIPDEVSAKKPAVIRVPN  175

Query  651  RVTEEHIAENIEP  689
            RVTE  I   I+P
Sbjct  176  RVTESFITGTIQP  188



>gb|EYU18195.1| hypothetical protein MIMGU_mgv1a023399mg [Erythranthe guttata]
Length=421

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 127/190 (67%), Gaps = 8/190 (4%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSL-  317
            MAVD RQ++A  LT +MF MLGNMIKRDH D L E    +T+         S PG   L 
Sbjct  1    MAVDLRQVMAAFLTFSMFAMLGNMIKRDHIDPLWEPEPETTMVQYGMLKN-SKPGMHKLS  59

Query  318  ------WKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
                  WK     +KPC ++P     + SNGY+ FSLT+GPEYH SQ+++AV VARYL A
Sbjct  60   EANYGPWKEHDEIVKPCSKKPLFKGKEQSNGYIFFSLTHGPEYHASQVANAVAVARYLGA  119

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVT  659
            TLV+PDVRG+  GDKR+FK++YDV++F K+L GVV+V  + P  +S + L ++KVP  V+
Sbjct  120  TLVLPDVRGAKLGDKRNFKELYDVEKFTKTLTGVVRVEKTPPKEISKERLPIIKVPYMVS  179

Query  660  EEHIAENIEP  689
            EE++A NI+P
Sbjct  180  EEYVASNIKP  189



>gb|EEC84820.1| hypothetical protein OsI_31907 [Oryza sativa Indica Group]
Length=471

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 107/240 (45%), Positives = 135/240 (56%), Gaps = 58/240 (24%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFD----------TLQESRLTS--TIHDTNKA  284
            MAVDPRQ+VAG LT++MFVMLGNMIK DHF              + R+ S  T+ ++ K 
Sbjct  1    MAVDPRQVVAGFLTLSMFVMLGNMIKHDHFTPVGAGQEEHVVCSQKRIRSSITVKNSTKL  60

Query  285  SELSLP---------------------------------------------GGDSLWKGD  329
               SLP                                              G  L K  
Sbjct  61   YAFSLPKERFLESFTTVFILSNAQLLGLEATGIESNEIKIADTTEMSKVNKAGVDLPKET  120

Query  330  GLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDVRGS  509
               ++PCW +P  ++   S G+VTFSLT GPEYH+SQI+DAVV+ARYL ATLV+P++RG+
Sbjct  121  AEEIRPCWSKPR-SNVQESKGFVTFSLTMGPEYHISQITDAVVIARYLGATLVLPEIRGN  179

Query  510  NPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIAENIEP  689
              G +R F+D+YDVD+F+ SLDGVVKV  S P  +SSK  AVV+VPNRVTEE I   IEP
Sbjct  180  ELGKRRKFEDMYDVDKFMTSLDGVVKVVHSLPNAVSSKKPAVVRVPNRVTEEFITGTIEP  239



>ref|XP_011077745.1| PREDICTED: uncharacterized protein At1g04910-like [Sesamum indicum]
Length=417

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 130/191 (68%), Gaps = 10/191 (5%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSL-  317
            MAVD RQ++A VLT +MF+MLGNMIKRDH D   E  L  +      A ++S PG   L 
Sbjct  1    MAVDLRQVMAAVLTFSMFIMLGNMIKRDHIDPFLEP-LPVSPDVQYHALKVSKPGMVKLI  59

Query  318  ------WKGDGLSMKPCWERPSLADGDL-SNGYVTFSLTNGPEYHVSQISDAVVVARYLR  476
                  W  +  SM PCW  P L+ G + SNGY+ FSLT+GPEYH SQ+++AV VA++L 
Sbjct  60   ETRYGPWMENNDSMNPCWTTP-LSKGKVQSNGYIFFSLTHGPEYHASQLANAVAVAKHLG  118

Query  477  ATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRV  656
            ATL +PD+RGS  G+KR F +IYDV+ F++SL+GVV+V  + P  LS+  L +V+VPNRV
Sbjct  119  ATLALPDIRGSKLGEKRRFGEIYDVNNFIRSLNGVVQVDKNPPAELSNGRLPIVRVPNRV  178

Query  657  TEEHIAENIEP  689
            +E+ IA  +EP
Sbjct  179  SEDFIASKVEP  189



>dbj|BAK06813.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=417

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 127/186 (68%), Gaps = 7/186 (4%)
 Frame = +3

Query  147  VDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQE-----SRLTSTIHDTNKASELSLPGGD  311
            VDPRQ++AG LT++MFVMLGNMIK DHF ++ E     + +  T       +E++   G 
Sbjct  2    VDPRQVLAGFLTLSMFVMLGNMIKHDHFTSVSELAVDATGVEFTAMKVAGNTEIT-KAGV  60

Query  312  SLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVI  491
             L       +KPCW +PS  D D  NG+VT SLT GPEYH SQI+DAVV+ARYL ATLV+
Sbjct  61   ELQTEATEEIKPCWTKPSPKD-DQPNGFVTLSLTIGPEYHTSQIADAVVIARYLGATLVL  119

Query  492  PDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHI  671
            P++RGS  G  R F+++YDV++F K+LDGVVK+    P   ++K  AV++VPNRVTE+ I
Sbjct  120  PEIRGSELGKSRKFQEMYDVEKFKKNLDGVVKIVDKLPAEWTTKKPAVIRVPNRVTEDFI  179

Query  672  AENIEP  689
             + I+P
Sbjct  180  LDTIQP  185



>gb|EYU38735.1| hypothetical protein MIMGU_mgv1a007007mg [Erythranthe guttata]
Length=423

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 126/191 (66%), Gaps = 8/191 (4%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTS--TIHDTNKASELSLPGGDS  314
            MA D RQ++A  LT +MF+MLGNMIK DH D L +S   S    +D+ K S+ S+     
Sbjct  1    MAFDIRQVMAAFLTFSMFIMLGNMIKTDHIDPLFDSMEVSENVRYDSFKVSKQSMVKLQE  60

Query  315  L----WKGDGLSMKPCWERPSLADGDLSN-GYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
            L    W+    ++KPCW+ PS    + SN GY+ FSLT+GPE+H SQ+++AV VA++L A
Sbjct  61   LDYGPWRVKSDTLKPCWKNPSSKGKEKSNNGYIFFSLTHGPEFHASQVANAVAVAKHLGA  120

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSK-NLAVVKVPNRV  656
            TLVIPD+RG+  GDKR F DIYDVD F+ +L  +VKV  + P  LSS   L  +++PN V
Sbjct  121  TLVIPDIRGTKLGDKRQFGDIYDVDTFIAALKEIVKVDKNAPAELSSNAKLYTMRIPNGV  180

Query  657  TEEHIAENIEP  689
            +E+ IA  IEP
Sbjct  181  SEDLIASKIEP  191



>ref|XP_009617901.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
tomentosiformis]
Length=418

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 123/187 (66%), Gaps = 5/187 (3%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSLW  320
            MA D RQ+VAG+LT +M +ML NM+KRDHFD L    L S  +D  K S+ SL       
Sbjct  1    MARDVRQVVAGLLTGSMLMMLCNMVKRDHFDPLVVENL-SVQYDVIKVSKQSLIKLSDTS  59

Query  321  KGDGL----SMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLV  488
            +G  L    S+KPCW +P   + + S GY+ F+LT   E HVSQI+DAVVVARYL ATLV
Sbjct  60   RGSLLMENHSLKPCWRKPLTINEEQSKGYIFFTLTESFEDHVSQIADAVVVARYLGATLV  119

Query  489  IPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEH  668
            +P++RG+  G KR F DIYD+ +F+ SLDG+V++    PT  S  N+  +KVP+ VT++ 
Sbjct  120  LPEIRGTKTGHKRQFGDIYDIKRFMTSLDGIVQIVRDPPTESSKVNITNIKVPSMVTKDF  179

Query  669  IAENIEP  689
            IA  I+P
Sbjct  180  IASKIQP  186



>ref|XP_009785320.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=418

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 122/187 (65%), Gaps = 5/187 (3%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSLW  320
            MA D RQ+VAG+LT +M +ML NM+KRDHFD L    L S  +D  K S+ SL       
Sbjct  1    MARDVRQVVAGLLTGSMLMMLCNMVKRDHFDPLVVENL-SVQYDVIKVSKQSLIKLSDTS  59

Query  321  KGDGL----SMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLV  488
            +G  L    S+KPCW +P   + + S GY+ F+LT  PE HV+QI+DAVVVA+YL ATLV
Sbjct  60   RGSLLMESHSLKPCWRKPLTINEEQSKGYIFFTLTESPEDHVTQIADAVVVAKYLGATLV  119

Query  489  IPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEH  668
            +P++RG+  G KR F DIYD+ +F+ SLDG+V+V    P   S  N+  +KVP+ V ++ 
Sbjct  120  LPEIRGTKTGHKRQFGDIYDIKRFMTSLDGIVQVVKDPPMESSKVNITNIKVPSMVNQDF  179

Query  669  IAENIEP  689
            IA  I+P
Sbjct  180  IASKIQP  186



>gb|KEH28614.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=368

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +3

Query  315  LWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIP  494
            LWKGD   +K CW +PS  + + ++G+VTFSLTNGPEYH+SQI+DAV+VAR L A+LVIP
Sbjct  12   LWKGDTDELKQCWVKPSGDEVEQTDGFVTFSLTNGPEYHLSQIADAVIVARNLGASLVIP  71

Query  495  DVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIA  674
            D+RGS PGDKR+F+DIYDVD F+KS++GVVKV    P+ +++K +A VKVPNRVTE++IA
Sbjct  72   DIRGSQPGDKRNFEDIYDVDVFMKSMEGVVKVVKDLPSHVTTKKIAAVKVPNRVTEDYIA  131

Query  675  ENIEP  689
             ++EP
Sbjct  132  RHVEP  136



>ref|XP_004488019.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=420

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 128/188 (68%), Gaps = 7/188 (4%)
 Frame = +3

Query  144  AVDPRQIVAGVLTVTMFVMLGNMIKRDHFD-TLQESRLTSTIHDTNKASELSLP-----G  305
            ++D RQ  AG+LT++MF+MLGNMIK+DHFD ++ +  +  + H++   +E S        
Sbjct  3    SMDLRQAFAGLLTLSMFIMLGNMIKKDHFDYSINDVDIEVSEHESVAVTEPSFATVSHLS  62

Query  306  GDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATL  485
              SL K D   +KPCW  P L + + S G++ FSLTNGPEYH+SQI+DAVVVARYL ATL
Sbjct  63   KKSLKKNDQ-GLKPCWNPPPLKEVEQSKGFILFSLTNGPEYHISQIADAVVVARYLGATL  121

Query  486  VIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEE  665
            V+P ++ S  G      DIYDV+  +  L+G+VKVT + P  +S++N  +++VPN+V+++
Sbjct  122  VLPHIKSSKSGHTMSLGDIYDVENVLNKLNGLVKVTRTLPPQVSNRNTPIIRVPNKVSQD  181

Query  666  HIAENIEP  689
            +I + ++P
Sbjct  182  YIMKKVKP  189



>gb|EMT00881.1| hypothetical protein F775_06359 [Aegilops tauschii]
Length=441

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/233 (43%), Positives = 133/233 (57%), Gaps = 54/233 (23%)
 Frame = +3

Query  147  VDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTST-----IHDTNKASELSLPGGD  311
            V PRQ++AG LT++MFVMLGNMIK DHF ++ E  L +T     +  T+  S + L  G 
Sbjct  2    VGPRQVLAGFLTLSMFVMLGNMIKHDHFTSVSERALDATDDSASVGLTHLCSTV-LRTGK  60

Query  312  SLW------KGDGLS-----------------------------------------MKPC  350
             LW       G G++                                         +KPC
Sbjct  61   FLWVLAKISDGFGVAVTLKTQLKLAVEATGVELNAMKIADNTEITKAGVELEATEEIKPC  120

Query  351  WERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDVRGSNPGDKRD  530
            W +PS  D D SNG+VT SLT GPEYH SQI+DAVV+ARYL ATLV+P++RG+  G  R 
Sbjct  121  WTKPSPKD-DQSNGFVTMSLTIGPEYHSSQIADAVVIARYLGATLVLPEIRGNELGKSRK  179

Query  531  FKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIAENIEP  689
            F+D+YDV++F  +LDGVVKV    P   ++K  AV++VPNRVTE+ I + I+P
Sbjct  180  FQDMYDVEKFKMNLDGVVKVVDKLPAEWTTKKPAVIRVPNRVTEDFILDTIQP  232



>ref|XP_003595107.1| DUF246 domain-containing protein [Medicago truncatula]
 gb|AES65358.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=423

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 127/195 (65%), Gaps = 17/195 (9%)
 Frame = +3

Query  144  AVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTL------------QESRLTSTIHDTNKAS  287
            +++ RQ  AG+LT++MF+MLGNMIK+DHFD              Q+  +T T  +    S
Sbjct  3    SMELRQAFAGLLTLSMFIMLGNMIKKDHFDYAVEDIEVQATEVSQQDSVTVTQENMATVS  62

Query  288  ELSLPGGDSLWKGDGLSMKPCWERPS-LADGDLSNGYVTFSLTNGPEYHVSQISDAVVVA  464
             L+        K +  ++KPCW  P+ L + D S G+V FSLTNGPEYH+SQI+DAVVVA
Sbjct  63   HLT----KKPLKQNDKALKPCWNPPAPLKEEDQSKGFVIFSLTNGPEYHISQIADAVVVA  118

Query  465  RYLRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKV  644
            RYL ATLV+PD++ S  G+  +  DIYDV+  +  L+G VKVT + P  +S+++  +V+V
Sbjct  119  RYLGATLVLPDIKNSKSGNSMNLGDIYDVENVLDKLNGFVKVTKTLPPQVSTRSTPIVRV  178

Query  645  PNRVTEEHIAENIEP  689
            PN+V++++I   I+P
Sbjct  179  PNKVSQDYILNKIKP  193



>gb|KJB66474.1| hypothetical protein B456_010G141100 [Gossypium raimondii]
Length=395

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 121/191 (63%), Gaps = 35/191 (18%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSLW  320
            M +D RQ+VAG+LT+TMFVMLG MIKRDHFD+LQ+ +L     D          G  ++ 
Sbjct  1    MGIDLRQVVAGILTLTMFVMLGQMIKRDHFDSLQD-KLPGEAQDVQ-------VGNANVI  52

Query  321  KGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQ--------ISDAVVVARYLR  476
            + DGL               LS G      + GP    SQ        ++DAV+VARYL 
Sbjct  53   EKDGLV-------------KLSKG------SKGPWMKDSQELKPLPLQMADAVIVARYLA  93

Query  477  ATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRV  656
            A LV+PD+RGS PGD+R+FKDIYDV++F+KSLDGVVKV    P  +S ++LA VKVPNRV
Sbjct  94   AALVLPDIRGSRPGDERNFKDIYDVEKFMKSLDGVVKVVKQLPNEISIRDLAAVKVPNRV  153

Query  657  TEEHIAENIEP  689
            TE+HI EN++P
Sbjct  154  TEDHIVENVQP  164



>ref|XP_004243033.1| PREDICTED: uncharacterized protein LOC101261246 [Solanum lycopersicum]
Length=419

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 125/189 (66%), Gaps = 10/189 (5%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSL-----PG  305
            MA D RQ+VAG+LT +M +ML NM+KRDHFD +    L S  +D  K S+ SL      G
Sbjct  1    MARDVRQVVAGLLTGSMLIMLCNMVKRDHFDPIYVENL-SVQYDLVKVSKQSLVKLSDKG  59

Query  306  GDSLWKGDGLSMKPCWERP-SLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRAT  482
            G  +W+ +  S+KPCW +P S  + +   GY+ F+LT+ PE H++QI++AVVVA+Y+ AT
Sbjct  60   G--IWR-ENFSLKPCWRKPLSTTNEEQGKGYIFFNLTDNPEDHITQIANAVVVAKYVGAT  116

Query  483  LVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTE  662
            LV+P++RGS  G KR F DIYD+++F+ SLDG ++V    P   S  N+  +KVP  VT+
Sbjct  117  LVLPEIRGSQTGHKRQFGDIYDIERFMTSLDGTIQVVKDPPMEASKVNITNIKVPFIVTK  176

Query  663  EHIAENIEP  689
            + I   I+P
Sbjct  177  DFIESKIKP  185



>ref|NP_001242787.1| uncharacterized protein LOC100818659 [Glycine max]
 gb|ACU17958.1| unknown [Glycine max]
Length=420

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 125/188 (66%), Gaps = 9/188 (5%)
 Frame = +3

Query  147  VDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKA---SELSLPGGDSL  317
            +D RQ +AG+LT++MF+MLGNMIK+DHFD++ +  + +     N +   +E SL     +
Sbjct  4    MDLRQALAGLLTLSMFIMLGNMIKKDHFDSMYDVNIEAAPTSQNASEVVTEQSLATVSHV  63

Query  318  WKG----DGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATL  485
             K     +G  +KPC    +L +   S G++TFSLTNGPEYH+SQI+DAVVVAR L ATL
Sbjct  64   SKKSLMENGKGLKPCRNPLALEEAPQSEGFITFSLTNGPEYHISQIADAVVVARILGATL  123

Query  486  VIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEE  665
            V+PD+R S  G      DIYDV + +  LDG+V+VT + P  +++ N  +VKVPNRV+++
Sbjct  124  VLPDIRSSKSGYSMSLGDIYDVQKIINRLDGLVRVTRTLP--VTNGNPPIVKVPNRVSQD  181

Query  666  HIAENIEP  689
            +I   ++P
Sbjct  182  YIVRTVQP  189



>emb|CDP20249.1| unnamed protein product [Coffea canephora]
Length=421

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 123/189 (65%), Gaps = 8/189 (4%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESR-----LTSTIHDTNKASELSLPG  305
            MA+D RQ+VA +LT++MF+MLGNMIK+DH D L         +   +   +K S + L  
Sbjct  1    MAMDLRQVVAAILTMSMFLMLGNMIKKDHIDPLLVDMPVSLDIQQGLLKVSKHSVVKLAS  60

Query  306  GDSLWKGDGLSMKPCWER-PSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRAT  482
            G   WK D  +M+PCW++      G+ +NGY++ SLT GPEYH  QI++A+++A++L AT
Sbjct  61   GP--WKEDDEAMRPCWKKLYKTKKGEQTNGYISLSLTKGPEYHALQIANAIMIAKHLGAT  118

Query  483  LVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTE  662
            LV+PD++G+   +KR F +IYD  +F  SLDGV++V          + + +VKVP RVTE
Sbjct  119  LVLPDIKGAKVSEKRMFGEIYDPQKFTTSLDGVIQVVKDPINQQVGEKVVIVKVPERVTE  178

Query  663  EHIAENIEP  689
            + I+ +IEP
Sbjct  179  KFISAHIEP  187



>gb|ABR16242.1| unknown [Picea sitchensis]
Length=428

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 121/193 (63%), Gaps = 10/193 (5%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHF-DTLQESRLTST---------IHDTNKASE  290
            M VD RQI   +LT++MFVMLGNMIK+DHF DT     +  +          + T+K   
Sbjct  1    MGVDVRQIAGAILTLSMFVMLGNMIKKDHFSDTTATLEVNYSNGPAPSEDAAYATSKGVI  60

Query  291  LSLPGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARY  470
                  ++LW+    ++ PCW+       + S G+V F L+NGP YHVSQ++DA+VVA+Y
Sbjct  61   TKEKEPNNLWRTTEPALNPCWDDKITKSTEKSAGFVQFRLSNGPHYHVSQVADAIVVAKY  120

Query  471  LRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPN  650
            L ATLV+P+++GS+  +   F++IYD D+F+ SL  VVKV    P    ++   +VK+P+
Sbjct  121  LGATLVLPEIKGSSADENSKFEEIYDADKFINSLRDVVKVARQLPNDKIARRTVLVKIPH  180

Query  651  RVTEEHIAENIEP  689
            RVTEE+I EN+EP
Sbjct  181  RVTEEYIEENVEP  193



>ref|XP_003533745.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=420

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 125/190 (66%), Gaps = 13/190 (7%)
 Frame = +3

Query  147  VDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASE---------LSL  299
            +D RQ +AG+LT++MF+MLGNMIK+DHFD++ +  + +     N ASE         +S 
Sbjct  4    MDLRQALAGLLTLSMFIMLGNMIKKDHFDSMYDVNIEAAPASQN-ASEAVIDQSLATVSH  62

Query  300  PGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
                SL + +G  +KPC    SL +   S G++TFSLTNGPEYH+SQI+DAVVVAR L A
Sbjct  63   VSKKSLME-NGKGLKPCRNPLSLEEAHQSKGFITFSLTNGPEYHISQIADAVVVARILGA  121

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVT  659
            TLV+PD+R S  G      DIYDV + +  LDG+V VT + P  +++ N  +VKVPNRV+
Sbjct  122  TLVLPDIRSSKLGYSMSLGDIYDVQKIINRLDGLVGVTKTLP--VTNGNPPIVKVPNRVS  179

Query  660  EEHIAENIEP  689
            +++I   ++P
Sbjct  180  QDYIVRIVKP  189



>gb|KHN35827.1| DUF246 domain-containing protein [Glycine soja]
Length=420

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 124/190 (65%), Gaps = 13/190 (7%)
 Frame = +3

Query  147  VDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASE---------LSL  299
            +D RQ +AG+LT++MF+MLGNMIK+DHFD++ +  + +     N ASE         +S 
Sbjct  4    MDLRQALAGLLTLSMFIMLGNMIKKDHFDSMYDVNIEAAPASQN-ASEAVIDQSLATVSH  62

Query  300  PGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
                SL + +G  +KPC    SL +   S G++TFSLTNGPEYH+SQ +DAVVVAR L A
Sbjct  63   VSKKSLME-NGKGLKPCRNPLSLEEAHQSKGFITFSLTNGPEYHISQATDAVVVARILGA  121

Query  480  TLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVT  659
            TLV+PD+R S  G      DIYDV + +  LDG+V VT + P  +++ N  +VKVPNRV+
Sbjct  122  TLVLPDIRSSKLGYSMSLGDIYDVQKIINRLDGLVGVTKTLP--VTNGNPPIVKVPNRVS  179

Query  660  EEHIAENIEP  689
            +++I   ++P
Sbjct  180  QDYIVRIVKP  189



>gb|ERN07449.1| hypothetical protein AMTR_s00019p00251420 [Amborella trichopoda]
Length=392

 Score =   157 bits (397),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 107/156 (69%), Gaps = 10/156 (6%)
 Frame = +3

Query  222  DHFDTLQESRLTSTIHDTNKASELSLPGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVT  401
            D F ++ E R+  TIH  N             WK     +KPCW  P   +GD + G++T
Sbjct  14   DVFPSVAEGRI-ETIHTANIV--------KGPWKQSNF-LKPCWTNPGSKEGDQAKGFIT  63

Query  402  FSLTNGPEYHVSQISDAVVVARYLRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGV  581
            FSL++GP YHVSQ++DAVVVARYL ATLVIPD++G+  GDKR F++IY+VD+F+KSL+GV
Sbjct  64   FSLSHGPHYHVSQVADAVVVARYLGATLVIPDIKGTKTGDKRKFEEIYNVDKFMKSLNGV  123

Query  582  VKVTASEPTVLSSKNLAVVKVPNRVTEEHIAENIEP  689
            VK+    P  L +   A VKVP++VTE++I+E+IEP
Sbjct  124  VKIVREAPNELRTVKPAPVKVPSQVTEDYISEHIEP  159



>gb|AFV79649.1| mannan synthesis-related protein [Trigonella foenum-graecum]
Length=413

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 127/186 (68%), Gaps = 9/186 (5%)
 Frame = +3

Query  144  AVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTI----HDTNKASELSLPGGD  311
            +++ RQ  AG+LT++MF+MLGNMIK+DHFD   E     T     HD    S +S     
Sbjct  3    SMEIRQAFAGLLTLSMFIMLGNMIKKDHFDYPAEEVEIQTTEVSQHDLATVSHISQKS--  60

Query  312  SLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVI  491
               K +  ++KPCW  P+L + + S G++ FSLTNGPEYH++Q++DAVVVA+YL ATLV+
Sbjct  61   ---KQNDKALKPCWNPPTLKEVEQSKGFIIFSLTNGPEYHIAQVADAVVVAKYLGATLVL  117

Query  492  PDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHI  671
            PD++ S  G+  +  DIYDV+  +  L+G+VKVT + P  +S++N  +V+VPN+V++++I
Sbjct  118  PDIKNSKSGNSMNLGDIYDVENVLNKLNGLVKVTKTLPPHVSTRNTPIVRVPNKVSQDYI  177

Query  672  AENIEP  689
             + ++P
Sbjct  178  MKKLKP  183



>ref|XP_010927269.1| PREDICTED: uncharacterized protein LOC105049343 [Elaeis guineensis]
Length=374

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +3

Query  318  WKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPD  497
            W   G  +K CW +P++ + +   GY+TFSLT GPEYHVSQ++DAVV+ARYL ATLV+PD
Sbjct  19   WSEYGQGLKTCWNKPAIMEAEQPKGYITFSLTGGPEYHVSQLTDAVVIARYLGATLVLPD  78

Query  498  VRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIAE  677
            +RGS  G K++F+D+YD D+F++S+DGV+K+    P  ++++  AVV+VPNRV+E+ I  
Sbjct  79   IRGSELGQKKNFEDMYDSDKFMRSMDGVIKIVKEVPAEVATEKPAVVRVPNRVSEDFIMA  138

Query  678  NIEP  689
            N+EP
Sbjct  139  NVEP  142



>gb|EMS49507.1| hypothetical protein TRIUR3_13058 [Triticum urartu]
Length=358

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 90/117 (77%), Gaps = 1/117 (1%)
 Frame = +3

Query  339  MKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDVRGSNPG  518
            +KPCW +PS  D D +NG+VT SLT GPEYH SQI+DAVV+ARYL ATLV+P++RG+  G
Sbjct  44   IKPCWTKPSPKD-DQTNGFVTLSLTIGPEYHASQIADAVVIARYLGATLVLPEIRGNELG  102

Query  519  DKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIAENIEP  689
              R F+D+YDV++F  +LDGVVKV    P  L++K  AV++VPNRVTE+ I + I+P
Sbjct  103  KSRKFQDMYDVEKFKMNLDGVVKVVDKLPAELTTKKPAVIRVPNRVTEDFILDTIQP  159



>gb|KJB66473.1| hypothetical protein B456_010G141100 [Gossypium raimondii]
Length=314

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  441  ISDAVVVARYLRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSS  620
            ++DAV+VARYL A LV+PD+RGS PGD+R+FKDIYDV++F+KSLDGVVKV    P  +S 
Sbjct  1    MADAVIVARYLAAALVLPDIRGSRPGDERNFKDIYDVEKFMKSLDGVVKVVKQLPNEISI  60

Query  621  KNLAVVKVPNRVTEEHIAENIEP  689
            ++LA VKVPNRVTE+HI EN++P
Sbjct  61   RDLAAVKVPNRVTEDHIVENVQP  83



>ref|XP_004959583.1| PREDICTED: uncharacterized protein LOC101779953 [Setaria italica]
Length=252

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 82/112 (73%), Gaps = 2/112 (2%)
 Frame = +3

Query  255  TSTIHDTNKASELSLPGGDSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHV  434
            T  + D  + S ++  G ++L   D   +KPCW  PS      SNGYVTFSLT GPEYH+
Sbjct  134  TMKLDDNAEMSNINTGGVENLMDADE-EVKPCWTIPS-PKTQPSNGYVTFSLTMGPEYHI  191

Query  435  SQISDAVVVARYLRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKV  590
            SQI+DAVVVARYL ATLV+ D+RG+  G+KR F+D+Y+VD+F+++L+GVV+V
Sbjct  192  SQITDAVVVARYLGATLVLTDIRGNELGNKRKFQDMYNVDKFMRNLEGVVEV  243



>ref|XP_010911218.1| PREDICTED: uncharacterized protein LOC105037225 [Elaeis guineensis]
 ref|XP_010911219.1| PREDICTED: uncharacterized protein LOC105037225 [Elaeis guineensis]
Length=122

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 72/120 (60%), Gaps = 9/120 (8%)
 Frame = +3

Query  141  MAVDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDSL-  317
            MAVDPRQ++A  LT++MF MLGNMIK+DHFD  +   LT +    N  S + +   +   
Sbjct  1    MAVDPRQVLAAFLTISMFAMLGNMIKKDHFDNAEVGLLTLSSEPDNTYSVMRVEDSEERK  60

Query  318  --------WKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYL  473
                    W   G  +K CW +P++ + +   GY+TFSLT GPEYHVSQ+S +  V+ +L
Sbjct  61   GSKVKEGPWSEYGQGLKTCWNKPAIMEAEQPKGYITFSLTGGPEYHVSQVSWSHNVSCWL  120



>gb|ABR18129.1| unknown [Picea sitchensis]
Length=426

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 97/187 (52%), Gaps = 6/187 (3%)
 Frame = +3

Query  147  VDPRQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELS------LPGG  308
            +D +Q VA  LT+ M  ML NM+    F    ++       + ++  E S          
Sbjct  2    IDLKQAVAAFLTLGMLAMLINMMSNGPFLDADQASSEGKYSNGSELRERSPTVNRKTTRL  61

Query  309  DSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLV  488
              LW   G  ++PCW++        + G++   L+NGP YH  QI+DAVVV++YL ATL+
Sbjct  62   KELWGRPGPVLEPCWDKHITNLKGKTWGFIGVRLSNGPHYHRVQIADAVVVSKYLGATLL  121

Query  489  IPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEH  668
            IP ++  +      F  IYD  +F+ SL  +V+V    P  +SS +  V+ VP RVT ++
Sbjct  122  IPTIKDGHKEPNGQFDKIYDTSKFIASLQNIVRVVGRIPDDMSSISPTVISVPYRVTHDY  181

Query  669  IAENIEP  689
            I E+I P
Sbjct  182  IDEHIRP  188



>gb|EPS66825.1| hypothetical protein M569_07951, partial [Genlisea aurea]
Length=120

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDVRGSNPGDKRDFKDIYDVDQFV  563
            S+GY+ F+L  GPEYH  Q+++AV VAR+L ATL IPD+RG+N  + R F D+YDVD F+
Sbjct  8    SSGYIFFTLIRGPEYHALQVANAVRVARFLGATLAIPDIRGTNSTNARPFGDVYDVDNFI  67

Query  564  KSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIAENIEP  689
             SL+GVV+V  + P  L   +L    +P  +T + IA  I+P
Sbjct  68   ASLEGVVQVDKTPPP-LPRMSLG---IPQTLTGDFIASEIKP  105



>gb|KCW78621.1| hypothetical protein EUGRSUZ_C00086 [Eucalyptus grandis]
Length=292

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 66/110 (60%), Gaps = 6/110 (5%)
 Frame = +3

Query  276  NKASELSLPGGDSLWKGDGLSMKPCWERPSLADGDL-SNGYVTFSLTNGPEYHVSQISDA  452
            NKAS       +  W  D   +KPCW   +   G   S GY+TFSLT GPEYHVSQI+ A
Sbjct  25   NKAS-----ANEQFWMNDSHKLKPCWNISAPITGQQPSQGYITFSLTEGPEYHVSQIAVA  79

Query  453  VVVARYLRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASE  602
            V+VAR L ATL++PD++G  PGDKR  +   +V Q V  + G +K +  E
Sbjct  80   VLVARELGATLMLPDIKGRKPGDKRTLQLQTEVWQLVNQIIGKLKTSGGE  129



>ref|XP_001768259.1| predicted protein [Physcomitrella patens]
 gb|EDQ66873.1| predicted protein [Physcomitrella patens]
Length=425

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 69/125 (55%), Gaps = 0/125 (0%)
 Frame = +3

Query  315  LWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIP  494
            LW      ++PCW  PS        GYV    + GP +H  QI+DAV+VAR L ATLVIP
Sbjct  48   LWGVPFRPLEPCWTEPSRKSNRKEWGYVLVRCSQGPHHHRFQIADAVIVARQLGATLVIP  107

Query  495  DVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIA  674
             V+        +F D+Y V  F+ +L+GVV++    P  L   N   ++VP R+T+ +I 
Sbjct  108  IVKEGLTELASNFDDLYTVKHFIATLEGVVRIMGRLPEDLRGLNHTSIQVPYRITKPYID  167

Query  675  ENIEP  689
            +NI P
Sbjct  168  QNIRP  172



>gb|ERN01984.1| hypothetical protein AMTR_s00045p00073910 [Amborella trichopoda]
Length=426

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 89/183 (49%), Gaps = 5/183 (3%)
 Frame = +3

Query  156  RQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPG-----GDSLW  320
            +++VA  ++  +F M+ N+     F   +E+ L    + T    +  L          LW
Sbjct  5    KRLVAVFVSFGVFAMVINLRSNGPFFDSKEANLLPNFNKTVVLEKPQLKAIRKEIYRQLW  64

Query  321  KGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV  500
            +     ++PCW++          G++   L+ GP YH  Q+++AVV+A+Y+ ATL++P +
Sbjct  65   RHPEPVLQPCWDKHLAMLKTKPWGFLGVRLSKGPHYHRIQVAEAVVIAKYVSATLLLPTI  124

Query  501  RGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIAEN  680
            +  +      F +IY    F+  L  V++V    P  +SS    V+ VP   T ++I EN
Sbjct  125  KDGDKEPNGQFDNIYHPTAFIMGLQNVLRVVGRLPEDMSSVTPTVINVPYGATPKYIEEN  184

Query  681  IEP  689
            I P
Sbjct  185  IRP  187



>ref|XP_006840309.2| PREDICTED: uncharacterized protein At1g04910 [Amborella trichopoda]
Length=428

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 89/183 (49%), Gaps = 5/183 (3%)
 Frame = +3

Query  156  RQIVAGVLTVTMFVMLGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPG-----GDSLW  320
            +++VA  ++  +F M+ N+     F   +E+ L    + T    +  L          LW
Sbjct  7    KRLVAVFVSFGVFAMVINLRSNGPFFDSKEANLLPNFNKTVVLEKPQLKAIRKEIYRQLW  66

Query  321  KGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV  500
            +     ++PCW++          G++   L+ GP YH  Q+++AVV+A+Y+ ATL++P +
Sbjct  67   RHPEPVLQPCWDKHLAMLKTKPWGFLGVRLSKGPHYHRIQVAEAVVIAKYVSATLLLPTI  126

Query  501  RGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIAEN  680
            +  +      F +IY    F+  L  V++V    P  +SS    V+ VP   T ++I EN
Sbjct  127  KDGDKEPNGQFDNIYHPTAFIMGLQNVLRVVGRLPEDMSSVTPTVINVPYGATPKYIEEN  186

Query  681  IEP  689
            I P
Sbjct  187  IRP  189



>tpg|DAA37712.1| TPA: hypothetical protein ZEAMMB73_184782 [Zea mays]
Length=435

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +3

Query  339  MKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDVRGSNPG  518
            +KPCW +PS  +   SNG+VTFSLT GPEYH+S+I+D VVVARYL AT V+ D+RG+  G
Sbjct  194  VKPCWTKPSPKN-QPSNGFVTFSLTMGPEYHISRITDVVVVARYLGATFVLLDIRGNELG  252

Query  519  DKRDF  533
            +KR  
Sbjct  253  NKRQL  257



>gb|KHN24633.1| hypothetical protein glysoja_032277 [Glycine soja]
Length=370

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 81/157 (52%), Gaps = 29/157 (18%)
 Frame = +3

Query  219  RDHFDTLQESRLTSTIHDTNKASELSLPGGDSLWKGDGLSMKPCWERPSLADGDLSNGYV  398
            R  +D+   S+  S +      + +S     SL + +G  +KPC    +L +   S G++
Sbjct  12   RLEYDSAPASQNASEVVTEQSLATVSHVSKKSLME-NGKGLKPCRNPLALEEAPQSEGFI  70

Query  399  TFSLTNGPEYHVSQISDAVVVARYLRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDG  578
            TFSLTNGPEYH+SQ+  ++                           DIYDV + +  LDG
Sbjct  71   TFSLTNGPEYHISQVCLSL--------------------------GDIYDVQKIINRLDG  104

Query  579  VVKVTASEPTVLSSKNLAVVKVPNRVTEEHIAENIEP  689
            +V+VT + P  +++ N  +VKVPNRV++++I   ++P
Sbjct  105  LVRVTRTLP--VTNGNPPIVKVPNRVSQDYIVRTVKP  139



>emb|CAN79661.1| hypothetical protein VITISV_004325 [Vitis vinifera]
Length=352

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 64/103 (62%), Gaps = 2/103 (2%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDVRGSNPG-DKRDFKDIYDVDQF  560
            S G+VTFSLT+GPEYHVSQIS +  +  +L +     + RG        +F++IYD ++F
Sbjct  85   SXGFVTFSLTDGPEYHVSQISRSDSLC-FLTSGRANRETRGETCTLTYLNFEEIYDFEKF  143

Query  561  VKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIAENIEP  689
            ++SL  VV+V    P  +S+  L  V V NR +E+++A  IEP
Sbjct  144  IRSLGVVVRVAKDLPAEVSTGELKAVWVLNRASEDYMAAKIEP  186



>ref|XP_002965248.1| hypothetical protein SELMODRAFT_63007, partial [Selaginella moellendorffii]
 gb|EFJ34086.1| hypothetical protein SELMODRAFT_63007, partial [Selaginella moellendorffii]
Length=387

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 56/108 (52%), Gaps = 6/108 (6%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+    + G     + I+DAVV AR L ATLV+P +   S   D  +F DI+DVD F
Sbjct  1    ANGYLMIEASGGLNQQRTGITDAVVAARLLNATLVVPGLDHKSYWKDNSNFSDIFDVDWF  60

Query  561  VKSLDGVVKVTASEPTVLSSK-----NLAVVKVPNRVTEEHIAENIEP  689
            +KSL   V V    P    SK     +L  ++VP + T ++    I P
Sbjct  61   IKSLTSDVSVVKELPAAARSKYLKRNHLTSMRVPRKCTPQYYQSKILP  108



>ref|XP_001769456.1| predicted protein [Physcomitrella patens]
 gb|EDQ65825.1| predicted protein, partial [Physcomitrella patens]
Length=340

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +3

Query  438  QISDAVVVARYLRATLVIPDVRGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLS  617
            QI+DAV+VAR L ATLV+P ++         F DIY+V  F+ +L+GVV++    P  L 
Sbjct  3    QIADAVIVARQLGATLVMPTIKEGLTEPISKFDDIYNVKHFIATLEGVVRIVGRLPEDLR  62

Query  618  SKNLAVVKVPNRVTEEHIAENIEP  689
            + N   V++P+++T+  I   I P
Sbjct  63   NVNHTSVELPHKITKAEIDNKIRP  86



>ref|XP_002986571.1| hypothetical protein SELMODRAFT_43041, partial [Selaginella moellendorffii]
 gb|EFJ12428.1| hypothetical protein SELMODRAFT_43041, partial [Selaginella moellendorffii]
Length=387

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 56/108 (52%), Gaps = 6/108 (6%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+    + G     + I+DAVV AR L ATLV+P +   S   D  +F DI+DVD F
Sbjct  1    ANGYLMIEASGGLNQQRTGITDAVVAARLLNATLVVPGLDHKSYWKDNSNFSDIFDVDWF  60

Query  561  VKSLDGVVKVTASEPTVLSSK-----NLAVVKVPNRVTEEHIAENIEP  689
            +KSL   V V    P    SK     +L  ++VP + T ++    I P
Sbjct  61   IKSLTSDVSVVKELPAAARSKYLKRNHLTSMRVPRKCTPQYYQSKILP  108



>ref|XP_009389009.1| PREDICTED: uncharacterized protein At1g04910 [Musa acuminata 
subsp. malaccensis]
Length=542

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 59/106 (56%), Gaps = 4/106 (4%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            SNGY+  + + G     + I+DAVVVAR L ATLV+P++   S   D  DF DI+DVD F
Sbjct  120  SNGYLLIATSGGLNQQRTGITDAVVVARILNATLVVPELDHHSFWKDDSDFADIFDVDWF  179

Query  561  VKSLDGVVKVTASEP-TVLSS--KNLAVVKVPNRVTEEHIAENIEP  689
            + SL   V V    P  V+ S  K    ++VP + T E+  E + P
Sbjct  180  INSLSKDVPVVKRIPDKVMRSMEKPPYTMRVPRKSTPEYYLEQVLP  225



>ref|XP_004984508.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=499

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 46/81 (57%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            SNGY+  S   G     + I D V VARYL  T+VIP++ + S   D  DF+DI+DV+ F
Sbjct  96   SNGYLLVSCNGGLNQMRAAICDMVTVARYLNLTMVIPELDKQSFWADPSDFRDIFDVNHF  155

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL G VK+    P   S K
Sbjct  156  IDSLRGEVKIIKGLPQKFSEK  176



>emb|CDX98087.1| BnaA06g08380D [Brassica napus]
Length=683

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 72/156 (46%), Gaps = 10/156 (6%)
 Frame = +3

Query  201  LGNMIKRDHFDTLQESRLTSTIHDTNKASELSLPGGDS------LWKG---DGLSMKPCW  353
             G ++  +  + L  SR TS   + N   ++S+    +      LW+G     L+ KPC 
Sbjct  206  FGRLLPCELVNALSSSRRTSLASNRNNRLKISMMYNQNKREPKELWQGPKAQALAWKPCA  265

Query  354  ERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDVRGSNPG-DKRD  530
            ++ S +  D  NGY+  +   G       + + VVVAR L A+LVIP    S+   D   
Sbjct  266  DQRSWSPDDGENGYIMVTANGGINQQRVAVCNIVVVARLLNASLVIPKFMLSDVWTDASQ  325

Query  531  FKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVV  638
            F DIY  + F+K L   +++    P  L S +L  +
Sbjct  326  FGDIYQEEHFIKYLSPDIRIVKELPKELQSLDLEAI  361



>emb|CDY60713.1| BnaC07g50120D [Brassica napus]
Length=553

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 64/122 (52%), Gaps = 8/122 (7%)
 Frame = +3

Query  348  CWER----PSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSN  512
            C ER    P       SNGY+  + + G     + I+DAVVVAR L ATLV+P++   S 
Sbjct  109  CSERGRNFPPAVQEHSSNGYLLIAASGGLNQQRTGITDAVVVARILNATLVVPELDHRSY  168

Query  513  PGDKRDFKDIYDVDQFVKSLDGVVKVTASEP-TVLSS--KNLAVVKVPNRVTEEHIAENI  683
              D  DFKDI+DV+ F+ SL   V V    P  V+ S  K    ++VP + T E+  + +
Sbjct  169  WKDDSDFKDIFDVNWFISSLTKDVTVVKRVPDRVMRSMEKPPYTMRVPRKSTPEYYLDQV  228

Query  684  EP  689
             P
Sbjct  229  LP  230



>ref|XP_010677047.1| PREDICTED: uncharacterized protein At1g04910 [Beta vulgaris subsp. 
vulgaris]
Length=576

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 58/107 (54%), Gaps = 4/107 (4%)
 Frame = +3

Query  381  LSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQ  557
             SNGY+  + + G     + I+DAVVVAR L ATLV+P +   S   D  DF DI+DVD 
Sbjct  143  FSNGYLLIATSGGLNQQRTGITDAVVVARILNATLVVPSLDHNSYWKDDSDFADIFDVDW  202

Query  558  FVKSLDGVVKVTASEP-TVLSS--KNLAVVKVPNRVTEEHIAENIEP  689
            F+ SL   VK+    P  V+ S  K    ++VP + T E   E + P
Sbjct  203  FISSLAKDVKIVKRIPDKVMRSMEKPPYTMRVPRKSTPEDYIELVLP  249



>ref|XP_010434789.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=550

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 64/122 (52%), Gaps = 8/122 (7%)
 Frame = +3

Query  348  CWER----PSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSN  512
            C ER    P  A    SNGY+  + + G     + I+DAVVVAR L ATLV+P++   S 
Sbjct  107  CSERGRNFPPAAQEHSSNGYLLIAASGGLNQQRTGITDAVVVARILNATLVVPELDHHSY  166

Query  513  PGDKRDFKDIYDVDQFVKSLDGVVKVTASEP-TVLSS--KNLAVVKVPNRVTEEHIAENI  683
              D  DF DI+DV+ F+ SL   V +    P  V+ S  K    ++VP + T E+  + +
Sbjct  167  WKDDSDFNDIFDVNWFISSLAKDVTIVKRVPDRVMRSMEKPPYTMRVPRKSTPEYYLDQV  226

Query  684  EP  689
             P
Sbjct  227  LP  228



>ref|XP_010449737.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=547

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 64/122 (52%), Gaps = 8/122 (7%)
 Frame = +3

Query  348  CWER----PSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSN  512
            C ER    P  A    SNGY+  + + G     + I+DAVVVAR L ATLV+P++   S 
Sbjct  104  CSERGRNFPPAAQEHSSNGYLLIAASGGLNQQRTGITDAVVVARILNATLVVPELDHHSY  163

Query  513  PGDKRDFKDIYDVDQFVKSLDGVVKVTASEP-TVLSS--KNLAVVKVPNRVTEEHIAENI  683
              D  DF DI+DV+ F+ SL   V +    P  V+ S  K    ++VP + T E+  + +
Sbjct  164  WKDDSDFNDIFDVNWFISSLAKDVTIVKRVPDRVMRSMEKPPYTMRVPRKSTPEYYLDQV  223

Query  684  EP  689
             P
Sbjct  224  LP  225



>ref|XP_010440121.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=551

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 64/122 (52%), Gaps = 8/122 (7%)
 Frame = +3

Query  348  CWER----PSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSN  512
            C ER    P  A    SNGY+  + + G     + I+DAVVVAR L ATLV+P++   S 
Sbjct  108  CSERGRSFPPAAQEHSSNGYLLIAASGGLNQQRTGITDAVVVARILNATLVVPELDHHSY  167

Query  513  PGDKRDFKDIYDVDQFVKSLDGVVKVTASEP-TVLSS--KNLAVVKVPNRVTEEHIAENI  683
              D  DF DI+DV+ F+ SL   V +    P  V+ S  K    ++VP + T E+  + +
Sbjct  168  WKDDSDFNDIFDVNWFISSLAKDVTIVKRVPDRVMRSMEKPPYTMRVPRKSTPEYYLDQV  227

Query  684  EP  689
             P
Sbjct  228  LP  229



>emb|CDY19543.1| BnaC09g13600D [Brassica napus]
Length=651

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 56/112 (50%), Gaps = 4/112 (4%)
 Frame = +3

Query  315  LW---KGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATL  485
            LW   K   L+ KPC ++ S    D  NGY+  +   G       + + VVVAR L ATL
Sbjct  194  LWREPKDQALAWKPCADQRSWKPNDGKNGYIMVTANGGINQQRVAVCNIVVVARLLNATL  253

Query  486  VIPDVRGSNP-GDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVV  638
            V+P    S+   D   F+DIY V+ F+K L   +++  + P  L S +L  +
Sbjct  254  VVPKFMFSDVWTDSSQFEDIYQVEHFIKYLSPDIRIVKNLPKELQSLDLEAI  305



>ref|NP_176423.3| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AEE33954.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=652

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 54/112 (48%), Gaps = 4/112 (4%)
 Frame = +3

Query  315  LW---KGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATL  485
            LW   K   L+ KPC ++ S    D  NGY+  +   G       + + VVVAR L ATL
Sbjct  195  LWREPKDQALAWKPCADQRSWKPSDGKNGYIMVTANGGINQQRVAVCNIVVVARMLNATL  254

Query  486  VIPDVRGSNP-GDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVV  638
            VIP    S+   D   F DIY V+ F+K L   +++    P  L S +L  +
Sbjct  255  VIPKFMFSDVWTDASQFGDIYQVEHFIKYLSPDIRIVKKLPKELQSLDLEAI  306



>dbj|BAD44565.1| unnamed protein product [Arabidopsis thaliana]
Length=652

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 54/112 (48%), Gaps = 4/112 (4%)
 Frame = +3

Query  315  LW---KGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATL  485
            LW   K   L+ KPC ++ S    D  NGY+  +   G       + + VVVAR L ATL
Sbjct  195  LWREPKDQALAWKPCADQRSWKPSDGKNGYIMVTANGGINQQRVAVCNIVVVARMLNATL  254

Query  486  VIPDVRGSNP-GDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVV  638
            VIP    S+   D   F DIY V+ F+K L   +++    P  L S +L  +
Sbjct  255  VIPKFMFSDVWTDASQFGDIYQVEHFIKYLSPDIRIVKKLPKELQSLDLEAI  306



>ref|XP_010227801.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=594

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 57/124 (46%), Gaps = 11/124 (9%)
 Frame = +3

Query  300  PGGDSLWKG--DGLSMKPC-----WE---RPSLADGDLSNGYVTFSLTNGPEYHVSQISD  449
            P    LWK   +    +PC     WE     S +D D +NGY+  S   G       I +
Sbjct  124  PEPKDLWKEPVNATLWRPCSDQTDWEASGNTSSSDADGTNGYIIISANGGINQQRVAICN  183

Query  450  AVVVARYLRATLVIPDVRGSNPG-DKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKN  626
            AV ++R L ATLVIP    SN   DK  F DIY  D F+K L   V++    P  L S +
Sbjct  184  AVTISRLLNATLVIPKFLYSNVWLDKSQFGDIYQEDYFIKYLKSDVRIVKELPLELQSLD  243

Query  627  LAVV  638
            L  +
Sbjct  244  LEAI  247



>ref|XP_010473452.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=650

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 56/112 (50%), Gaps = 4/112 (4%)
 Frame = +3

Query  315  LW---KGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATL  485
            LW   K   L+ KPC ++ S    D +NGY+  +   G       + + VVVAR L ATL
Sbjct  193  LWREPKDQALAWKPCADQRSWKPSDGNNGYIMVTANGGINQQRVAVCNIVVVARMLNATL  252

Query  486  VIPDVRGSNP-GDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVV  638
            V+P +  S+   D   F DIY V+ F+K L   +++    P  L S +L  +
Sbjct  253  VVPKLMFSDVWTDASQFGDIYQVEHFIKYLSPDIRIVKKLPKELQSLDLEAI  304



>gb|KFK40606.1| hypothetical protein AALP_AA2G017600 [Arabis alpina]
Length=649

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 54/112 (48%), Gaps = 4/112 (4%)
 Frame = +3

Query  315  LW---KGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATL  485
            LW   K   L+ KPC ++ S    D  NGY+  +   G       + + VVVAR L ATL
Sbjct  192  LWREPKDQALAWKPCADQRSWKPSDGKNGYIMVTANGGINQQRVAVCNIVVVARMLNATL  251

Query  486  VIPDVRGSNP-GDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVV  638
            V+P    S+   D   F DIY V+ F+K L   +++    P  L S +L  +
Sbjct  252  VVPKFMFSDVWTDASQFGDIYQVEHFIKYLSPDIRIVKKLPKELQSLDLEAI  303



>emb|CDY12942.1| BnaA09g13320D [Brassica napus]
Length=651

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 56/112 (50%), Gaps = 4/112 (4%)
 Frame = +3

Query  315  LW---KGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATL  485
            LW   K   L+ KPC ++ S    D  NGY+  +   G       + + VV+AR L ATL
Sbjct  194  LWREPKDQALAWKPCADQRSWKPNDGKNGYIMVTANGGINQQRVAVCNIVVLARLLNATL  253

Query  486  VIPDVRGSNP-GDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVV  638
            V+P    S+   D   F+DIY V+ F+K L   +++  + P  L S +L  +
Sbjct  254  VVPKFMFSDVWTDSSQFEDIYQVEHFIKYLSPDIRIVKNLPKELQSLDLEAI  305



>ref|XP_009782231.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=541

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 59/108 (55%), Gaps = 10/108 (9%)
 Frame = +3

Query  315  LWKG-DGLSMKPC------WERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYL  473
             WK  DGL  +PC      + + S+      N Y+   ++ G     +QI DAVV+AR L
Sbjct  120  FWKQPDGLGYRPCLDFSAEYRKVSVEILKDRNKYLMVVVSGGMNQQRNQIVDAVVIARIL  179

Query  474  RATLVIPDVRGSNP--GDKRDFKDIYDVDQFVKSLDGVVKVTASEPTV  611
             A LV+P +   NP  GD+ +F DI+D+D F K L   V++ +S P++
Sbjct  180  GAALVVP-IFQVNPIWGDESEFSDIFDMDHFKKVLANDVRIVSSLPSI  226



>ref|XP_006414319.1| hypothetical protein EUTSA_v10024831mg [Eutrema salsugineum]
 gb|ESQ55772.1| hypothetical protein EUTSA_v10024831mg [Eutrema salsugineum]
Length=552

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 60/106 (57%), Gaps = 4/106 (4%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            SNGY+  + + G     + I+DAVVVAR L ATLV+P++   S   D  DF DI+DV+ F
Sbjct  125  SNGYLLIAASGGLNQQRTGITDAVVVARILNATLVVPELDHHSYWKDDSDFNDIFDVNWF  184

Query  561  VKSLDGVVKVTASEP-TVLSS--KNLAVVKVPNRVTEEHIAENIEP  689
            + SL   V +  + P  V+ S  K    ++VP + T E+  + + P
Sbjct  185  ISSLTKDVTIVKAVPDRVMRSMEKPPYTMRVPRKSTPEYYLDQVLP  230



>ref|XP_010938112.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=511

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 51/94 (54%), Gaps = 3/94 (3%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            SNGY+  S   G     + I D V VARYL  TLV+P++ + S   D  DF+DI++V+ F
Sbjct  97   SNGYLLVSCNGGLNQMRAGICDMVTVARYLNLTLVVPELDKNSFWADSSDFRDIFNVNHF  156

Query  561  VKSLDGVVKVTASEPTVLSSK--NLAVVKVPNRV  656
            + SL   VK+    P     K  N +V +VP  +
Sbjct  157  INSLRDEVKIVKKLPAKFGRKTPNKSVKEVPREI  190



>ref|XP_010264336.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Nelumbo 
nucifera]
Length=564

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 59/106 (56%), Gaps = 4/106 (4%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            SNGY+  + + G     + I+DAVVVAR L ATLVIP +   S   D  DF++I+DVD F
Sbjct  127  SNGYLLIATSGGLNQQRTGITDAVVVARILNATLVIPQLDHRSFWKDDSDFENIFDVDWF  186

Query  561  VKSLDG---VVKVTASEPTVLSSKNLAVVKVPNRVTEEHIAENIEP  689
            + SL     +VK  + +   L  K    ++VP + T E+  + + P
Sbjct  187  ISSLAKDVTIVKRISDKVMRLMEKPPYTMRVPRKSTPEYYLDMVLP  232



>ref|XP_006300315.1| hypothetical protein CARUB_v10019899mg, partial [Capsella rubella]
 gb|EOA33213.1| hypothetical protein CARUB_v10019899mg, partial [Capsella rubella]
Length=682

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 54/112 (48%), Gaps = 4/112 (4%)
 Frame = +3

Query  315  LW---KGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATL  485
            LW   K   L+ KPC ++ S    D  NGY+  +   G       + + VVVAR L ATL
Sbjct  225  LWREPKDQALAWKPCADQRSWKPSDGKNGYIMVTANGGINQQRVAVCNIVVVARMLNATL  284

Query  486  VIPDVRGSNP-GDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVV  638
            V+P    S+   D   F DIY V+ F+K L   +++    P  L S +L  +
Sbjct  285  VVPKFMFSDVWTDASQFGDIYQVEHFIKYLSPDIRIVKKLPKELQSLDLEAI  336



>ref|XP_006465351.1| PREDICTED: uncharacterized protein At1g04910-like [Citrus sinensis]
Length=436

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 49/103 (48%), Gaps = 1/103 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDVR-GSNPGDKRDFKDIYDVDQF  560
            SNGY+      G         D V VAR L ATLV+P     +   +  DF DI+DVD F
Sbjct  71   SNGYICVDCYGGLNQMRRDFCDGVGVARLLNATLVLPKFEVAAYWNESSDFADIFDVDYF  130

Query  561  VKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIAENIEP  689
            ++ +DG VKV    P  +SSK    V    R  +    E++ P
Sbjct  131  IQHMDGFVKVVKELPPEISSKEPFHVDCSKRKGQFDYVESVLP  173



>emb|CDY50845.1| BnaC08g47910D [Brassica napus]
Length=532

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 63/122 (52%), Gaps = 8/122 (7%)
 Frame = +3

Query  348  CWER----PSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSN  512
            C ER    P       SNGY+  + + G     + I+DAVVVAR L ATLV+P++   S 
Sbjct  89   CTERGNSFPPAVQEHKSNGYLLIAASGGLNQQRTGITDAVVVARILNATLVVPELDHHSY  148

Query  513  PGDKRDFKDIYDVDQFVKSLDGVVKVTASEP-TVLSS--KNLAVVKVPNRVTEEHIAENI  683
              D  DF DI+DV+ F+ SL   V +    P  V+ S  K    ++VP + T E+  + +
Sbjct  149  WKDDSDFNDIFDVNWFISSLTNDVTIVKRVPDRVMRSMEKPPYTMRVPRKSTPEYYLDQV  208

Query  684  EP  689
             P
Sbjct  209  LP  210



>gb|KDO61426.1| hypothetical protein CISIN_1g0081651mg, partial [Citrus sinensis]
Length=447

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 59/106 (56%), Gaps = 4/106 (4%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            SNGY+  + + G     + I+DAVVVAR L ATLV+P++   S   D  DF +I+DVD F
Sbjct  132  SNGYLLIAASGGLNQQRTGITDAVVVARILNATLVVPELDHHSYWKDDSDFANIFDVDHF  191

Query  561  VKSLDGVVKVTASEP-TVLSS--KNLAVVKVPNRVTEEHIAENIEP  689
            + SL   V +    P  V+ S  K    ++VP + T E+  + + P
Sbjct  192  ISSLAKDVTIVKRVPDKVMRSMEKPPYTMRVPRKSTPEYYLDQVLP  237



>ref|XP_010418221.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=658

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 54/112 (48%), Gaps = 4/112 (4%)
 Frame = +3

Query  315  LW---KGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATL  485
            LW   K   L+ KPC ++ S    D  NGY+  +   G       + + VVVAR L ATL
Sbjct  201  LWREPKDQALAWKPCADQRSWKPSDGKNGYIMVTANGGINQQRVAVCNIVVVARMLNATL  260

Query  486  VIPDVRGSNP-GDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVV  638
            V+P    S+   D   F DIY V+ F+K L   +++    P  L S +L  +
Sbjct  261  VVPKFMFSDVWTDASQFGDIYQVEHFIKYLSPDIRIVKKLPKELQSLDLEAI  312



>ref|XP_006440300.1| hypothetical protein CICLE_v10019483mg [Citrus clementina]
 gb|ESR53540.1| hypothetical protein CICLE_v10019483mg [Citrus clementina]
Length=575

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 59/106 (56%), Gaps = 4/106 (4%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            SNGY+  + + G     + I+DAVVVAR L ATLV+P++   S   D  DF +I+DVD F
Sbjct  132  SNGYLLIAASGGLNQQRTGITDAVVVARILNATLVVPELDHHSYWKDDSDFANIFDVDHF  191

Query  561  VKSLDGVVKVTASEP-TVLSS--KNLAVVKVPNRVTEEHIAENIEP  689
            + SL   V +    P  V+ S  K    ++VP + T E+  + + P
Sbjct  192  ISSLAKDVTIVKRVPDKVMRSMEKPPYTMRVPRKSTPEYYLDQVLP  237



>gb|KHN23921.1| Auxin response factor 8 [Glycine soja]
Length=133

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +3

Query  525  RDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIA  674
            R+F+DIYDVD F+KS++GVV+V    P+ +S+  +A +KVPN VT+++IA
Sbjct  84   RNFEDIYDVDVFMKSMEGVVRVLRDLPSHVSTHKIAAMKVPNPVTKDYIA  133



>ref|XP_009136801.1| PREDICTED: uncharacterized protein At1g04910-like [Brassica rapa]
Length=553

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 66/123 (54%), Gaps = 10/123 (8%)
 Frame = +3

Query  348  CWER-----PSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGS  509
            C ER     P++ D   SNGY+  + + G     + I+DAVVVAR L ATLV+P++   S
Sbjct  109  CSERGRNLPPAVQDHS-SNGYLLIAASGGLNQQRTGITDAVVVARILNATLVVPELDHHS  167

Query  510  NPGDKRDFKDIYDVDQFVKSLDGVVKVTASEP-TVLSS--KNLAVVKVPNRVTEEHIAEN  680
               D  DF DI+DV+ F+ SL   V +    P  V+ S  K    ++VP + T E+  + 
Sbjct  168  YWKDDSDFNDIFDVNWFISSLTKDVTIVKRVPDRVMRSMEKPPYTMRVPRKSTPEYYLDQ  227

Query  681  IEP  689
            + P
Sbjct  228  VLP  230



>ref|XP_010264337.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010264338.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Nelumbo 
nucifera]
Length=515

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 59/106 (56%), Gaps = 4/106 (4%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            SNGY+  + + G     + I+DAVVVAR L ATLVIP +   S   D  DF++I+DVD F
Sbjct  78   SNGYLLIATSGGLNQQRTGITDAVVVARILNATLVIPQLDHRSFWKDDSDFENIFDVDWF  137

Query  561  VKSLDG---VVKVTASEPTVLSSKNLAVVKVPNRVTEEHIAENIEP  689
            + SL     +VK  + +   L  K    ++VP + T E+  + + P
Sbjct  138  ISSLAKDVTIVKRISDKVMRLMEKPPYTMRVPRKSTPEYYLDMVLP  183



>ref|XP_006477177.1| PREDICTED: uncharacterized protein At1g04910-like [Citrus sinensis]
Length=576

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 59/106 (56%), Gaps = 4/106 (4%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            SNGY+  + + G     + I+DAVVVAR L ATLV+P++   S   D  DF +I+DVD F
Sbjct  132  SNGYLLIAASGGLNQQRTGITDAVVVARILNATLVVPELDHHSYWKDDSDFANIFDVDHF  191

Query  561  VKSLDGVVKVTASEP-TVLSS--KNLAVVKVPNRVTEEHIAENIEP  689
            + SL   V +    P  V+ S  K    ++VP + T E+  + + P
Sbjct  192  ISSLAKDVTIVKRVPDKVMRSMEKPPYTMRVPRKSTPEYYLDQVLP  237



>ref|XP_006391902.1| hypothetical protein EUTSA_v10023332mg [Eutrema salsugineum]
 gb|ESQ29188.1| hypothetical protein EUTSA_v10023332mg [Eutrema salsugineum]
Length=655

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 54/112 (48%), Gaps = 4/112 (4%)
 Frame = +3

Query  315  LW---KGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATL  485
            LW   K   L+ KPC ++ S    D  NGY+  +   G       + + VV+AR L ATL
Sbjct  198  LWREPKDQALAWKPCADQRSWKPNDGKNGYIMVTANGGINQQRVAVCNIVVIARLLNATL  257

Query  486  VIPDVRGSNP-GDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVV  638
            V+P    S+   D   F DIY V+ F+K L   +++    P  L S +L  +
Sbjct  258  VVPKFMFSDVWTDASQFGDIYQVEHFIKYLSPDIRIVKKLPKELQSLDLEAI  309



>emb|CDY40517.1| BnaC01g19950D [Brassica napus]
Length=551

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 63/122 (52%), Gaps = 8/122 (7%)
 Frame = +3

Query  348  CWER----PSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSN  512
            C ER    P       SNGY+  + + G     + I+DAVVVAR L ATLV+P++   S 
Sbjct  107  CSERGRNFPPAVQEHRSNGYLLIAASGGLNQQRTGITDAVVVARILNATLVVPELDHHSY  166

Query  513  PGDKRDFKDIYDVDQFVKSLDGVVKVTASEP-TVLSS--KNLAVVKVPNRVTEEHIAENI  683
              D  DF DI+DV+ F+ SL   V +    P  V+ S  K    ++VP + T E+  + +
Sbjct  167  WKDDSDFNDIFDVNWFIASLTKDVTIVKRVPDRVMRSMEKPPYTMRVPRKSTPEYYLDQV  226

Query  684  EP  689
             P
Sbjct  227  LP  228



>dbj|BAJ99135.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=592

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 59/124 (48%), Gaps = 9/124 (7%)
 Frame = +3

Query  294  SLPGGDSLWKG--DGLSMKPCW-ERPSLADGDLS-----NGYVTFSLTNGPEYHVSQISD  449
            S P    LWK   +    KPC  +R   A G++S     NGY+  S   G       I +
Sbjct  125  SRPEPKDLWKEPINATLWKPCSDQRDREASGNVSSSEGANGYIIISANGGINQQRVAICN  184

Query  450  AVVVARYLRATLVIPDVRGSNPG-DKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKN  626
            AV ++R L ATLVIP    SN   DK  F+DIY  D F+K L   +++    P  L S +
Sbjct  185  AVTISRLLNATLVIPKFLYSNVWLDKSQFRDIYQEDYFIKYLKPDIRIVKELPLELQSLD  244

Query  627  LAVV  638
            L  +
Sbjct  245  LEAI  248



>emb|CDX90501.1| BnaA03g42800D [Brassica napus]
Length=553

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 63/122 (52%), Gaps = 8/122 (7%)
 Frame = +3

Query  348  CWER----PSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSN  512
            C ER    P       SNGY+  + + G     + I+DAVVVAR L ATLV+P++   S 
Sbjct  109  CSERGRNFPPAVQEHSSNGYLLIAASGGLNQQRTGITDAVVVARILNATLVVPELDHHSY  168

Query  513  PGDKRDFKDIYDVDQFVKSLDGVVKVTASEP-TVLSS--KNLAVVKVPNRVTEEHIAENI  683
              D  DF DI+DV+ F+ SL   V +    P  V+ S  K    ++VP + T E+  + +
Sbjct  169  WKDDSDFNDIFDVNWFISSLTKDVTIVKRVPDRVMRSMEKPPYTMRVPRKSTPEYYLDQV  228

Query  684  EP  689
             P
Sbjct  229  LP  230



>ref|XP_009145647.1| PREDICTED: uncharacterized protein At1g04910-like [Brassica rapa]
 emb|CDY32271.1| BnaA01g17130D [Brassica napus]
Length=550

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 63/122 (52%), Gaps = 8/122 (7%)
 Frame = +3

Query  348  CWER----PSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSN  512
            C ER    P       SNGY+  + + G     + I+DAVVVAR L ATLV+P++   S 
Sbjct  106  CSERGRNFPPAVQEHRSNGYLLIAASGGLNQQRTGITDAVVVARILNATLVVPELDHHSY  165

Query  513  PGDKRDFKDIYDVDQFVKSLDGVVKVTASEP-TVLSS--KNLAVVKVPNRVTEEHIAENI  683
              D  DF DI+DV+ F+ SL   V +    P  V+ S  K    ++VP + T E+  + +
Sbjct  166  WKDDSDFNDIFDVNWFIASLTKDVTIVKRVPDRVMRSMEKPPYTMRVPRKSTPEYYLDQV  225

Query  684  EP  689
             P
Sbjct  226  LP  227



>gb|EMT23612.1| hypothetical protein F775_09460 [Aegilops tauschii]
Length=611

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 58/126 (46%), Gaps = 17/126 (13%)
 Frame = +3

Query  300  PGGDSLWKG--DGLSMKPC-----WERPSLADGDLS-----NGYVTFSLTNGPEYHVSQI  443
            P    LWK   +    KPC     WE    A G++S     NGY+  S   G       I
Sbjct  116  PEPKDLWKEPINATLWKPCSDQRDWE----ASGNISSSEGTNGYIIISANGGINQQRVAI  171

Query  444  SDAVVVARYLRATLVIPDVRGSNPG-DKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSS  620
             +AV ++R L ATLVIP    SN   DK  F+DIY  D F+K L   +++    P  L S
Sbjct  172  CNAVTISRLLNATLVIPKFLYSNVWLDKSQFRDIYQEDYFIKYLKPDIRIVKELPLELQS  231

Query  621  KNLAVV  638
             +L  +
Sbjct  232  LDLEAI  237



>emb|CDY53645.1| BnaA08g30350D [Brassica napus]
Length=530

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 63/122 (52%), Gaps = 8/122 (7%)
 Frame = +3

Query  348  CWER----PSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSN  512
            C ER    P       SNGY+  + + G     + I+DAVVVAR L ATLV+P++   S 
Sbjct  86   CSERGKSFPPAVQEHKSNGYLLIAASGGLNQQRTGITDAVVVARILNATLVVPELDHHSY  145

Query  513  PGDKRDFKDIYDVDQFVKSLDGVVKVTASEP-TVLSS--KNLAVVKVPNRVTEEHIAENI  683
              D  DF DI+DV+ F+ SL   V +    P  V+ S  K    ++VP + T E+  + +
Sbjct  146  WKDDSDFNDIFDVNWFISSLTKDVTIVKRVPDRVMRSMEKPPYTMRVPRKSTPEYYLDQV  205

Query  684  EP  689
             P
Sbjct  206  LP  207



>ref|XP_009113085.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=651

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 56/112 (50%), Gaps = 4/112 (4%)
 Frame = +3

Query  315  LW---KGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATL  485
            LW   K   L+ KPC ++ S    D  NGY+  +   G       + + VV+AR L ATL
Sbjct  194  LWREPKDQTLAWKPCADQRSWKPNDGKNGYIMVTANGGINQQRVAVCNIVVLARLLNATL  253

Query  486  VIPDVRGSNP-GDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVV  638
            V+P    S+   D   F+DIY V+ F+K L   +++  + P  L S +L  +
Sbjct  254  VVPKFMFSDVWTDSSQFEDIYQVEHFIKYLSPDIRIVKNLPKELQSLDLEAI  305



>gb|KHN46676.1| DUF246 domain-containing protein [Glycine soja]
Length=488

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 56/114 (49%), Gaps = 18/114 (16%)
 Frame = +3

Query  306  GDSLWKGDGLSMKPCWERP----SLADGDL---------SNGYVTFSLTNGPEYHVSQIS  446
            G SL KG    M  C+  P    SLA   +         +NGY+  S   G     S I 
Sbjct  51   GPSLLKG----MPYCFSSPPVEKSLAQAKVVLPPKRIYRNNGYLLVSCNGGLNQMRSAIC  106

Query  447  DAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEP  605
            D V +AR+L  TL++P++ + S   D  DFKDI+DVD F+ SL   V++    P
Sbjct  107  DMVAIARHLNVTLIVPELDKASFWADLSDFKDIFDVDHFITSLRDEVRIIKQLP  160



>ref|XP_009793270.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=498

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 46/81 (57%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     S I D V +ARYL  TL++P++ + S   D  +F+DI+DVD F
Sbjct  94   NNGYLMVSCNGGLNQMRSAICDMVAIARYLNVTLIVPELDKTSFWADPSEFQDIFDVDHF  153

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   V++    P  L S+
Sbjct  154  ITSLRDEVRILKELPPRLKSR  174



>ref|XP_002465327.1| hypothetical protein SORBIDRAFT_01g036540 [Sorghum bicolor]
 gb|EER92325.1| hypothetical protein SORBIDRAFT_01g036540 [Sorghum bicolor]
Length=500

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 44/81 (54%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            SNGY+  S   G     + I D V VARYL  T+VIP++ + S   D  DF DI+DV+ F
Sbjct  97   SNGYLLVSCNGGLNQMRAAICDMVTVARYLNLTMVIPELDKQSFWADPSDFGDIFDVNHF  156

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   VK+    P   S K
Sbjct  157  IDSLRNEVKIVKELPQKFSEK  177



>ref|XP_003551780.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=505

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 56/114 (49%), Gaps = 18/114 (16%)
 Frame = +3

Query  306  GDSLWKGDGLSMKPCWERP----SLADGDL---------SNGYVTFSLTNGPEYHVSQIS  446
            G SL KG    M  C+  P    SLA   +         +NGY+  S   G     S I 
Sbjct  68   GPSLLKG----MPYCFSSPPVEKSLAQAKVVLPPKRIYRNNGYLLVSCNGGLNQMRSAIC  123

Query  447  DAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEP  605
            D V +AR+L  TL++P++ + S   D  DFKDI+DVD F+ SL   V++    P
Sbjct  124  DMVAIARHLNVTLIVPELDKASFWADLSDFKDIFDVDHFITSLRDEVRIIKQLP  177



>ref|XP_004508646.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Cicer arietinum]
Length=544

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D V +ARYL  TL++P++ + S   D  DF+DI+DVD F
Sbjct  111  NNGYLMVSCNGGLNQMRAAICDMVAIARYLNVTLIVPELDKASFWADPSDFQDIFDVDHF  170

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   V++    P  L  K
Sbjct  171  ITSLRDEVRILKELPPRLKLK  191



>gb|EPS63860.1| hypothetical protein M569_10923, partial [Genlisea aurea]
Length=410

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 59/106 (56%), Gaps = 4/106 (4%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            SNGY+  + + G     + I+DAVVVAR L ATLV+P++   S   D  DF +I+D+D F
Sbjct  93   SNGYLLIATSGGLNQQRTGITDAVVVARILNATLVVPELDHHSYWKDDSDFNNIFDLDWF  152

Query  561  VKSLDGVVKVTASEP-TVLSS--KNLAVVKVPNRVTEEHIAENIEP  689
            + SL+  V +    P  V+ S  K    ++VP +   E+  E + P
Sbjct  153  ISSLEKDVPIVKKVPDKVMRSMDKPPYTMRVPRKSEPEYYLEEVLP  198



>ref|XP_004508647.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Cicer arietinum]
Length=513

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D V +ARYL  TL++P++ + S   D  DF+DI+DVD F
Sbjct  111  NNGYLMVSCNGGLNQMRAAICDMVAIARYLNVTLIVPELDKASFWADPSDFQDIFDVDHF  170

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   V++    P  L  K
Sbjct  171  ITSLRDEVRILKELPPRLKLK  191



>ref|XP_003570464.2| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=506

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 54/97 (56%), Gaps = 3/97 (3%)
 Frame = +3

Query  342  KPCWERPSLADGDL--SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSN  512
            +P  E+P+L    +  +NGY+  S   G     + I D V +ARYL  TL++P++ + S 
Sbjct  89   EPVAEKPALPPQRVYRNNGYLMVSCNGGLNQMRAAICDMVAIARYLNVTLIVPELDKTSF  148

Query  513  PGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSK  623
              D  +F+DI+DV+ F+ SL G V++    P  +  +
Sbjct  149  WNDPSEFQDIFDVEHFITSLRGEVRILRELPPRMKQR  185



>gb|EMS46512.1| hypothetical protein TRIUR3_15824 [Triticum urartu]
Length=693

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 58/126 (46%), Gaps = 17/126 (13%)
 Frame = +3

Query  300  PGGDSLWKG--DGLSMKPC-----WERPSLADGDLS-----NGYVTFSLTNGPEYHVSQI  443
            P    LWK   +    KPC     WE    A G++S     NGY+  S   G       I
Sbjct  201  PEPKDLWKEPINATLWKPCSDQRDWE----ASGNISSSEGTNGYIIISANGGINQQRVAI  256

Query  444  SDAVVVARYLRATLVIPDVRGSNPG-DKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSS  620
             +AV ++R L ATLVIP    SN   DK  F+DIY  D F+K L   +++    P  L S
Sbjct  257  CNAVTISRLLNATLVIPKFLYSNVWLDKSQFRDIYQEDYFIKYLKPDIRIVKELPLELQS  316

Query  621  KNLAVV  638
             +L  +
Sbjct  317  LDLEAI  322



>dbj|BAD37877.1| putative auxin-independent growth promoter [Oryza sativa Japonica 
Group]
Length=585

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 54/116 (47%), Gaps = 3/116 (3%)
 Frame = +3

Query  300  PGGDSLWKG--DGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYL  473
            P    LWK   +    +PC ++ +    + +NGY+  S   G       I +AV ++R L
Sbjct  131  PEPQDLWKEPINATMWRPCSDKRTWEPSEGTNGYIMISANGGINQQRVAICNAVTISRLL  190

Query  474  RATLVIPDVRGSNPG-DKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVV  638
             ATLVIP    SN   DK  F DIY  D F+  L   +++    P  L S +L  +
Sbjct  191  NATLVIPKFLYSNVWLDKSQFGDIYQEDYFINYLKSDIRIVKELPVELQSLDLEAI  246



>ref|XP_002979307.1| hypothetical protein SELMODRAFT_110454 [Selaginella moellendorffii]
 gb|EFJ19715.1| hypothetical protein SELMODRAFT_110454 [Selaginella moellendorffii]
Length=500

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 49/91 (54%), Gaps = 3/91 (3%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D V +A+YL  TL++P++ + S   D  DF DI+DVD F
Sbjct  83   NNGYLMVSCNGGLNQMRAAICDMVAIAKYLNVTLIVPELDKTSFWADPSDFGDIFDVDHF  142

Query  561  VKSLDGVVKVTASEPTVLSSK--NLAVVKVP  647
            + SL   V++    P   + K  N AV  +P
Sbjct  143  INSLRDEVRIIKQVPAKFAQKLQNQAVYTMP  173



>gb|KHN18388.1| DUF246 domain-containing protein [Glycine soja]
Length=519

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D V +ARYL  TL++P++ + S   D  DF+DI+DVD F
Sbjct  113  NNGYLMVSCNGGLNQMRAAICDMVAIARYLNVTLIVPELDKTSFWADPSDFQDIFDVDHF  172

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   V++    P  L  K
Sbjct  173  IASLRDEVRILKELPPRLKMK  193



>ref|XP_010430282.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=655

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 54/112 (48%), Gaps = 4/112 (4%)
 Frame = +3

Query  315  LW---KGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATL  485
            LW   K   L+ KPC ++ S    +  NGY+  +   G       + + VVVAR L ATL
Sbjct  198  LWREPKDQALAWKPCADQRSWKPSEGKNGYIMVTANGGINQQRVAVCNIVVVARMLNATL  257

Query  486  VIPDVRGSNP-GDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVV  638
            V+P    S+   D   F DIY V+ F+K L   +++    P  L S +L  +
Sbjct  258  VVPKFMFSDVWTDASQFGDIYQVEHFIKYLSPDIRIVKKLPKELQSLDLEAI  309



>ref|XP_006430964.1| hypothetical protein CICLE_v10011493mg [Citrus clementina]
 gb|ESR44204.1| hypothetical protein CICLE_v10011493mg [Citrus clementina]
Length=519

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (57%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D V +ARYL  TL++P++ + S   D  +FKDI+DVD F
Sbjct  118  NNGYLMVSCNGGLNQMRAAICDMVAIARYLNVTLIVPELDKTSFWNDPSEFKDIFDVDHF  177

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   V++    P  L ++
Sbjct  178  IASLRDEVRILKELPPRLKTR  198



>gb|KDO72306.1| hypothetical protein CISIN_1g036592mg [Citrus sinensis]
Length=519

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (57%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D V +ARYL  TL++P++ + S   D  +FKDI+DVD F
Sbjct  118  NNGYLMVSCNGGLNQMRAAICDMVAIARYLNVTLIVPELDKTSFWNDPSEFKDIFDVDHF  177

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   V++    P  L ++
Sbjct  178  IASLRDEVRILKELPPRLKTR  198



>ref|XP_006408431.1| hypothetical protein EUTSA_v10020530mg [Eutrema salsugineum]
 gb|ESQ49884.1| hypothetical protein EUTSA_v10020530mg [Eutrema salsugineum]
Length=513

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (57%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D V +ARY+ ATL++P++ + S   D  +FKDI+DVD F
Sbjct  106  NNGYLMVSCNGGLNQMRAAICDMVTIARYMNATLIVPELDKTSFWNDPSEFKDIFDVDHF  165

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   V++    P  L  +
Sbjct  166  ITSLRDEVRILKELPPRLKRR  186



>ref|XP_006482442.1| PREDICTED: uncharacterized protein At1g04910-like [Citrus sinensis]
Length=519

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (57%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D V +ARYL  TL++P++ + S   D  +FKDI+DVD F
Sbjct  118  NNGYLMVSCNGGLNQMRAAICDMVAIARYLNVTLIVPELDKTSFWNDPSEFKDIFDVDHF  177

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   V++    P  L ++
Sbjct  178  IASLRDEVRILKELPPRLKTR  198



>ref|XP_007139392.1| hypothetical protein PHAVU_008G025600g [Phaseolus vulgaris]
 gb|ESW11386.1| hypothetical protein PHAVU_008G025600g [Phaseolus vulgaris]
Length=511

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 58/115 (50%), Gaps = 20/115 (17%)
 Frame = +3

Query  306  GDSLWKGDGLSMKPCWERPSLADGDLS--------------NGYVTFSLTNGPEYHVSQI  443
            G SL KG    M  C+  P++ + DL+              NGY+  S   G     + I
Sbjct  74   GPSLLKG----MPHCFSTPAV-EKDLAPAKVLLPPKRTYRNNGYLLVSCNGGLNQMRAAI  128

Query  444  SDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEP  605
             D V +AR+L ATL++P++ + S   D  DFKDI+DVD F+ SL   V++    P
Sbjct  129  CDMVAIARHLNATLIVPELDKTSFWADSSDFKDIFDVDHFITSLRDEVRILKQLP  183



>ref|XP_002985325.1| hypothetical protein SELMODRAFT_234769 [Selaginella moellendorffii]
 gb|EFJ13819.1| hypothetical protein SELMODRAFT_234769 [Selaginella moellendorffii]
Length=462

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 57/103 (55%), Gaps = 3/103 (3%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NG++    + G       I+DAVVVAR L ATLV+P +   S   D  +F DI+D+D F
Sbjct  51   TNGFLLIQASGGLNQQRIGITDAVVVARILNATLVVPSLDHTSFWKDNSNFSDIFDIDWF  110

Query  561  VKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIAENIEP  689
            + +L   V++    PT L  KN   ++VP + T  +  +++ P
Sbjct  111  IATLAQDVRIVKELPTRL--KNPISLRVPRKSTPHYYQKSVLP  151



>ref|XP_002970137.1| hypothetical protein SELMODRAFT_171255 [Selaginella moellendorffii]
 gb|EFJ29261.1| hypothetical protein SELMODRAFT_171255 [Selaginella moellendorffii]
Length=482

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 57/103 (55%), Gaps = 3/103 (3%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NG++    + G       I+DAVVVAR L ATLV+P +   S   D  +F DI+D+D F
Sbjct  71   TNGFLLIQASGGLNQQRIGITDAVVVARILNATLVVPSLDHTSFWKDNSNFSDIFDIDWF  130

Query  561  VKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIAENIEP  689
            + +L   V++    PT L  KN   ++VP + T  +  +++ P
Sbjct  131  IATLAQDVRIVKELPTRL--KNPISLRVPRKSTPHYYQKSVLP  171



>ref|XP_002967060.1| hypothetical protein SELMODRAFT_408430 [Selaginella moellendorffii]
 gb|EFJ31659.1| hypothetical protein SELMODRAFT_408430 [Selaginella moellendorffii]
Length=571

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 67/134 (50%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DTLQESRLTSTIHDTNKASELSLPGGDSLWKG-DGLSMKPCWERP--SLADGDLSNGYVT  401
            ++ Q + + STI    K S +     +SLW   D    + C  RP  S   G  +NGY+ 
Sbjct  114  ESYQRAMIESTI---TKVSHVERKLYNSLWANPDSSKYEQCIARPKKSRKAGAATNGYLL  170

Query  402  FSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQFVKSLDG  578
             +   G     + I D V VAR + ATLV+P +   S   D  +F DI+D+D F+++L  
Sbjct  171  VNANGGLNQMRTGICDMVAVARIMNATLVMPTLDHSSFWEDPSEFADIFDIDHFIETLKD  230

Query  579  VVKVTASEPTVLSS  620
             V++  + P+ L S
Sbjct  231  DVRIVKALPSHLES  244



>gb|KJB51854.1| hypothetical protein B456_008G234600 [Gossypium raimondii]
Length=438

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 65/134 (49%), Gaps = 9/134 (7%)
 Frame = +3

Query  315  LWKGD-GLSMKPCWER----PSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
            +WK + G S   C +R    P       SNGY+  + + G     + ISDAVVVAR L A
Sbjct  94   IWKSENGKSFYGCSKRSRKFPHAVREQSSNGYLLIAASGGLNQQRTGISDAVVVARVLNA  153

Query  480  TLVIPDV-RGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVL---SSKNLAVVKVP  647
            TLV+P++   S   D  DF +I+DV+ F+  L   V +    P        KN   ++VP
Sbjct  154  TLVVPELDHNSYWKDNSDFVNIFDVNWFISYLVKDVTIVKKVPDKFMRSMEKNPYSMRVP  213

Query  648  NRVTEEHIAENIEP  689
             +   E+  + + P
Sbjct  214  RKSPPEYYLDQVLP  227



>ref|XP_003525629.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=515

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D V +ARYL  TL++P++ + S   D  DF+DI+DVD F
Sbjct  110  NNGYLMVSCNGGLNQMRAAICDMVAIARYLNVTLIVPELDKTSFWADPSDFQDIFDVDHF  169

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   V++    P  L  K
Sbjct  170  ITSLRDEVRILKELPPRLKLK  190



>gb|KHN15193.1| DUF246 domain-containing protein [Glycine soja]
Length=515

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D V +ARYL  TL++P++ + S   D  DF+DI+DVD F
Sbjct  110  NNGYLMVSCNGGLNQMRAAICDMVAIARYLNVTLIVPELDKTSFWADPSDFQDIFDVDHF  169

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   V++    P  L  K
Sbjct  170  ITSLRDEVRILKELPPRLKLK  190



>ref|NP_001049999.1| Os03g0328100 [Oryza sativa Japonica Group]
 gb|ABF95732.1| Axi 1 protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11913.1| Os03g0328100 [Oryza sativa Japonica Group]
Length=498

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 44/81 (54%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            SNGY+  S   G     + I D V VARY+  T+V+P++ + S   D  DF DI+DV+ F
Sbjct  95   SNGYLLISCNGGLNQMRAAICDMVTVARYMNLTMVVPELDKQSFWADPSDFGDIFDVNHF  154

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   VK+    P   S K
Sbjct  155  INSLQDEVKIIRELPQKFSRK  175



>ref|XP_004965235.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=508

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D VV+ARYL  TLV+P++ + S   D  +F+DI+DV+ F
Sbjct  107  NNGYLMVSCNGGLNQMRAAICDMVVIARYLNVTLVVPELDKTSFWNDPSEFQDIFDVEHF  166

Query  561  VKSLDGVVKVTASEP  605
            + SL G V++    P
Sbjct  167  ITSLRGEVRILRELP  181



>ref|NP_001159291.1| hypothetical protein [Zea mays]
 gb|ACN25705.1| unknown [Zea mays]
 gb|AFW76982.1| hypothetical protein ZEAMMB73_344359 [Zea mays]
Length=500

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D VV+ARYL  TLV+P++ + S   D  +F+DI+DV+ F
Sbjct  99   NNGYLMVSCNGGLNQMRAAICDMVVIARYLNVTLVVPELDKTSFWNDPSEFQDIFDVEHF  158

Query  561  VKSLDGVVKVTASEP  605
            + SL G V++    P
Sbjct  159  ITSLRGEVRILRELP  173



>ref|XP_008788918.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Phoenix 
dactylifera]
Length=522

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (57%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D V +ARYL  TL++P++ + S   D  +F+DI+DVD F
Sbjct  121  NNGYLMVSCNGGLNQMRAAICDMVTIARYLNVTLIVPELDKTSFWADPSEFQDIFDVDHF  180

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            +KSL   V++    P  L  +
Sbjct  181  IKSLRDEVRILKELPHRLKRR  201



>ref|XP_003522979.2| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
 gb|KHN02637.1| DUF246 domain-containing protein [Glycine soja]
Length=523

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 46/81 (57%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D V +ARYL  TL++P++ + S   D  +F+DI+DVD F
Sbjct  121  NNGYLMVSCNGGLNQMRAAICDMVAIARYLNVTLIVPELDKASFWADPSEFQDIFDVDHF  180

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   V++    P  L ++
Sbjct  181  ITSLRDEVRILKELPPRLKTR  201



>ref|XP_002438243.1| hypothetical protein SORBIDRAFT_10g010460 [Sorghum bicolor]
 gb|EER89610.1| hypothetical protein SORBIDRAFT_10g010460 [Sorghum bicolor]
Length=513

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D VV+ARYL  TLV+P++ + S   D  +F+DI+DV+ F
Sbjct  112  NNGYLMVSCNGGLNQMRAAICDMVVIARYLNVTLVVPELDKTSFWNDPSEFQDIFDVEHF  171

Query  561  VKSLDGVVKVTASEP  605
            + SL G V++    P
Sbjct  172  ITSLRGEVRILRELP  186



>ref|XP_002873739.1| hypothetical protein ARALYDRAFT_488418 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49998.1| hypothetical protein ARALYDRAFT_488418 [Arabidopsis lyrata subsp. 
lyrata]
Length=505

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +3

Query  381  LSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQ  557
            ++NGY+  S   G     + I D V VARYL  TL++P++ + S   D  +FKDI+DVD 
Sbjct  102  VNNGYLMVSCNGGLNQMRAAICDMVTVARYLNVTLIVPELDKTSFWNDPSEFKDIFDVDH  161

Query  558  FVKSLDGVVKVTASEPTVLSSK  623
            F+ SL   V++    P  L  +
Sbjct  162  FIGSLRDEVRILKELPPRLKKR  183



>ref|XP_004957108.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=492

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D V +ARYL  TL++P++ + S   D  DF+DI+DVD F
Sbjct  92   NNGYLMVSCNGGLNQMRAAICDMVTIARYLNVTLIVPELDKASFWADPSDFQDIFDVDYF  151

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   V+V    P  L  +
Sbjct  152  IASLRDEVRVLRQLPPRLKRR  172



>ref|XP_011099050.1| PREDICTED: uncharacterized protein At1g04910 [Sesamum indicum]
Length=505

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D V +ARYL  TL++P++ + S   D  DF+DI+DVD F
Sbjct  113  NNGYLIVSCNGGLNQMRAAICDMVSIARYLNITLIVPELDKASFWADPSDFQDIFDVDHF  172

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   V++    P  L  +
Sbjct  173  ILSLRDEVRILKELPAKLQRR  193



>ref|XP_010691586.1| PREDICTED: uncharacterized protein At1g04910-like [Beta vulgaris 
subsp. vulgaris]
Length=556

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 65/141 (46%), Gaps = 18/141 (13%)
 Frame = +3

Query  309  DSLWKGDGLSM-KPCWERPSLADGDL------SNGYVTFSLTNGPEYHVSQISDAVVVAR  467
             +LWK   L + KPC     + +  +      +NGY+      G     S I +AV VA 
Sbjct  100  STLWKYKKLKIEKPC----KITNAGMRMETSQNNGYLIVEANGGLNQQRSSICNAVAVAG  155

Query  468  YLRATLVIPDVRGSNPG-DKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSK------N  626
            +L ATLVIP +   N   D   F  IYD   FV +L+G V+V    P +L  +      N
Sbjct  156  FLNATLVIPRLEYHNVWMDPSPFDAIYDEQHFVNTLNGFVRVARELPLILMEQYDNNISN  215

Query  627  LAVVKVPNRVTEEHIAENIEP  689
            + +++VP   +  +  E + P
Sbjct  216  VPIIQVPAWSSISYYLEEVFP  236



>ref|XP_006582034.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=526

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 46/81 (57%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D V +ARYL  TL++P++ + S   D  +F+DI+DVD F
Sbjct  124  NNGYLMVSCNGGLNQMRAAICDMVAIARYLNVTLIVPELDKASFWADPSEFQDIFDVDHF  183

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   V++    P  L ++
Sbjct  184  ITSLRDEVRILKELPPRLKTR  204



>gb|KJB51853.1| hypothetical protein B456_008G234600 [Gossypium raimondii]
Length=542

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 65/134 (49%), Gaps = 9/134 (7%)
 Frame = +3

Query  315  LWKGD-GLSMKPCWER----PSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRA  479
            +WK + G S   C +R    P       SNGY+  + + G     + ISDAVVVAR L A
Sbjct  94   IWKSENGKSFYGCSKRSRKFPHAVREQSSNGYLLIAASGGLNQQRTGISDAVVVARVLNA  153

Query  480  TLVIPDV-RGSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVL---SSKNLAVVKVP  647
            TLV+P++   S   D  DF +I+DV+ F+  L   V +    P        KN   ++VP
Sbjct  154  TLVVPELDHNSYWKDNSDFVNIFDVNWFISYLVKDVTIVKKVPDKFMRSMEKNPYSMRVP  213

Query  648  NRVTEEHIAENIEP  689
             +   E+  + + P
Sbjct  214  RKSPPEYYLDQVLP  227



>ref|XP_009148624.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=620

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 54/112 (48%), Gaps = 4/112 (4%)
 Frame = +3

Query  315  LW---KGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATL  485
            LW   K   L+ KPC ++ S +  D  NGY+  +   G       + + VVVAR L A+L
Sbjct  156  LWQEPKAQALAWKPCADQRSWSPDDGKNGYIMVTANGGINQQRVAVCNIVVVARLLNASL  215

Query  486  VIPDVRGSNPG-DKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVV  638
            VIP    S+   D   F DIY  + F+K L   +++    P  L S +L  +
Sbjct  216  VIPKFMLSDVWTDASQFGDIYQEEHFIKYLSPDIRIVKELPKELQSLDLEAI  267



>ref|XP_008782753.1| PREDICTED: uncharacterized protein At1g04910-like [Phoenix dactylifera]
Length=506

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            SNGY+  S   G     + I D V VARYL  TLV+P++ + S   D  DF+DI++V+ F
Sbjct  99   SNGYLLVSCNGGLNQMRAAICDMVTVARYLNLTLVVPELDKTSFWADPSDFRDIFNVNHF  158

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   VK+    P   S K
Sbjct  159  INSLRDEVKIIRKLPDKFSRK  179



>ref|XP_002267185.2| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
 emb|CBI37357.3| unnamed protein product [Vitis vinifera]
Length=572

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 59/106 (56%), Gaps = 4/106 (4%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            SNGY+  + + G     + I+DAVVVAR L ATLV+P++   S   D  DF +I+DVD F
Sbjct  127  SNGYLLIAASGGLNQQRTGITDAVVVARILNATLVVPELDHHSFWKDDSDFVNIFDVDWF  186

Query  561  VKSLDGVVKVTASEP-TVLSS--KNLAVVKVPNRVTEEHIAENIEP  689
            + SL   V +    P  V+ S  K    ++VP + T E+  + + P
Sbjct  187  ISSLAKDVTIVKRVPDKVMRSMEKPPYTMRVPRKSTPEYYLDQVLP  232



>gb|EEE65417.1| hypothetical protein OsJ_20764 [Oryza sativa Japonica Group]
Length=784

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 54/116 (47%), Gaps = 3/116 (3%)
 Frame = +3

Query  300  PGGDSLWKG--DGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYL  473
            P    LWK   +    +PC ++ +    + +NGY+  S   G       I +AV ++R L
Sbjct  70   PEPQDLWKEPINATMWRPCSDKRTWEPSEGTNGYIMISANGGINQQRVAICNAVTISRLL  129

Query  474  RATLVIPDVRGSNPG-DKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVV  638
             ATLVIP    SN   DK  F DIY  D F+  L   +++    P  L S +L  +
Sbjct  130  NATLVIPKFLYSNVWLDKSQFGDIYQEDYFINYLKSDIRIVKELPVELQSLDLEAI  185



>ref|XP_011001504.1| PREDICTED: uncharacterized protein At1g04910-like [Populus euphratica]
Length=577

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 63/122 (52%), Gaps = 8/122 (7%)
 Frame = +3

Query  348  CWER----PSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSN  512
            C ER    PS      SNGY+  + + G     + I+DAVVVAR L ATLV+P++   S 
Sbjct  122  CSERGRNFPSAIRERASNGYLLIAASGGLNQQRTGITDAVVVARILNATLVVPELDHRSY  181

Query  513  PGDKRDFKDIYDVDQFVKSLDGVVKVTASEP-TVLSS--KNLAVVKVPNRVTEEHIAENI  683
              D  DF +I+D+DQF+  L   V +    P  V+ S  K    ++VP +   E+  + +
Sbjct  182  WKDDSDFVNIFDIDQFISYLAKDVTIVKRVPDKVMRSMEKPPYTMRVPRKSPPEYYLDQV  241

Query  684  EP  689
             P
Sbjct  242  LP  243



>ref|NP_197078.2| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AAY56449.1| At5g15740 [Arabidopsis thaliana]
 dbj|BAE99696.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED92200.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=508

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +3

Query  381  LSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQ  557
            ++NGY+  S   G     + I D V VARY+  TL++P++ + S   D  +FKDI+DVD 
Sbjct  105  VNNGYLMVSCNGGLNQMRAAICDMVTVARYMNVTLIVPELDKTSFWNDPSEFKDIFDVDH  164

Query  558  FVKSLDGVVKVTASEPTVLSSK  623
            F+ SL   V++    P  L  +
Sbjct  165  FISSLRDEVRILKELPPRLKKR  186



>ref|XP_008651776.1| PREDICTED: uncharacterized protein LOC100384451 isoform X1 [Zea 
mays]
 tpg|DAA61926.1| TPA: hypothetical protein ZEAMMB73_619275 [Zea mays]
Length=497

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D V +ARYL  TL++P++ + S   D  DF+DI+DVD F
Sbjct  97   NNGYLMVSCNGGLNQMRAAICDMVTIARYLNVTLIVPELDKASFWADPSDFQDIFDVDYF  156

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   V++    P  L  +
Sbjct  157  IASLRDEVRILKQLPPRLKRR  177



>gb|EYU44245.1| hypothetical protein MIMGU_mgv1a004661mg [Erythranthe guttata]
Length=516

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D V +ARYL  TL++P++ + S   D  DF+DI+DVD F
Sbjct  114  NNGYLVVSCNGGLNQMRAAICDMVAIARYLNITLIVPELDKTSFWADSSDFEDIFDVDHF  173

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   V++    P  L  +
Sbjct  174  ISSLRDEVRILKELPPRLKRR  194



>gb|KFK37682.1| hypothetical protein AALP_AA3G015000 [Arabis alpina]
Length=514

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D V +ARYL  TL++P++ + S   D  +FKDI+DVD F
Sbjct  107  NNGYLMVSCNGGLNQMRAAICDMVTIARYLNVTLIVPELDKTSFWNDPSEFKDIFDVDHF  166

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   V++    P  L  +
Sbjct  167  ITSLRDEVRILKELPPRLKRR  187



>gb|EEC80302.1| hypothetical protein OsI_22331 [Oryza sativa Indica Group]
Length=845

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 54/116 (47%), Gaps = 3/116 (3%)
 Frame = +3

Query  300  PGGDSLWKG--DGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYL  473
            P    LWK   +    +PC ++ +    + +NGY+  S   G       I +AV ++R L
Sbjct  131  PEPQDLWKEPINATMWRPCSDKRTWEPSEGTNGYIMISANGGINQQRVAICNAVTISRLL  190

Query  474  RATLVIPDVRGSNPG-DKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVV  638
             ATLVIP    SN   DK  F DIY  D F+  L   +++    P  L S +L  +
Sbjct  191  NATLVIPKFLYSNVWLDKSQFGDIYQEDYFINYLKSDIRIVKELPVELQSLDLEAI  246



>ref|XP_002462529.1| hypothetical protein SORBIDRAFT_02g027470 [Sorghum bicolor]
 gb|EER99050.1| hypothetical protein SORBIDRAFT_02g027470 [Sorghum bicolor]
Length=498

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D V +ARYL  TL++P++ + S   D  DF+DI+DVD F
Sbjct  99   NNGYLMVSCNGGLNQMRAAICDMVTIARYLNVTLIVPELDKASFWADPSDFQDIFDVDYF  158

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   V++    P  L  +
Sbjct  159  IASLRDEVRILRQLPPRLKRR  179



>ref|XP_006354743.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum tuberosum]
Length=494

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     S I D V +ARYL  TL++P++ + S   D  +F+DI+DVD F
Sbjct  94   NNGYLMVSCNGGLNQMRSAICDMVAIARYLNVTLIVPELDKTSFWADSSEFQDIFDVDHF  153

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   V++    P  L  +
Sbjct  154  IMSLRDEVRILKELPPRLKRR  174



>ref|XP_010999426.1| PREDICTED: uncharacterized protein At1g04910-like [Populus euphratica]
Length=504

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 46/81 (57%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D V +ARYL  TL++P++ + S   D  +F+DI+DV  F
Sbjct  102  NNGYLMVSCNGGLNQMRAAICDMVAIARYLNVTLIVPELDKTSFWNDPSEFQDIFDVHHF  161

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL G V++    P  L ++
Sbjct  162  IASLRGEVRILKELPPRLKTR  182



>ref|XP_009623754.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nicotiana tomentosiformis]
Length=503

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 69/165 (42%), Gaps = 22/165 (13%)
 Frame = +3

Query  165  VAGVLTVTMFVMLGNMI--------KRDHFDTLQESRLTSTI----HDTNKASELSLPGG  308
            VAGV  + + +   N++        K  +    + SRL  +         + SEL  P  
Sbjct  8    VAGVFMLLLPIFCANLLSHASPTILKDLNAPKFRHSRLAKSALQRQTSNEEQSELWTPLA  67

Query  309  DSLWKGDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLV  488
               WK       PC E  + +  + S GYV   L  G       I DAVVVA+ L ATLV
Sbjct  68   HQGWK-------PCTESDAASIPEKSEGYVQVFLDGGLNQQRMGICDAVVVAKILNATLV  120

Query  489  IPDVRGSNP--GDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLS  617
            IP +   NP   D   F DI+DVD F+  L   V +    P   S
Sbjct  121  IPQLE-VNPVWQDSSSFMDIFDVDHFINVLKDDVSIVKELPDEFS  164



>ref|XP_003530456.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=499

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     S I D V +AR+L  TL++P++ + S   D  DFKDI+DVD F
Sbjct  97   NNGYLLVSCNGGLNQMRSAICDMVAIARHLNVTLIVPELDKASFWADSSDFKDIFDVDHF  156

Query  561  VKSLDGVVKVTASEP  605
            + SL   V++    P
Sbjct  157  ITSLRDEVRIIKILP  171



>ref|NP_001175885.1| Os09g0475500 [Oryza sativa Japonica Group]
 dbj|BAH94613.1| Os09g0475500 [Oryza sativa Japonica Group]
Length=217

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D V +ARYL  TL++P++ + S   D  +FKDI+DVD F
Sbjct  112  NNGYLMVSCNGGLNQMRAAICDMVTIARYLNVTLIVPELDKTSFWADPSEFKDIFDVDYF  171

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   V++    P  L  +
Sbjct  172  ISSLRDEVRILKELPPRLKRR  192



>ref|XP_003563952.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=504

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 52/91 (57%), Gaps = 3/91 (3%)
 Frame = +3

Query  342  KPCWERPSLADGDL--SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSN  512
            +P  E+P+L    +  +NGY+  S   G     + I D VV+ARYL  TLV+P++ + S 
Sbjct  87   EPIVEKPALPPKRMYRNNGYLMVSCNGGLNQMRAAICDMVVIARYLNVTLVVPELDKTSF  146

Query  513  PGDKRDFKDIYDVDQFVKSLDGVVKVTASEP  605
              D  +F+DI+DV+ F+ SL   V++    P
Sbjct  147  WNDPSEFQDIFDVEHFITSLRDEVRILRELP  177



>emb|CAC01773.1| putative protein [Arabidopsis thaliana]
Length=505

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +3

Query  381  LSNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQ  557
            ++NGY+  S   G     + I D V VARY+  TL++P++ + S   D  +FKDI+DVD 
Sbjct  102  VNNGYLMVSCNGGLNQMRAAICDMVTVARYMNVTLIVPELDKTSFWNDPSEFKDIFDVDH  161

Query  558  FVKSLDGVVKVTASEPTVLSSK  623
            F+ SL   V++    P  L  +
Sbjct  162  FISSLRDEVRILKELPPRLKKR  183



>gb|KJB66472.1| hypothetical protein B456_010G141100 [Gossypium raimondii]
Length=274

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  561  VKSLDGVVKVTASEPTVLSSKNLAVVKVPNRVTEEHIAENIEP  689
            +KSLDGVVKV    P  +S ++LA VKVPNRVTE+HI EN++P
Sbjct  1    MKSLDGVVKVVKQLPNEISIRDLAAVKVPNRVTEDHIVENVQP  43



>ref|XP_010913449.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Elaeis guineensis]
Length=597

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 63/136 (46%), Gaps = 6/136 (4%)
 Frame = +3

Query  294  SLPGGDSLWK---GDGLSMKPCWERPSLADGDLSNGYVTFSLTNGPEYHVSQISDAVVVA  464
            S P    LW+      +S  PC  + S    + +NGY+  S T G       I +AV VA
Sbjct  129  SKPEPKDLWQEPLDPAVSWTPCANQRSWETCEGNNGYILVSATGGINQQRVAICNAVAVA  188

Query  465  RYLRATLVIPDVR-GSNPGDKRDFKDIYDVDQFVKSLDGVVKVTASEPTVLSSKNLAVVK  641
            R L +TLVIP     S   DK  F DIY  + F+  L   +++    P  L S +L  + 
Sbjct  189  RLLNSTLVIPHFSYNSVWKDKSQFSDIYQAEHFIDYLKADIRIVKELPVELRSLDLEAIG  248

Query  642  VPNRVTEEHIAENIEP  689
              + VT++ + +  +P
Sbjct  249  --SLVTDDEVMKESKP  262



>ref|XP_006384269.1| hypothetical protein POPTR_0004s11220g [Populus trichocarpa]
 gb|ERP62066.1| hypothetical protein POPTR_0004s11220g [Populus trichocarpa]
Length=504

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 46/81 (57%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D V +ARYL  TL++P++ + S   D  +F+DI+DV  F
Sbjct  102  NNGYLMVSCNGGLNQMRAAICDMVAIARYLNVTLIVPELDKTSFWNDPSEFQDIFDVHHF  161

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL G V++    P  L ++
Sbjct  162  IASLRGEVRILKELPPRLKTR  182



>ref|XP_008655269.1| PREDICTED: uncharacterized protein At1g04910-like [Zea mays]
 tpg|DAA45160.1| TPA: hypothetical protein ZEAMMB73_639862 [Zea mays]
Length=499

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            SNGY+  S   G     + I D V VARYL  T+VIP++ + S   D  DF DI+DV+ F
Sbjct  96   SNGYLLVSCNGGLNQMRAAICDMVTVARYLNLTMVIPELDKQSFWADPSDFGDIFDVNHF  155

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   VK+    P     K
Sbjct  156  IDSLRNEVKIVKELPQKFKEK  176



>ref|XP_006373415.1| hypothetical protein POPTR_0017s13570g [Populus trichocarpa]
 gb|ERP51212.1| hypothetical protein POPTR_0017s13570g [Populus trichocarpa]
Length=501

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (57%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D V +ARYL  TLV+P++ + S   D  +F+DI+DVD F
Sbjct  99   NNGYLMVSCNGGLNQMRAAICDMVAIARYLNVTLVVPELDKSSFWNDPSEFQDIFDVDHF  158

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   V++    P  L ++
Sbjct  159  ITSLRDEVRILKELPPRLKTR  179



>ref|XP_011021095.1| PREDICTED: uncharacterized protein At1g04910 [Populus euphratica]
Length=504

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (57%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D V +ARYL  TLV+P++ + S   D  +F+DI+DVD F
Sbjct  102  NNGYLMVSCNGGLNQMRAAICDMVAIARYLNVTLVVPELDKSSFWNDPSEFQDIFDVDHF  161

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   V++    P  L ++
Sbjct  162  ITSLRDEVRILKELPPRLKTR  182



>ref|XP_002312261.1| hypothetical protein POPTR_0008s09010g [Populus trichocarpa]
 gb|EEE89628.1| hypothetical protein POPTR_0008s09010g [Populus trichocarpa]
Length=493

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 56/106 (53%), Gaps = 4/106 (4%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            SNGY+  S   G     S I D V VAR L  TLV+P++ + S   D   F+DI+DV  F
Sbjct  83   SNGYLKVSCNGGLNQMRSAICDMVAVARLLNLTLVVPELDKTSFWADNSTFEDIFDVKHF  142

Query  561  VKSLDGVVKVTASEPTVLSSK-NLAVVKVP--NRVTEEHIAENIEP  689
            ++SL   +++    P   SSK    V ++P  +  +EE+  + I P
Sbjct  143  IESLRDEIRIVRRLPKRFSSKYGYKVFEMPPVSWSSEEYYLQQILP  188



>gb|AES65954.2| GDP-fucose O-fucosyltransferase-like protein [Medicago truncatula]
Length=520

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            +NGY+  S   G     + I D V +ARYL  TL++P++ + S   D  +F+DI+D+D F
Sbjct  115  NNGYLMVSCNGGLNQMRAAICDMVAIARYLNVTLIVPELDKASFWADPSEFQDIFDLDHF  174

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   V++    P  L  K
Sbjct  175  ITSLRDEVRILKELPPRLKQK  195



>ref|XP_006650024.1| PREDICTED: uncharacterized protein At1g04910-like [Oryza brachyantha]
Length=496

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 44/81 (54%), Gaps = 1/81 (1%)
 Frame = +3

Query  384  SNGYVTFSLTNGPEYHVSQISDAVVVARYLRATLVIPDV-RGSNPGDKRDFKDIYDVDQF  560
            SNGY+  S   G     + I D V VARYL  T+V+P++ + S   D  DF DI+DV+ F
Sbjct  93   SNGYLLISCNGGLNQMRAAICDMVTVARYLNLTMVVPELDKQSFWADPSDFGDIFDVNHF  152

Query  561  VKSLDGVVKVTASEPTVLSSK  623
            + SL   VK+    P   + K
Sbjct  153  INSLQDEVKIIRELPQKFNRK  173



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1183832463410