BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3820

Length=1337
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009595771.1|  PREDICTED: protein TIC110, chloroplastic iso...    517   4e-170   Nicotiana tomentosiformis
emb|CDP04069.1|  unnamed protein product                                514   3e-169   Coffea canephora [robusta coffee]
ref|XP_009595772.1|  PREDICTED: protein TIC110, chloroplastic iso...    513   9e-169   Nicotiana tomentosiformis
ref|XP_002276796.2|  PREDICTED: protein TIC110, chloroplastic           512   3e-168   Vitis vinifera
ref|XP_011080674.1|  PREDICTED: protein TIC110, chloroplastic           490   9e-160   Sesamum indicum [beniseed]
ref|XP_006361298.1|  PREDICTED: protein TIC110, chloroplastic-lik...    489   1e-159   Solanum tuberosum [potatoes]
ref|XP_010326200.1|  PREDICTED: protein TIC110, chloroplastic iso...    489   1e-159   Solanum lycopersicum
emb|CAN60839.1|  hypothetical protein VITISV_038562                     489   8e-159   Vitis vinifera
ref|XP_006361299.1|  PREDICTED: protein TIC110, chloroplastic-lik...    486   3e-158   Solanum tuberosum [potatoes]
ref|XP_004246966.1|  PREDICTED: protein TIC110, chloroplastic iso...    486   3e-158   Solanum lycopersicum
ref|XP_009354397.1|  PREDICTED: protein TIC110, chloroplastic           462   2e-149   Pyrus x bretschneideri [bai li]
ref|XP_002517728.1|  conserved hypothetical protein                     461   1e-148   Ricinus communis
ref|XP_010087175.1|  hypothetical protein L484_002222                   461   2e-148   
ref|XP_008354678.1|  PREDICTED: protein TIC110, chloroplastic           459   3e-148   
ref|XP_007204960.1|  hypothetical protein PRUPE_ppa000779mg             459   6e-148   Prunus persica
ref|XP_011041814.1|  PREDICTED: protein TIC110, chloroplastic-like      455   2e-146   Populus euphratica
ref|XP_010256257.1|  PREDICTED: protein TIC110, chloroplastic-like      454   3e-146   Nelumbo nucifera [Indian lotus]
ref|XP_008229850.1|  PREDICTED: protein TIC110, chloroplastic           454   4e-146   Prunus mume [ume]
gb|EYU46000.1|  hypothetical protein MIMGU_mgv1a000719mg                453   1e-145   Erythranthe guttata [common monkey flower]
ref|XP_011461432.1|  PREDICTED: protein TIC110, chloroplastic           451   5e-145   Fragaria vesca subsp. vesca
ref|XP_010028334.1|  PREDICTED: LOW QUALITY PROTEIN: protein TIC1...    451   8e-145   Eucalyptus grandis [rose gum]
ref|XP_006431981.1|  hypothetical protein CICLE_v10000209mg             448   9e-145   
ref|XP_008349539.1|  PREDICTED: protein TIC110, chloroplastic-like      450   1e-144   
ref|XP_009369542.1|  PREDICTED: protein TIC110, chloroplastic-like      449   4e-144   Pyrus x bretschneideri [bai li]
ref|XP_006468148.1|  PREDICTED: protein TIC110, chloroplastic-like      448   1e-143   Citrus sinensis [apfelsine]
ref|XP_008366219.1|  PREDICTED: protein TIC110, chloroplastic-like      447   1e-143   
gb|KDO49265.1|  hypothetical protein CISIN_1g001822mg                   444   5e-143   Citrus sinensis [apfelsine]
ref|XP_009789255.1|  PREDICTED: protein TIC110, chloroplastic           442   7e-143   Nicotiana sylvestris
ref|XP_012081021.1|  PREDICTED: protein TIC110, chloroplastic           444   3e-142   Jatropha curcas
gb|KDO49263.1|  hypothetical protein CISIN_1g001822mg                   444   3e-142   Citrus sinensis [apfelsine]
ref|XP_002326080.1|  chloroplast inner envelope family protein          443   7e-142   
ref|XP_002319406.2|  chloroplast inner envelope family protein          443   8e-142   Populus trichocarpa [western balsam poplar]
gb|KDO49262.1|  hypothetical protein CISIN_1g001822mg                   443   1e-141   Citrus sinensis [apfelsine]
ref|XP_008457310.1|  PREDICTED: protein TIC110, chloroplastic iso...    442   3e-141   
ref|XP_008457309.1|  PREDICTED: protein TIC110, chloroplastic iso...    441   5e-141   Cucumis melo [Oriental melon]
ref|XP_007017042.1|  Translocon at the inner envelope membrane of...    439   2e-140   
ref|XP_011021014.1|  PREDICTED: LOW QUALITY PROTEIN: protein TIC1...    439   3e-140   Populus euphratica
ref|XP_004145231.1|  PREDICTED: protein TIC110, chloroplastic           439   4e-140   Cucumis sativus [cucumbers]
gb|KJB20493.1|  hypothetical protein B456_003G151500                    438   4e-140   Gossypium raimondii
ref|XP_007017041.1|  Translocon at the inner envelope membrane of...    444   6e-140   
gb|KJB20492.1|  hypothetical protein B456_003G151500                    437   7e-140   Gossypium raimondii
gb|KHG09192.1|  chloroplast protein                                     437   9e-140   Gossypium arboreum [tree cotton]
gb|KJB20491.1|  hypothetical protein B456_003G151500                    437   1e-139   Gossypium raimondii
ref|XP_010277701.1|  PREDICTED: protein TIC110, chloroplastic-like      439   1e-139   Nelumbo nucifera [Indian lotus]
ref|XP_010045404.1|  PREDICTED: protein TIC110, chloroplastic-lik...    435   9e-139   Eucalyptus grandis [rose gum]
ref|XP_010523146.1|  PREDICTED: LOW QUALITY PROTEIN: protein TIC1...    431   1e-136   Tarenaya hassleriana [spider flower]
emb|CDY15593.1|  BnaA08g28770D                                          427   9e-136   Brassica napus [oilseed rape]
ref|XP_006417864.1|  hypothetical protein EUTSA_v10006671mg             427   1e-135   Eutrema salsugineum [saltwater cress]
emb|CDX86508.1|  BnaC08g01950D                                          426   2e-135   
ref|XP_010045405.1|  PREDICTED: protein TIC110, chloroplastic-lik...    426   4e-135   Eucalyptus grandis [rose gum]
ref|XP_009110969.1|  PREDICTED: protein TIC110, chloroplastic           425   5e-135   Brassica rapa
ref|XP_008807813.1|  PREDICTED: protein TIC110, chloroplastic-like      407   2e-134   Phoenix dactylifera
gb|KFK43011.1|  hypothetical protein AALP_AA1G067600                    422   8e-134   Arabis alpina [alpine rockcress]
ref|XP_006306669.1|  hypothetical protein CARUB_v10008186mg             422   1e-133   Capsella rubella
ref|XP_010475445.1|  PREDICTED: protein TIC110, chloroplastic-like      422   1e-133   Camelina sativa [gold-of-pleasure]
ref|XP_010457853.1|  PREDICTED: protein TIC110, chloroplastic           422   1e-133   Camelina sativa [gold-of-pleasure]
ref|XP_010486911.1|  PREDICTED: protein TIC110, chloroplastic-like      420   5e-133   Camelina sativa [gold-of-pleasure]
ref|NP_172176.1|  protein TIC110                                        420   5e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006846995.1|  PREDICTED: protein TIC110, chloroplastic           420   6e-133   Amborella trichopoda
gb|EPS69416.1|  hypothetical protein M569_05346                         422   3e-132   Genlisea aurea
gb|AAM20701.1|  chloroplast inner envelope protein, putative            417   5e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892369.1|  ATTIC110/TIC110                                    417   7e-132   
emb|CDY10236.1|  BnaC05g04790D                                          414   1e-130   Brassica napus [oilseed rape]
sp|O24303.1|TI110_PEA  RecName: Full=Protein TIC110, chloroplasti...    413   1e-130   Pisum sativum [garden pea]
emb|CAA92823.1|  chloroplast inner envelope protein, 110 kD (IEP110)    412   4e-130   Pisum sativum [garden pea]
emb|CDY54889.1|  BnaA10g28000D                                          411   9e-130   Brassica napus [oilseed rape]
ref|XP_010685953.1|  PREDICTED: protein TIC110, chloroplastic           411   1e-129   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009119009.1|  PREDICTED: protein TIC110, chloroplastic           409   7e-129   Brassica rapa
ref|XP_004490697.1|  PREDICTED: protein TIC110, chloroplastic-like      409   8e-129   Cicer arietinum [garbanzo]
ref|XP_003544919.1|  PREDICTED: protein TIC110, chloroplastic-like      408   2e-128   Glycine max [soybeans]
ref|XP_004500340.1|  PREDICTED: protein TIC110, chloroplastic-like      407   2e-128   Cicer arietinum [garbanzo]
ref|XP_003615974.1|  Chloroplast inner envelope protein (IEP110)        407   3e-128   Medicago truncatula
ref|XP_003519280.1|  PREDICTED: protein TIC110, chloroplastic-like      405   2e-127   Glycine max [soybeans]
ref|XP_010918040.1|  PREDICTED: protein TIC110, chloroplastic           405   4e-127   Elaeis guineensis
ref|XP_007142070.1|  hypothetical protein PHAVU_008G250000g             402   3e-126   Phaseolus vulgaris [French bean]
ref|XP_009382116.1|  PREDICTED: protein TIC110, chloroplastic           397   3e-124   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009796601.1|  PREDICTED: protein TIC110, chloroplastic-like      389   3e-123   Nicotiana sylvestris
ref|XP_003551181.1|  PREDICTED: protein TIC110, chloroplastic-like      388   4e-121   Glycine max [soybeans]
gb|EAY79032.1|  hypothetical protein OsI_34142                          379   2e-118   Oryza sativa Indica Group [Indian rice]
gb|KEH34416.1|  translocon at the inner envelope membrane ofs 110...    379   1e-117   Medicago truncatula
ref|XP_006662467.1|  PREDICTED: protein TIC110, chloroplastic-like      376   2e-117   Oryza brachyantha
ref|XP_010234858.1|  PREDICTED: protein TIC110, chloroplastic           375   1e-115   Brachypodium distachyon [annual false brome]
gb|AAP54402.2|  chloroplast inner envelope protein, putative, exp...    373   4e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008668098.1|  PREDICTED: uncharacterized protein LOC100273...    372   1e-114   
ref|XP_004982760.1|  PREDICTED: protein TIC110, chloroplastic-like      368   2e-113   Setaria italica
gb|AAF63131.1|AC011001_1  Putative chloroplast inner envelope pro...    360   2e-111   Arabidopsis thaliana [mouse-ear cress]
gb|ABR16698.1|  unknown                                                 363   2e-111   Picea sitchensis
emb|CDP09261.1|  unnamed protein product                                353   3e-110   Coffea canephora [robusta coffee]
dbj|BAJ91401.1|  predicted protein                                      328   5e-104   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT20950.1|  hypothetical protein F775_26398                         342   1e-103   
gb|KDO49264.1|  hypothetical protein CISIN_1g001822mg                   332   2e-101   Citrus sinensis [apfelsine]
ref|XP_010234859.1|  PREDICTED: protein TIC110, chloroplastic-like      321   4e-101   Brachypodium distachyon [annual false brome]
gb|EEE51190.1|  hypothetical protein OsJ_31997                          325   5e-98    Oryza sativa Japonica Group [Japonica rice]
gb|AAG13554.1|AC023240_27  putative chloroplast inner envelope pr...    322   4e-96    Oryza sativa Japonica Group [Japonica rice]
gb|ABG66163.1|  IAP100, putative, expressed                             293   6e-91    Oryza sativa Japonica Group [Japonica rice]
gb|EMS45727.1|  hypothetical protein TRIUR3_05354                       306   1e-90    Triticum urartu
gb|ABB47817.1|  IAP100, putative, expressed                             292   6e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002966718.1|  hypothetical protein SELMODRAFT_439675             306   2e-89    
ref|NP_001064931.1|  Os10g0492300                                       288   9e-89    
gb|AAG13550.2|AC023240_23  putative chloroplast inner envelope pr...    266   2e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001785732.1|  predicted protein                                  279   5e-81    
ref|XP_001757091.1|  predicted protein                                  277   2e-80    
gb|KCW55054.1|  hypothetical protein EUGRSUZ_I01027                     274   3e-80    Eucalyptus grandis [rose gum]
dbj|BAF93201.1|  putative chloroplast inner envelope protein            262   3e-80    Hordeum vulgare [barley]
ref|XP_006431980.1|  hypothetical protein CICLE_v10000209mg             269   1e-78    
ref|XP_002978024.1|  hypothetical protein SELMODRAFT_443745             272   1e-77    
gb|EEC67227.1|  hypothetical protein OsI_34144                          259   3e-77    Oryza sativa Indica Group [Indian rice]
gb|KHN46101.1|  Protein TIC110-like protein, chloroplastic              260   1e-74    Glycine soja [wild soybean]
gb|EMT20952.1|  hypothetical protein F775_05411                         233   4e-69    
ref|NP_001176218.1|  Os10g0492000                                       209   1e-61    
ref|XP_002464439.1|  hypothetical protein SORBIDRAFT_01g018450          221   2e-60    
dbj|BAF93191.1|  putative chloroplast inner envelope protein            201   1e-58    Hordeum vulgare [barley]
gb|EEE51192.1|  hypothetical protein OsJ_31999                          205   4e-58    Oryza sativa Japonica Group [Japonica rice]
gb|EMS45726.1|  hypothetical protein TRIUR3_05353                       166   2e-44    Triticum urartu
ref|XP_006661895.1|  PREDICTED: protein TIC110, chloroplastic-like      165   3e-44    Oryza brachyantha
dbj|BAJ93915.1|  predicted protein                                      164   4e-43    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002957380.1|  hypothetical protein VOLCADRAFT_98450              171   2e-42    Volvox carteri f. nagariensis
gb|AHA84145.1|  chloroplast inner envelope protein                      156   8e-41    Phaseolus vulgaris [French bean]
emb|CDP09260.1|  unnamed protein product                                155   1e-40    Coffea canephora [robusta coffee]
ref|XP_005643849.1|  hypothetical protein COCSUDRAFT_31183              164   6e-40    Coccomyxa subellipsoidea C-169
ref|XP_002892366.1|  hypothetical protein ARALYDRAFT_887896             149   6e-39    
ref|XP_005844387.1|  hypothetical protein CHLNCDRAFT_139027             155   5e-37    Chlorella variabilis
gb|KIY91916.1|  hypothetical protein MNEG_16047                         144   2e-36    Monoraphidium neglectum
ref|XP_007508341.1|  predicted protein                                  152   8e-36    Bathycoccus prasinos
ref|XP_011395978.1|  hypothetical protein F751_3299                     150   3e-35    Auxenochlorella protothecoides
ref|XP_002889630.1|  hypothetical protein ARALYDRAFT_887909             142   7e-33    
ref|XP_003061195.1|  chloroplast envelope anion channel-forming T...    141   1e-32    Micromonas pusilla CCMP1545
ref|XP_003080534.1|  chloroplast inner envelope protein-related (...    141   3e-32    
emb|CEF98872.1|  unnamed product                                        140   7e-32    Ostreococcus tauri
ref|XP_002503178.1|  chloroplast envelope anion channel-forming T...    139   1e-31    Micromonas commoda
ref|XP_001418787.1|  Tic110 family transporter: chloroplast inner...    138   2e-31    Ostreococcus lucimarinus CCE9901
gb|KIY98725.1|  hypothetical protein MNEG_9237                          127   9e-28    Monoraphidium neglectum
gb|AAF82224.1|AC067971_32  Strong similarity to an import interme...    113   8e-26    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001698524.1|  110 kDa translocon of chloroplast envelope i...    102   1e-19    Chlamydomonas reinhardtii
ref|XP_008385016.1|  PREDICTED: protein TIC110, chloroplastic-like    89.7    9e-16    
gb|AER92593.1|  hypothetical protein                                  80.5    5e-14    Linum usitatissimum
gb|AFW87324.1|  hypothetical protein ZEAMMB73_975143                  58.2    2e-06    



>ref|XP_009595771.1| PREDICTED: protein TIC110, chloroplastic isoform X1 [Nicotiana 
tomentosiformis]
Length=1014

 Score =   517 bits (1331),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 314/410 (77%), Positives = 343/410 (84%), Gaps = 11/410 (3%)
 Frame = +2

Query  116   MNPSLLLSTN-PS--PNRKALFSPFLSPAPLRLT-AASRNRYHFRYRIsavssssdqpst  283
             MNPSLLL+TN PS  P      SPFL+P PLR T   S+ R HF Y     +  S     
Sbjct  1     MNPSLLLTTNQPSVNPTTTTFLSPFLNPTPLRFTRKISQKRRHFLYNYGLSTVRSSASDK  60

Query  284   sisssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLG  463
               SSS         V+PDVFGGK+ELS IQ+LVD+MSPPIRIASSA++FAGAVAAGYGLG
Sbjct  61    PPSSSIS-------VKPDVFGGKKELSTIQSLVDAMSPPIRIASSALVFAGAVAAGYGLG  113

Query  464   FRFGGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDA  643
              RFGGSRNAG+GGA+ALGAAGAGAAYALN+C PEVAA+NLHNYVA  +DPAAL KEDIDA
Sbjct  114   VRFGGSRNAGVGGAIALGAAGAGAAYALNSCVPEVAAINLHNYVADFEDPAALNKEDIDA  173

Query  644   IAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAA  823
             IA KYGVSKQ+EAFNAEL DIYCRYV+AV P G E+LRGDEVDTIIKFKNALGIDDPDAA
Sbjct  174   IANKYGVSKQNEAFNAELRDIYCRYVSAVFPTGTEELRGDEVDTIIKFKNALGIDDPDAA  233

Query  824   AMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDA  1003
              MHMEIGRRIFRQRLETGDRDGD+EQRRAFQKLIYVS +VF +AS+FLLPWKR+FKVTD+
Sbjct  234   DMHMEIGRRIFRQRLETGDRDGDIEQRRAFQKLIYVSTLVFGEASAFLLPWKRVFKVTDS  293

Query  1004  QVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVE  1183
             QVEVAVRDNAQRLYASKLKSVGRD++ DQLVSLREAQL Y LSDE AE MF+E+ RKLVE
Sbjct  294   QVEVAVRDNAQRLYASKLKSVGRDIDADQLVSLREAQLVYRLSDELAEEMFKEYARKLVE  353

Query  1184  ENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
             E IS AV  LKSRTRA  EATRV EELDKIL+FNNLLISLKNHPDASRFA
Sbjct  354   ECISLAVGSLKSRTRATREATRVIEELDKILSFNNLLISLKNHPDASRFA  403



>emb|CDP04069.1| unnamed protein product [Coffea canephora]
Length=1023

 Score =   514 bits (1325),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 300/409 (73%), Positives = 348/409 (85%), Gaps = 3/409 (1%)
 Frame = +2

Query  116   MNPSLLLSTNPSPNR-KALFSPFLSPAPLRL-TAASRNRYHFRYRIsavssssdqpstsi  289
             MN S+ L+ +PS  + K LFSPFL P PLRL T  + ++ H R R    +  S    TS+
Sbjct  1     MNTSIFLTASPSVAQPKVLFSPFLPPNPLRLSTTLAYHQSHRRRRYRISTIRSASIPTSL  60

Query  290   sssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFR  469
             S+S+ +      ++PDVFGGK+EL+G QAL D+MSP +RIASSA+IFAGA+AAGYGLG +
Sbjct  61    SASSSSDQPIKAIKPDVFGGKKELTGFQALADAMSPTVRIASSALIFAGAIAAGYGLGSK  120

Query  470   FGGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIA  649
             FGGSRN  +GGAVALG AGAG AYALN+C PEVAAVNLHNYVA  DDPAAL KEDI+AIA
Sbjct  121   FGGSRNVAMGGAVALGTAGAGVAYALNSCVPEVAAVNLHNYVADFDDPAALTKEDIEAIA  180

Query  650   KKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAM  829
              +YG+SKQ+EAFNAELCDIYCRYV+++LPPGNEDL+GDEV+TIIKFKNALGIDDPDAAAM
Sbjct  181   NRYGISKQNEAFNAELCDIYCRYVSSILPPGNEDLKGDEVETIIKFKNALGIDDPDAAAM  240

Query  830   HMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQV  1009
             HMEIGRRIFRQRLETGDRD DLEQRRAFQKLIYVS +VF +ASSFLLPWKR+FKVTDAQV
Sbjct  241   HMEIGRRIFRQRLETGDRDADLEQRRAFQKLIYVSTLVFGEASSFLLPWKRVFKVTDAQV  300

Query  1010  EVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEEN  1189
             E+AVRDNAQRLY  K+KS+G+DVNVDQLV LREAQL+Y LSDE AE MF+E TRKLVEEN
Sbjct  301   ELAVRDNAQRLYGFKVKSIGQDVNVDQLVGLREAQLAYRLSDELAEDMFKELTRKLVEEN  360

Query  1190  ISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             IS A++ILKSRTRA  EATR+ EEL+K+L FNNLLISLKNHP+A+RFAR
Sbjct  361   ISTALNILKSRTRA-SEATRIVEELNKVLKFNNLLISLKNHPEANRFAR  408



>ref|XP_009595772.1| PREDICTED: protein TIC110, chloroplastic isoform X2 [Nicotiana 
tomentosiformis]
Length=1013

 Score =   513 bits (1322),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 314/410 (77%), Positives = 343/410 (84%), Gaps = 12/410 (3%)
 Frame = +2

Query  116   MNPSLLLSTN-PS--PNRKALFSPFLSPAPLRLT-AASRNRYHFRYRIsavssssdqpst  283
             MNPSLLL+TN PS  P      SPFL+P PLR T   S+ R HF Y     +  S     
Sbjct  1     MNPSLLLTTNQPSVNPTTTTFLSPFLNPTPLRFTRKISQKRRHFLYNYGLSTVRSSASDK  60

Query  284   sisssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLG  463
               SSS         V+PDVFGGK+ELS IQ+LVD+MSPPIRIASSA++FAGAVAAGYGLG
Sbjct  61    PPSSSIS-------VKPDVFGGKKELSTIQSLVDAMSPPIRIASSALVFAGAVAAGYGLG  113

Query  464   FRFGGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDA  643
              RFGGSRNAG+GGA+ALGAAGAGAAYALN+C PEVAA+NLHNYVA  +DPAAL KEDIDA
Sbjct  114   VRFGGSRNAGVGGAIALGAAGAGAAYALNSCVPEVAAINLHNYVADFEDPAALNKEDIDA  173

Query  644   IAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAA  823
             IA KYGVSKQ+EAFNAEL DIYCRYV+AV P G E+LRGDEVDTIIKFKNALGIDDPDAA
Sbjct  174   IANKYGVSKQNEAFNAELRDIYCRYVSAVFPTGTEELRGDEVDTIIKFKNALGIDDPDAA  233

Query  824   AMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDA  1003
              MHMEIGRRIFRQRLETGDRDGD+EQRRAFQKLIYVS +VF +AS+FLLPWKR+FKVTD+
Sbjct  234   DMHMEIGRRIFRQRLETGDRDGDIEQRRAFQKLIYVSTLVFGEASAFLLPWKRVFKVTDS  293

Query  1004  QVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVE  1183
             QVEVAVRDNAQRLYASKLKSVGRD++ DQLVSLREAQL Y LSDE AE MF+E+ RKLVE
Sbjct  294   QVEVAVRDNAQRLYASKLKSVGRDIDADQLVSLREAQLVYRLSDELAEEMFKEYARKLVE  353

Query  1184  ENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
             E IS AV  LKSRTRA  EATRV EELDKIL+FNNLLISLKNHPDASRFA
Sbjct  354   ECISLAVGSLKSRTRAT-EATRVIEELDKILSFNNLLISLKNHPDASRFA  402



>ref|XP_002276796.2| PREDICTED: protein TIC110, chloroplastic [Vitis vinifera]
 emb|CBI15848.3| unnamed protein product [Vitis vinifera]
Length=1007

 Score =   512 bits (1318),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 305/406 (75%), Positives = 341/406 (84%), Gaps = 12/406 (3%)
 Frame = +2

Query  116   MNPSLLLSTNPSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpstsiss  295
             MNPSLL  T P P++ +  SPFL+P P R +  S  R   RYRIS + SSS  P    SS
Sbjct  1     MNPSLL--TAPPPSQHS--SPFLNPTPFRFSTTSLTRRR-RYRISLIRSSSTPPDPLTSS  55

Query  296   sagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFG  475
                       V  DVFGG+RELSGIQ LVDS+SPP+R+ SSA+I AGA+AAGYGLGFRFG
Sbjct  56    PPS-------VTSDVFGGRRELSGIQPLVDSLSPPLRLVSSALIVAGAIAAGYGLGFRFG  108

Query  476   GSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKK  655
              SRN  LGGAVA+GAAG  AAYALNAC PEVAA NLHNYVAGCDDP A+KKEDI+ IA K
Sbjct  109   KSRNTALGGAVAIGAAGGAAAYALNACVPEVAAANLHNYVAGCDDPGAVKKEDIEEIANK  168

Query  656   YGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHM  835
             YGVSKQ EAFNAELCD+YCR+VT+V+PPG+EDL+GDEVDTIIKFK++LGIDDPDAAAMHM
Sbjct  169   YGVSKQDEAFNAELCDLYCRFVTSVVPPGSEDLKGDEVDTIIKFKSSLGIDDPDAAAMHM  228

Query  836   EIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEV  1015
             EIGRRIFRQRLETGDRDGD+EQRRAFQKL+YVS +VF +AS FLLPWKR+F+VTD+QVEV
Sbjct  229   EIGRRIFRQRLETGDRDGDIEQRRAFQKLVYVSTLVFGEASKFLLPWKRVFRVTDSQVEV  288

Query  1016  AVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENIS  1195
             AVRDNAQRLYA KLKSVGRDV+V+QLVSLREAQLS LLSDE AE MF+EHTRKLVEENIS
Sbjct  289   AVRDNAQRLYAFKLKSVGRDVDVNQLVSLREAQLSCLLSDELAEDMFKEHTRKLVEENIS  348

Query  1196  RAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
              A+SILKSRTRA   AT+V EEL+K LAFNNLLISLKNHPDA RFA
Sbjct  349   TALSILKSRTRAVRGATQVVEELNKALAFNNLLISLKNHPDAGRFA  394



>ref|XP_011080674.1| PREDICTED: protein TIC110, chloroplastic [Sesamum indicum]
Length=1034

 Score =   490 bits (1262),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 294/409 (72%), Positives = 333/409 (81%), Gaps = 19/409 (5%)
 Frame = +2

Query  116   MNPSLLLSTNPS-PNRKALF-SPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpstsi  289
             M PS+LL+T PS P+ K LF +PFLS      TA  R+  H R                 
Sbjct  31    MKPSVLLTTTPSSPHPKTLFFTPFLSST----TALRRSSTHLR----------RDRCKIS  76

Query  290   sssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFR  469
                +    ++  V+PDVFG KREL G+Q+LVD+MSPPIRIASS +I A AV AGYGLG R
Sbjct  77    RIRSSGEPSSPAVKPDVFGEKRELMGLQSLVDAMSPPIRIASSVLIVAAAVGAGYGLGSR  136

Query  470   FGGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIA  649
             FGGSRNAGLGGAV +GAAGAGAAYALNAC PEVAA NLHNYV GCDDP A+KKEDI+AIA
Sbjct  137   FGGSRNAGLGGAVIVGAAGAGAAYALNACVPEVAAANLHNYVVGCDDPGAIKKEDIEAIA  196

Query  650   KKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAM  829
              KYGVSKQ+EAFNAELCDIYCR+V+AVLPP +EDL+GDEV+TIIKFK++LGIDDPDAAAM
Sbjct  197   NKYGVSKQNEAFNAELCDIYCRFVSAVLPPESEDLKGDEVETIIKFKSSLGIDDPDAAAM  256

Query  830   HMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQV  1009
             HMEIGRRIFRQRLETGDRD D+ QRRAFQKLIYVSN+VF +AS FLLPWKR+FKVTDAQV
Sbjct  257   HMEIGRRIFRQRLETGDRDADMAQRRAFQKLIYVSNLVFGEASGFLLPWKRVFKVTDAQV  316

Query  1010  EVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEEN  1189
             EVAVRDNAQRLY+ KL S+ +DV+V QL+SLREAQL Y LSDE AE MFR+HTRKLVE+N
Sbjct  317   EVAVRDNAQRLYSYKLDSISQDVDVTQLISLREAQLLYRLSDELAENMFRDHTRKLVEQN  376

Query  1190  ISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             IS A+S+LKSR+R+   A  V EELDKILAFNNLLISLKNHPDASRFAR
Sbjct  377   ISAALSVLKSRSRS---AQPVLEELDKILAFNNLLISLKNHPDASRFAR  422



>ref|XP_006361298.1| PREDICTED: protein TIC110, chloroplastic-like isoform X1 [Solanum 
tuberosum]
Length=1004

 Score =   489 bits (1259),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 299/407 (73%), Positives = 335/407 (82%), Gaps = 15/407 (4%)
 Frame = +2

Query  116   MNP-SLLLSTNPSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpstsis  292
             MNP SLLL  N  P      S FL+P PLRLT     +++ + RI +   SS       +
Sbjct  1     MNPTSLLLPINQPPPVTTFRSQFLNPTPLRLTP----KFYLKRRIQSTVLSSSSVQDKPT  56

Query  293   ssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRF  472
             S          V PDVFGGK+ELS IQ+LVD+MSPPIRIASSA+IFAGA+AAGYGLG RF
Sbjct  57    S----------VNPDVFGGKKELSPIQSLVDAMSPPIRIASSALIFAGAIAAGYGLGLRF  106

Query  473   GGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAK  652
             GGSRNAG+GGA+A GAAGAGAAYALN+CAPEVAA+NLHNYVA  ++PAAL KEDI+AIA 
Sbjct  107   GGSRNAGVGGAIAFGAAGAGAAYALNSCAPEVAAINLHNYVADFENPAALNKEDIEAIAN  166

Query  653   KYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMH  832
             KYGVSKQ+EAFNAEL DIYCRYV+AVLP   E+LRGDEVDTIIKFKN LGIDDPDAA MH
Sbjct  167   KYGVSKQNEAFNAELRDIYCRYVSAVLPASTEELRGDEVDTIIKFKNTLGIDDPDAADMH  226

Query  833   MEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVE  1012
             MEIGRRIFRQRLETGDRDGD+ QRRAFQKLIYVS IVF +AS+FLLPWKR+FKVTDAQV+
Sbjct  227   MEIGRRIFRQRLETGDRDGDMVQRRAFQKLIYVSTIVFGEASAFLLPWKRVFKVTDAQVD  286

Query  1013  VAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENI  1192
             VAVRDNAQRLYASKLKSVGRD++V+QL+SLREAQL+Y LSDE A  MF+EH R LVEE I
Sbjct  287   VAVRDNAQRLYASKLKSVGRDIDVNQLISLREAQLAYRLSDELAHEMFKEHARNLVEEII  346

Query  1193  SRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
             S AV ILKSRTRA  E TRV EELDK+L++NNLLISLKNH DASRFA
Sbjct  347   STAVGILKSRTRATREPTRVIEELDKVLSYNNLLISLKNHADASRFA  393



>ref|XP_010326200.1| PREDICTED: protein TIC110, chloroplastic isoform X1 [Solanum 
lycopersicum]
Length=1006

 Score =   489 bits (1259),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 297/407 (73%), Positives = 337/407 (83%), Gaps = 13/407 (3%)
 Frame = +2

Query  116   MNPS-LLLSTNPSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpstsis  292
             MNPS LLL  N  P      S FL+P PLRLT     +++ + RI +   SS   S    
Sbjct  1     MNPSSLLLPINQPPPVNTFRSQFLNPTPLRLTP----KFYLKRRIQSTVISSSSASLQHK  56

Query  293   ssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRF  472
              ++        V PDVFGGK+ELS IQ+LVD+MSPPIRIASSA+IFA A+AAGYGLG RF
Sbjct  57    PTS--------VNPDVFGGKKELSPIQSLVDAMSPPIRIASSALIFAAAIAAGYGLGLRF  108

Query  473   GGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAK  652
             GGSRNAGLGGA+A GAAGAGAAYALN+CAP+VAA+NLHNYVA  D+PAAL KEDI++IA 
Sbjct  109   GGSRNAGLGGAIAFGAAGAGAAYALNSCAPQVAAINLHNYVADFDNPAALNKEDIESIAN  168

Query  653   KYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMH  832
             KYGVSKQ+EAFNAEL DIYCRY++AVLP   E+LRGDEVDTIIKFKNALGIDDPDAA MH
Sbjct  169   KYGVSKQNEAFNAELRDIYCRYISAVLPASTEELRGDEVDTIIKFKNALGIDDPDAADMH  228

Query  833   MEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVE  1012
             MEIGRRIFRQRLETGDRDGD+EQRRAFQKLIYVS +VF ++S+FLLPWKR+FKVTDAQV+
Sbjct  229   MEIGRRIFRQRLETGDRDGDMEQRRAFQKLIYVSTLVFGESSAFLLPWKRVFKVTDAQVD  288

Query  1013  VAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENI  1192
             VAVRDNAQRLYASKLKSVGRD++V+QL+SLREAQL+Y LSDE A  M +EH RKLVEE I
Sbjct  289   VAVRDNAQRLYASKLKSVGRDIDVNQLISLREAQLAYRLSDELAHEMLKEHARKLVEEII  348

Query  1193  SRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
             S AV ILKSRTRA  E TRV EELDK+L++NNLLISLKNH DASRFA
Sbjct  349   STAVGILKSRTRATREPTRVIEELDKVLSYNNLLISLKNHADASRFA  395



>emb|CAN60839.1| hypothetical protein VITISV_038562 [Vitis vinifera]
Length=1061

 Score =   489 bits (1258),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 305/451 (68%), Positives = 342/451 (76%), Gaps = 57/451 (13%)
 Frame = +2

Query  116   MNPSLLLSTNPSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpstsiss  295
             MNPSLL  T P P++ +  SPFL+P P R +  S  R   RYRIS + +SS  P    SS
Sbjct  1     MNPSLL--TAPPPSQHS--SPFLNPTPFRFSTTSLTRRR-RYRISLIRNSSTPPDPLTSS  55

Query  296   sagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFG  475
                       V  DVFGG+RELSGIQ LVDS+SPP+R+ SSA+I AGA+AAGYGLGFRFG
Sbjct  56    PPS-------VTSDVFGGRRELSGIQPLVDSLSPPLRLVSSALIVAGAIAAGYGLGFRFG  108

Query  476   GSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKK  655
              SRN  LGGAVA+GAAG  AAYALNAC PEVAAVNLHNYVAGCDDP A+KKEDI+ IA K
Sbjct  109   KSRNTALGGAVAIGAAGGAAAYALNACVPEVAAVNLHNYVAGCDDPGAVKKEDIEEIANK  168

Query  656   YGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHM  835
             YGVSKQ EAFNAELCD+YCR+VT+V PPG+EDL+GDEVDTIIKFK++LGIDDPDAAAMHM
Sbjct  169   YGVSKQDEAFNAELCDLYCRFVTSVXPPGSEDLKGDEVDTIIKFKSSLGIDDPDAAAMHM  228

Query  836   EIGRRIFRQRLETGDRDGDLEQRR-------------AFQKLIYVSNIVFRDASSFLLPW  976
             EIGRRIFRQRLETGDRDGD+EQRR             AFQKL+YVS +VF +AS FLLPW
Sbjct  229   EIGRRIFRQRLETGDRDGDIEQRRIWSLTIISKSPVQAFQKLVYVSTLVFGEASKFLLPW  288

Query  977   KRMFKVTDAQVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMF  1156
             KR+F+VTD+QVEVAVRDNAQRLYA KLKSVGRDV+V+QLVSLREAQLS LLSDE AE MF
Sbjct  289   KRVFRVTDSQVEVAVRDNAQRLYAFKLKSVGRDVDVNQLVSLREAQLSCLLSDELAEDMF  348

Query  1157  REHTRKLVEENISRAVSILKSRTRAPGE--------------------------------  1240
             +EHTRKLVEENIS A+SILKSRTRA  +                                
Sbjct  349   KEHTRKLVEENISTALSILKSRTRAVYDYYSFILKQLISVSILVVVAFALSYKIRLFSRG  408

Query  1241  ATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
             AT+V EEL+K LAFNNLLISLKNHPDA RFA
Sbjct  409   ATQVVEELNKALAFNNLLISLKNHPDAGRFA  439



>ref|XP_006361299.1| PREDICTED: protein TIC110, chloroplastic-like isoform X2 [Solanum 
tuberosum]
Length=1003

 Score =   486 bits (1250),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 299/407 (73%), Positives = 335/407 (82%), Gaps = 16/407 (4%)
 Frame = +2

Query  116   MNP-SLLLSTNPSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpstsis  292
             MNP SLLL  N  P      S FL+P PLRLT     +++ + RI +   SS       +
Sbjct  1     MNPTSLLLPINQPPPVTTFRSQFLNPTPLRLTP----KFYLKRRIQSTVLSSSSVQDKPT  56

Query  293   ssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRF  472
             S          V PDVFGGK+ELS IQ+LVD+MSPPIRIASSA+IFAGA+AAGYGLG RF
Sbjct  57    S----------VNPDVFGGKKELSPIQSLVDAMSPPIRIASSALIFAGAIAAGYGLGLRF  106

Query  473   GGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAK  652
             GGSRNAG+GGA+A GAAGAGAAYALN+CAPEVAA+NLHNYVA  ++PAAL KEDI+AIA 
Sbjct  107   GGSRNAGVGGAIAFGAAGAGAAYALNSCAPEVAAINLHNYVADFENPAALNKEDIEAIAN  166

Query  653   KYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMH  832
             KYGVSKQ+EAFNAEL DIYCRYV+AVLP   E+LRGDEVDTIIKFKN LGIDDPDAA MH
Sbjct  167   KYGVSKQNEAFNAELRDIYCRYVSAVLPASTEELRGDEVDTIIKFKNTLGIDDPDAADMH  226

Query  833   MEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVE  1012
             MEIGRRIFRQRLETGDRDGD+ QRRAFQKLIYVS IVF +AS+FLLPWKR+FKVTDAQV+
Sbjct  227   MEIGRRIFRQRLETGDRDGDMVQRRAFQKLIYVSTIVFGEASAFLLPWKRVFKVTDAQVD  286

Query  1013  VAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENI  1192
             VAVRDNAQRLYASKLKSVGRD++V+QL+SLREAQL+Y LSDE A  MF+EH R LVEE I
Sbjct  287   VAVRDNAQRLYASKLKSVGRDIDVNQLISLREAQLAYRLSDELAHEMFKEHARNLVEEII  346

Query  1193  SRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
             S AV ILKSRTRA  E TRV EELDK+L++NNLLISLKNH DASRFA
Sbjct  347   STAVGILKSRTRAT-EPTRVIEELDKVLSYNNLLISLKNHADASRFA  392



>ref|XP_004246966.1| PREDICTED: protein TIC110, chloroplastic isoform X2 [Solanum 
lycopersicum]
Length=1005

 Score =   486 bits (1250),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 297/407 (73%), Positives = 337/407 (83%), Gaps = 14/407 (3%)
 Frame = +2

Query  116   MNPS-LLLSTNPSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpstsis  292
             MNPS LLL  N  P      S FL+P PLRLT     +++ + RI +   SS   S    
Sbjct  1     MNPSSLLLPINQPPPVNTFRSQFLNPTPLRLTP----KFYLKRRIQSTVISSSSASLQHK  56

Query  293   ssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRF  472
              ++        V PDVFGGK+ELS IQ+LVD+MSPPIRIASSA+IFA A+AAGYGLG RF
Sbjct  57    PTS--------VNPDVFGGKKELSPIQSLVDAMSPPIRIASSALIFAAAIAAGYGLGLRF  108

Query  473   GGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAK  652
             GGSRNAGLGGA+A GAAGAGAAYALN+CAP+VAA+NLHNYVA  D+PAAL KEDI++IA 
Sbjct  109   GGSRNAGLGGAIAFGAAGAGAAYALNSCAPQVAAINLHNYVADFDNPAALNKEDIESIAN  168

Query  653   KYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMH  832
             KYGVSKQ+EAFNAEL DIYCRY++AVLP   E+LRGDEVDTIIKFKNALGIDDPDAA MH
Sbjct  169   KYGVSKQNEAFNAELRDIYCRYISAVLPASTEELRGDEVDTIIKFKNALGIDDPDAADMH  228

Query  833   MEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVE  1012
             MEIGRRIFRQRLETGDRDGD+EQRRAFQKLIYVS +VF ++S+FLLPWKR+FKVTDAQV+
Sbjct  229   MEIGRRIFRQRLETGDRDGDMEQRRAFQKLIYVSTLVFGESSAFLLPWKRVFKVTDAQVD  288

Query  1013  VAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENI  1192
             VAVRDNAQRLYASKLKSVGRD++V+QL+SLREAQL+Y LSDE A  M +EH RKLVEE I
Sbjct  289   VAVRDNAQRLYASKLKSVGRDIDVNQLISLREAQLAYRLSDELAHEMLKEHARKLVEEII  348

Query  1193  SRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
             S AV ILKSRTRA  E TRV EELDK+L++NNLLISLKNH DASRFA
Sbjct  349   STAVGILKSRTRAT-EPTRVIEELDKVLSYNNLLISLKNHADASRFA  394



>ref|XP_009354397.1| PREDICTED: protein TIC110, chloroplastic [Pyrus x bretschneideri]
Length=1004

 Score =   462 bits (1190),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 273/406 (67%), Positives = 322/406 (79%), Gaps = 15/406 (4%)
 Frame = +2

Query  116   MNPSLLLSTNPSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpstsiss  295
             MNPS L     +P+R A  SPFL+P  + L AA+      R               +  +
Sbjct  1     MNPSTL-----TPHRSAFRSPFLNP--ISLPAATSVHSRRRRF-------RVSFPRNSDA  46

Query  296   sagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFG  475
             S+  +  A P  PDVFGGKREL+GIQ +V+ +SPP+RI +SAI+FAGAVAAGYGLG R G
Sbjct  47    SSEQSTDASPPPPDVFGGKRELTGIQPVVEKLSPPLRIVTSAIVFAGAVAAGYGLGLRLG  106

Query  476   GSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKK  655
              S+NA  GGA  LGAAG  A YA+N+CAPEVAAV+LHNYVAG DDP A+KKEDI+ IA+K
Sbjct  107   KSQNAAYGGAAVLGAAGGAALYAMNSCAPEVAAVDLHNYVAGLDDPKAVKKEDIEGIARK  166

Query  656   YGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHM  835
             YGVSKQ EAFNAELCD+YCR+VT+VLPPG ++L+GDEVDTI+ FKN+LGIDDP+AA+MHM
Sbjct  167   YGVSKQDEAFNAELCDLYCRFVTSVLPPGAQELKGDEVDTIVSFKNSLGIDDPEAASMHM  226

Query  836   EIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEV  1015
             EIGRRIFRQRLET DR+GDLEQRRAFQKLIYVS +VF DASSFLLPWKR+FKVTD+QVE+
Sbjct  227   EIGRRIFRQRLET-DREGDLEQRRAFQKLIYVSTLVFGDASSFLLPWKRVFKVTDSQVEL  285

Query  1016  AVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENIS  1195
             A+RDNAQRLYASKLKSVGRD+ V+QLV L+EAQL Y LSDE AE +F+EH RKLVE NIS
Sbjct  286   AIRDNAQRLYASKLKSVGRDIGVEQLVKLKEAQLMYQLSDEHAEDLFKEHARKLVEANIS  345

Query  1196  RAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
              A+ ILKSRTR+    T V EELDK+L  N+LLISLKN PDA+RFA
Sbjct  346   AALRILKSRTRSAAGITEVVEELDKMLELNSLLISLKNQPDAARFA  391



>ref|XP_002517728.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44660.1| conserved hypothetical protein [Ricinus communis]
Length=1019

 Score =   461 bits (1186),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 273/408 (67%), Positives = 327/408 (80%), Gaps = 7/408 (2%)
 Frame = +2

Query  116   MNPSLLLSTNPSPNRKALFSPFLSPAPLRL-TAASRNRYHFRYRIsavssssdqpstsis  292
             MNPSL+ ST  S       SPFLSP+PLRL T +S  R  FR  I   SSS      S +
Sbjct  1     MNPSLVTST-ASSLASPFLSPFLSPSPLRLSTPSSLKRRRFRVYIPRNSSSDAAVDDSTT  59

Query  293   ssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRF  472
             ++  T         ++FGGK+EL+G+Q LV ++SPP+R+ASSAII AGAVAAGYGLG +F
Sbjct  60    TATTTT-----TNENIFGGKKELTGLQPLVANLSPPVRLASSAIIIAGAVAAGYGLGLKF  114

Query  473   GGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAK  652
             G +RN  LGGA A GAAG    YA+N+C PEVAA +LHNYVAG DDP A+KKED++ IAK
Sbjct  115   GKTRNLALGGAAAAGAAGGAFVYAINSCVPEVAAADLHNYVAGFDDPKAVKKEDVEQIAK  174

Query  653   KYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMH  832
             +YGVSKQ EAFNAELCD+YCR+V++VLPPGNEDL+G+EV+TII FK+A+GIDDPDAA+MH
Sbjct  175   RYGVSKQDEAFNAELCDMYCRFVSSVLPPGNEDLKGNEVETIINFKSAMGIDDPDAASMH  234

Query  833   MEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVE  1012
             +EIGRR+FRQRLETGDRDGD+EQRRAFQKLIYVS +VF +ASSFLLPWKR+FKVTD+QVE
Sbjct  235   VEIGRRLFRQRLETGDRDGDVEQRRAFQKLIYVSTLVFGEASSFLLPWKRVFKVTDSQVE  294

Query  1013  VAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENI  1192
             +A+RDNAQRLYASKLKSV RDVN ++LVSLR+AQL Y LSDE AE +FR+ T KL EENI
Sbjct  295   IAIRDNAQRLYASKLKSVSRDVNAEELVSLRQAQLQYRLSDELAEDLFRQQTIKLAEENI  354

Query  1193  SRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             S A+++LKSRT A     +V EELDKILAFN+ LISLKNH DA+ FAR
Sbjct  355   SAALAVLKSRTTAVNGVKQVVEELDKILAFNSKLISLKNHADAASFAR  402



>ref|XP_010087175.1| hypothetical protein L484_002222 [Morus notabilis]
 gb|EXB28414.1| hypothetical protein L484_002222 [Morus notabilis]
Length=1018

 Score =   461 bits (1186),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 281/410 (69%), Positives = 331/410 (81%), Gaps = 9/410 (2%)
 Frame = +2

Query  116   MNPSLLLSTNPSPNRKALFSPFLSPAPLRLTA-ASRNRYHFRYRIsavssssdqpstsis  292
             MN S LLS   +P R  L SPFL+  PLR T  AS      R+R+S   +S+     S +
Sbjct  1     MNSSALLSPPSAPPRPLLRSPFLNSIPLRTTTTASLRPQRRRFRVSVPRNSTTPADQSAA  60

Query  293   ssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRF  472
             +++       P  PDVFGGK+EL+GIQ +V+ +SPP+R+ASSAI+FAGAVAAGYGLGFRF
Sbjct  61    ATSSP-----PTPPDVFGGKKELTGIQLIVEKLSPPLRLASSAILFAGAVAAGYGLGFRF  115

Query  473   GGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAK  652
             G ++NA LGGAVALGAAG  AAYALNAC P+VAAV LHNYVAG DDP A+KK +I+ IAK
Sbjct  116   GKTQNAALGGAVALGAAGGAAAYALNACVPDVAAVELHNYVAGSDDPRAVKKVEIEGIAK  175

Query  653   KYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMH  832
             KYGVSKQ EAF+AE  D+YCR++++VLPPG+EDL G+EVDTII FKNALGIDDP+AAAMH
Sbjct  176   KYGVSKQDEAFSAEFSDLYCRFLSSVLPPGSEDLSGNEVDTIINFKNALGIDDPEAAAMH  235

Query  833   MEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVE  1012
             MEIGRRIFRQRLETGDRD D+EQR+AFQKLIYVS +VF DASSFLLPWKR+FKVTD+QVE
Sbjct  236   MEIGRRIFRQRLETGDRDADMEQRQAFQKLIYVSTLVFGDASSFLLPWKRVFKVTDSQVE  295

Query  1013  VAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENI  1192
             +A+RDNAQRLYAS+LKSVGRD++V QLVSLREAQ  Y L+DE AE + +EHTRKLVEENI
Sbjct  296   IAIRDNAQRLYASRLKSVGRDISVGQLVSLREAQRLYRLTDEHAEDLLKEHTRKLVEENI  355

Query  1193  SRAVSILKSRTRA---PGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
             S A+SI+KSR RA        +V EELDK LA NNLLISLKNHP+A RFA
Sbjct  356   SSALSIVKSRARAVIFSQGVKQVVEELDKGLALNNLLISLKNHPEADRFA  405



>ref|XP_008354678.1| PREDICTED: protein TIC110, chloroplastic [Malus domestica]
Length=1004

 Score =   459 bits (1182),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 272/406 (67%), Positives = 321/406 (79%), Gaps = 15/406 (4%)
 Frame = +2

Query  116   MNPSLLLSTNPSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpstsiss  295
             MNPS L     +P+R AL SPFL+P  + L AA+                      + ++
Sbjct  1     MNPSTL-----TPHRSALRSPFLNP--ISLPAATSVHSR-------RRRFRVSFPRNSAA  46

Query  296   sagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFG  475
             S+     A P  PDVFGGKREL+GIQ +V+ +SPP+RI +SAI+FAGAVAAGYGLG R G
Sbjct  47    SSEQPTDASPPPPDVFGGKRELTGIQPVVEKLSPPLRIVTSAIVFAGAVAAGYGLGLRLG  106

Query  476   GSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKK  655
              S+NA  GGA  LGAAG  A YA+N+CAPEVAAV+LHNYVAG DDP A+KKEDI+ IA+K
Sbjct  107   KSQNAAYGGAAVLGAAGGAALYAMNSCAPEVAAVDLHNYVAGFDDPKAVKKEDIEGIARK  166

Query  656   YGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHM  835
             YGVSKQ EAFNAELCD+YCR+VT+VLPPG ++L+GDEVDTI+ FKN+LGIDDP+AA+MHM
Sbjct  167   YGVSKQDEAFNAELCDLYCRFVTSVLPPGAQELKGDEVDTIVSFKNSLGIDDPEAASMHM  226

Query  836   EIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEV  1015
             EIGRRIFRQRLET DR+GDLEQRRAFQKLIYVS +VF DASSFLLPWKR+FKVTD+QVE+
Sbjct  227   EIGRRIFRQRLET-DREGDLEQRRAFQKLIYVSTLVFGDASSFLLPWKRVFKVTDSQVEL  285

Query  1016  AVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENIS  1195
             A+RDNAQRLYASKLKSVGRD+ V+QLV L+EAQ  Y LSDE AE +F+EH RKLVE NIS
Sbjct  286   AIRDNAQRLYASKLKSVGRDIGVEQLVKLKEAQRMYRLSDEHAEDLFKEHARKLVEANIS  345

Query  1196  RAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
              A+ ILKSRTR+    T V EELDK+L  N+LLISLKN PDA+RFA
Sbjct  346   AALRILKSRTRSAAGITEVVEELDKMLELNSLLISLKNQPDAARFA  391



>ref|XP_007204960.1| hypothetical protein PRUPE_ppa000779mg [Prunus persica]
 gb|EMJ06159.1| hypothetical protein PRUPE_ppa000779mg [Prunus persica]
Length=1006

 Score =   459 bits (1181),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 270/406 (67%), Positives = 328/406 (81%), Gaps = 14/406 (3%)
 Frame = +2

Query  116   MNPSLLLSTNPSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpstsiss  295
             MNPS L     +P R  L SPFL+P  L    + + R   R+R+S   +S+     S  +
Sbjct  1     MNPSTL-----TPQRSVLHSPFLNPISLPAATSGQTRRR-RFRVSFPRNSATPSDQSTGA  54

Query  296   sagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFG  475
             ++          PDVFGGKREL+GIQ +V+ +SPP+R+A+SAI+ AGAVAAGYGLG R  
Sbjct  55    TSTPP-------PDVFGGKRELTGIQPVVEKLSPPLRLATSAIVIAGAVAAGYGLGLRLS  107

Query  476   GSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKK  655
              S+NA  GGA  LGAAG  AAYALN+CAPEVAA++LHNYVAG DDP A+KKEDI+ IA+K
Sbjct  108   KSQNAAFGGAAVLGAAGGAAAYALNSCAPEVAAIDLHNYVAGVDDPKAVKKEDIEGIARK  167

Query  656   YGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHM  835
             YGVSKQ EAFNAELCD+YCR+VT+VLPPG E+L+GDEV+TI+ FKN+LG+DDP+AA+MHM
Sbjct  168   YGVSKQDEAFNAELCDLYCRFVTSVLPPGAEELKGDEVETIVSFKNSLGVDDPEAASMHM  227

Query  836   EIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEV  1015
             EIGRRIFRQRLET DR+GDLEQRRAFQKLIYVS +VF DASSFLLPWKR+FK+TD+QVE+
Sbjct  228   EIGRRIFRQRLET-DREGDLEQRRAFQKLIYVSTLVFGDASSFLLPWKRVFKITDSQVEL  286

Query  1016  AVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENIS  1195
             A+RDNAQRLYASKLKSVGRD++ +QLV L+EAQ +Y LSDE+AE +F+EH RKLVE NIS
Sbjct  287   AIRDNAQRLYASKLKSVGRDIDAEQLVRLKEAQHAYRLSDEYAEDLFKEHARKLVEANIS  346

Query  1196  RAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
              A+SI+KSRTRA    T V EEL+K+LAFN+LLISLKN PDA+RFA
Sbjct  347   AALSIIKSRTRAARGVTHVVEELEKMLAFNSLLISLKNQPDAARFA  392



>ref|XP_011041814.1| PREDICTED: protein TIC110, chloroplastic-like [Populus euphratica]
Length=1010

 Score =   455 bits (1171),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 267/413 (65%), Positives = 325/413 (79%), Gaps = 28/413 (7%)
 Frame = +2

Query  116   MNPSLLLSTNPSPNRKALFSPFLSPAPLRLTAAS-----RNRYHFRYRIsavssssdqps  280
             MNPSLL S+ PS       +PFLSP PL+LT +S     R+R+   Y             
Sbjct  1     MNPSLLASS-PS-------TPFLSPIPLKLTPSSLTLPKRHRFLVSY-------------  39

Query  281   tsisssagtaaaaiPVQPD-VFGGKRELSGIQALVDsmsppiriassaiifagavaaGYG  457
                S++   +   +  +PD VFGGKREL+GIQ +V ++SP +R+ASSAII AGA+AAGYG
Sbjct  40    PRSSAAETPSTVTLESKPDNVFGGKRELTGIQPIVSNLSPTLRLASSAIILAGALAAGYG  99

Query  458   LGFRFGG-SRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKED  634
             LG +FGG SRN  LGGA   GAAG    +ALN+  PEVAA+NLHNYV+G DDP  + KE+
Sbjct  100   LGNKFGGGSRNLALGGAAVAGAAGGAVVFALNSAVPEVAAINLHNYVSGFDDPIQVSKEE  159

Query  635   IDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDP  814
             I+ IAKKYGVSKQ EAFNAELCD+Y R+V++VLPPG E+L+G+EV+TII FKNALGIDDP
Sbjct  160   IEGIAKKYGVSKQDEAFNAELCDLYSRFVSSVLPPGGEELKGNEVETIINFKNALGIDDP  219

Query  815   DAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKV  994
             DAA+MH+E+GRRIFRQRLETGDRDGD+EQRRAFQKLIYVS +VF +ASSFLLPWKR+FKV
Sbjct  220   DAASMHVELGRRIFRQRLETGDRDGDVEQRRAFQKLIYVSTLVFGEASSFLLPWKRVFKV  279

Query  995   TDAQVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRK  1174
             TD+QVE+A+RDNAQRLY+SKLKSVG+D++V+QLVSLR+AQ+S  LSDE AE +FR+HTRK
Sbjct  280   TDSQVEIAIRDNAQRLYSSKLKSVGKDIDVEQLVSLRQAQISCRLSDELAEDLFRQHTRK  339

Query  1175  LVEENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
             LVE+NIS A+  LKSRTR   +  +V EELDKILAFNN LISLKNH DA+ FA
Sbjct  340   LVEKNISAALDRLKSRTRTVQDVVKVVEELDKILAFNNKLISLKNHKDAASFA  392



>ref|XP_010256257.1| PREDICTED: protein TIC110, chloroplastic-like [Nelumbo nucifera]
Length=1008

 Score =   454 bits (1169),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 251/337 (74%), Positives = 296/337 (88%), Gaps = 0/337 (0%)
 Frame = +2

Query  323   PVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglgg  502
             P+   VFGGK+ELSG+Q LVD +SP +R+ASS +I AGA+AAGYGLG+R GG+RNAGLGG
Sbjct  60    PINSSVFGGKKELSGVQLLVDGLSPSVRLASSVVIVAGALAAGYGLGYRIGGTRNAGLGG  119

Query  503   avalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEA  682
             A+A GAAG  AAYALN+C PEVAAVNLHN+VA  DDP  LKKEDI+ IAK+YGVSKQ EA
Sbjct  120   AIAFGAAGGAAAYALNSCVPEVAAVNLHNFVADHDDPTTLKKEDIEGIAKRYGVSKQDEA  179

Query  683   FNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQ  862
             FNAELCD+Y R+V++VLPPG+E+L+G+EVDTIIKF++ALGIDDPDAAA+HMEIGRRIFRQ
Sbjct  180   FNAELCDLYGRFVSSVLPPGSENLKGNEVDTIIKFRSALGIDDPDAAAVHMEIGRRIFRQ  239

Query  863   RLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRL  1042
             RLETGD D D+EQRRAFQKLIYVS +VF +AS+FLLPWKR+FKVTDAQVEVA+RDNAQRL
Sbjct  240   RLETGDHDADIEQRRAFQKLIYVSTLVFGEASTFLLPWKRVFKVTDAQVEVAIRDNAQRL  299

Query  1043  YASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSR  1222
             YA KL+SVGRD++  QL+SLREAQL Y LS+E A  MFREHTRK+VEENISRA+ +LKSR
Sbjct  300   YAFKLESVGRDIDEKQLISLREAQLLYRLSEELASDMFREHTRKIVEENISRALEVLKSR  359

Query  1223  TRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
             +RA   +T+V EEL+KIL FNNLL+SL NH DA RFA
Sbjct  360   SRAVRGSTQVVEELEKILEFNNLLMSLNNHSDAGRFA  396



>ref|XP_008229850.1| PREDICTED: protein TIC110, chloroplastic [Prunus mume]
Length=1005

 Score =   454 bits (1168),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 270/406 (67%), Positives = 326/406 (80%), Gaps = 14/406 (3%)
 Frame = +2

Query  116   MNPSLLLSTNPSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpstsiss  295
             MNPS L     +P R  L SPFL+P P     + + R   R+R+S   +S+     S  S
Sbjct  1     MNPSTL-----TPQRSVLHSPFLNPIPPPAATSGQTRRR-RFRVSFPRNSATPSDQSTGS  54

Query  296   sagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFG  475
             ++          PDVFGGKREL+GIQ +V+ +SPP+R+A+SAI+ AGAVAAGYGLG R  
Sbjct  55    TSTPP-------PDVFGGKRELTGIQPVVEKLSPPLRLATSAIVIAGAVAAGYGLGLRLS  107

Query  476   GSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKK  655
              S+N   GGA  LGAAG  AAYALN+CAPEVAA++LHNYVAG DDP A+KKEDI+ IA+K
Sbjct  108   KSQNTAFGGAAVLGAAGGAAAYALNSCAPEVAAIDLHNYVAGVDDPKAVKKEDIEDIARK  167

Query  656   YGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHM  835
             YGVSKQ EAFNAELCD+YCR+VT+VLP G E+L+GDEV+TI+ FKN+LGIDDP+AA+MHM
Sbjct  168   YGVSKQDEAFNAELCDLYCRFVTSVLPSGAEELKGDEVETIVSFKNSLGIDDPEAASMHM  227

Query  836   EIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEV  1015
             EIGRRIFRQRLET DR+GDLEQRRAFQKLIYVS +VF DASSFLLPWKR+FK TD+QVE+
Sbjct  228   EIGRRIFRQRLET-DREGDLEQRRAFQKLIYVSTLVFGDASSFLLPWKRVFKNTDSQVEL  286

Query  1016  AVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENIS  1195
             A+RDNAQRLYASKLKSVGRD++ +QLV L+EAQ +Y LSDE+AE +F+EH RKLVE NIS
Sbjct  287   AIRDNAQRLYASKLKSVGRDIDAEQLVRLKEAQHAYRLSDEYAEDLFKEHARKLVEANIS  346

Query  1196  RAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
              A+SI+KSRTRA    T+V EEL+K+LAFN+LLISLKN PDA+RFA
Sbjct  347   AALSIIKSRTRAARGVTQVVEELEKMLAFNSLLISLKNQPDAARFA  392



>gb|EYU46000.1| hypothetical protein MIMGU_mgv1a000719mg [Erythranthe guttata]
Length=1006

 Score =   453 bits (1165),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 282/411 (69%), Positives = 327/411 (80%), Gaps = 24/411 (6%)
 Frame = +2

Query  116   MNPSLLLSTNP---SPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpsts  286
             MN SLLL+TNP    PN   L +PF     LR ++      H R R              
Sbjct  1     MNSSLLLTTNPRFPHPNF-TLLTPFPPLIALRPSSV-----HLRRR-----------RLD  43

Query  287   isssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGF  466
             ISSS     +A  V+PDVFG K+EL+G+Q+LVD+MSPP+RIASSA+I A AVAAGYGLG 
Sbjct  44    ISSSLSDRPSAAAVKPDVFGDKKELTGVQSLVDAMSPPVRIASSALIVAAAVAAGYGLGL  103

Query  467   RFGGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAI  646
             RFGGSRN  +GGAVA+GAAGAGAAYALN+C PEVAA +LHNYV  C DP A+KKEDI+AI
Sbjct  104   RFGGSRNVAIGGAVAVGAAGAGAAYALNSCVPEVAAASLHNYVVECGDPGAVKKEDIEAI  163

Query  647   AKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAA  826
             A +YGVSKQ EAFNAEL DIYCR+V+A+LP  +EDLRGDEVD IIKFKN+LGIDDPDAA 
Sbjct  164   ANRYGVSKQDEAFNAELSDIYCRFVSAILPSVSEDLRGDEVDAIIKFKNSLGIDDPDAAN  223

Query  827   MHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASS-FLLPWKRMFKVTDA  1003
             MHMEIGRRIFRQRLETGDR+ D+EQRRAFQKLIYVS +VF +A+S FLLPWKR+FK TD+
Sbjct  224   MHMEIGRRIFRQRLETGDREADMEQRRAFQKLIYVSTLVFGEAASEFLLPWKRVFKYTDS  283

Query  1004  QVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVE  1183
             QVEVAVRDNAQRLYA KL+S+ +DV+V QL+SLREAQ  Y LSDE AE MFREHTRKLVE
Sbjct  284   QVEVAVRDNAQRLYAIKLESISQDVDVSQLISLREAQRLYRLSDELAEDMFREHTRKLVE  343

Query  1184  ENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             +NIS A+++LKSRT+A      V EE+DKIL+FN+LLISLKNHPDASRFAR
Sbjct  344   QNISAALTVLKSRTKA---VQPVIEEVDKILSFNSLLISLKNHPDASRFAR  391



>ref|XP_011461432.1| PREDICTED: protein TIC110, chloroplastic [Fragaria vesca subsp. 
vesca]
Length=1009

 Score =   451 bits (1161),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 277/407 (68%), Positives = 321/407 (79%), Gaps = 10/407 (2%)
 Frame = +2

Query  116   MNPSLLLSTNPS-PNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpstsis  292
             MNPS LLS   S P R  L S FL+P PLR TAAS      R+R+S   +SS Q   + S
Sbjct  1     MNPSALLSPPSSAPQRSILHSQFLNPIPLRSTAASAAVPRRRFRVSFPRNSSAQSDGATS  60

Query  293   ssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRF  472
             +         P   DVFGGKREL+G+Q LV  +SPP+R  +SAI+ AGA AAGYGLG R 
Sbjct  61    A---------PPPADVFGGKRELTGVQPLVGKLSPPLRFVTSAIVLAGAAAAGYGLGLRI  111

Query  473   GGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAK  652
             G ++N  LGGAV LGAAG  A YALNA AP VAAV+LHNYVAG DDP  ++K++I+ IAK
Sbjct  112   GKTQNTALGGAVVLGAAGGAAVYALNASAPAVAAVDLHNYVAGRDDPRDVRKDEIEGIAK  171

Query  653   KYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMH  832
             KYGVSKQ EAFNAELCD+YCR+VT+V+PPG+E+LRGDEVDTI+ FKNALGI DP+AA+MH
Sbjct  172   KYGVSKQDEAFNAELCDLYCRFVTSVIPPGSEELRGDEVDTILNFKNALGIQDPEAASMH  231

Query  833   MEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVE  1012
             MEIGRRIFRQRLETGDR+GDLEQRRAFQKLIYVS +VF DASSFLLPWKR+FKVTD+QVE
Sbjct  232   MEIGRRIFRQRLETGDREGDLEQRRAFQKLIYVSTLVFGDASSFLLPWKRVFKVTDSQVE  291

Query  1013  VAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENI  1192
             +A+RDNAQRLYASKLKSVGRD++ + LV LREAQL Y LSDE A  +F+EHTRKL EE I
Sbjct  292   IAIRDNAQRLYASKLKSVGRDIDAESLVRLREAQLMYRLSDETAADLFKEHTRKLAEEYI  351

Query  1193  SRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
             S A+SILKSRTR  G  T+V EELDK+LA N+ LISL N PDA RFA
Sbjct  352   SSALSILKSRTRTAGGVTQVAEELDKVLALNSSLISLMNQPDAVRFA  398



>ref|XP_010028334.1| PREDICTED: LOW QUALITY PROTEIN: protein TIC110, chloroplastic-like 
[Eucalyptus grandis]
Length=1003

 Score =   451 bits (1159),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 248/336 (74%), Positives = 293/336 (87%), Gaps = 1/336 (0%)
 Frame = +2

Query  332   PDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGG-SRNaglggav  508
             PDVFGG REL+G+Q LV S  PP R+A+SAI+ AGA+AAGY LG RFGG SRNA LGGA 
Sbjct  57    PDVFGGPRELAGLQPLVKSFPPPARLAASAIVVAGALAAGYRLGLRFGGGSRNAALGGAA  116

Query  509   algaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFN  688
              LGAAG  AAYA+ AC PEVAA +LHNYVAGCDDP A++KEDI+ IA +YGVSKQ EAFN
Sbjct  117   VLGAAGGAAAYAVRACVPEVAAADLHNYVAGCDDPQAVRKEDIEEIAGRYGVSKQDEAFN  176

Query  689   AELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRL  868
             AELCD+Y R+V++VLPPGNE+L+GDEV+ I+KFK+ALGIDDP+AA+MHMEIGRRIFRQRL
Sbjct  177   AELCDLYLRFVSSVLPPGNEELKGDEVEKIVKFKSALGIDDPEAASMHMEIGRRIFRQRL  236

Query  869   ETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYA  1048
             ETGDR+ D+EQRRAFQKLIYVS +VF +ASSFLLPWKR+FKVTDAQ+EVAVRDNAQRLY 
Sbjct  237   ETGDREADVEQRRAFQKLIYVSTLVFGEASSFLLPWKRIFKVTDAQIEVAVRDNAQRLYV  296

Query  1049  SKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTR  1228
             SKLK++GRD+  +QL +LR AQLSY LSDE AE +F+EHTRKLVEEN+S AV+++KSRTR
Sbjct  297   SKLKAIGRDLKAEQLENLRAAQLSYRLSDELAEDLFKEHTRKLVEENVSAAVNVVKSRTR  356

Query  1229  APGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             A    T+V E+LD+ILAFNNLL+SLKNHP+A  FAR
Sbjct  357   AATAVTQVVEQLDEILAFNNLLVSLKNHPNADHFAR  392



>ref|XP_006431981.1| hypothetical protein CICLE_v10000209mg [Citrus clementina]
 gb|ESR45221.1| hypothetical protein CICLE_v10000209mg [Citrus clementina]
Length=913

 Score =   448 bits (1153),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 268/408 (66%), Positives = 321/408 (79%), Gaps = 13/408 (3%)
 Frame = +2

Query  116   MNPSLLLSTNPSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpstsiss  295
             MN S LL+T P+ NR  LFSPFL+P+PL      R R+   +        +   +TS S+
Sbjct  1     MNNSSLLTT-PTSNRPLLFSPFLNPSPL----PKRRRFKVSF------PRNRSAATSASA  49

Query  296   sagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFG  475
             SA     A P   +++G ++EL GIQ +VD +SPP+R+A+SA++ AGAV AG+ LG ++G
Sbjct  50    SAEATPTATP-SDNIWGPRKELQGIQPVVDKLSPPVRLATSAVVIAGAVFAGFKLGSKYG  108

Query  476   G-SRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAK  652
             G SRN  +GGAV LGAAG   AYA+NA  PEVAA  LH+YVA C+DP A+K+EDI+AIA 
Sbjct  109   GGSRNVAIGGAVILGAAGGAMAYAMNAAVPEVAAKRLHDYVADCNDPGAVKREDIEAIAS  168

Query  653   KYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMH  832
             KYGVSKQ EAFNAEL +IYCR+VT+VLPPG EDLRGDEVD I++FK ALGIDDPDAAAMH
Sbjct  169   KYGVSKQDEAFNAELSEIYCRFVTSVLPPGGEDLRGDEVDKIVQFKKALGIDDPDAAAMH  228

Query  833   MEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVE  1012
             +EIGRRIFRQRLE GDRDGD+EQR AFQKLIYVS +VF +ASSFLLPWKR+FKVTD+QVE
Sbjct  229   VEIGRRIFRQRLEVGDRDGDMEQRWAFQKLIYVSTLVFGEASSFLLPWKRVFKVTDSQVE  288

Query  1013  VAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENI  1192
             +A+RDNA+RLYASKLKSVGRDV+ + +V LRE QLSY LSD  AE +FREHTRKLVEENI
Sbjct  289   IAIRDNAKRLYASKLKSVGRDVDAEHIVRLREEQLSYRLSDALAEDLFREHTRKLVEENI  348

Query  1193  SRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
               A+SILKSRTR      +V EELDK+LAFNNLLISLK HP+A RFAR
Sbjct  349   VTALSILKSRTRVVKGVAQVVEELDKVLAFNNLLISLKQHPNADRFAR  396



>ref|XP_008349539.1| PREDICTED: protein TIC110, chloroplastic-like [Malus domestica]
Length=1005

 Score =   450 bits (1158),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 272/407 (67%), Positives = 317/407 (78%), Gaps = 16/407 (4%)
 Frame = +2

Query  116   MNPSLLLSTNPSPNRKALFSPFLSPAPL-RLTAASRNRYHFRYRIsavssssdqpstsis  292
             MNPS L S      R +L SPFL+P      T+    R  FR   S  S++  + ST  +
Sbjct  1     MNPSTLTS-----QRSSLRSPFLNPISJPAATSVQSRRRPFRVSFSRNSAAPSEQSTDAA  55

Query  293   ssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRF  472
             SS            DVFGG REL+G+Q +V+ + PP+RI +SAI+FAGAVAAGYGLG R 
Sbjct  56    SSPPX---------DVFGGXRELTGVQPVVEKLXPPLRIVTSAIVFAGAVAAGYGLGLRL  106

Query  473   GGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAK  652
             G S+NA  GGA  LGAAG  A YALN+CAPEVAAVNLHNYVAG DDP A+KKEDI+ IA+
Sbjct  107   GKSQNAAYGGAAVLGAAGGAAVYALNSCAPEVAAVNLHNYVAGLDDPKAVKKEDIEGIAR  166

Query  653   KYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMH  832
             KYGVSKQ EAFNAELC +YCR+VT+VLPPG ++L+GDEVD I+ FKN+LGIDDP+AA+MH
Sbjct  167   KYGVSKQDEAFNAELCGLYCRFVTSVLPPGAQELKGDEVDXIVSFKNSLGIDDPEAASMH  226

Query  833   MEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVE  1012
             MEIGRRIFRQRLET DR+GDLEQRRAFQKLIYVS +VF DASSFLLPWKR+FKVTD+QVE
Sbjct  227   MEIGRRIFRQRLET-DREGDLEQRRAFQKLIYVSTLVFGDASSFLLPWKRVFKVTDSQVE  285

Query  1013  VAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENI  1192
             +A+RDNAQRLYASKLKSVGRD+  +QLV L+EAQ  Y LSDE AE +F+EH RKLVE NI
Sbjct  286   LAIRDNAQRLYASKLKSVGRDIGAEQLVKLKEAQRIYRLSDEHAEDLFKEHARKLVEANI  345

Query  1193  SRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
             S A+ ILKSRTR+    T V EELDK+L  NNLLISLKNHPDA+RFA
Sbjct  346   SAALRILKSRTRSATGITEVVEELDKMLELNNLLISLKNHPDAARFA  392



>ref|XP_009369542.1| PREDICTED: protein TIC110, chloroplastic-like [Pyrus x bretschneideri]
Length=1005

 Score =   449 bits (1155),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 270/406 (67%), Positives = 317/406 (78%), Gaps = 14/406 (3%)
 Frame = +2

Query  116   MNPSLLLSTNPSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpstsiss  295
             MNPS L S      R AL SPFL+P  L    + ++R                P  S + 
Sbjct  1     MNPSTLTS-----QRSALRSPFLNPISLPTATSVQSRRR--------RFRVSSPRNSAAP  47

Query  296   sagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFG  475
             S  +  A  P   DVFGGKREL+G+Q +V+ +SPP+RI +SAI+FAGAVAAGYGLG R G
Sbjct  48    SEQSTDAVSPPPHDVFGGKRELTGVQPVVEKLSPPLRIVTSAIVFAGAVAAGYGLGLRLG  107

Query  476   GSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKK  655
              S+NA  GGA  LGAAG  A YALN+CAPEVAAV+LHNYVAG DDP A+KKEDI+ IA+K
Sbjct  108   KSQNAAYGGAAVLGAAGGAAVYALNSCAPEVAAVDLHNYVAGLDDPKAVKKEDIEGIARK  167

Query  656   YGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHM  835
             +GVSKQ EAFNAELCD+YCR+VTAVLPPG ++L+GDE DTI+ FKN+LGIDDP+AA+MHM
Sbjct  168   FGVSKQDEAFNAELCDLYCRFVTAVLPPGAQELKGDEADTIVSFKNSLGIDDPEAASMHM  227

Query  836   EIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEV  1015
             EIGRRIFRQRLET DR+GDLEQRRAFQKLIYVS +VF DASSFLLPWKR+FKVTD+QVE+
Sbjct  228   EIGRRIFRQRLET-DREGDLEQRRAFQKLIYVSTLVFGDASSFLLPWKRVFKVTDSQVEL  286

Query  1016  AVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENIS  1195
             A+RDNAQRLYASKLKSVGRD+  +QLV L+EAQ  Y LSDE AE +F+EH RKLVE NIS
Sbjct  287   AIRDNAQRLYASKLKSVGRDIGAEQLVKLKEAQRIYRLSDEHAEDLFKEHARKLVEANIS  346

Query  1196  RAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
              A+ +LKSRTR+    T V +ELDK+L  NNLLISLKNHPDA+RFA
Sbjct  347   AALRMLKSRTRSATGITEVVQELDKMLELNNLLISLKNHPDAARFA  392



>ref|XP_006468148.1| PREDICTED: protein TIC110, chloroplastic-like [Citrus sinensis]
Length=1009

 Score =   448 bits (1152),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 268/408 (66%), Positives = 321/408 (79%), Gaps = 13/408 (3%)
 Frame = +2

Query  116   MNPSLLLSTNPSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpstsiss  295
             MN S LL+T P+ NR  LFSPFL+P+PL      R R+   +        +   +TS S+
Sbjct  1     MNNSSLLTT-PTSNRPLLFSPFLNPSPL----PKRRRFKVSF------PRNRSAATSASA  49

Query  296   sagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFG  475
             SA     A P   +++G ++EL GIQ +VD +SPP+R+A+SA++ AGAV AG+ LG ++G
Sbjct  50    SAEATPTATP-SDNIWGPRKELQGIQPVVDKLSPPVRLATSAVVIAGAVFAGFKLGSKYG  108

Query  476   G-SRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAK  652
             G SRN  +GGAV LGAAG   AYA+NA  PEVAA  LH+YVA C+DP A+K+EDI+AIA 
Sbjct  109   GGSRNVAIGGAVILGAAGGAMAYAMNAAVPEVAAKRLHDYVADCNDPGAVKREDIEAIAS  168

Query  653   KYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMH  832
             KYGVSKQ EAFNAEL +IYCR+VT+VLPPG EDLRGDEVD I++FK ALGIDDPDAAAMH
Sbjct  169   KYGVSKQDEAFNAELSEIYCRFVTSVLPPGGEDLRGDEVDKIVQFKKALGIDDPDAAAMH  228

Query  833   MEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVE  1012
             +EIGRRIFRQRLE GDRDGD+EQR AFQKLIYVS +VF +ASSFLLPWKR+FKVTD+QVE
Sbjct  229   VEIGRRIFRQRLEVGDRDGDMEQRWAFQKLIYVSTLVFGEASSFLLPWKRVFKVTDSQVE  288

Query  1013  VAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENI  1192
             +A+RDNA+RLYASKLKSVGRDV+ + +V LRE QLSY LSD  AE +FREHTRKLVEENI
Sbjct  289   IAIRDNAKRLYASKLKSVGRDVDAEHIVRLREEQLSYRLSDALAEDLFREHTRKLVEENI  348

Query  1193  SRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
               A+SILKSRTR      +V EELDK+LAFNNLLISLK HP+A RFAR
Sbjct  349   VTALSILKSRTRVVKGVAQVVEELDKVLAFNNLLISLKQHPNADRFAR  396



>ref|XP_008366219.1| PREDICTED: protein TIC110, chloroplastic-like [Malus domestica]
Length=1005

 Score =   447 bits (1151),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 271/407 (67%), Positives = 316/407 (78%), Gaps = 16/407 (4%)
 Frame = +2

Query  116   MNPSLLLSTNPSPNRKALFSPFLSPAPL-RLTAASRNRYHFRYRIsavssssdqpstsis  292
             MNPS L S      R +L SPFL+P      T+    R  FR   S  S++  + ST  +
Sbjct  1     MNPSTLTS-----QRSSLRSPFLNPISJPAATSVQSRRRPFRVSFSRNSAAPSEQSTDAA  55

Query  293   ssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRF  472
             SS            DVFGG REL+G+Q +V+ + PP+RI +SAI+FAGAVAAGYGLG R 
Sbjct  56    SSPPX---------DVFGGXRELTGVQPVVEKLXPPLRIVTSAIVFAGAVAAGYGLGLRL  106

Query  473   GGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAK  652
             G S+NA  GGA  LGAAG  A YALN+CAPEVAAVNLH YVAG DDP A+KKEDI+ IA+
Sbjct  107   GKSQNAAYGGAAVLGAAGGAAVYALNSCAPEVAAVNLHXYVAGLDDPKAVKKEDIEGIAR  166

Query  653   KYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMH  832
             KYGVSKQ EAFNAELC +YCR+VT+VLPPG ++L+GDEVD I+ FKN+LGIDDP+AA+MH
Sbjct  167   KYGVSKQDEAFNAELCGLYCRFVTSVLPPGAQELKGDEVDXIVSFKNSLGIDDPEAASMH  226

Query  833   MEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVE  1012
             MEIGRRIFRQRLET DR+GDLEQRRAFQKLIYVS +VF DASSFLLPWKR+FKVTD+QVE
Sbjct  227   MEIGRRIFRQRLET-DREGDLEQRRAFQKLIYVSTLVFGDASSFLLPWKRVFKVTDSQVE  285

Query  1013  VAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENI  1192
             +A+RDNAQRLYASKLKSVGRD+  +QLV L+EAQ  Y LSDE AE +F+EH RKLVE NI
Sbjct  286   LAIRDNAQRLYASKLKSVGRDIGAEQLVKLKEAQRIYRLSDEHAEDLFKEHARKLVEANI  345

Query  1193  SRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
             S A+ ILKSRTR+    T V EELDK+L  NNLLISLKNHPDA+RFA
Sbjct  346   SAALRILKSRTRSATGITEVVEELDKMLELNNLLISLKNHPDAARFA  392



>gb|KDO49265.1| hypothetical protein CISIN_1g001822mg [Citrus sinensis]
Length=943

 Score =   444 bits (1143),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 264/408 (65%), Positives = 319/408 (78%), Gaps = 13/408 (3%)
 Frame = +2

Query  116   MNPSLLLSTNPSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpstsiss  295
             MN S LL+T P+ NR  LFSPFL+P+PL      R R+   +        +   +TS S+
Sbjct  1     MNNSSLLTT-PTSNRPLLFSPFLNPSPL----PKRRRFKVSF------PRNRSAATSASA  49

Query  296   sagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFG  475
             SA     A P   +++G ++EL GIQ +VD +SPP+R+A+SA++ AGAV AG+ LG ++G
Sbjct  50    SAEATPTATP-SDNIWGPRKELQGIQPVVDKLSPPVRLATSAVVIAGAVFAGFKLGSKYG  108

Query  476   G-SRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAK  652
             G SRN  +GGA  LGAAG   AYA+NA  PEVAA  LH+YV  C+DP A+K+EDI+AIA 
Sbjct  109   GGSRNVAIGGAAILGAAGGAMAYAMNAAVPEVAAKRLHDYVTDCNDPGAVKREDIEAIAS  168

Query  653   KYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMH  832
             KYGVSKQ EAFNAEL +IYCR+VT+VLPPG EDLRGDEVD I++FK ALGIDDPDAAAMH
Sbjct  169   KYGVSKQDEAFNAELSEIYCRFVTSVLPPGGEDLRGDEVDKIVQFKKALGIDDPDAAAMH  228

Query  833   MEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVE  1012
             +EIGRR+FRQRLE GDRDGD+EQR AFQKLIYVS +VF +ASSFLLPWKR+FKVTD+QVE
Sbjct  229   VEIGRRLFRQRLEVGDRDGDMEQRWAFQKLIYVSTLVFGEASSFLLPWKRVFKVTDSQVE  288

Query  1013  VAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENI  1192
             +A+RDNA+RLYASKLKSVGRDV+ + +V LRE QLSY LSD  AE +FREHTRKLVEENI
Sbjct  289   IAIRDNAKRLYASKLKSVGRDVDAEHIVRLREEQLSYRLSDALAEDLFREHTRKLVEENI  348

Query  1193  SRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
               A+SILKSRTR      +V EELDK+LAFNNLLISL+ HP+A RFAR
Sbjct  349   VTALSILKSRTRVVKGVAQVVEELDKVLAFNNLLISLRQHPNADRFAR  396



>ref|XP_009789255.1| PREDICTED: protein TIC110, chloroplastic, partial [Nicotiana 
sylvestris]
Length=882

 Score =   442 bits (1138),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 217/258 (84%), Positives = 234/258 (91%), Gaps = 0/258 (0%)
 Frame = +2

Query  560   PEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPP  739
             PEVAA+NLHNYVA  +DPAAL KEDIDAIA KYGVSKQ+EAFNAEL DIYCRYV+AV P 
Sbjct  14    PEVAAINLHNYVADFEDPAALNKEDIDAIANKYGVSKQNEAFNAELRDIYCRYVSAVFPT  73

Query  740   GNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQK  919
             G E+LRGDEVDTIIKFKNALGIDDPDAA MHMEIGRRIFRQRLETGDRDGD+EQRRAFQK
Sbjct  74    GTEELRGDEVDTIIKFKNALGIDDPDAADMHMEIGRRIFRQRLETGDRDGDIEQRRAFQK  133

Query  920   LIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKSVGRDVNVDQLVS  1099
             LIYVS +VF +AS+FLLPWKR+FKVTD+QVEVAVRDNAQRLYASKLKSVGRD++V+QLVS
Sbjct  134   LIYVSTLVFGEASAFLLPWKRVFKVTDSQVEVAVRDNAQRLYASKLKSVGRDIDVNQLVS  193

Query  1100  LREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEATRVTEELDKILA  1279
             LREAQL+Y LSDE AE MF+EH RKLVEE IS AV  LKSR RA  EATRV EELDKIL+
Sbjct  194   LREAQLAYRLSDELAEEMFKEHARKLVEECISLAVGSLKSRARATREATRVIEELDKILS  253

Query  1280  FNNLLISLKNHPDASRFA  1333
             FNNLLISLKNH DASRFA
Sbjct  254   FNNLLISLKNHRDASRFA  271



>ref|XP_012081021.1| PREDICTED: protein TIC110, chloroplastic [Jatropha curcas]
 ref|XP_012081022.1| PREDICTED: protein TIC110, chloroplastic [Jatropha curcas]
 ref|XP_012081023.1| PREDICTED: protein TIC110, chloroplastic [Jatropha curcas]
 ref|XP_012081024.1| PREDICTED: protein TIC110, chloroplastic [Jatropha curcas]
 gb|KDP30450.1| hypothetical protein JCGZ_17138 [Jatropha curcas]
Length=1010

 Score =   444 bits (1142),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 243/333 (73%), Positives = 287/333 (86%), Gaps = 0/333 (0%)
 Frame = +2

Query  338   VFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggavalg  517
             VFGGKREL GIQ LV ++SPP+R+ASSAII AG++AAGY LGFRFG S+N  LG A A+G
Sbjct  61    VFGGKRELGGIQPLVANLSPPLRLASSAIILAGSLAAGYALGFRFGKSQNLALGAAAAVG  120

Query  518   aagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAEL  697
              AGA A +A+N+  PEVAA +LHNYVA  DDP  +KKEDI  IAK+YGVSKQ EAFNAEL
Sbjct  121   GAGAAAVFAINSSVPEVAATDLHNYVAALDDPKTVKKEDIQQIAKRYGVSKQDEAFNAEL  180

Query  698   CDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLETG  877
             CD+YCR+V++VLPPG EDL+G+EV+ I  FK+ALGIDDPDAA+MH+EIGRRIFRQRLETG
Sbjct  181   CDLYCRFVSSVLPPGGEDLKGNEVEIISNFKSALGIDDPDAASMHVEIGRRIFRQRLETG  240

Query  878   DRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKL  1057
             DRDGD+EQRRAFQKLIYVS +VF +ASSFLLPWKR+FKVTD+Q+E+A+RDNAQRLYASKL
Sbjct  241   DRDGDVEQRRAFQKLIYVSTLVFGEASSFLLPWKRVFKVTDSQIEIAIRDNAQRLYASKL  300

Query  1058  KSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAPG  1237
             KSV RD++V+QLVSLR+ QL Y LSDE AE +FR+ TRK+VEENIS A+ ILKSRTRA  
Sbjct  301   KSVTRDIDVEQLVSLRQLQLQYRLSDELAEDLFRQQTRKIVEENISTALDILKSRTRAVK  360

Query  1238  EATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
               T+V EEL+KILAFNN LISLKNH D++ FAR
Sbjct  361   GVTQVVEELEKILAFNNKLISLKNHVDSASFAR  393



>gb|KDO49263.1| hypothetical protein CISIN_1g001822mg [Citrus sinensis]
Length=1009

 Score =   444 bits (1142),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 264/408 (65%), Positives = 319/408 (78%), Gaps = 13/408 (3%)
 Frame = +2

Query  116   MNPSLLLSTNPSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpstsiss  295
             MN S LL+T P+ NR  LFSPFL+P+PL      R R+   +        +   +TS S+
Sbjct  1     MNNSSLLTT-PTSNRPLLFSPFLNPSPL----PKRRRFKVSF------PRNRSAATSASA  49

Query  296   sagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFG  475
             SA     A P   +++G ++EL GIQ +VD +SPP+R+A+SA++ AGAV AG+ LG ++G
Sbjct  50    SAEATPTATP-SDNIWGPRKELQGIQPVVDKLSPPVRLATSAVVIAGAVFAGFKLGSKYG  108

Query  476   G-SRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAK  652
             G SRN  +GGA  LGAAG   AYA+NA  PEVAA  LH+YV  C+DP A+K+EDI+AIA 
Sbjct  109   GGSRNVAIGGAAILGAAGGAMAYAMNAAVPEVAAKRLHDYVTDCNDPGAVKREDIEAIAS  168

Query  653   KYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMH  832
             KYGVSKQ EAFNAEL +IYCR+VT+VLPPG EDLRGDEVD I++FK ALGIDDPDAAAMH
Sbjct  169   KYGVSKQDEAFNAELSEIYCRFVTSVLPPGGEDLRGDEVDKIVQFKKALGIDDPDAAAMH  228

Query  833   MEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVE  1012
             +EIGRR+FRQRLE GDRDGD+EQR AFQKLIYVS +VF +ASSFLLPWKR+FKVTD+QVE
Sbjct  229   VEIGRRLFRQRLEVGDRDGDMEQRWAFQKLIYVSTLVFGEASSFLLPWKRVFKVTDSQVE  288

Query  1013  VAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENI  1192
             +A+RDNA+RLYASKLKSVGRDV+ + +V LRE QLSY LSD  AE +FREHTRKLVEENI
Sbjct  289   IAIRDNAKRLYASKLKSVGRDVDAEHIVRLREEQLSYRLSDALAEDLFREHTRKLVEENI  348

Query  1193  SRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
               A+SILKSRTR      +V EELDK+LAFNNLLISL+ HP+A RFAR
Sbjct  349   VTALSILKSRTRVVKGVAQVVEELDKVLAFNNLLISLRQHPNADRFAR  396



>ref|XP_002326080.1| chloroplast inner envelope family protein [Populus trichocarpa]
 gb|EEF00462.1| chloroplast inner envelope family protein [Populus trichocarpa]
Length=1013

 Score =   443 bits (1140),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 265/416 (64%), Positives = 323/416 (78%), Gaps = 31/416 (7%)
 Frame = +2

Query  116   MNPSLLLSTNPSPNRKALFSPFLSPAPLRLTAAS-----RNRYHFRYRIsavssssdqps  280
             MNPSLL S+ PS       +PFLSP PL+LT +S     R+R+   +             
Sbjct  1     MNPSLLASS-PS-------TPFLSPIPLKLTPSSLTLPKRHRFLVSF-------------  39

Query  281   tsisssagtaaaaiPVQPD-VFGGKRELSGIQALVDsmsppiriassaiifagavaaGYG  457
                S++   +   +  +PD VFGGKREL+GIQ +V ++SP +R+ASSAII AGA+AAGYG
Sbjct  40    PRSSAAETPSTVTLESKPDNVFGGKRELTGIQPIVSNLSPTLRLASSAIILAGALAAGYG  99

Query  458   LGFRFGG-SRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKED  634
             LG +FGG SRN  LGGA   GAAG    YALN+  PEVAA+NLHNYV+G DDP  + KE+
Sbjct  100   LGTKFGGGSRNLALGGAAVAGAAGGAVVYALNSAVPEVAAINLHNYVSGFDDPIQVSKEE  159

Query  635   IDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDP  814
             I+ IAKKYGVSKQ EAFNAELCD+Y R+V++VLPPG E+L+G+EV+TII FKNALGIDDP
Sbjct  160   IEGIAKKYGVSKQDEAFNAELCDLYSRFVSSVLPPGGEELKGNEVETIINFKNALGIDDP  219

Query  815   DAAAMHMEIGRRIFRQRLETGDRDGDLEQRRA---FQKLIYVSNIVFRDASSFLLPWKRM  985
             DAA+MH+E+GRRIFRQRLETGDRDGD+EQRRA   FQKLIYVS +VF +ASSFLLPWKR+
Sbjct  220   DAASMHVELGRRIFRQRLETGDRDGDVEQRRAMQAFQKLIYVSTLVFGEASSFLLPWKRV  279

Query  986   FKVTDAQVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREH  1165
             FKVTD+QVE+A+RDNAQRLY+SKLKSVG+D++V+QLVSLR+AQ+S  LSDE AE +FR+ 
Sbjct  280   FKVTDSQVEIAIRDNAQRLYSSKLKSVGKDIDVEQLVSLRQAQISCRLSDELAEDLFRQR  339

Query  1166  TRKLVEENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
             TRKL E+NIS A+  LKSRTR   +  +V EELDKILAFNN LISLKNH DA+ FA
Sbjct  340   TRKLAEKNISAALDRLKSRTRTVQDVVKVVEELDKILAFNNKLISLKNHEDAASFA  395



>ref|XP_002319406.2| chloroplast inner envelope family protein [Populus trichocarpa]
 gb|EEE95329.2| chloroplast inner envelope family protein [Populus trichocarpa]
Length=1011

 Score =   443 bits (1139),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 250/392 (64%), Positives = 311/392 (79%), Gaps = 20/392 (5%)
 Frame = +2

Query  179   FLSPAPLRLTAAS-----RNRYHFRYRIsavssssdqpstsisssagtaaaaiPVQPD-V  340
             FLSP P +LT +S     R+R+   Y                S++   +A  +  +PD +
Sbjct  14    FLSPLPFKLTPSSLTLPKRHRFRVSY-------------PRSSAAEYPSAITLESKPDDL  60

Query  341   FGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGG-SRNaglggavalg  517
             FGGKRELSG Q++V ++SP +R+ASSA+I AGA+AAGYGLG +FGG SRN  LGG    G
Sbjct  61    FGGKRELSGAQSIVSNLSPTLRLASSALILAGALAAGYGLGTKFGGGSRNLALGGGAVAG  120

Query  518   aagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAEL  697
             AA     ++LN+  PE+AA+NLHNYV+G DDP  + KE+I+ IAKKYGVSKQ EAFNAEL
Sbjct  121   AAVGAVVFSLNSAVPEIAAINLHNYVSGFDDPTKVSKEEIEGIAKKYGVSKQDEAFNAEL  180

Query  698   CDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLETG  877
             CD+YC++V++VLPPG E+LRG+EVDTII FKNALG+DDPDAA+MH+E+GRRIFRQRLETG
Sbjct  181   CDLYCQFVSSVLPPGGEELRGNEVDTIINFKNALGMDDPDAASMHVELGRRIFRQRLETG  240

Query  878   DRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKL  1057
             D DGD+EQRRAFQKLIYVS +VF +ASSFLLPWKR+FKVTD+QVE+A+RDNAQRLY SKL
Sbjct  241   DPDGDVEQRRAFQKLIYVSTLVFGEASSFLLPWKRVFKVTDSQVEIAIRDNAQRLYTSKL  300

Query  1058  KSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAPG  1237
             KSVG+D++V+QLV+LR+AQ+SY LSD+ AE +FR+HTRKL+EENIS A+  LKSRTR   
Sbjct  301   KSVGKDIDVEQLVNLRQAQISYQLSDKLAEDLFRQHTRKLIEENISAALDRLKSRTRTVQ  360

Query  1238  EATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
             +  +V EELDKILAFNN LISLKNH DA+ FA
Sbjct  361   DVVKVVEELDKILAFNNKLISLKNHTDAASFA  392



>gb|KDO49262.1| hypothetical protein CISIN_1g001822mg [Citrus sinensis]
Length=1009

 Score =   443 bits (1139),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 263/408 (64%), Positives = 319/408 (78%), Gaps = 13/408 (3%)
 Frame = +2

Query  116   MNPSLLLSTNPSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpstsiss  295
             MN S LL+T P+ NR  LFSPFL+P+PL      R R+   +        +   +TS S+
Sbjct  1     MNNSSLLTT-PTSNRPLLFSPFLNPSPL----PKRRRFKVSF------PRNRSAATSASA  49

Query  296   sagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFG  475
             SA     A P   +++G ++EL GIQ +VD +SPP+R+A+SA++ AGAV AG+ LG ++G
Sbjct  50    SAEATPTATP-SDNIWGPRKELQGIQPVVDKLSPPVRLATSAVVIAGAVFAGFKLGSKYG  108

Query  476   G-SRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAK  652
             G SRN  +GGA  LGAAG   AYA+NA  PEVAA  LH+YV  C+DP A+K+EDI+AIA 
Sbjct  109   GGSRNVAIGGAAILGAAGGAMAYAMNAAVPEVAAKRLHDYVTDCNDPGAVKREDIEAIAS  168

Query  653   KYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMH  832
             KYGVSKQ EAFNAEL +IYCR+VT+VLPPG EDLRGDEVD I++FK ALGIDDPDAAAMH
Sbjct  169   KYGVSKQDEAFNAELSEIYCRFVTSVLPPGGEDLRGDEVDKIVQFKKALGIDDPDAAAMH  228

Query  833   MEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVE  1012
             +EIGRR+FRQRLE GDRDGD+EQ +AFQKLIYVS +VF +ASSFLLPWKR+FKVTD+QVE
Sbjct  229   VEIGRRLFRQRLEVGDRDGDMEQLQAFQKLIYVSTLVFGEASSFLLPWKRVFKVTDSQVE  288

Query  1013  VAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENI  1192
             +A+RDNA+RLYASKLKSVGRDV+ + +V LRE QLSY LSD  AE +FREHTRKLVEENI
Sbjct  289   IAIRDNAKRLYASKLKSVGRDVDAEHIVRLREEQLSYRLSDALAEDLFREHTRKLVEENI  348

Query  1193  SRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
               A+SILKSRTR      +V EELDK+LAFNNLLISL+ HP+A RFAR
Sbjct  349   VTALSILKSRTRVVKGVAQVVEELDKVLAFNNLLISLRQHPNADRFAR  396



>ref|XP_008457310.1| PREDICTED: protein TIC110, chloroplastic isoform X2 [Cucumis 
melo]
Length=1018

 Score =   442 bits (1136),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 249/333 (75%), Positives = 291/333 (87%), Gaps = 0/333 (0%)
 Frame = +2

Query  335   DVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggaval  514
             D+FGGK+EL+GIQ +V  + PP+R+A+SAI+ AGAVAAGYGLG RFG SRNA LGGA AL
Sbjct  69    DIFGGKKELTGIQPIVHLLPPPLRLATSAIVVAGAVAAGYGLGLRFGKSRNAALGGAAAL  128

Query  515   gaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAE  694
              AA   A Y+LN+C PEVAAV+LHNYVAG DDP  +KKE+I++IA KYGVSKQ EAFNAE
Sbjct  129   AAASGAAVYSLNSCVPEVAAVDLHNYVAGFDDPKNVKKEEIESIATKYGVSKQDEAFNAE  188

Query  695   LCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLET  874
             LCD+YCR+V++VLP G++DL GDEVDTIIKFK+ALGIDDPDAAAMHMEIGRRIFRQRLET
Sbjct  189   LCDLYCRFVSSVLPSGSQDLSGDEVDTIIKFKSALGIDDPDAAAMHMEIGRRIFRQRLET  248

Query  875   GDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASK  1054
             GDRDGDLE+RRAFQKLIYVS +VF DASSFLLPWKR+FKVTD+QVE+A+RDNAQRLY S+
Sbjct  249   GDRDGDLEERRAFQKLIYVSTLVFGDASSFLLPWKRVFKVTDSQVEIAIRDNAQRLYISE  308

Query  1055  LKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAP  1234
             LKSVGRD+N ++L+SL+ AQ  Y LSDE A+ +F+EHTRKLVEENIS A++ILKSRTR  
Sbjct  309   LKSVGRDLNAEKLISLKGAQRLYRLSDELADDLFKEHTRKLVEENISVALNILKSRTRTA  368

Query  1235  GEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
                  V EELDKIL FN+LLISLKNHPDA+RFA
Sbjct  369   RGVIEVVEELDKILEFNSLLISLKNHPDANRFA  401



>ref|XP_008457309.1| PREDICTED: protein TIC110, chloroplastic isoform X1 [Cucumis 
melo]
Length=1018

 Score =   441 bits (1135),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 248/333 (74%), Positives = 291/333 (87%), Gaps = 0/333 (0%)
 Frame = +2

Query  335   DVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggaval  514
             D+FGGK+EL+GIQ +V  + PP+R+A+SAI+ AGAVAAGYGLG RFG SRNA LGGA AL
Sbjct  69    DIFGGKKELTGIQPIVHLLPPPLRLATSAIVVAGAVAAGYGLGLRFGKSRNAALGGAAAL  128

Query  515   gaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAE  694
              AA   A Y+LN+C PEVAAV+LHNYVAG DDP  +KKE+I++IA KYGVSKQ EAFNAE
Sbjct  129   AAASGAAVYSLNSCVPEVAAVDLHNYVAGFDDPKNVKKEEIESIATKYGVSKQDEAFNAE  188

Query  695   LCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLET  874
             LCD+YCR+V++VLP G++DL GDEVDTIIKFK+ALGIDDPDAAAMHMEIGRRIFRQRLET
Sbjct  189   LCDLYCRFVSSVLPSGSQDLSGDEVDTIIKFKSALGIDDPDAAAMHMEIGRRIFRQRLET  248

Query  875   GDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASK  1054
             GDRDGDLE+RRAFQKLIYVS +VF DASSFLLPWKR+FKVTD+Q+E+A+RDNAQRLY S+
Sbjct  249   GDRDGDLEERRAFQKLIYVSTLVFGDASSFLLPWKRVFKVTDSQIEIAIRDNAQRLYISE  308

Query  1055  LKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAP  1234
             LKSVGRD+N ++L+SL+ AQ  Y LSDE A+ +F+EHTRKLVEENIS A++ILKSRTR  
Sbjct  309   LKSVGRDLNAEKLISLKGAQRLYRLSDELADDLFKEHTRKLVEENISVALNILKSRTRTA  368

Query  1235  GEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
                  V EELDKIL FN+LLISLKNHPDA+RFA
Sbjct  369   RGVIEVVEELDKILEFNSLLISLKNHPDANRFA  401



>ref|XP_007017042.1| Translocon at the inner envelope membrane of chloroplasts 110 
isoform 2 [Theobroma cacao]
 gb|EOY34661.1| Translocon at the inner envelope membrane of chloroplasts 110 
isoform 2 [Theobroma cacao]
Length=1015

 Score =   439 bits (1130),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 273/409 (67%), Positives = 322/409 (79%), Gaps = 8/409 (2%)
 Frame = +2

Query  116   MNPSLLLSTNPSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsa-vssssdqpstsis  292
             MNPSLL  T P  +R     P +S  P  LT  S  R   RYR+S   +S S    + +S
Sbjct  1     MNPSLL--TAPPSSRPC---PLVSFPPFGLTPNSLPRRR-RYRVSFPRNSISTDDQSPMS  54

Query  293   ssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRF  472
             +S+    A  P  PD+FGG +EL+GIQ +V+ +SPP+R+A+S +I AGA+AAGYG+G R 
Sbjct  55    TSSTETTATTPTAPDIFGGPKELTGIQPVVEKLSPPLRVATSVVILAGALAAGYGIGLRL  114

Query  473   GGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAK  652
             GG+RNA LGGA  LGAAGA AAYA+NA  PEVAAV+LHNYVAGCD P A++KEDI+ IA+
Sbjct  115   GGNRNAALGGAAILGAAGAAAAYAVNAAVPEVAAVSLHNYVAGCDGPEAVRKEDIENIAQ  174

Query  653   KYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMH  832
             KYGVSKQ +AFN ELCD+Y  + ++VLP G+EDLRGDEV+TII FKNALGIDDPDAA+MH
Sbjct  175   KYGVSKQDDAFNLELCDLYSLFASSVLPSGSEDLRGDEVETIISFKNALGIDDPDAASMH  234

Query  833   MEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDA-QV  1009
             MEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVS +VF DAS+FLLPWKR+FKVTDA QV
Sbjct  235   MEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSTLVFGDASNFLLPWKRVFKVTDAQQV  294

Query  1010  EVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEEN  1189
             E+A+RDNA++LYASKL SVGRDV+V  LVSLREAQL Y LSDE A+ +  EH RKLVEEN
Sbjct  295   EIAIRDNAKQLYASKLSSVGRDVDVKLLVSLREAQLKYKLSDELAKDLLMEHKRKLVEEN  354

Query  1190  ISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             IS A++ILKSRTR  G   +  EELDKILAFN+LL SL NHPDA  FAR
Sbjct  355   ISVALNILKSRTRTVGGVKQAVEELDKILAFNDLLTSLSNHPDADHFAR  403



>ref|XP_011021014.1| PREDICTED: LOW QUALITY PROTEIN: protein TIC110, chloroplastic-like 
[Populus euphratica]
Length=1004

 Score =   439 bits (1128),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 247/394 (63%), Positives = 309/394 (78%), Gaps = 20/394 (5%)
 Frame = +2

Query  173   SPFLSPAPLRLTAAS-----RNRYHFRYRIsavssssdqpstsisssagtaaaaiPVQPD  337
             + FLSP P +LT +S     R+R+   Y                S++   +A  +  +PD
Sbjct  12    ASFLSPLPFKLTPSSLTLPKRHRFRVSY-------------PRSSAAEYPSAITLESKPD  58

Query  338   -VFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGG-SRNaglggava  511
              +FGGKRELSG Q++V ++SP +R+ASSA+I AGA+AAGYGLG +FGG SRN  LGGA  
Sbjct  59    DLFGGKRELSGAQSIVSNLSPTLRLASSAVILAGALAAGYGLGIKFGGGSRNLNLGGAAV  118

Query  512   lgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNA  691
              GAA     ++LN+  PE+AA+NLHNYV+G DDP  + KE+I+ IAKKYGVSKQ EAFN 
Sbjct  119   AGAASGAVVFSLNSAVPEIAAINLHNYVSGFDDPTKVSKEEIEGIAKKYGVSKQDEAFNG  178

Query  692   ELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLE  871
             ELCD+YC++V++VLPPG E+LRG+EVDTII FKNALG+DD DAA+MH+E+GRRIFRQRLE
Sbjct  179   ELCDLYCQFVSSVLPPGGEELRGNEVDTIINFKNALGMDDSDAASMHVELGRRIFRQRLE  238

Query  872   TGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYAS  1051
             TGD DGD+EQRRAFQKLIYVS +VF +ASSFLLPWKR+FKVTD+QVE+A+RDNAQRLY S
Sbjct  239   TGDPDGDVEQRRAFQKLIYVSTLVFGEASSFLLPWKRVFKVTDSQVEIAIRDNAQRLYTS  298

Query  1052  KLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRA  1231
             KLKSVG+D++V+QLV+LR+AQ+SY LSD+ AE +FR+HTRKL+EENIS A+  LKSRTR 
Sbjct  299   KLKSVGKDIDVEQLVNLRQAQISYRLSDKLAEDLFRQHTRKLIEENISAALDRLKSRTRT  358

Query  1232  PGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
               +  +V EELDK LAFNN LISLKNH D + FA
Sbjct  359   VQDVVKVVEELDKTLAFNNKLISLKNHTDTASFA  392



>ref|XP_004145231.1| PREDICTED: protein TIC110, chloroplastic [Cucumis sativus]
 gb|KGN65859.1| hypothetical protein Csa_1G533660 [Cucumis sativus]
Length=1014

 Score =   439 bits (1128),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 271/409 (66%), Positives = 321/409 (78%), Gaps = 13/409 (3%)
 Frame = +2

Query  116   MNPSLLLSTNPSPNRKALFSPFLSPAPLRLTAASRN---RYHFRYRIsavssssdqpsts  286
             MNPS LL+++ S NR +  S +L       T A+ N   R HFR  I   SS   Q   S
Sbjct  1     MNPSTLLASHFSNNRFST-SSYLLNPLPLPTPANFNLSRRRHFRVSIPRASSEVAQQDVS  59

Query  287   isssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGF  466
              SS +           D+FGGK+EL+G+Q +V  + PP+R+A+SAI+ AGAVAAGYGLG 
Sbjct  60    SSSPSSL---------DIFGGKKELTGLQPIVHLLPPPLRLATSAIVVAGAVAAGYGLGL  110

Query  467   RFGGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAI  646
             RFG S NA LGGA AL AA   A Y+ N+C PEVAAV+LHNYVAG DDP  +K E+I++I
Sbjct  111   RFGKSSNAALGGAAALAAASGAAVYSFNSCVPEVAAVDLHNYVAGFDDPKNVKNEEIESI  170

Query  647   AKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAA  826
             A KYGVSKQ EAFNAELCD+YCR+V++VLP G++DL GDEVDTIIKFK+ALGIDDPDAAA
Sbjct  171   ATKYGVSKQDEAFNAELCDLYCRFVSSVLPSGSQDLSGDEVDTIIKFKSALGIDDPDAAA  230

Query  827   MHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQ  1006
             MHMEIGRRIFRQRLETGDRDGDLE+RRAFQKLIYVS +VF DASSFLLPWKR+FKVTD+Q
Sbjct  231   MHMEIGRRIFRQRLETGDRDGDLEERRAFQKLIYVSTLVFGDASSFLLPWKRVFKVTDSQ  290

Query  1007  VEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEE  1186
             VE+A+RDNAQRLY S+LKSVGRD+N ++L+SL++AQ  Y LSDE A  +F+EHTRKLVEE
Sbjct  291   VEIAIRDNAQRLYISELKSVGRDLNAEKLISLKDAQRLYRLSDELAGDLFKEHTRKLVEE  350

Query  1187  NISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
             NIS A++ILKSRTRA      V EELDKIL FN+LLISLKNHPDA+RFA
Sbjct  351   NISVALNILKSRTRAVRGVIEVVEELDKILEFNSLLISLKNHPDANRFA  399



>gb|KJB20493.1| hypothetical protein B456_003G151500 [Gossypium raimondii]
Length=987

 Score =   438 bits (1126),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 243/334 (73%), Positives = 284/334 (85%), Gaps = 0/334 (0%)
 Frame = +2

Query  332   PDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggava  511
             P++FGG +EL+GIQ LV ++SPP+R+A+SA+I AGA+AAGYGLG RFGG+RNA  GGA  
Sbjct  59    PNIFGGPKELTGIQPLVQNLSPPVRLATSAVILAGALAAGYGLGLRFGGNRNAAFGGAAV  118

Query  512   lgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNA  691
             LGAAG  A YA+NA  PEVAAV LHNYVA  D P A+K+EDI+ IA+KYGVSKQ EAFN 
Sbjct  119   LGAAGGAAVYAVNAAVPEVAAVTLHNYVAAYDSPDAIKREDIENIAQKYGVSKQDEAFNM  178

Query  692   ELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLE  871
             ELCD+YCR+V++VL  G+EDLRGDEV+TII FKNALGIDDPDAA+MHMEIGRRIFRQRLE
Sbjct  179   ELCDLYCRFVSSVLSSGSEDLRGDEVETIISFKNALGIDDPDAASMHMEIGRRIFRQRLE  238

Query  872   TGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYAS  1051
             TGDRDGDLEQRRAFQ+LIYVS +VF DAS+FLLPWKR+FKVTDAQVE+A+RDNA++LYAS
Sbjct  239   TGDRDGDLEQRRAFQRLIYVSTLVFGDASTFLLPWKRVFKVTDAQVEIAIRDNAKQLYAS  298

Query  1052  KLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRA  1231
             KL SVGRDV  + LVSLR+AQL Y LSDE A+ +  EH RKLVEENIS A++ILKSR R 
Sbjct  299   KLTSVGRDVGEELLVSLRKAQLKYKLSDELAKDLLMEHKRKLVEENISVALNILKSRART  358

Query  1232  PGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
              G   +  EELDKIL+FN+LLISL  HPDA RFA
Sbjct  359   VGGVKQAVEELDKILSFNDLLISLSKHPDADRFA  392



>ref|XP_007017041.1| Translocon at the inner envelope membrane of chloroplasts 110 
isoform 1 [Theobroma cacao]
 gb|EOY34660.1| Translocon at the inner envelope membrane of chloroplasts 110 
isoform 1 [Theobroma cacao]
Length=1261

 Score =   444 bits (1142),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 273/408 (67%), Positives = 322/408 (79%), Gaps = 7/408 (2%)
 Frame = +2

Query  116   MNPSLLLSTNPSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsa-vssssdqpstsis  292
             MNPSLL  T P  +R     P +S  P  LT  S  R   RYR+S   +S S    + +S
Sbjct  1     MNPSLL--TAPPSSRPC---PLVSFPPFGLTPNSLPRRR-RYRVSFPRNSISTDDQSPMS  54

Query  293   ssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRF  472
             +S+    A  P  PD+FGG +EL+GIQ +V+ +SPP+R+A+S +I AGA+AAGYG+G R 
Sbjct  55    TSSTETTATTPTAPDIFGGPKELTGIQPVVEKLSPPLRVATSVVILAGALAAGYGIGLRL  114

Query  473   GGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAK  652
             GG+RNA LGGA  LGAAGA AAYA+NA  PEVAAV+LHNYVAGCD P A++KEDI+ IA+
Sbjct  115   GGNRNAALGGAAILGAAGAAAAYAVNAAVPEVAAVSLHNYVAGCDGPEAVRKEDIENIAQ  174

Query  653   KYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMH  832
             KYGVSKQ +AFN ELCD+Y  + ++VLP G+EDLRGDEV+TII FKNALGIDDPDAA+MH
Sbjct  175   KYGVSKQDDAFNLELCDLYSLFASSVLPSGSEDLRGDEVETIISFKNALGIDDPDAASMH  234

Query  833   MEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVE  1012
             MEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVS +VF DAS+FLLPWKR+FKVTDAQVE
Sbjct  235   MEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSTLVFGDASNFLLPWKRVFKVTDAQVE  294

Query  1013  VAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENI  1192
             +A+RDNA++LYASKL SVGRDV+V  LVSLREAQL Y LSDE A+ +  EH RKLVEENI
Sbjct  295   IAIRDNAKQLYASKLSSVGRDVDVKLLVSLREAQLKYKLSDELAKDLLMEHKRKLVEENI  354

Query  1193  SRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             S A++ILKSRTR  G   +  EELDKILAFN+LL SL NHPDA  FAR
Sbjct  355   SVALNILKSRTRTVGGVKQAVEELDKILAFNDLLTSLSNHPDADHFAR  402



>gb|KJB20492.1| hypothetical protein B456_003G151500 [Gossypium raimondii]
Length=978

 Score =   437 bits (1124),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 243/334 (73%), Positives = 284/334 (85%), Gaps = 0/334 (0%)
 Frame = +2

Query  332   PDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggava  511
             P++FGG +EL+GIQ LV ++SPP+R+A+SA+I AGA+AAGYGLG RFGG+RNA  GGA  
Sbjct  59    PNIFGGPKELTGIQPLVQNLSPPVRLATSAVILAGALAAGYGLGLRFGGNRNAAFGGAAV  118

Query  512   lgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNA  691
             LGAAG  A YA+NA  PEVAAV LHNYVA  D P A+K+EDI+ IA+KYGVSKQ EAFN 
Sbjct  119   LGAAGGAAVYAVNAAVPEVAAVTLHNYVAAYDSPDAIKREDIENIAQKYGVSKQDEAFNM  178

Query  692   ELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLE  871
             ELCD+YCR+V++VL  G+EDLRGDEV+TII FKNALGIDDPDAA+MHMEIGRRIFRQRLE
Sbjct  179   ELCDLYCRFVSSVLSSGSEDLRGDEVETIISFKNALGIDDPDAASMHMEIGRRIFRQRLE  238

Query  872   TGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYAS  1051
             TGDRDGDLEQRRAFQ+LIYVS +VF DAS+FLLPWKR+FKVTDAQVE+A+RDNA++LYAS
Sbjct  239   TGDRDGDLEQRRAFQRLIYVSTLVFGDASTFLLPWKRVFKVTDAQVEIAIRDNAKQLYAS  298

Query  1052  KLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRA  1231
             KL SVGRDV  + LVSLR+AQL Y LSDE A+ +  EH RKLVEENIS A++ILKSR R 
Sbjct  299   KLTSVGRDVGEELLVSLRKAQLKYKLSDELAKDLLMEHKRKLVEENISVALNILKSRART  358

Query  1232  PGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
              G   +  EELDKIL+FN+LLISL  HPDA RFA
Sbjct  359   VGGVKQAVEELDKILSFNDLLISLSKHPDADRFA  392



>gb|KHG09192.1| chloroplast protein [Gossypium arboreum]
Length=1005

 Score =   437 bits (1125),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 242/333 (73%), Positives = 282/333 (85%), Gaps = 0/333 (0%)
 Frame = +2

Query  335   DVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggaval  514
             ++FGG +EL+GIQ LV  +SPP+R+A+SA+I AGA+AAGYGLG RFGG+RNA  GGA  L
Sbjct  60    NIFGGPKELTGIQPLVQDLSPPVRLATSAVILAGALAAGYGLGLRFGGNRNAAFGGAAVL  119

Query  515   gaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAE  694
             GAAG  A YA+NA  PEVAAV LHNYVA CD P A+K+EDI+ IA+KYGVSKQ EAFN E
Sbjct  120   GAAGGAAIYAVNAAVPEVAAVTLHNYVAACDSPDAIKREDIENIAQKYGVSKQDEAFNME  179

Query  695   LCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLET  874
             LCD+YCR+V++VL  G+EDLRGDEV+TII FKNALGIDDPDAA+MHMEIGRRIFRQRLET
Sbjct  180   LCDLYCRFVSSVLSSGSEDLRGDEVETIISFKNALGIDDPDAASMHMEIGRRIFRQRLET  239

Query  875   GDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASK  1054
             GDRDGDLEQRRAFQ+LIYVS +VF DAS+FLLPWKR+FKVTDAQVE+A+RDNA++LYASK
Sbjct  240   GDRDGDLEQRRAFQRLIYVSTLVFGDASTFLLPWKRVFKVTDAQVEIAIRDNAKQLYASK  299

Query  1055  LKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAP  1234
             L SVGRDV  + LVSLR+AQL Y LSDE A+ +  EH RKLVEENIS A++ILKSR R  
Sbjct  300   LTSVGRDVGEELLVSLRKAQLQYKLSDELAKDLLMEHKRKLVEENISVALNILKSRARTV  359

Query  1235  GEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
             G   +  EELDKIL+FN+LLISL  HPDA  FA
Sbjct  360   GGVKQAVEELDKILSFNDLLISLSKHPDADHFA  392



>gb|KJB20491.1| hypothetical protein B456_003G151500 [Gossypium raimondii]
Length=1005

 Score =   437 bits (1125),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 243/334 (73%), Positives = 284/334 (85%), Gaps = 0/334 (0%)
 Frame = +2

Query  332   PDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggava  511
             P++FGG +EL+GIQ LV ++SPP+R+A+SA+I AGA+AAGYGLG RFGG+RNA  GGA  
Sbjct  59    PNIFGGPKELTGIQPLVQNLSPPVRLATSAVILAGALAAGYGLGLRFGGNRNAAFGGAAV  118

Query  512   lgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNA  691
             LGAAG  A YA+NA  PEVAAV LHNYVA  D P A+K+EDI+ IA+KYGVSKQ EAFN 
Sbjct  119   LGAAGGAAVYAVNAAVPEVAAVTLHNYVAAYDSPDAIKREDIENIAQKYGVSKQDEAFNM  178

Query  692   ELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLE  871
             ELCD+YCR+V++VL  G+EDLRGDEV+TII FKNALGIDDPDAA+MHMEIGRRIFRQRLE
Sbjct  179   ELCDLYCRFVSSVLSSGSEDLRGDEVETIISFKNALGIDDPDAASMHMEIGRRIFRQRLE  238

Query  872   TGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYAS  1051
             TGDRDGDLEQRRAFQ+LIYVS +VF DAS+FLLPWKR+FKVTDAQVE+A+RDNA++LYAS
Sbjct  239   TGDRDGDLEQRRAFQRLIYVSTLVFGDASTFLLPWKRVFKVTDAQVEIAIRDNAKQLYAS  298

Query  1052  KLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRA  1231
             KL SVGRDV  + LVSLR+AQL Y LSDE A+ +  EH RKLVEENIS A++ILKSR R 
Sbjct  299   KLTSVGRDVGEELLVSLRKAQLKYKLSDELAKDLLMEHKRKLVEENISVALNILKSRART  358

Query  1232  PGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
              G   +  EELDKIL+FN+LLISL  HPDA RFA
Sbjct  359   VGGVKQAVEELDKILSFNDLLISLSKHPDADRFA  392



>ref|XP_010277701.1| PREDICTED: protein TIC110, chloroplastic-like [Nelumbo nucifera]
Length=1082

 Score =   439 bits (1129),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 265/392 (68%), Positives = 309/392 (79%), Gaps = 10/392 (3%)
 Frame = +2

Query  158   RKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpstsisssagtaaaaiPVQPD  337
             R  LFS F++P  L    +S      RYR           S   SS+A  A  +  +   
Sbjct  89    RHVLFSHFINPYSLPSKTSSSLYRKRRYR----------ASLVRSSAADPAEVSQSISSS  138

Query  338   VFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggavalg  517
             VFGGK+ELSG+Q LVD +SP +R+ASS +I AGA+AAGYGLG R GG+RN GLGGA+ALG
Sbjct  139   VFGGKKELSGVQLLVDGLSPSVRLASSVVIVAGALAAGYGLGNRIGGTRNTGLGGAIALG  198

Query  518   aagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAEL  697
             AAG  AAYALN+C PEVAAVNLH +VAG DDP ALKKEDI+ IAKKYGVSKQ EAFNAEL
Sbjct  199   AAGGTAAYALNSCIPEVAAVNLHTFVAGHDDPGALKKEDIEGIAKKYGVSKQDEAFNAEL  258

Query  698   CDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLETG  877
             C +Y R+V++VLPPG E+L+G+EV+TIIKFK+ALGIDDPDAAA+HMEIGR IFRQRLETG
Sbjct  259   CYLYSRFVSSVLPPGGENLKGNEVETIIKFKSALGIDDPDAAAVHMEIGRYIFRQRLETG  318

Query  878   DRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKL  1057
             DRD D+EQRRAFQKLIYVS +VF +AS+FLLPWKR+FKVTDAQVEVA+RDNAQRLY SKL
Sbjct  319   DRDADIEQRRAFQKLIYVSTLVFGEASTFLLPWKRVFKVTDAQVEVAIRDNAQRLYLSKL  378

Query  1058  KSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAPG  1237
             +SVG D++  QL SLREAQ  Y LSDE A  MFR+HTRK+VE N+SRA+ ILKSRTRA  
Sbjct  379   ESVGSDIDEKQLRSLREAQFLYRLSDELAIDMFRDHTRKIVEGNLSRALEILKSRTRAVK  438

Query  1238  EATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
              AT++ EELDKIL FNNLL+SL NH DA  FA
Sbjct  439   GATQIVEELDKILEFNNLLMSLSNHSDAGCFA  470



>ref|XP_010045404.1| PREDICTED: protein TIC110, chloroplastic-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW87567.1| hypothetical protein EUGRSUZ_B04013 [Eucalyptus grandis]
Length=1008

 Score =   435 bits (1119),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 242/337 (72%), Positives = 287/337 (85%), Gaps = 0/337 (0%)
 Frame = +2

Query  323   PVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglgg  502
             P   DVFGG +EL+GIQ LV ++SPP+R+A+SAI  A AVAAGY LG RFGGSRNA +GG
Sbjct  61    PRDSDVFGGPKELTGIQPLVRNLSPPVRLAASAIAVAAAVAAGYHLGSRFGGSRNAAIGG  120

Query  503   avalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEA  682
             A  LGAAG  AAYA+ AC PEVAA +LHNYVA CDDP A+KKEDI+ IA KYGVSKQ  A
Sbjct  121   AALLGAAGGAAAYAVKACVPEVAAADLHNYVASCDDPQAVKKEDIELIASKYGVSKQDAA  180

Query  683   FNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQ  862
             FNAELCD+Y R+V++VLPPGNE+L+G EVD I+KF++ALGIDDP+AAAMHMEIGRRIFRQ
Sbjct  181   FNAELCDLYLRFVSSVLPPGNEELKGTEVDKIVKFRSALGIDDPEAAAMHMEIGRRIFRQ  240

Query  863   RLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRL  1042
             RLETGDR+ ++EQRRAFQKLIYVS +VF +AS+FLLPWKR+FKVTDAQVEVAVRDNAQRL
Sbjct  241   RLETGDREDNVEQRRAFQKLIYVSTLVFGEASTFLLPWKRVFKVTDAQVEVAVRDNAQRL  300

Query  1043  YASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSR  1222
             Y+S+LK++GRD+N +QL SLR AQL Y LSDE AE +F+EHTRKLVEEN+S A+++LKSR
Sbjct  301   YSSRLKAIGRDLNENQLESLRAAQLMYRLSDELAEDLFKEHTRKLVEENVSAALNVLKSR  360

Query  1223  TRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
             TR+     +  EELDKILAFNNLL+S KNHP+A   A
Sbjct  361   TRSARGVAQAVEELDKILAFNNLLVSFKNHPNADGLA  397



>ref|XP_010523146.1| PREDICTED: LOW QUALITY PROTEIN: protein TIC110, chloroplastic 
[Tarenaya hassleriana]
Length=1049

 Score =   431 bits (1107),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 231/334 (69%), Positives = 269/334 (81%), Gaps = 14/334 (4%)
 Frame = +2

Query  335   DVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggaval  514
             D  G K+ELSGIQ +V+ M+PP+R+               G   RFGGS+N  LGGA   
Sbjct  114   DAIGSKKELSGIQPVVEKMTPPVRL--------------XGRVIRFGGSKNVALGGAALG  159

Query  515   gaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAE  694
             GAAG    YALN+  PEVAA++LHNYVAG DDP A+ KEDI+ IA KYGVSKQ EAFNAE
Sbjct  160   GAAGGAVVYALNSAVPEVAAISLHNYVAGFDDPGAVTKEDIERIANKYGVSKQDEAFNAE  219

Query  695   LCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLET  874
             +CDIYC+YVT+VLP G + L+GDEV+ I+KFKNALGIDDPDAAAMHMEIGRRIFRQRLET
Sbjct  220   ICDIYCQYVTSVLPSGGQSLKGDEVEKIVKFKNALGIDDPDAAAMHMEIGRRIFRQRLET  279

Query  875   GDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASK  1054
             GDRDGD EQRRAF KLIYVS++VF DASSFLLPWKR+ KVTDAQVE+A+RDNA+ LYA K
Sbjct  280   GDRDGDAEQRRAFMKLIYVSSLVFGDASSFLLPWKRVLKVTDAQVEIAIRDNAKLLYAEK  339

Query  1055  LKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAP  1234
             LKSV RD++ ++L+SLREAQLS+ L+DE AE +FREHTRKLVEENIS A++ILKSR RA 
Sbjct  340   LKSVSRDIDTEKLISLREAQLSFKLNDELAEDLFREHTRKLVEENISSALTILKSRARAA  399

Query  1235  GEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
                T   EELDKILAFN+LL+SLKNHP+A RFAR
Sbjct  400   KGITPAVEELDKILAFNDLLVSLKNHPEADRFAR  433



>emb|CDY15593.1| BnaA08g28770D [Brassica napus]
Length=1013

 Score =   427 bits (1099),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 239/411 (58%), Positives = 310/411 (75%), Gaps = 15/411 (4%)
 Frame = +2

Query  116   MNPSLLLSTN----PSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpst  283
             MNPSL+ + N    PSP R  L   FL+P+PLRL+  S++    RYR+S    ++     
Sbjct  1     MNPSLITAVNAPISPSP-RSPLLCHFLTPSPLRLSQ-SQSPSRRRYRVSFPRCAATSSEQ  58

Query  284   sisssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLG  463
              + S+          + DV G K+EL+G+Q +V+ M+PP+R+A+SA++ A  +A+GYGLG
Sbjct  59    PLVSTK---------KSDVHGNKKELTGLQPIVEKMTPPVRLATSAVVLAATLASGYGLG  109

Query  464   FRFGGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDA  643
              R  GSRN  LG A   GAAG    YA+N+  PEVAA+ LHNYVA  +DPA++ K+DI+ 
Sbjct  110   LRLAGSRNIALGAAAVAGAAGGAVVYAMNSAVPEVAAIGLHNYVAEIEDPASVTKDDIEK  169

Query  644   IAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAA  823
             IA +YGV+K  EAF AE+CDIYCRYVT+VLP   + L+GDEV+ I+KFK+ALGIDDPDAA
Sbjct  170   IASRYGVNKGDEAFQAEICDIYCRYVTSVLPAEGQSLKGDEVEKIVKFKSALGIDDPDAA  229

Query  824   AMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDA  1003
             +MHMEIGRRIFRQRLETG+R+GD EQRRAF +L+YVS +VF DA+SFLLPWKR+ KVTDA
Sbjct  230   SMHMEIGRRIFRQRLETGEREGDAEQRRAFMRLVYVSALVFGDAASFLLPWKRVLKVTDA  289

Query  1004  QVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVE  1183
             QVE+A+R+NA++LYA KLK VGRD+NV+ LV LR+AQLS+ LSDE AE +FREHTR +  
Sbjct  290   QVEIAIRENAKQLYAEKLKLVGRDINVENLVDLRKAQLSFKLSDELAEDLFREHTRTVAI  349

Query  1184  ENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             ENIS A+S+LKSRTRA    + V EEL+K+L FNNLL+SLK+H +A +FAR
Sbjct  350   ENISSALSVLKSRTRAVKSMSLVVEELEKVLEFNNLLVSLKSHSEADQFAR  400



>ref|XP_006417864.1| hypothetical protein EUTSA_v10006671mg [Eutrema salsugineum]
 gb|ESQ36217.1| hypothetical protein EUTSA_v10006671mg [Eutrema salsugineum]
Length=1010

 Score =   427 bits (1098),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 246/410 (60%), Positives = 313/410 (76%), Gaps = 16/410 (4%)
 Frame = +2

Query  116   MNPSLLLSTNP--SPN-RKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpsts  286
             MNPSL+ S N   SP+ R  L   FL+P PLR    S+NR   RYR+S    ++      
Sbjct  1     MNPSLITSINAPISPSTRSPLLCHFLTPLPLRF---SKNR---RYRVSFPRCAATSSDLP  54

Query  287   isssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGF  466
             + S           +PDV+G K+EL+G+Q++V+ M+PP+R+A+SA++ A ++AAGYGLG 
Sbjct  55    LVSEQAK-------KPDVYGNKKELTGLQSIVEKMTPPVRLATSAVVLAASLAAGYGLGL  107

Query  467   RFGGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAI  646
             RF GSRN  LGGA   GAAG G  YALN+  PEVAA +LHN+VA  +DPA++ KEDI+ I
Sbjct  108   RFSGSRNIALGGAAVAGAAGGGLVYALNSAVPEVAATSLHNFVAEFEDPASVTKEDIERI  167

Query  647   AKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAA  826
             A +YGV+K  EAF AE+CDIYCRYVT+VLP   + L+GDEV+ I+KFKNALGIDDPDAA+
Sbjct  168   ADRYGVNKGDEAFLAEICDIYCRYVTSVLPTEGQSLKGDEVEKIVKFKNALGIDDPDAAS  227

Query  827   MHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQ  1006
             MHMEIGRRIFRQRLETG+R+GD EQRRAF +L+YVS +VF DA+SFLLPWKR+ KVTDAQ
Sbjct  228   MHMEIGRRIFRQRLETGEREGDAEQRRAFMRLVYVSALVFGDAASFLLPWKRVLKVTDAQ  287

Query  1007  VEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEE  1186
             VE+A+R+NA++LYA +LKSVGRD+NV+ LV LR+AQLS+ LSDE AE +FREHTR +  E
Sbjct  288   VEIAIRENAKQLYAERLKSVGRDINVENLVDLRKAQLSFKLSDELAEDLFREHTRAVAVE  347

Query  1187  NISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             NIS A+ +LKSRTRA      V EEL+K+L FNNLL+SLK+H +A +FAR
Sbjct  348   NISSALGVLKSRTRAVKSMALVVEELEKVLDFNNLLVSLKSHSEADQFAR  397



>emb|CDX86508.1| BnaC08g01950D [Brassica napus]
Length=1013

 Score =   426 bits (1096),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 240/411 (58%), Positives = 310/411 (75%), Gaps = 15/411 (4%)
 Frame = +2

Query  116   MNPSLLLSTN----PSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpst  283
             MNPSL+ +TN    PSP R  L   FL+P+PLRL+  S++    RYR+S    ++     
Sbjct  1     MNPSLITATNAPISPSP-RPPLLCHFLTPSPLRLSQ-SQSPSRRRYRVSFPRCAATSSEQ  58

Query  284   sisssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLG  463
              + S+          + DV G K+EL+G+Q +V+ M+PP+R+A+SA++ A ++A+GYGLG
Sbjct  59    PLVSTK---------KSDVHGNKKELTGLQPIVEKMTPPVRLATSAVVLAASLASGYGLG  109

Query  464   FRFGGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDA  643
              R  GSRN   G A A GAAG    YA+N+  PEVAA+ LHNYVA  +DPA++ K+DI+ 
Sbjct  110   LRLAGSRNIAFGAAAAAGAAGGAVVYAMNSAVPEVAAIGLHNYVAEIEDPASVTKDDIEK  169

Query  644   IAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAA  823
             IA +YGV+K  EAF AE+CD YCRYVT+VLP   + L+GDEVD IIKFK+ALGIDDPDAA
Sbjct  170   IASRYGVNKGDEAFQAEICDTYCRYVTSVLPAEGQSLKGDEVDKIIKFKSALGIDDPDAA  229

Query  824   AMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDA  1003
             +MHMEIGRRIFRQRLETG+R+GD EQRRAF +L+YVS +VF DA+SFLLPWKR+ KVTDA
Sbjct  230   SMHMEIGRRIFRQRLETGEREGDAEQRRAFMRLVYVSALVFGDAASFLLPWKRVLKVTDA  289

Query  1004  QVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVE  1183
             QVE+A+R+NA++LYA +LK VGRD+NV+ LV LR+AQLS  LSDE AE +FREHTR +  
Sbjct  290   QVEIAIRENAKQLYAERLKLVGRDINVENLVDLRKAQLSIKLSDELAEDLFREHTRTVAI  349

Query  1184  ENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             ENIS A+S+LKSRTRA    + V EEL+K+L FNNLL+SLK+H +A +FAR
Sbjct  350   ENISSALSVLKSRTRAVKSMSLVVEELEKVLEFNNLLVSLKSHSEADQFAR  400



>ref|XP_010045405.1| PREDICTED: protein TIC110, chloroplastic-like isoform X2 [Eucalyptus 
grandis]
Length=1006

 Score =   426 bits (1094),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 240/337 (71%), Positives = 285/337 (85%), Gaps = 2/337 (1%)
 Frame = +2

Query  323   PVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglgg  502
             P   DVFGG +EL+GIQ LV ++SPP+R+A+SAI  A AVAAGY LG RFGGSRNA +GG
Sbjct  61    PRDSDVFGGPKELTGIQPLVRNLSPPVRLAASAIAVAAAVAAGYHLGSRFGGSRNAAIGG  120

Query  503   avalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEA  682
             A  LGAAG  AAYA+ AC PEVAA +LHNYVA CDDP A+KKEDI+ IA KYGVSKQ  A
Sbjct  121   AALLGAAGGAAAYAVKACVPEVAAADLHNYVASCDDPQAVKKEDIELIASKYGVSKQDAA  180

Query  683   FNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQ  862
             FNAELCD+Y R+V++VLPPGNE+L+G EVD I+KF++ALGIDDP+AAAMHMEIGRRIFRQ
Sbjct  181   FNAELCDLYLRFVSSVLPPGNEELKGTEVDKIVKFRSALGIDDPEAAAMHMEIGRRIFRQ  240

Query  863   RLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRL  1042
             RLETGDR+ ++EQRRAFQKLIYVS +VF +AS+FLLPWKR+FKVTDAQVEVAVRDNAQRL
Sbjct  241   RLETGDREDNVEQRRAFQKLIYVSTLVFGEASTFLLPWKRVFKVTDAQVEVAVRDNAQRL  300

Query  1043  YASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSR  1222
             Y+S+LK++  D+N +QL SLR AQL Y LSDE AE +F+EHTRKLVEEN+S A+++LKSR
Sbjct  301   YSSRLKAI--DLNENQLESLRAAQLMYRLSDELAEDLFKEHTRKLVEENVSAALNVLKSR  358

Query  1223  TRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
             TR+     +  EELDKILAFNNLL+S KNHP+A   A
Sbjct  359   TRSARGVAQAVEELDKILAFNNLLVSFKNHPNADGLA  395



>ref|XP_009110969.1| PREDICTED: protein TIC110, chloroplastic [Brassica rapa]
Length=1013

 Score =   425 bits (1093),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 238/411 (58%), Positives = 309/411 (75%), Gaps = 15/411 (4%)
 Frame = +2

Query  116   MNPSLLLSTN----PSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpst  283
             MNPSL+ + N    PSP R  L   FL+P+PLRL+  S++    RYR+S    ++     
Sbjct  1     MNPSLITAVNAPISPSP-RSPLLCHFLTPSPLRLSQ-SQSPSRRRYRVSFPRCAATSSEQ  58

Query  284   sisssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLG  463
              + S+          + DV G K+EL+G+Q +V+ M+PP+R+A+SA++ A  +A+GYGLG
Sbjct  59    PLVSTK---------KSDVHGNKKELTGLQPIVEKMTPPVRLATSAVVLAATLASGYGLG  109

Query  464   FRFGGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDA  643
              R  GSRN  LG A   GAAG    YA+N+  PEVAA+ LHNYVA  +DPA++ K+DI+ 
Sbjct  110   LRLAGSRNIALGAAAVAGAAGGAVVYAMNSAVPEVAAIGLHNYVAEIEDPASVTKDDIEK  169

Query  644   IAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAA  823
             IA +YGV+K  EAF AE+CDIYCRYVT+VLP   + L+GDEV+ I+KFK+ALGIDDPDAA
Sbjct  170   IASRYGVNKGDEAFQAEICDIYCRYVTSVLPAEGQSLKGDEVEKIVKFKSALGIDDPDAA  229

Query  824   AMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDA  1003
             +MHMEIGRRIFRQRLETG+R+GD EQRRAF +L+YVS +VF DA+SFLLPWKR+ KVTDA
Sbjct  230   SMHMEIGRRIFRQRLETGEREGDAEQRRAFMRLVYVSALVFGDAASFLLPWKRVLKVTDA  289

Query  1004  QVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVE  1183
             QVE+A+R+NA++LYA KLK VGRD+NV+ LV LR+AQLS+ LSDE AE +FREHTR +  
Sbjct  290   QVEIAIRENAKQLYAEKLKLVGRDINVENLVDLRKAQLSFKLSDELAEDLFREHTRTVAI  349

Query  1184  ENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             ENIS A+S+LKSRTRA    + V EEL+K+L  NNLL+SLK+H +A +FAR
Sbjct  350   ENISSALSVLKSRTRAVKSMSLVVEELEKVLELNNLLVSLKSHSEADQFAR  400



>ref|XP_008807813.1| PREDICTED: protein TIC110, chloroplastic-like [Phoenix dactylifera]
Length=457

 Score =   407 bits (1046),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 228/336 (68%), Positives = 277/336 (82%), Gaps = 0/336 (0%)
 Frame = +2

Query  326   VQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglgga  505
             V P +FGG+RELSG Q LVD++ PP R+ASS ++ A A+AAGYGLG RF GSR A LGGA
Sbjct  63    VGPSIFGGRRELSGPQVLVDALPPPARVASSVVVAAAALAAGYGLGLRFVGSRVAALGGA  122

Query  506   valgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAF  685
              ALGAAG    YALN+  PEVAAVNLHN VA  DDP A+ KED++A+AKKYGVS+Q  AF
Sbjct  123   AALGAAGGAVVYALNSSVPEVAAVNLHNLVASYDDPTAVSKEDVEAVAKKYGVSRQDNAF  182

Query  686   NAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQR  865
              AELCD+Y R+V++VLPPG E+L+G EV+TIIKFK ALGIDDPDAA++H+EIGR IFRQR
Sbjct  183   KAELCDLYSRFVSSVLPPGGENLKGHEVETIIKFKEALGIDDPDAASVHIEIGRHIFRQR  242

Query  866   LETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLY  1045
             LETGD + ++EQRRAFQKLIYVS +VF +AS FLLPWKR+F+VTDAQV++AVRDNAQRLY
Sbjct  243   LETGDCEANIEQRRAFQKLIYVSTLVFGEASKFLLPWKRLFQVTDAQVDIAVRDNAQRLY  302

Query  1046  ASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRT  1225
             A KLK +GRD++V+QL+ LR++QL Y LSDE A  M REHTRKL+EENIS A+ +LKSRT
Sbjct  303   ALKLKLIGRDIDVNQLIDLRKSQLLYRLSDEIASEMLREHTRKLIEENISVALGMLKSRT  362

Query  1226  RAPGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
             +A    T V EEL+K+LAFN+LL SL  HP+A +FA
Sbjct  363   KAITGTTLVIEELNKVLAFNDLLTSLSKHPEADQFA  398



>gb|KFK43011.1| hypothetical protein AALP_AA1G067600 [Arabis alpina]
Length=1010

 Score =   422 bits (1085),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 242/411 (59%), Positives = 301/411 (73%), Gaps = 17/411 (4%)
 Frame = +2

Query  116   MNPSLLLSTN----PSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpst  283
             MNPSL+ + N    PSP R  L   FL+P P      S +    RYR+S    ++     
Sbjct  1     MNPSLVTAINAPISPSP-RSPLLCHFLTPLP-----KSHSPIRRRYRVSLPRCTATSEVP  54

Query  284   sisssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLG  463
               ++             DV G ++EL+GIQ  V+ M+PP+R+A+S +I A  +AAGYGLG
Sbjct  55    VSTTQVKKNR-------DVHGNRKELTGIQPFVEKMTPPVRLATSTVILAATLAAGYGLG  107

Query  464   FRFGGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDA  643
             FR  GSRN  LG A   GAAG    YALN+  PEVAA++LHNYVA  +DPA++ KEDI+ 
Sbjct  108   FRLAGSRNIALGSAAVAGAAGGAVVYALNSAVPEVAAISLHNYVADIEDPASVTKEDIER  167

Query  644   IAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAA  823
             IA +YGVSK  EAF AE+CDIYCRYVT+VLP   E L+GDEV+ I+KFK ALGID+PDAA
Sbjct  168   IADRYGVSKGDEAFQAEICDIYCRYVTSVLPSEGETLKGDEVEKIVKFKKALGIDEPDAA  227

Query  824   AMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDA  1003
             +MHMEIGRRIFRQRLETG+R+GD EQRRAF +L+YVS +VF DA+SFLLPWKR+ KVTDA
Sbjct  228   SMHMEIGRRIFRQRLETGEREGDAEQRRAFMRLVYVSALVFGDAASFLLPWKRVLKVTDA  287

Query  1004  QVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVE  1183
             QVE+A+R+NA++LYA +LK VGRD+NV+ LV LR+AQL++ LSDE AE +FREHTRK+  
Sbjct  288   QVEIAIRENAKQLYAERLKLVGRDINVENLVDLRKAQLTFKLSDELAEDLFREHTRKVAI  347

Query  1184  ENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             ENIS AVSILKSRTRA      V EELDK+L FNNLL+SLK+H +A +FAR
Sbjct  348   ENISSAVSILKSRTRAVKGMAPVVEELDKVLEFNNLLVSLKSHSEADQFAR  398



>ref|XP_006306669.1| hypothetical protein CARUB_v10008186mg [Capsella rubella]
 gb|EOA39567.1| hypothetical protein CARUB_v10008186mg [Capsella rubella]
Length=1016

 Score =   422 bits (1085),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 244/411 (59%), Positives = 304/411 (74%), Gaps = 13/411 (3%)
 Frame = +2

Query  116   MNPSLLLSTN----PSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpst  283
             MNPSL+ + N    PSP R  L   FL   P R +  S      RYR+S   +S+     
Sbjct  1     MNPSLVTAINAPISPSP-RSPLLCHFLPSLPHRFSK-SECLARRRYRVSFPRNSAASSDQ  58

Query  284   sisssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLG  463
                S+   +        DV G K+EL+G+Q +V+ M+PP+R+A+SA++ A ++A GYGLG
Sbjct  59    VSVSTQAKSN-------DVHGNKKELTGLQPIVEKMTPPVRLATSAVVLAASLATGYGLG  111

Query  464   FRFGGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDA  643
              R  GSRN   GGA   GAAG    YALN+  PEVAA++LHNYVA  +DPAA+ KED++ 
Sbjct  112   LRLAGSRNIAFGGAAVAGAAGGAVVYALNSAVPEVAAISLHNYVAEFEDPAAVTKEDVEK  171

Query  644   IAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAA  823
             IA +YGV+K  EAF AE+CDIYCRYVT+VLP   + L+GDEV  I+KFKNALGIDDPDAA
Sbjct  172   IADRYGVNKGDEAFQAEICDIYCRYVTSVLPTEGQSLKGDEVAKIVKFKNALGIDDPDAA  231

Query  824   AMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDA  1003
             AMHMEIGRRIFRQRLETG+R+GD EQRRAF +L+YVS +VF DASSFLLPWKR+ KVTDA
Sbjct  232   AMHMEIGRRIFRQRLETGEREGDAEQRRAFMRLVYVSALVFGDASSFLLPWKRVLKVTDA  291

Query  1004  QVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVE  1183
             QVE+A+R+NA++LYA +LK VGRD+NV+ LV LR+AQLS+ LSDE AE +FREHTRK+V 
Sbjct  292   QVEIAIRENAKQLYAERLKLVGRDINVENLVDLRKAQLSFKLSDELAEDLFREHTRKVVI  351

Query  1184  ENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             ENIS A+SILKSRTRA      V EEL+K+L FNNLL+SLK+H +A +FAR
Sbjct  352   ENISSALSILKSRTRAAKSLASVVEELEKVLEFNNLLVSLKSHSEADQFAR  402



>ref|XP_010475445.1| PREDICTED: protein TIC110, chloroplastic-like [Camelina sativa]
Length=1013

 Score =   422 bits (1084),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 242/414 (58%), Positives = 306/414 (74%), Gaps = 22/414 (5%)
 Frame = +2

Query  116   MNPSLLLSTN----PSPNRKALFSPFLSPAPLRLTAA---SRNRYHFRYRIsavssssdq  274
             MNPSL+ + N    PSP R  L S FL   P R + +   +R RY   +           
Sbjct  1     MNPSLVAAINAPISPSP-RSPLLSHFLPSLPRRFSKSECLARRRYRVSF-----------  48

Query  275   pstsisssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGY  454
                  +S+A +   ++  Q DV G K+EL+G+Q +V+ M+PP+R+A+SA++ A ++A GY
Sbjct  49    ---PRNSAASSDQVSVSTQSDVHGNKKELTGLQPIVEKMTPPVRLATSAVVLAASLATGY  105

Query  455   GLGFRFGGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKED  634
             GLG R  GSRN  LGGA   GAAG    YALN+  PEVAA+ LHNYVA  +DPAA+ KED
Sbjct  106   GLGLRLAGSRNIALGGAAVAGAAGGAVVYALNSAVPEVAAIGLHNYVAEFEDPAAVTKED  165

Query  635   IDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDP  814
             ++ IA +YGV+K  E F AE+CDIYCRYVT+VLP   + L+GDEV  I+KFK+ALGID+P
Sbjct  166   VEKIADRYGVNKGDEVFQAEICDIYCRYVTSVLPSEGQSLKGDEVAKIVKFKSALGIDEP  225

Query  815   DAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKV  994
             DAAAMHMEIGRRIFRQRLETG+R+GD EQRRAF +L+YVS +VF DASSFLLPWKR+ KV
Sbjct  226   DAAAMHMEIGRRIFRQRLETGEREGDAEQRRAFMRLVYVSALVFGDASSFLLPWKRVLKV  285

Query  995   TDAQVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRK  1174
             TDAQVE+A+R+NA++LYA +LK VGRD+NV+ LV LR+AQLS+ LSDE AE +FREHTRK
Sbjct  286   TDAQVEIAIRENAKQLYAERLKLVGRDINVENLVDLRKAQLSFKLSDELAEDLFREHTRK  345

Query  1175  LVEENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             +V ENIS A+SILKSRTRA      V EEL+K+L FNNLL+SLK+H +A +FAR
Sbjct  346   VVIENISSALSILKSRTRATKSLASVVEELEKVLEFNNLLVSLKSHSEADQFAR  399



>ref|XP_010457853.1| PREDICTED: protein TIC110, chloroplastic [Camelina sativa]
Length=1016

 Score =   422 bits (1084),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 245/414 (59%), Positives = 306/414 (74%), Gaps = 19/414 (5%)
 Frame = +2

Query  116   MNPSLLLSTN----PSPNRKALFSPFLSPAPLRLTAA---SRNRYHFRYRIsavssssdq  274
             MNPSLL + N    PSP R  L S FL   P R + +   +R RY   +           
Sbjct  1     MNPSLLAAINAPISPSP-RSPLLSHFLPSLPHRFSKSECLTRRRYRVSF-----------  48

Query  275   pstsisssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGY  454
             P  S +SS   + +      DV G K+EL+G+Q +V+ M+PP+R+A+SA++ A ++A GY
Sbjct  49    PRNSAASSDQVSVSTQAKNSDVHGNKKELTGLQPIVEKMTPPVRLATSAVVLAASLATGY  108

Query  455   GLGFRFGGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKED  634
             GLG R  GSRN  LGGA   GAAG    YALN+  PEVAA+ LHNYVA  +DPAA+ KED
Sbjct  109   GLGLRLAGSRNIALGGAAVAGAAGGAVVYALNSAVPEVAAIGLHNYVAEFEDPAAVTKED  168

Query  635   IDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDP  814
             ++ IA +YGV+K  EAF AE+CDIYCRYVT+VLP   + L+GDEV  I+KFK+ALGID+P
Sbjct  169   VEKIADRYGVNKGDEAFQAEICDIYCRYVTSVLPSEGQSLKGDEVAKIVKFKSALGIDEP  228

Query  815   DAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKV  994
             DAAAMHMEIGRRIFRQRLETG+R+GD EQRRAF +L+YVS +VF DASSFLLPWKR+ KV
Sbjct  229   DAAAMHMEIGRRIFRQRLETGEREGDAEQRRAFMRLVYVSALVFGDASSFLLPWKRVLKV  288

Query  995   TDAQVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRK  1174
             TDAQVE+A+R+NA++LYA +LK VGRD+NV+ LV LR+AQLS+ LSDE AE +FREHTRK
Sbjct  289   TDAQVEIAIRENAKQLYAERLKLVGRDINVENLVDLRKAQLSFKLSDELAEDLFREHTRK  348

Query  1175  LVEENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             +V ENIS A+SILKSRTRA      V EEL+K+L FNNLL+SLK+H +A +FAR
Sbjct  349   VVIENISSALSILKSRTRATKSLASVVEELEKVLEFNNLLVSLKSHSEADQFAR  402



>ref|XP_010486911.1| PREDICTED: protein TIC110, chloroplastic-like [Camelina sativa]
Length=1016

 Score =   420 bits (1080),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 244/414 (59%), Positives = 306/414 (74%), Gaps = 19/414 (5%)
 Frame = +2

Query  116   MNPSLLLSTN----PSPNRKALFSPFLSPAPLRLTAA---SRNRYHFRYRIsavssssdq  274
             MNPSL+ + N    PSP R  L S FL   P R + +   +R RY   +           
Sbjct  1     MNPSLVAAINAPISPSP-RSPLLSHFLPSLPHRFSKSECLTRRRYRVSF-----------  48

Query  275   pstsisssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGY  454
             P  S +SS   + +      DV G K+EL+G+Q +V+ M+PP+R+A+SA++ A ++A GY
Sbjct  49    PRNSAASSDQVSVSTQAKNSDVHGNKKELTGLQPIVEKMTPPVRLATSAVVLAASLATGY  108

Query  455   GLGFRFGGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKED  634
             GLG R  GSRN  LGGA   GAAG    YALN+  PEVAA+ LHNYVA  +DPAA+ KED
Sbjct  109   GLGLRLAGSRNIALGGAAVAGAAGGAVVYALNSAVPEVAAIGLHNYVAEFEDPAAVTKED  168

Query  635   IDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDP  814
             ++ IA +YGV+K  EAF AE+CDIYCRYVT+VLP   + L+GDEV  I+KFK+ALGID+P
Sbjct  169   VEKIADRYGVNKGDEAFQAEICDIYCRYVTSVLPSEGQSLKGDEVAKIVKFKSALGIDEP  228

Query  815   DAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKV  994
             DAAAMHMEIGRRIFRQRLETG+R+GD EQRRAF +L+YVS +VF DASSFLLPWKR+ KV
Sbjct  229   DAAAMHMEIGRRIFRQRLETGEREGDAEQRRAFMRLVYVSALVFGDASSFLLPWKRVLKV  288

Query  995   TDAQVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRK  1174
             TDAQVE+A+R+NA++LYA +LK VGRD+NV+ LV LR+AQLS+ LSDE AE +FREHTRK
Sbjct  289   TDAQVEIAIRENAKQLYAERLKLVGRDINVENLVDLRKAQLSFKLSDELAEDLFREHTRK  348

Query  1175  LVEENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             +V ENIS A+SILKSRTRA      V EEL+K+L FNNLL+SLK+H +A +FAR
Sbjct  349   VVIENISSALSILKSRTRATKSLASVVEELEKVLEFNNLLVSLKSHSEADQFAR  402



>ref|NP_172176.1| protein TIC110 [Arabidopsis thaliana]
 sp|Q8LPR9.1|TI110_ARATH RecName: Full=Protein TIC110, chloroplastic; AltName: Full=Translocon 
at the inner envelope membrane of chloroplasts 110; 
Short=AtTIC110; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM19799.1| At1g06940/F4H5_1 [Arabidopsis thaliana]
 gb|AEE28057.1| translocon at the inner envelope membrane of chloroplasts 110 
[Arabidopsis thaliana]
Length=1016

 Score =   420 bits (1080),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 241/414 (58%), Positives = 307/414 (74%), Gaps = 19/414 (5%)
 Frame = +2

Query  116   MNPSLLLSTN----PSPNRKALFSPFLSPAPLRLTAA---SRNRYHFRYRIsavssssdq  274
             MNPSL+ + N    PSP R  L S FL   P R + +   SR RY   +           
Sbjct  1     MNPSLVTAINAPISPSP-RSPLLSHFLPTLPHRFSKSECLSRRRYRVSF-----------  48

Query  275   pstsisssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGY  454
             P +S +SS   + +     P + G K+EL+G+Q +V+ M+PP+R+A+SA++ A ++A GY
Sbjct  49    PRSSAASSDQLSVSTQAKNPGIHGNKKELTGLQPIVEKMTPPVRLATSAVVLAASLATGY  108

Query  455   GLGFRFGGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKED  634
             GLG R  GSRN   GGA   GAAG    YALN+  PEVAA++LHNYVA  +DPA++ K+D
Sbjct  109   GLGLRLAGSRNIAFGGAAVAGAAGGAVVYALNSAVPEVAAISLHNYVAEFEDPASVTKDD  168

Query  635   IDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDP  814
             ++ IA +YGV+K  EAF AE+CDIYCRYVT+VLP   + L+GDEV  I+KFKNALGID+P
Sbjct  169   VEKIADRYGVNKGDEAFQAEICDIYCRYVTSVLPTEGQSLKGDEVAKIVKFKNALGIDEP  228

Query  815   DAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKV  994
             DAAAMHMEIGRRIFRQRLETG+R+GD EQRRAF +L+YVS +VF DASSFLLPWKR+ KV
Sbjct  229   DAAAMHMEIGRRIFRQRLETGEREGDAEQRRAFMRLVYVSALVFGDASSFLLPWKRVLKV  288

Query  995   TDAQVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRK  1174
             TDAQVE+A+R+NA++LYA +LK VGRD+NV+ LV LR++QLS+ LSDE AE +FREHTRK
Sbjct  289   TDAQVEIAIRENAKQLYAERLKLVGRDINVENLVDLRKSQLSFKLSDELAEDLFREHTRK  348

Query  1175  LVEENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             +V ENIS A+SILKSRTRA      V EEL+K+L FNNLL+SLK+H +A +FAR
Sbjct  349   VVVENISSALSILKSRTRAAKSLASVVEELEKVLEFNNLLVSLKSHSEADQFAR  402



>ref|XP_006846995.1| PREDICTED: protein TIC110, chloroplastic [Amborella trichopoda]
 gb|ERN08576.1| hypothetical protein AMTR_s00017p00132450 [Amborella trichopoda]
Length=1011

 Score =   420 bits (1079),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 229/338 (68%), Positives = 283/338 (84%), Gaps = 1/338 (0%)
 Frame = +2

Query  323   PVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglgg  502
             P++ D+FGG++E+SG+Q LVDSM   +R  SS +I AGA+A+GYGLG +  G+R A +GG
Sbjct  59    PIKADIFGGEKEISGVQKLVDSMPSSVRYVSSVVIVAGALASGYGLGMKVKGTRAAAIGG  118

Query  503   avalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEA  682
             AVALGAAG   AYALN+C P+VAA NLHN V    DP +L+KE +D IA +YGVS+Q+EA
Sbjct  119   AVALGAAGGAVAYALNSCVPDVAAANLHNMVVRSGDPRSLEKEAVDEIANRYGVSRQNEA  178

Query  683   FNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQ  862
             FNAELCD+Y R+V++VLPPG E+LRGDEVD+II+FKN+LGI+DPDAA++HMEIGR IFRQ
Sbjct  179   FNAELCDLYSRFVSSVLPPGGENLRGDEVDSIIQFKNSLGIEDPDAASVHMEIGRHIFRQ  238

Query  863   RLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRL  1042
             RLETGDRD D+EQRRAFQKL+YVS +VF +AS+FLLPWKR+FK+TDAQVEVA+RDNAQRL
Sbjct  239   RLETGDRDADIEQRRAFQKLVYVSTLVFGEASTFLLPWKRVFKITDAQVEVAIRDNAQRL  298

Query  1043  YASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSR  1222
             YA KL SVGRDV+  QL+ LREAQL Y LSDE A  MFREH RKLVEENI+ A+ +LKSR
Sbjct  299   YALKLNSVGRDVDAMQLIDLREAQLQYRLSDEVAADMFREHARKLVEENITIALDVLKSR  358

Query  1223  TRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             +R  G  T+V EEL+KI+AFN LL+SL NHP+ +RFA+
Sbjct  359   SRTKG-LTKVVEELEKIIAFNKLLVSLSNHPEVARFAQ  395



>gb|EPS69416.1| hypothetical protein M569_05346 [Genlisea aurea]
Length=1179

 Score =   422 bits (1084),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 263/415 (63%), Positives = 315/415 (76%), Gaps = 22/415 (5%)
 Frame = +2

Query  125   SLLLSTNPSPNRKALF-SPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpstsisssa  301
             S L+  + SP  K LF SPFLS       ++S  R  F+  +S         S   SSS 
Sbjct  27    SRLMCFSTSPRSKNLFVSPFLSGTNGLGCSSSNLRRRFKISLSRKIRGIRSSSEGSSSS-  85

Query  302   gtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGS  481
                      +P+VFG +R L+G+Q+ VD+M P +RIASSAI+ A A AAGYGLG R GGS
Sbjct  86    -------AAKPNVFGDRRVLTGLQSFVDAMPPAVRIASSAIVVAAAAAAGYGLGNRLGGS  138

Query  482   RNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKK--  655
             RNA LGGAVA+GAAGAGAAYALN+C PEVAA+NLHNYV GCDDP A+K++DI+AIA K  
Sbjct  139   RNAALGGAVAIGAAGAGAAYALNSCVPEVAAINLHNYVVGCDDPGAIKRDDIEAIANKIR  198

Query  656   --------YGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDD  811
                     YGVSKQ EAFN EL DIYCR+V+AV+PPG+EDL+G+EV+++IKFKNALGIDD
Sbjct  199   RDGFLHYRYGVSKQSEAFNTELKDIYCRFVSAVIPPGSEDLKGNEVESVIKFKNALGIDD  258

Query  812   PDAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFK  991
             PDAAAMH+EIGRRIFRQRLETGDRD DLEQRRAFQKLIY+SN+VF +AS FLLPWKR+FK
Sbjct  259   PDAAAMHIEIGRRIFRQRLETGDRDADLEQRRAFQKLIYISNLVFGEASGFLLPWKRLFK  318

Query  992   VTDAQVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTR  1171
             V+DAQVEVA+RDNAQRLY   L+SV +DV+  QL+ +REAQLSY LSDE A  MFREH R
Sbjct  319   VSDAQVEVAIRDNAQRLYLHTLESVSQDVDASQLIRIREAQLSYRLSDEVAADMFREHVR  378

Query  1172  KLVEENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             KLVE+NIS +++ILKSRT+       V  ELD+IL FNN L SLKNH +A+RFA+
Sbjct  379   KLVEKNISASLNILKSRTKT---MKPVIAELDRILEFNNALTSLKNHSEATRFAQ  430



>gb|AAM20701.1| chloroplast inner envelope protein, putative [Arabidopsis thaliana]
Length=1016

 Score =   417 bits (1073),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 240/414 (58%), Positives = 306/414 (74%), Gaps = 19/414 (5%)
 Frame = +2

Query  116   MNPSLLLSTN----PSPNRKALFSPFLSPAPLRLTAA---SRNRYHFRYRIsavssssdq  274
             MNPSL+ + N    PSP R  L S FL   P R + +   SR RY   +           
Sbjct  1     MNPSLVTAINAPISPSP-RSPLLSHFLPTLPHRFSKSECLSRRRYRVSF-----------  48

Query  275   pstsisssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGY  454
             P +S +SS   + +     P + G K+EL+G+Q +V+ M+PP+R+A+SA++ A ++A GY
Sbjct  49    PRSSAASSDQLSVSTQAKNPGIHGNKKELTGLQPIVEKMTPPVRLATSAVVLAASLATGY  108

Query  455   GLGFRFGGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKED  634
             GLG R  GSRN   GGA   GAAG    YALN+  PEVAA++LHNYVA  +DPA++ K+D
Sbjct  109   GLGLRLAGSRNIAFGGAAVAGAAGGAVVYALNSAVPEVAAISLHNYVAEFEDPASVTKDD  168

Query  635   IDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDP  814
             ++ IA +YGV+K  EAF AE+CDIYCRYVT+VLP   + L+GDEV  I+KF NALGID+P
Sbjct  169   VEKIADRYGVNKGDEAFQAEICDIYCRYVTSVLPTEGQSLKGDEVAKIVKFNNALGIDEP  228

Query  815   DAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKV  994
             DAAAMHMEIGRRIFRQRLETG+R+GD EQRRAF +L+YVS +VF DASSFLLPWKR+ KV
Sbjct  229   DAAAMHMEIGRRIFRQRLETGEREGDAEQRRAFMRLVYVSALVFGDASSFLLPWKRVLKV  288

Query  995   TDAQVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRK  1174
             TDAQVE+A+R+NA++LYA +LK VGRD+NV+ LV LR++QLS+ LSDE AE +FREHTRK
Sbjct  289   TDAQVEIAIRENAKQLYAERLKLVGRDINVENLVDLRKSQLSFKLSDELAEDLFREHTRK  348

Query  1175  LVEENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             +V ENIS A+SILKSRTRA      V EEL+K+L FNNLL+SLK+H +A +FAR
Sbjct  349   VVVENISSALSILKSRTRAAKSLASVVEELEKVLEFNNLLVSLKSHSEADQFAR  402



>ref|XP_002892369.1| ATTIC110/TIC110 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68628.1| ATTIC110/TIC110 [Arabidopsis lyrata subsp. lyrata]
Length=1013

 Score =   417 bits (1072),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 240/414 (58%), Positives = 304/414 (73%), Gaps = 22/414 (5%)
 Frame = +2

Query  116   MNPSLLLSTN----PSPNRKALFSPFLSPAPLRLTAA---SRNRYHFRYRIsavssssdq  274
             MNPSL+ + N    PSP R  L S FL   P R + +   +R RY   +           
Sbjct  1     MNPSLVTAINAPISPSP-RSPLLSHFLPSLPHRFSKSECLTRRRYRVSF-----------  48

Query  275   pstsisssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGY  454
                  SS+A +   +    P + G K+EL+G+Q +V+ M+PP+R+A+SA++ A ++A GY
Sbjct  49    ---PRSSAASSDQLSQAKNPGIHGDKKELTGLQPIVEKMTPPVRLATSAVVLAASLATGY  105

Query  455   GLGFRFGGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKED  634
             GLG R  GSRN   GGA   GAAG    YALN+  PEVAA++LHNYVA  +DPA++ K+D
Sbjct  106   GLGLRLAGSRNIAFGGAAVAGAAGGAVVYALNSAVPEVAAISLHNYVADFEDPASVTKDD  165

Query  635   IDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDP  814
             ++ IA +YGV+K  EAF AE+CDIYCRYVT+VLP   + L+GDEV  IIKFKNALGID+P
Sbjct  166   VEKIADRYGVNKGDEAFQAEICDIYCRYVTSVLPTEGQSLKGDEVAKIIKFKNALGIDEP  225

Query  815   DAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKV  994
             DAAAMHMEIGRRIFRQRLETG+R+GD EQRRAF +L+YVS +VF DASSFLLPWKR+ KV
Sbjct  226   DAAAMHMEIGRRIFRQRLETGEREGDAEQRRAFMRLVYVSALVFGDASSFLLPWKRVLKV  285

Query  995   TDAQVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRK  1174
             TDAQVE+A+R+NA++LYA +LK VGR +NV+ LV LR+AQLS+ LSDE AE +FREHTRK
Sbjct  286   TDAQVEIAIRENAKQLYAERLKLVGRAINVENLVDLRKAQLSFKLSDELAEDLFREHTRK  345

Query  1175  LVEENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             +V ENIS A+SILKSRTRA      V EEL+K+L FNNLL+SLK+H +A +FAR
Sbjct  346   VVVENISSALSILKSRTRAVKSLASVVEELEKVLEFNNLLVSLKSHSEADQFAR  399



>emb|CDY10236.1| BnaC05g04790D [Brassica napus]
Length=1005

 Score =   414 bits (1063),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 234/403 (58%), Positives = 300/403 (74%), Gaps = 27/403 (7%)
 Frame = +2

Query  143   NPSPNRKALFSPFLSPAPLRLT---AASRNRYHFRYRIsavssssdqpstsisssagtaa  313
             +PSP R AL   FL+P PLRL+   + SR RY   +                        
Sbjct  11    SPSP-RSALLCHFLTPLPLRLSNSQSPSRRRYRASF---------------------PRC  48

Query  314   aaiPVQ--PDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRN  487
             AA P +  P V   K+EL+G+Q +V+ M+PP+R+A+SA++ A ++A+GYGLG R  GSRN
Sbjct  49    AATPSEQPPLVVANKKELTGLQPIVEKMTPPVRLATSAVVLAASLASGYGLGLRLMGSRN  108

Query  488   aglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVS  667
               LGGA   GAAG    YA+N+  PEVAA+ LHNYVA  +DPA++ KEDI+ IA +YGV+
Sbjct  109   IALGGAAVAGAAGGALVYAMNSAVPEVAAIGLHNYVAEFEDPASVTKEDIEKIASRYGVN  168

Query  668   KQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGR  847
             K+ EAF AE+CDIYCRYVT+VLP   + L+GDEV+ I+KFK+ALGIDDPDAA+MHMEIGR
Sbjct  169   KEDEAFQAEICDIYCRYVTSVLPAEGQSLKGDEVEKIVKFKSALGIDDPDAASMHMEIGR  228

Query  848   RIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRD  1027
             RIFRQRLETG+R+GD EQRRAF +L+YVS +VF DA+SFLLPWKR+ KVTDAQVE+A+R+
Sbjct  229   RIFRQRLETGEREGDAEQRRAFMRLVYVSALVFGDAASFLLPWKRVLKVTDAQVEIAIRE  288

Query  1028  NAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVS  1207
             NA++LYA +LK VGRD+NV+ LV LR+AQLS+ LSDE AE +FREHTR +  ENI+ A+ 
Sbjct  289   NAKQLYAERLKLVGRDINVENLVDLRKAQLSFKLSDELAEELFREHTRAVAIENITSALG  348

Query  1208  ILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             +LKSRTRA    + V EEL+K+L FNNLL+SLKNH +A+ FAR
Sbjct  349   VLKSRTRAVKSMSLVVEELEKVLEFNNLLVSLKNHSEAANFAR  391



>sp|O24303.1|TI110_PEA RecName: Full=Protein TIC110, chloroplastic; AltName: Full=Chloroplast 
inner envelope protein, 110 kDa; Short=psIEP110; AltName: 
Full=IAP100; AltName: Full=Translocon at the inner envelope 
membrane of chloroplasts 110; Flags: Precursor [Pisum 
sativum]
 gb|AAC49399.1| IAP100 [Pisum sativum]
Length=996

 Score =   413 bits (1062),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 237/328 (72%), Positives = 281/328 (86%), Gaps = 0/328 (0%)
 Frame = +2

Query  353   RELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggavalgaagag  532
             +EL+GI+ LVD +S P R+A+SA+I AGAVAAGYGLG RFGGSRNA LGGAVALGAAG  
Sbjct  56    KELNGIEILVDKLSSPARLATSAVIVAGAVAAGYGLGSRFGGSRNAALGGAVALGAAGGA  115

Query  533   aayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAELCDIYC  712
             AAYALNA AP+VAAVNLHNYVAG DDP+ L +EDI+ IA KYGVSKQ EAF AE+CDIY 
Sbjct  116   AAYALNAAAPQVAAVNLHNYVAGFDDPSILTREDIEVIANKYGVSKQDEAFKAEICDIYS  175

Query  713   RYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLETGDRDGD  892
              +V++V+PPG E+L+GDEVD I+ FK++LG+DDPDAAA+HMEIGR++FRQRLE GDR+G 
Sbjct  176   EFVSSVIPPGGEELKGDEVDKIVNFKSSLGLDDPDAAAVHMEIGRKLFRQRLEVGDREGG  235

Query  893   LEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKSVGR  1072
             +EQRRAFQKLIYVSNIVF DASSFLLPWKR+FKVT++QVEVA+RDNAQRLYASKLKSVGR
Sbjct  236   VEQRRAFQKLIYVSNIVFGDASSFLLPWKRVFKVTESQVEVAIRDNAQRLYASKLKSVGR  295

Query  1073  DVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEATRV  1252
             D ++ +LV+L+E Q    LSDE AE +FREH RKLVEENIS A+ ILKSRTRA    ++V
Sbjct  296   DFDLGKLVTLKETQSLCCLSDELAENLFREHARKLVEENISVALGILKSRTRAVPGVSQV  355

Query  1253  TEELDKILAFNNLLISLKNHPDASRFAR  1336
              EE++K+LAFN+LLIS KNH D  R AR
Sbjct  356   VEEIEKVLAFNDLLISFKNHSDIDRLAR  383



>emb|CAA92823.1| chloroplast inner envelope protein, 110 kD (IEP110) [Pisum sativum]
Length=996

 Score =   412 bits (1059),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 237/328 (72%), Positives = 281/328 (86%), Gaps = 0/328 (0%)
 Frame = +2

Query  353   RELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggavalgaagag  532
             +EL+GI+ LVD +S P R+A+SA+I AGAVAAGYGLG RFGGSRNA LGGAVALGAAG  
Sbjct  56    KELNGIEILVDKLSSPARLATSAVIVAGAVAAGYGLGSRFGGSRNAALGGAVALGAAGGA  115

Query  533   aayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAELCDIYC  712
             AAYALNA AP+VAAVNLHNYVAG DDP+ L +EDI+ IA KYGVSKQ EAF AE+CDIY 
Sbjct  116   AAYALNAAAPQVAAVNLHNYVAGFDDPSILTREDIEVIANKYGVSKQDEAFKAEICDIYS  175

Query  713   RYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLETGDRDGD  892
              +V++V+PPG E+L+GDEVD I+ FK++LG+DDPDAAA+HMEIGR++FRQRLE GDR+G 
Sbjct  176   EFVSSVIPPGGEELKGDEVDKIVNFKSSLGLDDPDAAAVHMEIGRKLFRQRLEVGDREGG  235

Query  893   LEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKSVGR  1072
             +EQRRAFQKLIYVSNIVF DASSFLLPWKR+FKVT++QVEVA+RDNAQRLYASKLKSVGR
Sbjct  236   VEQRRAFQKLIYVSNIVFGDASSFLLPWKRVFKVTESQVEVAIRDNAQRLYASKLKSVGR  295

Query  1073  DVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEATRV  1252
             D ++ +LV+L+E Q    LSDE AE +FREH RKLVEENIS A+ ILKSRTRA    ++V
Sbjct  296   DFDLGKLVTLKETQSLCRLSDELAENLFREHARKLVEENISVALGILKSRTRAVPGVSQV  355

Query  1253  TEELDKILAFNNLLISLKNHPDASRFAR  1336
              EEL+K+L+FN+LLIS KNH D  R AR
Sbjct  356   VEELEKVLSFNDLLISFKNHSDIDRLAR  383



>emb|CDY54889.1| BnaA10g28000D [Brassica napus]
Length=1003

 Score =   411 bits (1057),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 233/408 (57%), Positives = 304/408 (75%), Gaps = 19/408 (5%)
 Frame = +2

Query  116   MNPSLLLS-TNPSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpstsis  292
             MNP+ + +  +PSP R  L   FL+P PLRL+  S+++   RYR S    ++        
Sbjct  1     MNPTAINAPISPSP-RSPLLCHFLTPLPLRLSN-SQSQTRRRYRASFPRCAATPSE----  54

Query  293   ssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRF  472
                         QP V   K+EL+G+Q +V+ M+PP+R+A+SA++ A ++A GYGLG R 
Sbjct  55    ------------QPLVMSNKKELTGLQPIVEKMTPPVRLATSAVVLAASLATGYGLGLRL  102

Query  473   GGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAK  652
              GS+N  LGGA   GAAG    YALN+  PEVAA+ LHNYVA  +DPA++ KEDI+ IA 
Sbjct  103   MGSKNIALGGAAVAGAAGGALVYALNSAVPEVAAIGLHNYVAEFEDPASVTKEDIEKIAS  162

Query  653   KYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMH  832
             +YGV+K  EAF AE+CDIYCRYVT+VLP   + L+GDEV+ I+KFK+ALGIDDPDAA+MH
Sbjct  163   RYGVNKGDEAFQAEICDIYCRYVTSVLPAEGQSLKGDEVEKIVKFKSALGIDDPDAASMH  222

Query  833   MEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVE  1012
             MEIGRRIFRQRLETG+R+GD EQRRAF +L+YVS +VF DA+SFLLPWKR+ KVTDAQVE
Sbjct  223   MEIGRRIFRQRLETGEREGDAEQRRAFMRLVYVSALVFGDAASFLLPWKRVLKVTDAQVE  282

Query  1013  VAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENI  1192
             +A+R+NA++LYA +LK VGRD+NV+ LV LR+AQLS+ LSDE AE +FREHTR +  ENI
Sbjct  283   IAIRENAKQLYAERLKLVGRDINVENLVDLRKAQLSFKLSDELAEELFREHTRTVAIENI  342

Query  1193  SRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             + A+ +LK+RTRA    + V EEL+K+L FNNLL+SLK+H +A+ FAR
Sbjct  343   TSALGVLKNRTRAVKSMSLVVEELEKVLEFNNLLVSLKSHSEAANFAR  390



>ref|XP_010685953.1| PREDICTED: protein TIC110, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=1016

 Score =   411 bits (1057),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 253/417 (61%), Positives = 308/417 (74%), Gaps = 24/417 (6%)
 Frame = +2

Query  116   MNPSLLLSTNPSPNRKALFSPFLSPAPL-RLT---------AASRNRYHFRYRIsavsss  265
             MN ++ LS++ SP    LFS F  P P   LT          +S  R HFR      S+ 
Sbjct  1     MNSTIPLSSSQSP---LLFSSFTHPNPTPSLTPPNFTRIPIKSSIKRRHFRLTKLHCSTD  57

Query  266   sdqpstsisssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagava  445
                P++    S            +VFG  RELSG+Q+L +S+SPP+R+ASS ++ A A A
Sbjct  58    QTPPTSQSHDSNF----------EVFGPPRELSGLQSLAESLSPPVRLASSVLLVAAASA  107

Query  446   aGYGLGFRFGGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALK  625
             AG+GLG RFGG+RN  +G AVALGAAG  AAY+LN+C PEVAA NLHNYVA C DP  L 
Sbjct  108   AGFGLGSRFGGNRNVAIGAAVALGAAGGAAAYSLNSCVPEVAATNLHNYVAQCHDPLELN  167

Query  626   KEDIDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGI  805
             KE+I AIA ++GVSKQ EAFNAELCD+Y R+V +VLP GNEDL+G EV+TI KFKNALGI
Sbjct  168   KEEILAIANRFGVSKQDEAFNAELCDLYLRFVLSVLPAGNEDLKGTEVETIKKFKNALGI  227

Query  806   DDPDAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRM  985
             DDPDAA MH+EI RR  RQRLETGDR+GD+EQRRAFQKL+YVS +VF +AS+FLLPWKR+
Sbjct  228   DDPDAANMHLEIARRFVRQRLETGDREGDIEQRRAFQKLVYVSTLVFGEASAFLLPWKRV  287

Query  986   FKVTDAQVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREH  1165
             FKVTD+QVEVAVRDNAQRLY  +LKS+ RD+++ QL  LRE QLSY LSDE AE MF++H
Sbjct  288   FKVTDSQVEVAVRDNAQRLYGQRLKSIDRDLDLKQLADLREVQLSYRLSDELAEEMFKDH  347

Query  1166  TRKLVEENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             TRKL EE ISRA+ I KSR+R  G  T V +EL+K+LAFN++L+SL+NHPDA  FAR
Sbjct  348   TRKLAEECISRALEISKSRSRTGG-PTEVVQELNKLLAFNDMLLSLRNHPDAGNFAR  403



>ref|XP_009119009.1| PREDICTED: protein TIC110, chloroplastic [Brassica rapa]
Length=1003

 Score =   409 bits (1051),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 230/407 (57%), Positives = 299/407 (73%), Gaps = 17/407 (4%)
 Frame = +2

Query  116   MNPSLLLSTNPSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpstsiss  295
             MNP+ + +      R  L   FL+P PLRL+  S++    RYR S    ++         
Sbjct  1     MNPTAINAPISPSTRSPLLCHFLTPLPLRLSN-SQSHTRRRYRASFPRCAATPSE-----  54

Query  296   sagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFG  475
                        QP V   K+EL+G+Q +V+ M+PP+R+A+SA++ A ++A GYGLG R  
Sbjct  55    -----------QPLVVSNKKELTGLQPIVEKMTPPVRLATSAVVLAASLATGYGLGLRLM  103

Query  476   GSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKK  655
             GS+N  LGGA   GAAG    YALN+  PEVAA+ LHNYVA  +DPA++ KEDI+ IA +
Sbjct  104   GSKNIALGGAAVAGAAGGALVYALNSAVPEVAAIGLHNYVAEFEDPASVTKEDIEKIASR  163

Query  656   YGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHM  835
             YGV+K  EAF AE+CDIYCRYVT+VLP   + L+GDEV+ I+KFK+ALGIDDPDAA+MHM
Sbjct  164   YGVNKGDEAFQAEICDIYCRYVTSVLPAEGQSLKGDEVEKIVKFKSALGIDDPDAASMHM  223

Query  836   EIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEV  1015
             EIGRRIFRQRLETG+R+GD EQRRAF +L+YVS +VF DA+SFLLPWKR+ KVTDAQVE+
Sbjct  224   EIGRRIFRQRLETGEREGDAEQRRAFMRLVYVSALVFGDAASFLLPWKRVLKVTDAQVEI  283

Query  1016  AVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENIS  1195
             A+R+NA++LYA +LK VGRD+NV+ LV LR+AQLS+ LSDE AE +FREHTR +  ENI+
Sbjct  284   AIRENAKQLYAERLKLVGRDINVENLVDLRKAQLSFKLSDELAEELFREHTRTVAIENIT  343

Query  1196  RAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
              A+ +LK+RTRA    + V EEL+K+L FNNLL+SLK+H +A+ FAR
Sbjct  344   SALGVLKNRTRAVKSMSLVVEELEKVLEFNNLLVSLKSHSEAANFAR  390



>ref|XP_004490697.1| PREDICTED: protein TIC110, chloroplastic-like [Cicer arietinum]
Length=992

 Score =   409 bits (1050),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 232/328 (71%), Positives = 279/328 (85%), Gaps = 0/328 (0%)
 Frame = +2

Query  353   RELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggavalgaagag  532
             +EL+GI+ LVD +  P R+A+SA+I AGAVAAGYGLG RFGGSRNA LGGAVA+G AG  
Sbjct  54    KELNGIENLVDKLPLPARLATSAVIVAGAVAAGYGLGLRFGGSRNAALGGAVAVGVAGGA  113

Query  533   aayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAELCDIYC  712
             AAYALNA AP+VAAVNLHNYV G DDP+ L KEDI+AIAKKYGV+KQ EAF AE+CDIY 
Sbjct  114   AAYALNATAPQVAAVNLHNYVVGFDDPSKLNKEDIEAIAKKYGVNKQDEAFKAEICDIYS  173

Query  713   RYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLETGDRDGD  892
              +V++V+PPG E+L+GDEVD I+ FK+++GIDDPDAA +H+EIGR+++RQRLE GDR+ D
Sbjct  174   EFVSSVIPPGGEELKGDEVDRIVNFKSSIGIDDPDAATVHIEIGRKLYRQRLEVGDREAD  233

Query  893   LEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKSVGR  1072
             +EQRRAFQKLIYVSNIVF DASSFLLPWKR+FKVTD+QVEVA+RDNAQRLYASKLKSVGR
Sbjct  234   VEQRRAFQKLIYVSNIVFGDASSFLLPWKRVFKVTDSQVEVAIRDNAQRLYASKLKSVGR  293

Query  1073  DVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEATRV  1252
             D+++++LV+LR+AQ    LSDE A  +FREH R LVEENIS A+ ILKSRTRA    ++V
Sbjct  294   DLDLEKLVTLRDAQRLCRLSDELAGNLFREHVRNLVEENISVALGILKSRTRAVPGVSQV  353

Query  1253  TEELDKILAFNNLLISLKNHPDASRFAR  1336
              EEL+K+L FN+LLIS KNH D  R AR
Sbjct  354   VEELNKVLMFNDLLISFKNHSDIDRLAR  381



>ref|XP_003544919.1| PREDICTED: protein TIC110, chloroplastic-like [Glycine max]
Length=996

 Score =   408 bits (1048),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 241/328 (73%), Positives = 280/328 (85%), Gaps = 0/328 (0%)
 Frame = +2

Query  353   RELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggavalgaagag  532
             ++L GI+ LVD +SPP R+A+SA+I AGA AAGYGLG RFGGSR A LGGAVALGAAG  
Sbjct  58    KDLKGIELLVDKLSPPARLATSAVIVAGAAAAGYGLGSRFGGSRYAALGGAVALGAAGGA  117

Query  533   aayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAELCDIYC  712
             AAYALNA AP+VAAVNLHNYVA  DDP+ LKKE+I+AIA KYGVSKQ EAF AE+CDIY 
Sbjct  118   AAYALNAAAPQVAAVNLHNYVAAFDDPSKLKKEEIEAIASKYGVSKQDEAFKAEICDIYS  177

Query  713   RYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLETGDRDGD  892
              +V++VLPPG E+L+GDEVD I+ FKN+LGIDDPDAA+MHMEIGR+IFRQRLE GDRD D
Sbjct  178   EFVSSVLPPGGEELKGDEVDRIVSFKNSLGIDDPDAASMHMEIGRKIFRQRLEVGDRDAD  237

Query  893   LEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKSVGR  1072
             +EQRRAFQKLIYVSN+VF DASSFLLPWKR+FKVTD+Q+EVAVRDNAQRL+ASKLKSVGR
Sbjct  238   VEQRRAFQKLIYVSNLVFGDASSFLLPWKRVFKVTDSQIEVAVRDNAQRLFASKLKSVGR  297

Query  1073  DVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEATRV  1252
             D++ +QLV+LR+ Q    LSDE AE +FR HTRKLVEENIS A+ ILKSRT+A    ++ 
Sbjct  298   DIDAEQLVALRKEQQLCRLSDELAENLFRTHTRKLVEENISVAIGILKSRTKAVPGVSQA  357

Query  1253  TEELDKILAFNNLLISLKNHPDASRFAR  1336
               ELD++LAFNNLLIS K HPD  RFAR
Sbjct  358   VAELDRVLAFNNLLISFKTHPDVDRFAR  385



>ref|XP_004500340.1| PREDICTED: protein TIC110, chloroplastic-like [Cicer arietinum]
Length=994

 Score =   407 bits (1047),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 250/407 (61%), Positives = 311/407 (76%), Gaps = 23/407 (6%)
 Frame = +2

Query  116   MNPSLLLSTNPSPNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpstsiss  295
             MNPS  L+  PS  R     PFL P PL L+++++ R+ F+      SSSS   S+S   
Sbjct  2     MNPSSTLT--PSSQR-----PFLIPLPLSLSSSTK-RHRFKLSFPRCSSSSSSSSSSSV-  52

Query  296   sagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFG  475
                      P Q       ++L+G++ LVD + P +R+A+SA++ AGAVAAG+ LG +FG
Sbjct  53    ---------PSQV-----PKDLTGVELLVDKLPPTLRLATSAVVVAGAVAAGFSLGSKFG  98

Query  476   GSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKK  655
             GSRNA +GGAVALG AG  A YALNA AP+VAAVNLHNYVAG DDP+ LK EDI  IAK+
Sbjct  99    GSRNAAVGGAVALGVAGGAAVYALNAAAPQVAAVNLHNYVAGLDDPSLLKNEDIGGIAKR  158

Query  656   YGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHM  835
             YGV K+ E F AE+CDIY ++V++VLPPG E+L+GDE D II FKN+LGIDDPDAAAMH+
Sbjct  159   YGVKKEDEVFKAEICDIYGQFVSSVLPPGGEELKGDEADRIISFKNSLGIDDPDAAAMHI  218

Query  836   EIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEV  1015
             E+GR+IFR RLE GDR+ D+EQRRAFQKL++VS +VF +ASSFLLPWKR+F+ TD+QVEV
Sbjct  219   EVGRKIFRLRLEVGDREADIEQRRAFQKLVFVSYLVFGEASSFLLPWKRVFQFTDSQVEV  278

Query  1016  AVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENIS  1195
             A+RD+AQRLYASKLKSVGRD++ +QLV+LREAQ  Y LSD+ AE +F++HTRKL+EENIS
Sbjct  279   AIRDSAQRLYASKLKSVGRDIDAEQLVALREAQRFYRLSDQLAENLFKKHTRKLIEENIS  338

Query  1196  RAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
              A+ ILKSRTRA     +V EELDKILAFNNLLI+LKNH D   FAR
Sbjct  339   AALDILKSRTRAVTGVIQVIEELDKILAFNNLLITLKNHADVDLFAR  385



>ref|XP_003615974.1| Chloroplast inner envelope protein (IEP110) [Medicago truncatula]
 gb|AES98932.1| translocon at the inner envelope membrane ofs 110 protein [Medicago 
truncatula]
Length=993

 Score =   407 bits (1047),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 233/328 (71%), Positives = 276/328 (84%), Gaps = 0/328 (0%)
 Frame = +2

Query  353   RELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggavalgaagag  532
             +EL+G++ LVD +  P R+A+SA+I AGAVAAGYG+G RFGGSRNA +GGAVA+G AG  
Sbjct  54    KELAGLEILVDKLPLPARLATSAVIVAGAVAAGYGIGSRFGGSRNAAIGGAVAVGVAGGA  113

Query  533   aayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAELCDIYC  712
             AAYALNA AP+VAAVNL NYVAG DD + LKKEDI+ IA KYGVSKQ EAF AE+CDIY 
Sbjct  114   AAYALNATAPQVAAVNLRNYVAGFDDASKLKKEDIEVIANKYGVSKQDEAFKAEICDIYS  173

Query  713   RYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLETGDRDGD  892
              +V +V+PPG E+L+GDEVD I+ FKN+LG+DDPDAA +HMEIGR++FRQRLE GDR+ D
Sbjct  174   EFVFSVIPPGGEELKGDEVDRIVTFKNSLGLDDPDAAGVHMEIGRKLFRQRLEVGDREAD  233

Query  893   LEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKSVGR  1072
             +EQRRAFQKLIYVSNIVF DASSFLLPWKR+FKVT++QVEVA+RDNAQRLYASKLKSVGR
Sbjct  234   VEQRRAFQKLIYVSNIVFGDASSFLLPWKRVFKVTESQVEVAIRDNAQRLYASKLKSVGR  293

Query  1073  DVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEATRV  1252
             D ++++LV+LRE Q    LSDE A  +FREH RKLVEENIS A+ ILKSRTRA    ++V
Sbjct  294   DFDLEKLVTLRETQRLCRLSDELAVNLFREHVRKLVEENISVALGILKSRTRAVPGVSQV  353

Query  1253  TEELDKILAFNNLLISLKNHPDASRFAR  1336
              EELDK+LAFN+LLIS KNH D  R AR
Sbjct  354   VEELDKVLAFNDLLISFKNHSDIDRLAR  381



>ref|XP_003519280.1| PREDICTED: protein TIC110, chloroplastic-like [Glycine max]
Length=995

 Score =   405 bits (1041),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 242/328 (74%), Positives = 278/328 (85%), Gaps = 0/328 (0%)
 Frame = +2

Query  353   RELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggavalgaagag  532
             ++L GI  LVD +SPP R+A+SA+I AGA AAGYGLG RFGGSR A LGGAVALGAAG  
Sbjct  57    KDLKGIDVLVDKLSPPARLATSAVIVAGAAAAGYGLGSRFGGSRYAALGGAVALGAAGGA  116

Query  533   aayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAELCDIYC  712
             AAYALNA AP+VAAVNLHNYVA  DDP+ LKKE+I+AIA KYGVSKQ EAF  E+C IY 
Sbjct  117   AAYALNAAAPQVAAVNLHNYVAAFDDPSKLKKEEIEAIASKYGVSKQDEAFKTEICHIYS  176

Query  713   RYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLETGDRDGD  892
              +V++VLPPG E+L+GDEVD I+ FKN+LGIDDPDAAAMHMEIGR+ FRQRLE GDRD D
Sbjct  177   EFVSSVLPPGGEELKGDEVDRIVSFKNSLGIDDPDAAAMHMEIGRKFFRQRLEVGDRDAD  236

Query  893   LEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKSVGR  1072
             +EQRRAFQKLIYVSN+VF DASSFLLPWKR+FKVTD+Q+EVAVRDNAQRL+ASKLKSVGR
Sbjct  237   VEQRRAFQKLIYVSNLVFGDASSFLLPWKRVFKVTDSQIEVAVRDNAQRLFASKLKSVGR  296

Query  1073  DVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEATRV  1252
             D++ ++LV+LR+ Q    LSDE AE +FR+HTRKLVEENIS A  ILKSRT+A   AT+ 
Sbjct  297   DIDAEKLVALRKEQQLCRLSDELAENLFRDHTRKLVEENISEANRILKSRTKAVPGATQA  356

Query  1253  TEELDKILAFNNLLISLKNHPDASRFAR  1336
               ELDK+LAFNNLLIS KNHPD  RFAR
Sbjct  357   IAELDKVLAFNNLLISFKNHPDVDRFAR  384



>ref|XP_010918040.1| PREDICTED: protein TIC110, chloroplastic [Elaeis guineensis]
Length=1015

 Score =   405 bits (1040),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 231/336 (69%), Positives = 277/336 (82%), Gaps = 0/336 (0%)
 Frame = +2

Query  326   VQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglgga  505
             V P VFGG+RELSG Q LVD++ PP  +ASS +I A A+AAGYGLG RFGGSR AGLGGA
Sbjct  67    VYPSVFGGRRELSGPQVLVDALPPPAMVASSVVIAAAALAAGYGLGLRFGGSRVAGLGGA  126

Query  506   valgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAF  685
              ALGAA     YALN+  PEVAAVNLHN VA  DDP A+ KED++A+AKKYGVS+Q  AF
Sbjct  127   AALGAASGAVVYALNSSVPEVAAVNLHNLVASYDDPTAVSKEDVEAVAKKYGVSRQDNAF  186

Query  686   NAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQR  865
              AELCD+Y R+V++VLPPG E+L+G EV+TIIKFK ALGIDDPDAA++H+EIGR IFRQR
Sbjct  187   KAELCDLYSRFVSSVLPPGGENLKGHEVETIIKFKEALGIDDPDAASVHIEIGRHIFRQR  246

Query  866   LETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLY  1045
             LETGDR+ D+EQRRAFQKLIYVS +VF +AS FLLPWKR+F+VTDAQV++AVRDNAQRLY
Sbjct  247   LETGDREADIEQRRAFQKLIYVSTLVFGEASKFLLPWKRLFQVTDAQVDIAVRDNAQRLY  306

Query  1046  ASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRT  1225
             A KLK +GRD+  +QL+ +R++QL Y LSD+ A  MFREHTRKL+EENIS A+ +LKSRT
Sbjct  307   ALKLKLIGRDIEANQLIDMRKSQLLYRLSDDIASEMFREHTRKLIEENISVALGMLKSRT  366

Query  1226  RAPGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
             +A    T V EELDK+LAFN+LL SL  HP+A +FA
Sbjct  367   KASTGTTVVIEELDKVLAFNDLLTSLSKHPEADQFA  402



>ref|XP_007142070.1| hypothetical protein PHAVU_008G250000g [Phaseolus vulgaris]
 gb|ESW14064.1| hypothetical protein PHAVU_008G250000g [Phaseolus vulgaris]
Length=996

 Score =   402 bits (1033),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 241/328 (73%), Positives = 276/328 (84%), Gaps = 0/328 (0%)
 Frame = +2

Query  353   RELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggavalgaagag  532
             ++L GI+ LVD +SPP R+A+SAI+ AGAVAAGYGLG RFGG+R A LGGAVALGAAG  
Sbjct  56    KDLKGIEVLVDKLSPPARLATSAIVVAGAVAAGYGLGSRFGGNRYAALGGAVALGAAGGA  115

Query  533   aayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAELCDIYC  712
             AAYALNA AP+VAAVNLHNYVA  DDP+ LKKE+IDAIA KYGVSKQ EAF AE+CDIY 
Sbjct  116   AAYALNASAPQVAAVNLHNYVAAFDDPSKLKKEEIDAIALKYGVSKQDEAFKAEICDIYS  175

Query  713   RYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLETGDRDGD  892
              +V +V PP  E+L+GDEVD I+ FKN+LGIDDPDAAAMH+EIGR+IFRQRLE GDR+ D
Sbjct  176   EFVFSVFPPVGEELKGDEVDRIVAFKNSLGIDDPDAAAMHVEIGRKIFRQRLEVGDREAD  235

Query  893   LEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKSVGR  1072
              EQRRAFQKLIYVSN+VF DASSFLLPWKR+FKVTD+Q+EVAVRDNAQRLYASKLKSVGR
Sbjct  236   AEQRRAFQKLIYVSNLVFGDASSFLLPWKRVFKVTDSQIEVAVRDNAQRLYASKLKSVGR  295

Query  1073  DVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEATRV  1252
             D++ +QLV+LREAQL   LSDE AE +FR H RKLVEENIS A+ ILKSRTRA    ++ 
Sbjct  296   DIDAEQLVALREAQLLCRLSDELAENLFRAHARKLVEENISVAIGILKSRTRAGPGVSQA  355

Query  1253  TEELDKILAFNNLLISLKNHPDASRFAR  1336
               ELD +L FNN LIS KNHP+  RFAR
Sbjct  356   IAELDGVLEFNNSLISFKNHPNVDRFAR  383



>ref|XP_009382116.1| PREDICTED: protein TIC110, chloroplastic [Musa acuminata subsp. 
malaccensis]
Length=1018

 Score =   397 bits (1021),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 220/337 (65%), Positives = 276/337 (82%), Gaps = 0/337 (0%)
 Frame = +2

Query  326   VQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglgga  505
             V P VFGG +ELSG QALV ++ PP R+ASSA++ A A+AAG+GLG R GGS+ AG+GGA
Sbjct  71    VDPSVFGGPKELSGPQALVCALPPPARMASSAVLAAAAMAAGFGLGLRVGGSKVAGIGGA  130

Query  506   valgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAF  685
               LG AG  A YALN+  PEVAA++LHN VAG DDP  L+K+++ AI +KYGVSKQ +AF
Sbjct  131   AVLGVAGGAAVYALNSKVPEVAAISLHNLVAGYDDPTELRKDEVAAIVEKYGVSKQDDAF  190

Query  686   NAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQR  865
              AELCD+Y R+V++VLPPG+E+L+G EV+ II+FK ALGIDDPDAA++H+EIGR I+RQR
Sbjct  191   KAELCDLYSRFVSSVLPPGSENLKGYEVEMIIRFKEALGIDDPDAASVHVEIGRHIYRQR  250

Query  866   LETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLY  1045
             LETGDR+ D+EQRRAFQKLIYVS +VF +AS FLLPWKR+F VTD+Q+E+A+RDNAQ+LY
Sbjct  251   LETGDREADIEQRRAFQKLIYVSTLVFGEASKFLLPWKRLFNVTDSQIEIAIRDNAQKLY  310

Query  1046  ASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRT  1225
             ASKLK +GRD+ V QL+ LRE+QL Y LSD+ A  MFREHTR+LVEENIS A+SILKSR 
Sbjct  311   ASKLKLIGRDIEVKQLIELRESQLLYRLSDQIAGEMFREHTRELVEENISSALSILKSRG  370

Query  1226  RAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             +      +V EEL+K+LAFNNLL SL  H D+ +FA+
Sbjct  371   KTSMGTLQVIEELEKVLAFNNLLTSLSKHSDSGQFAQ  407



>ref|XP_009796601.1| PREDICTED: protein TIC110, chloroplastic-like, partial [Nicotiana 
sylvestris]
Length=783

 Score =   389 bits (998),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 244/324 (75%), Positives = 272/324 (84%), Gaps = 8/324 (2%)
 Frame = +2

Query  116   MNPSLLLSTN-PS--PNRKALFSPFLSPAPLRLT-AASRNRYHFRYRIsavssssdqpst  283
             MNPSLLL+TN PS  P      SPFL+P PLR T   S+ R H+RY     +  S   S 
Sbjct  32    MNPSLLLTTNQPSVNPTTTTFLSPFLNPTPLRFTRKISQKRRHYRYNYGLSTVRSSASSV  91

Query  284   sisssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLG  463
                  + + +    V+PDVFGGK+ELS IQ+LVD+MSPPIRIASSA++FAGAVAAGYGLG
Sbjct  92    PDKPPSSSIS----VKPDVFGGKKELSTIQSLVDAMSPPIRIASSALVFAGAVAAGYGLG  147

Query  464   FRFGGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDA  643
              RFGGSRNAG+GGA+ALGAAGAGAAYALN+C PEVAA+NLHNYVA  +DPAAL KEDIDA
Sbjct  148   VRFGGSRNAGVGGAIALGAAGAGAAYALNSCVPEVAAINLHNYVADFEDPAALNKEDIDA  207

Query  644   IAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAA  823
             IA KYGVSKQ+EAFNAEL DIYCRYV+AV P G E+LRGDEVDTIIKFKNALGIDDPDAA
Sbjct  208   IANKYGVSKQNEAFNAELRDIYCRYVSAVFPTGTEELRGDEVDTIIKFKNALGIDDPDAA  267

Query  824   AMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDA  1003
              MHMEIGRRIFRQRLETGDRDGD+EQRRAFQKLIYVS +VF +AS+FLLPWKR+FKVTD+
Sbjct  268   DMHMEIGRRIFRQRLETGDRDGDIEQRRAFQKLIYVSTLVFGEASAFLLPWKRVFKVTDS  327

Query  1004  QVEVAVRDNAQRLYASKLKSVGRD  1075
             QVEVAVRDNAQRLYASKLKSVGRD
Sbjct  328   QVEVAVRDNAQRLYASKLKSVGRD  351


 Score =   126 bits (317),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 74/86 (86%), Gaps = 1/86 (1%)
 Frame = +2

Query  1076  VNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEATRVT  1255
             ++V+QLVSLREAQL+Y LSDE AE MF+EH RKLVEE IS A+  LKSRTRA G ATRV 
Sbjct  412   IDVNQLVSLREAQLAYRLSDELAEEMFKEHARKLVEECISLALGSLKSRTRATG-ATRVI  470

Query  1256  EELDKILAFNNLLISLKNHPDASRFA  1333
             EELDKIL+FNNLLISLKNH DASRFA
Sbjct  471   EELDKILSFNNLLISLKNHRDASRFA  496



>ref|XP_003551181.1| PREDICTED: protein TIC110, chloroplastic-like [Glycine max]
Length=990

 Score =   388 bits (997),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 217/328 (66%), Positives = 266/328 (81%), Gaps = 0/328 (0%)
 Frame = +2

Query  353   RELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggavalgaagag  532
             ++L GI+ LVD +SPP+R+A+S ++FA A +AGYGLG + GG +N  +GGAVA G AG  
Sbjct  52    KDLCGIEHLVDKLSPPVRLATSVVVFAAAASAGYGLGSKLGGCQNVAIGGAVAFGVAGTA  111

Query  533   aayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAELCDIYC  712
             AAYALNA AP+VAAVNLHNYV G D+P  LKKEDID I+ +YGVSKQ +AF AE+CDIY 
Sbjct  112   AAYALNAVAPQVAAVNLHNYVVGLDNPFLLKKEDIDGISNRYGVSKQDDAFKAEICDIYS  171

Query  713   RYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLETGDRDGD  892
              +V+++LPPG+ +L+GDE D II FKN+LGIDDPDAAAMH+E+GR IFRQRLE GD + D
Sbjct  172   HFVSSLLPPGDVELKGDEADKIISFKNSLGIDDPDAAAMHIEVGRNIFRQRLEVGDCEAD  231

Query  893   LEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKSVGR  1072
             +EQ RAFQKLIY+S +VF +ASSFLLPWK +FKVTD+QVE A+RDNAQRLYASKLKSVGR
Sbjct  232   IEQYRAFQKLIYMSYLVFGEASSFLLPWKHVFKVTDSQVEEAIRDNAQRLYASKLKSVGR  291

Query  1073  DVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEATRV  1252
             D++ +QLV+LREAQ  Y LSD+ AE +F+EHTRKLVE +IS A  ILKS TR+       
Sbjct  292   DIDAEQLVTLREAQHLYCLSDQLAENLFKEHTRKLVEGSISVAHGILKSHTRSVYGVIEA  351

Query  1253  TEELDKILAFNNLLISLKNHPDASRFAR  1336
              EELD +LAFNN+LISLKNHPD   FA+
Sbjct  352   VEELDSVLAFNNILISLKNHPDVDHFAQ  379



>gb|EAY79032.1| hypothetical protein OsI_34142 [Oryza sativa Indica Group]
Length=902

 Score =   379 bits (974),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 189/297 (64%), Positives = 238/297 (80%), Gaps = 1/297 (0%)
 Frame = +2

Query  449   GYGLGFRFGG-SRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALK  625
             GYG+G R GG SR   + GA  LGAA    A A+N+  PEVAAV LHNYVAGCDDP  L+
Sbjct  30    GYGIGLRAGGGSRAVAVAGAAVLGAASVAGAAAVNSVVPEVAAVGLHNYVAGCDDPTKLE  89

Query  626   KEDIDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGI  805
             + +++A+A KYGVS Q  AF AELCD+Y R++ +VLPPG+EDL+GDEV TIIKFKNALG+
Sbjct  90    RGEVEALATKYGVSTQDAAFKAELCDLYARFLYSVLPPGDEDLKGDEVQTIIKFKNALGL  149

Query  806   DDPDAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRM  985
             DD DAA MHMEIGRRI+R+RLET DRD D+EQRRAFQKLIYVSN+VF DAS+FLLPWKR+
Sbjct  150   DDVDAANMHMEIGRRIYRERLETRDRDADMEQRRAFQKLIYVSNLVFGDASTFLLPWKRL  209

Query  986   FKVTDAQVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREH  1165
             F VTD+Q+++A+R+NA+ LYAS+LKS+GR +++  L+ +R AQL+Y LSDE A  MF+EH
Sbjct  210   FGVTDSQIDIAMRENAKILYASQLKSIGRGLDIGTLIEVRRAQLAYKLSDEIAAEMFKEH  269

Query  1166  TRKLVEENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
              +KLV+ENIS A+ I+KSRT+A    T+V E++  ILAFN+LLI+L  HPD  RF R
Sbjct  270   AKKLVQENISSALDIVKSRTKAANSPTQVIEDVKSILAFNSLLITLSKHPDQDRFIR  326



>gb|KEH34416.1| translocon at the inner envelope membrane ofs 110 protein [Medicago 
truncatula]
Length=984

 Score =   379 bits (973),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 223/328 (68%), Positives = 273/328 (83%), Gaps = 0/328 (0%)
 Frame = +2

Query  353   RELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggavalgaagag  532
             ++L+GI+ +VD +SPP+R+A+SA++ AGAVAAG+ LG +FGGSRNA +GGAVALGAAG  
Sbjct  47    KDLTGIENVVDKLSPPLRLATSAVVIAGAVAAGFHLGSKFGGSRNAAVGGAVALGAAGGA  106

Query  533   aayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAELCDIYC  712
             AAYALNA AP+VAAVNLHNYVA  D P  LKKEDI+ IA +YGV K+ E F AELCDIY 
Sbjct  107   AAYALNAMAPQVAAVNLHNYVADLDHPLLLKKEDIENIANRYGVKKEDEVFKAELCDIYR  166

Query  713   RYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLETGDRDGD  892
              +V++VLPP  E+L+GDE D IIKFKNALGIDDPDAA +H+E+GR+IFR RLE GDR+ D
Sbjct  167   EFVSSVLPPVGEELQGDEADRIIKFKNALGIDDPDAADIHIEVGRKIFRLRLEVGDREAD  226

Query  893   LEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKSVGR  1072
             +EQRRAFQKLI+VS +VF +ASSFLLPWKR+F+ TD+QVEVA+RDNA RLYASKLKS+GR
Sbjct  227   IEQRRAFQKLIFVSYLVFGEASSFLLPWKRIFQFTDSQVEVAIRDNAHRLYASKLKSIGR  286

Query  1073  DVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEATRV  1252
             D++ +QLV+LREAQ  Y LSD+ AE +F+EHT+KL+ ENIS A+ ILKS TR     ++ 
Sbjct  287   DIDPEQLVTLREAQHQYRLSDQLAENLFKEHTKKLIVENISVALDILKSCTRTVPGVSQA  346

Query  1253  TEELDKILAFNNLLISLKNHPDASRFAR  1336
              EELDKI+AFNNLLISLKNH D   FAR
Sbjct  347   AEELDKIMAFNNLLISLKNHVDVDLFAR  374



>ref|XP_006662467.1| PREDICTED: protein TIC110, chloroplastic-like [Oryza brachyantha]
Length=896

 Score =   376 bits (966),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/259 (67%), Positives = 215/259 (83%), Gaps = 0/259 (0%)
 Frame = +2

Query  560   PEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPP  739
             PEVAAV LHNYVAGCDDP  L+  +++AIA KYGVS Q  AF AELCD+Y R++ +VLPP
Sbjct  20    PEVAAVGLHNYVAGCDDPTNLESGEVEAIASKYGVSTQDAAFKAELCDLYARFLYSVLPP  79

Query  740   GNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQK  919
             G+EDL+GDEV TIIKFKNALG+DD DAA MHMEIGRRI+R+RLET DRD D+EQRRAFQK
Sbjct  80    GDEDLKGDEVQTIIKFKNALGLDDVDAANMHMEIGRRIYRERLETRDRDADMEQRRAFQK  139

Query  920   LIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKSVGRDVNVDQLVS  1099
             LIYVSN+VF DAS+FLLPWKR+F VTD+Q+++A+R+NA+ LYAS+LKS+GR +++  L+ 
Sbjct  140   LIYVSNLVFGDASTFLLPWKRLFGVTDSQIDIAMRENAKILYASQLKSIGRGLDIGTLIE  199

Query  1100  LREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEATRVTEELDKILA  1279
             +R AQL+Y LSDE A  MFREH +KLV+ENI+ AV I+KSRT+A    T+V EE+  ILA
Sbjct  200   VRRAQLAYKLSDEIAAEMFREHAKKLVQENITPAVDIIKSRTKAANSQTQVVEEVKSILA  259

Query  1280  FNNLLISLKNHPDASRFAR  1336
             FN+LLI+L  HPD  RF R
Sbjct  260   FNSLLITLSKHPDQDRFVR  278



>ref|XP_010234858.1| PREDICTED: protein TIC110, chloroplastic [Brachypodium distachyon]
Length=1032

 Score =   375 bits (963),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 195/335 (58%), Positives = 253/335 (76%), Gaps = 1/335 (0%)
 Frame = +2

Query  335   DVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggaval  514
             +VFGG++EL+G+Q LV+S+ P  R A+   + A AVAAGYG+G R GG   A      A+
Sbjct  80    EVFGGRKELTGVQPLVESLPPAARTAAELAVAAAAVAAGYGIGLRLGGGSRAAAVAGAAV  139

Query  515   gaagagaayaln-acaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNA  691
               A + A  A   +  PEVAAV LHNYV GCDDP  L+  +++AIA KYGVS Q  AF A
Sbjct  140   LGAASVAGAAAVNSVVPEVAAVGLHNYVVGCDDPTKLETSEVEAIASKYGVSTQDAAFKA  199

Query  692   ELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLE  871
             ELCD+Y  ++ +VLPPG+EDL+G+EV+ I KFK+ALG+DD DAA MHMEIGRR++R+RLE
Sbjct  200   ELCDLYASFLYSVLPPGDEDLKGNEVEVITKFKSALGLDDVDAANMHMEIGRRLYRERLE  259

Query  872   TGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYAS  1051
             T DRD D+EQRRAFQKLIYVSN+VF DAS+FLLPWKR+F +TD+Q+++A+RDNA+ LY S
Sbjct  260   TRDRDADMEQRRAFQKLIYVSNLVFGDASAFLLPWKRLFGITDSQIDIAMRDNAKNLYTS  319

Query  1052  KLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRA  1231
             +LKS+GRD+++  L+ +R AQL+Y LSDE A  MFREH +KL++ENIS A+ ILKSRT+A
Sbjct  320   QLKSIGRDLDIGTLIEVRRAQLAYKLSDEIAADMFREHAKKLIQENISSALDILKSRTKA  379

Query  1232  PGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
                 T+V EE+  +LAFN+LL  L  HP   RF R
Sbjct  380   ANSPTQVIEEVKIVLAFNSLLTVLSKHPQGDRFVR  414



>gb|AAP54402.2| chloroplast inner envelope protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=1011

 Score =   373 bits (957),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 203/335 (61%), Positives = 258/335 (77%), Gaps = 9/335 (3%)
 Frame = +2

Query  335   DVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGG-SRNaglggava  511
             +VFG +REL+G+Q LV+++ P  R A+   + A AVAAGYG+G R GG SR   + GA  
Sbjct  68    EVFGPRRELAGVQPLVEALPPAARTAAELAVAAAAVAAGYGIGLRAGGGSRAVAVAGAAV  127

Query  512   lgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNA  691
             LGAA    A A+N+  PEVAAV LHNYVAGCDDP  L+  +++A+A KYGVS Q  AF A
Sbjct  128   LGAASVAGAAAVNSVVPEVAAVGLHNYVAGCDDPTKLESGEVEALATKYGVSTQDAAFKA  187

Query  692   ELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLE  871
             ELCD+Y R++ +VLPPG+EDL+GDEV TIIKFKNALG+DD DAA MHMEIGRRI+R+RLE
Sbjct  188   ELCDLYARFLYSVLPPGDEDLKGDEVQTIIKFKNALGLDDVDAANMHMEIGRRIYRERLE  247

Query  872   TGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYAS  1051
             T DRD D+EQRRAFQKLIYVSN+VF DAS+FLLPWKR+F VTD+Q+++A+R+NA+ LYAS
Sbjct  248   TRDRDADMEQRRAFQKLIYVSNLVFGDASTFLLPWKRLFGVTDSQIDIAMRENAKILYAS  307

Query  1052  KLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRA  1231
             +LKS+GR +++  L+ +R AQL+Y LSDE A  MF+EH +KLV+ENIS A+ I       
Sbjct  308   QLKSIGRGLDIGTLIEVRRAQLAYKLSDEIAAEMFKEHAKKLVQENISSALDI-----EY  362

Query  1232  PGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             P   T+V E++  ILAFN+LLI+L  HPD  RF R
Sbjct  363   P---TQVIEDVKSILAFNSLLITLSKHPDQDRFIR  394



>ref|XP_008668098.1| PREDICTED: uncharacterized protein LOC100273973 isoform X1 [Zea 
mays]
Length=1011

 Score =   372 bits (954),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 200/335 (60%), Positives = 256/335 (76%), Gaps = 3/335 (1%)
 Frame = +2

Query  335   DVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGG-SRNaglggava  511
             +VFG +REL+GIQ LV+++ P  R A+   + A AVAAGYG+G R GG SR   + GA  
Sbjct  65    EVFGARRELTGIQPLVEALPPAARTAAELAVAAAAVAAGYGIGLRAGGGSRAVAVAGAAV  124

Query  512   lgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNA  691
             L AA    A A+N+  PEVAAV LHNYVAG DDP  L   +++AIAKKYGVS Q +AF A
Sbjct  125   LCAASVAGAAAVNSVVPEVAAVGLHNYVAGHDDPTNLDNGEVEAIAKKYGVSTQDDAFKA  184

Query  692   ELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLE  871
             ELCD+Y RY+ +VLPPG+EDL+G EV  IIKFK+ALG+DD DAA MHMEIGRRI+R+RLE
Sbjct  185   ELCDLYARYLYSVLPPGDEDLKGTEVQAIIKFKSALGLDDVDAANMHMEIGRRIYRERLE  244

Query  872   TGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYAS  1051
             T DRD D+EQRRAFQKLIYVSN+VF DAS FLLPWKR+F VTD+Q+++A+R+NA+ LY+ 
Sbjct  245   TSDRDADMEQRRAFQKLIYVSNLVFGDASVFLLPWKRLFGVTDSQIDIAMRENAKNLYSV  304

Query  1052  KLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRA  1231
             +LKS+GR +++  L+ +R AQL+Y LSDE A  MFREH ++LV+ENIS A+ ILKSR   
Sbjct  305   QLKSIGRGLDIGTLIEVRRAQLAYKLSDEIAAEMFREHAKQLVQENISSALDILKSRI--  362

Query  1232  PGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             P   T+  EE++ ++ FN+LL +L  HP+A  FAR
Sbjct  363   PDSLTQAVEEVNIVIKFNSLLTTLSKHPEADNFAR  397



>ref|XP_004982760.1| PREDICTED: protein TIC110, chloroplastic-like [Setaria italica]
Length=1010

 Score =   368 bits (945),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 198/335 (59%), Positives = 253/335 (76%), Gaps = 3/335 (1%)
 Frame = +2

Query  335   DVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGG-SRNaglggava  511
             +VFGG++EL+G+Q LV+++ P  R A+   + A A+AAGYG+G R GG SR   + GA  
Sbjct  63    EVFGGRKELTGVQPLVEALPPAARTAAELAVAAAAIAAGYGIGLRAGGGSRAVAVAGAAV  122

Query  512   lgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNA  691
             LGAA    A A+N+  PEVAAV LHNYVAG DDP  L   +++AIAKKYGVS Q  AF A
Sbjct  123   LGAASVAGAAAVNSVVPEVAAVGLHNYVAGHDDPTNLDNGEVEAIAKKYGVSTQDAAFKA  182

Query  692   ELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLE  871
             ELCD+Y RY+ +VLPPG+EDL+G EV  I KFK ALG+DD DAA MHMEIGR I+R+RLE
Sbjct  183   ELCDLYARYIYSVLPPGDEDLKGSEVQAITKFKRALGLDDVDAANMHMEIGRHIYRERLE  242

Query  872   TGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYAS  1051
             T DRD D+EQRRAFQKLIYVSN+VF D S+FLLPWKR+F VT++Q+++A+R+NA+ LY+S
Sbjct  243   TSDRDADMEQRRAFQKLIYVSNLVFGDQSAFLLPWKRLFGVTESQIDIAMRENAKNLYSS  302

Query  1052  KLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRA  1231
             +LKS+GR +++  L+ +R AQL+Y LSDE A  MFREH +KLVEENIS A+ I+KSR   
Sbjct  303   QLKSIGRGLDIGTLIDVRRAQLAYKLSDEIAAEMFREHAKKLVEENISSALDIMKSRI--  360

Query  1232  PGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             P   T+  EE+  ++ FN+LL  L  HP A RFAR
Sbjct  361   PDSLTKAVEEVKSVIRFNSLLTILSKHPQADRFAR  395



>gb|AAF63131.1|AC011001_1 Putative chloroplast inner envelope protein [Arabidopsis thaliana]
Length=860

 Score =   360 bits (923),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 208/244 (85%), Gaps = 0/244 (0%)
 Frame = +2

Query  605   DDPAALKKEDIDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIK  784
             +DPA++ K+D++ IA +YGV+K  EAF AE+CDIYCRYVT+VLP   + L+GDEV  I+K
Sbjct  3     EDPASVTKDDVEKIADRYGVNKGDEAFQAEICDIYCRYVTSVLPTEGQSLKGDEVAKIVK  62

Query  785   FKNALGIDDPDAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSF  964
             FKNALGID+PDAAAMHMEIGRRIFRQRLETG+R+GD EQRRAF +L+YVS +VF DASSF
Sbjct  63    FKNALGIDEPDAAAMHMEIGRRIFRQRLETGEREGDAEQRRAFMRLVYVSALVFGDASSF  122

Query  965   LLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFA  1144
             LLPWKR+ KVTDAQVE+A+R+NA++LYA +LK VGRD+NV+ LV LR++QLS+ LSDE A
Sbjct  123   LLPWKRVLKVTDAQVEIAIRENAKQLYAERLKLVGRDINVENLVDLRKSQLSFKLSDELA  182

Query  1145  EGMFREHTRKLVEENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDAS  1324
             E +FREHTRK+V ENIS A+SILKSRTRA      V EEL+K+L FNNLL+SLK+H +A 
Sbjct  183   EDLFREHTRKVVVENISSALSILKSRTRAAKSLASVVEELEKVLEFNNLLVSLKSHSEAD  242

Query  1325  RFAR  1336
             +FAR
Sbjct  243   QFAR  246



>gb|ABR16698.1| unknown [Picea sitchensis]
Length=1017

 Score =   363 bits (932),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 202/336 (60%), Positives = 261/336 (78%), Gaps = 0/336 (0%)
 Frame = +2

Query  323   PVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglgg  502
             P+   +FGG+++LSG + + +S+S P R  + A+I AGA+AAGY +G    G+R A  GG
Sbjct  65    PLSQVIFGGEKQLSGPEKVFESLSAPARYGACAVIVAGALAAGYAVGVTTKGTRTAAFGG  124

Query  503   avalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEA  682
             A+ALG AG   AYALN+ AP +AAV LHN V  C DP +L  EDID++  KYGVSKQ EA
Sbjct  125   ALALGVAGGATAYALNSTAPRIAAVTLHNKVVKCGDPTSLNSEDIDSLLHKYGVSKQDEA  184

Query  683   FNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQ  862
             FNAELC++Y RYV++++P GNEDL+GDE ++IIKFK ALGIDDPDAAA+H+EIGR IFRQ
Sbjct  185   FNAELCNLYERYVSSIIPSGNEDLKGDEAESIIKFKKALGIDDPDAAAVHIEIGRHIFRQ  244

Query  863   RLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRL  1042
             RLETGDRD  +E+RRAFQKL+YVS++VF DAS FLLPWKR+FKVTDAQVEVA+RDNAQRL
Sbjct  245   RLETGDRDAAIEERRAFQKLVYVSSLVFGDASKFLLPWKRVFKVTDAQVEVAIRDNAQRL  304

Query  1043  YASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSR  1222
             + S+L S+G+DV+  +L+ LREAQL   L DE A  MFR++TRK +EE+IS A+ ++KS+
Sbjct  305   FQSRLSSLGKDVDERKLMDLREAQLKLKLPDEAAADMFRDYTRKQIEEDISSALKVMKSQ  364

Query  1223  TRAPGEATRVTEELDKILAFNNLLISLKNHPDASRF  1330
              R  G A +V EELDK+LA+N  L  L+N+ D  + 
Sbjct  365   GRVRGSAIKVKEELDKLLAYNQALTDLRNNADKEKL  400



>emb|CDP09261.1| unnamed protein product [Coffea canephora]
Length=710

 Score =   353 bits (905),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 192/208 (92%), Gaps = 1/208 (0%)
 Frame = +2

Query  713   RYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLETGDRDGD  892
             RYV+++LPPGNEDL+GDEV+TIIKFKNALGIDDPDAAAMHM+IGRRIFRQRLE GDRD D
Sbjct  64    RYVSSILPPGNEDLKGDEVETIIKFKNALGIDDPDAAAMHMQIGRRIFRQRLEAGDRDAD  123

Query  893   LEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKSVGR  1072
             LEQRRAFQKLIYVS +VF +ASSFLLPWKR+FKVTDAQVE+AVRDNAQRLY  K+KS+G+
Sbjct  124   LEQRRAFQKLIYVSTLVFEEASSFLLPWKRVFKVTDAQVELAVRDNAQRLYGFKVKSIGQ  183

Query  1073  DVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEATRV  1252
             D NVDQLV+LREAQL+Y LSDE AE MF+E TRKLVEENIS A++ILKSRTRA  EATRV
Sbjct  184   DFNVDQLVALREAQLAYRLSDELAEDMFKELTRKLVEENISTALNILKSRTRA-SEATRV  242

Query  1253  TEELDKILAFNNLLISLKNHPDASRFAR  1336
              EEL+K+L FNNLLISLKNHP+A+RFAR
Sbjct  243   VEELNKVLKFNNLLISLKNHPEANRFAR  270



>dbj|BAJ91401.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=446

 Score =   328 bits (842),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 177/334 (53%), Positives = 235/334 (70%), Gaps = 12/334 (4%)
 Frame = +2

Query  335   DVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggaval  514
             +VFGG++EL+G+Q LV+++ P  R      + A A A GY LG R+GG+R   + GA  L
Sbjct  49    EVFGGRKELTGVQPLVEALPPAGRAVLELAVVAAAAAGGYSLGTRYGGTRTTAVAGAAVL  108

Query  515   gaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAE  694
             GAA    A A+N+  PEVAAV LHNYVAGCDDP AL+  ++ AIA KYGVS Q  AF +E
Sbjct  109   GAATLAGAAAVNSVVPEVAAVGLHNYVAGCDDPTALEASEVAAIASKYGVSTQDAAFKSE  168

Query  695   LCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLET  874
             LCD+Y  +V +VLPPG+EDL+G EV+ I KFK ALG+DD DAA+MH+ IGRR++R+RL+ 
Sbjct  169   LCDLYASFVYSVLPPGHEDLKGTEVEAIKKFKKALGLDDVDAASMHLAIGRRLYRERLD-  227

Query  875   GDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASK  1054
                        AFQKLI+VSN+VF DAS F+LPWK +F +TD Q+++A+R+NA+ LYA +
Sbjct  228   -----------AFQKLIFVSNLVFGDASDFILPWKHLFGITDYQIDIAMRENAKSLYALE  276

Query  1055  LKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAP  1234
             LKS+GR +++  L+ +R  QL+Y L DE A  MF+EH +KL++EN+S A+SILKS T A 
Sbjct  277   LKSIGRGLDIGTLIEVRRVQLAYKLFDEVAADMFKEHAKKLIQENVSSALSILKSNTSAG  336

Query  1235  GEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
                T V  E++ ILAFN LL  L   P   RFAR
Sbjct  337   NIPTEVINEVNSILAFNRLLTVLSKFPQGDRFAR  370



>gb|EMT20950.1| hypothetical protein F775_26398 [Aegilops tauschii]
Length=993

 Score =   342 bits (877),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/258 (62%), Positives = 203/258 (79%), Gaps = 0/258 (0%)
 Frame = +2

Query  563   EVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPG  742
             +VAAV LHNYVAG DDP  L+  +++AIA KYGVS Q  AF  ELCD+Y  ++ +VLPPG
Sbjct  83    KVAAVGLHNYVAGHDDPTKLEASEVEAIANKYGVSTQDAAFKTELCDLYGSFLYSVLPPG  142

Query  743   NEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKL  922
             +EDL+GDEV+ I KFK  LG+DD DAA MHMEIGRR++R+RLET DRD D+EQRRAFQKL
Sbjct  143   DEDLKGDEVEVIAKFKRGLGLDDVDAANMHMEIGRRLYRERLETRDRDADIEQRRAFQKL  202

Query  923   IYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSL  1102
             IYVSN+VF DAS+FLLPWKR+F +TD+Q+++A+RDNA+ LYA +LKS+GR +++  L+ +
Sbjct  203   IYVSNLVFGDASAFLLPWKRLFGITDSQIDIAMRDNAKNLYAIQLKSIGRGLDIGTLIEV  262

Query  1103  REAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEATRVTEELDKILAF  1282
             R AQL+  LSDE A  MFREH +KL++ENIS A+ ILKSR +A    T+V EE+  +LAF
Sbjct  263   RRAQLACKLSDEIAADMFREHAKKLIQENISSALDILKSRNKATNSPTQVIEEVKCVLAF  322

Query  1283  NNLLISLKNHPDASRFAR  1336
             N+LL  L  HP   RFAR
Sbjct  323   NSLLTVLSKHPQGDRFAR  340



>gb|KDO49264.1| hypothetical protein CISIN_1g001822mg [Citrus sinensis]
Length=821

 Score =   332 bits (852),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 181/207 (87%), Gaps = 0/207 (0%)
 Frame = +2

Query  716   YVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLETGDRDGDL  895
             +VT+VLPPG EDLRGDEVD I++FK ALGIDDPDAAAMH+EIGRR+FRQRLE GDRDGD+
Sbjct  2     FVTSVLPPGGEDLRGDEVDKIVQFKKALGIDDPDAAAMHVEIGRRLFRQRLEVGDRDGDM  61

Query  896   EQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKSVGRD  1075
             EQR AFQKLIYVS +VF +ASSFLLPWKR+FKVTD+QVE+A+RDNA+RLYASKLKSVGRD
Sbjct  62    EQRWAFQKLIYVSTLVFGEASSFLLPWKRVFKVTDSQVEIAIRDNAKRLYASKLKSVGRD  121

Query  1076  VNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEATRVT  1255
             V+ + +V LRE QLSY LSD  AE +FREHTRKLVEENI  A+SILKSRTR      +V 
Sbjct  122   VDAEHIVRLREEQLSYRLSDALAEDLFREHTRKLVEENIVTALSILKSRTRVVKGVAQVV  181

Query  1256  EELDKILAFNNLLISLKNHPDASRFAR  1336
             EELDK+LAFNNLLISL+ HP+A RFAR
Sbjct  182   EELDKVLAFNNLLISLRQHPNADRFAR  208



>ref|XP_010234859.1| PREDICTED: protein TIC110, chloroplastic-like [Brachypodium distachyon]
Length=439

 Score =   321 bits (822),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 177/334 (53%), Positives = 239/334 (72%), Gaps = 13/334 (4%)
 Frame = +2

Query  338   VFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGG-SRNaglggaval  514
             VFGG++EL+G+Q LV+++ P  R      + A A  AGYGLG ++GG SR A + GA  L
Sbjct  47    VFGGRKELTGVQPLVEALPPAARAVVELAVVAAAATAGYGLGTKYGGGSRTAAVAGAAVL  106

Query  515   gaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAE  694
             GAA    A A+N+  P+VAAV LHNYVAGCDDP  L+  D++AIAKKYGVS +  AF +E
Sbjct  107   GAASLAGAAAVNSVVPDVAAVGLHNYVAGCDDPTKLETGDVEAIAKKYGVSTEDAAFKSE  166

Query  695   LCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLET  874
             LCD+Y  +V +VLPPG+EDL+G+EV+ IIKFK ALG++D DAA MHM IGRR++++RL  
Sbjct  167   LCDLYGSFVYSVLPPGHEDLKGNEVEAIIKFKRALGLNDVDAANMHMAIGRRLYKERL--  224

Query  875   GDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASK  1054
                        AFQKLI+VSN+VF DAS FLLPWK +F +TD Q+++A+R+NA+ LYAS+
Sbjct  225   ----------NAFQKLIFVSNLVFGDASDFLLPWKHLFGITDYQIDIAMRENAKTLYASE  274

Query  1055  LKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAP  1234
             LKS+GR +++  L+ LR +QL+Y L DE A  MFREH +KL+ ENI+ A++ILKS+    
Sbjct  275   LKSIGRGLDIGTLIELRRSQLAYKLFDEVAADMFREHAKKLILENIASALAILKSQPSTA  334

Query  1235  GEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
                 +V +E++ I+AFN+LL  L   P   RFAR
Sbjct  335   ITPAQVIDEVNSIIAFNSLLRVLSKFPQGDRFAR  368



>gb|EEE51190.1| hypothetical protein OsJ_31997 [Oryza sativa Japonica Group]
Length=895

 Score =   325 bits (833),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 150/227 (66%), Positives = 189/227 (83%), Gaps = 0/227 (0%)
 Frame = +2

Query  656   YGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHM  835
             YGVS Q  AF AELCD+Y R++ +VLPPG+EDL+GDEV TIIKFKNALG+DD DAA MHM
Sbjct  52    YGVSTQDAAFKAELCDLYARFLYSVLPPGDEDLKGDEVQTIIKFKNALGLDDVDAANMHM  111

Query  836   EIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEV  1015
             EIGRRI+R+RLET DRD D+EQRRAFQKLIYVSN+VF DAS+FLLPWKR+F VTD+Q+++
Sbjct  112   EIGRRIYRERLETRDRDADMEQRRAFQKLIYVSNLVFGDASTFLLPWKRLFGVTDSQIDI  171

Query  1016  AVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENIS  1195
             A+R+NA+ LYAS+LKS+GR +++  L+ +R AQL+Y LSDE A  MF+EH +KLV+ENIS
Sbjct  172   AMRENAKILYASQLKSIGRGLDIGTLIEVRRAQLAYKLSDEIAAEMFKEHAKKLVQENIS  231

Query  1196  RAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
              A+ I+KSRT+A    T+V E++  ILAFN+LLI+L  HPD  RF R
Sbjct  232   SALDIVKSRTKAANSPTQVIEDVKSILAFNSLLITLSKHPDQDRFIR  278



>gb|AAG13554.1|AC023240_27 putative chloroplast inner envelope protein [Oryza sativa Japonica 
Group]
Length=988

 Score =   322 bits (824),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 185/335 (55%), Positives = 237/335 (71%), Gaps = 32/335 (10%)
 Frame = +2

Query  335   DVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGG-SRNaglggava  511
             +VFG +REL+G+Q LV+++ P  R A+   + A AVAAGYG+G R GG SR   + GA  
Sbjct  68    EVFGPRRELAGVQPLVEALPPAARTAAELAVAAAAVAAGYGIGLRAGGGSRAVAVAGAAV  127

Query  512   lgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNA  691
             LGAA    A A+N+  PEVAAV LHNYVAGCDDP  L+  +++A+A KYGVS Q  AF A
Sbjct  128   LGAASVAGAAAVNSVVPEVAAVGLHNYVAGCDDPTKLESGEVEALATKYGVSTQDAAFKA  187

Query  692   ELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLE  871
             ELCD+Y R++ +VLPPG+EDL+GDEV TIIKFKNALG+DD DAA MHME           
Sbjct  188   ELCDLYARFLYSVLPPGDEDLKGDEVQTIIKFKNALGLDDVDAANMHME-----------  236

Query  872   TGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYAS  1051
                         AFQKLIYVSN+VF DAS+FLLPWKR+F VTD+Q+++A+R+NA+ LYAS
Sbjct  237   ------------AFQKLIYVSNLVFGDASTFLLPWKRLFGVTDSQIDIAMRENAKILYAS  284

Query  1052  KLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRA  1231
             +LKS+GR +++  L+ +R AQL+Y LSDE A  MF+EH +KLV+ENIS A+ I       
Sbjct  285   QLKSIGRGLDIGTLIEVRRAQLAYKLSDEIAAEMFKEHAKKLVQENISSALDI-----EY  339

Query  1232  PGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             P   T+V E++  ILAFN+LLI+L  HPD  RF R
Sbjct  340   P---TQVIEDVKSILAFNSLLITLSKHPDQDRFIR  371



>gb|ABG66163.1| IAP100, putative, expressed [Oryza sativa Japonica Group]
Length=381

 Score =   293 bits (749),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 168/334 (50%), Positives = 230/334 (69%), Gaps = 15/334 (4%)
 Frame = +2

Query  335   DVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggaval  514
             +VFGG+REL+G+Q LV+++ P  R      + A A AAGY +G R GG+R   + GA AL
Sbjct  50    EVFGGRRELAGVQPLVEALPPVARAVVELAVVAAAAAAGYVVGLRAGGTRTTTVAGAAAL  109

Query  515   gaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAE  694
             GA     A A+N+  P VAA  LHNYVAG DDP  L+  +++AIA KYGVS +   F AE
Sbjct  110   GAVSVAGAAAVNSAVPGVAAAGLHNYVAGSDDPTKLESSEVEAIASKYGVSTEDATFKAE  169

Query  695   LCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLET  874
             LCD+Y R+V +++ PG EDL G EV+TIIKFK ALG++D DAA +HMEI +RI       
Sbjct  170   LCDLYGRFVFSLIHPGYEDLEGTEVETIIKFKKALGLNDIDAANVHMEIAKRI-------  222

Query  875   GDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASK  1054
              DR+  + Q++AF+KLI+V+N+VFRDA  +LLPWKR+F V ++Q++  +R++A+ LYAS 
Sbjct  223   -DRNAGVGQQQAFEKLIFVTNLVFRDAYEYLLPWKRLFGVHESQIDDVMRESAKSLYASL  281

Query  1055  LKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAP  1234
             LKS+GR +++  L+ +R +QL+Y LSDE A  MFREH +KLVEENIS A++ L +R    
Sbjct  282   LKSIGRGLDIGTLIEVRRSQLAYKLSDEIASEMFREHAKKLVEENISTALNNLNNR----  337

Query  1235  GEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
                T+V EE+  IL+FN +L  L N P   RF R
Sbjct  338   ---TQVVEEVKSILSFNGMLTVLSNFPGEERFVR  368



>gb|EMS45727.1| hypothetical protein TRIUR3_05354 [Triticum urartu]
Length=942

 Score =   306 bits (784),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/230 (61%), Positives = 182/230 (79%), Gaps = 0/230 (0%)
 Frame = +2

Query  647   AKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAA  826
             +K+YGVS Q  AF  ELCD+Y  ++ +VLPPG+EDL+GDEV+ I KFK  LG+DD DAA 
Sbjct  95    SKRYGVSTQDAAFKTELCDLYGSFLYSVLPPGDEDLKGDEVEVIAKFKRGLGLDDVDAAN  154

Query  827   MHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQ  1006
             MHMEIGRR++R+RLET DRD D+EQRRAFQKLIYVSN+VF DAS+FLLPWKR+F +TD+Q
Sbjct  155   MHMEIGRRLYRERLETRDRDADIEQRRAFQKLIYVSNLVFGDASAFLLPWKRLFGITDSQ  214

Query  1007  VEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEE  1186
             +++A+RDNA+ LYA +LKS+GR +++  L+ +R AQL+  LSDE A  MFREH +KL++E
Sbjct  215   IDIAMRDNAKNLYAIQLKSIGRGLDIGTLIEVRRAQLACKLSDEIAADMFREHAKKLIQE  274

Query  1187  NISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             NIS A+ ILKSR +A    T+V EE+  +LAFN+LL  L  HP   RFAR
Sbjct  275   NISSALDILKSRNKATNSPTQVIEEVKCVLAFNSLLTVLSKHPQGDRFAR  324



>gb|ABB47817.1| IAP100, putative, expressed [Oryza sativa Japonica Group]
Length=442

 Score =   292 bits (747),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 168/334 (50%), Positives = 230/334 (69%), Gaps = 15/334 (4%)
 Frame = +2

Query  335   DVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggaval  514
             +VFGG+REL+G+Q LV+++ P  R      + A A AAGY +G R GG+R   + GA AL
Sbjct  50    EVFGGRRELAGVQPLVEALPPVARAVVELAVVAAAAAAGYVVGLRAGGTRTTTVAGAAAL  109

Query  515   gaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAE  694
             GA     A A+N+  P VAA  LHNYVAG DDP  L+  +++AIA KYGVS +   F AE
Sbjct  110   GAVSVAGAAAVNSAVPGVAAAGLHNYVAGSDDPTKLESSEVEAIASKYGVSTEDATFKAE  169

Query  695   LCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLET  874
             LCD+Y R+V +++ PG EDL G EV+TIIKFK ALG++D DAA +HMEI +RI       
Sbjct  170   LCDLYGRFVFSLIHPGYEDLEGTEVETIIKFKKALGLNDIDAANVHMEIAKRI-------  222

Query  875   GDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASK  1054
              DR+  + Q++AF+KLI+V+N+VFRDA  +LLPWKR+F V ++Q++  +R++A+ LYAS 
Sbjct  223   -DRNAGVGQQQAFEKLIFVTNLVFRDAYEYLLPWKRLFGVHESQIDDVMRESAKSLYASL  281

Query  1055  LKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAP  1234
             LKS+GR +++  L+ +R +QL+Y LSDE A  MFREH +KLVEENIS A++ L +R    
Sbjct  282   LKSIGRGLDIGTLIEVRRSQLAYKLSDEIASEMFREHAKKLVEENISTALNNLNNR----  337

Query  1235  GEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
                T+V EE+  IL+FN +L  L N P   RF R
Sbjct  338   ---TQVVEEVKSILSFNGMLTVLSNFPGEERFVR  368



>ref|XP_002966718.1| hypothetical protein SELMODRAFT_439675 [Selaginella moellendorffii]
 gb|EFJ32745.1| hypothetical protein SELMODRAFT_439675 [Selaginella moellendorffii]
Length=1249

 Score =   306 bits (785),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 179/342 (52%), Positives = 244/342 (71%), Gaps = 9/342 (3%)
 Frame = +2

Query  329   QPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggav  508
             + +VFG ++ LSG + L++ M  P R  +   I AGA+ AGY +G +  G+ NA L GA+
Sbjct  68    KSNVFGSEKRLSGPKKLLEGMPAPTRYVTCTAIVAGALMAGYAVGSQAKGTPNAALAGAI  127

Query  509   algaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFN  688
             ALGA G   A+ +N+ AP+VAA  +HN +    DP +L+ E+I+ I KK+G++K +E FN
Sbjct  128   ALGAVGGATAFVVNSMAPDVAAAQVHNLLVNHPDPRSLRGEEIEGILKKFGINKTNEKFN  187

Query  689   AELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRL  868
              EL ++Y  +V++V+PPGNEDL+GDE  TI KFK ALG+DDPDAAA+H+EI RRI RQRL
Sbjct  188   TELRNLYDSFVSSVIPPGNEDLKGDEAATIRKFKEALGLDDPDAAAVHIEICRRIVRQRL  247

Query  869   ETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYA  1048
             ETGDRD  +E+ RAFQKL+YVSN+VF +AS FLLPWKR+FKVTD+QVE+AVRDNAQRL+A
Sbjct  248   ETGDRDTAVEELRAFQKLVYVSNLVFGEASKFLLPWKRVFKVTDSQVEIAVRDNAQRLFA  307

Query  1049  SKLKSVGRD--------VNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAV  1204
             +KL S+G          VN+DQL  LR  QL   LSDE    +F+ HT+KL+E  ISRA+
Sbjct  308   TKLSSIGTGKYSSYRTYVNIDQLKELRRIQLKVQLSDEITSSLFKSHTQKLLEGYISRAL  367

Query  1205  SILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRF  1330
              +LK+RTR   +  ++  EL+ +LA+N+LL +L    D+S  
Sbjct  368   EVLKARTRIK-DTKKLVMELESMLAYNDLLSALAKDADSSSL  408



>ref|NP_001064931.1| Os10g0492300 [Oryza sativa Japonica Group]
 dbj|BAF26845.1| Os10g0492300 [Oryza sativa Japonica Group]
Length=427

 Score =   288 bits (738),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 160/334 (48%), Positives = 220/334 (66%), Gaps = 30/334 (9%)
 Frame = +2

Query  335   DVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggaval  514
             +VFGG+REL+G+Q LV+++ P  R      + A A AAGY +G R GG+R        A+
Sbjct  50    EVFGGRRELAGVQPLVEALPPVARAVVELAVVAAAAAAGYVVGLRAGGTRTTTAAVNSAV  109

Query  515   gaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAE  694
                            P VAA  LHNYVAG DDP  L+  +++AIA KYGVS +   F AE
Sbjct  110   ---------------PGVAAAGLHNYVAGSDDPTKLESSEVEAIASKYGVSTEDATFKAE  154

Query  695   LCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLET  874
             LCD+Y R+V +++ PG EDL G EV+TIIKFK ALG++D DAA +HMEI +RI       
Sbjct  155   LCDLYGRFVFSLIHPGYEDLEGTEVETIIKFKKALGLNDIDAANVHMEIAKRI-------  207

Query  875   GDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASK  1054
              DR+  + Q++AF+KLI+V+N+VFRDA  +LLPWKR+F V ++Q++  +R++A+ LYAS 
Sbjct  208   -DRNAGVGQQQAFEKLIFVTNLVFRDAYEYLLPWKRLFGVHESQIDDVMRESAKSLYASL  266

Query  1055  LKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAP  1234
             LKS+GR +++  L+ +R +QL+Y LSDE A  MFREH +KLVEENIS A++ L +R    
Sbjct  267   LKSIGRGLDIGTLIEVRRSQLAYKLSDEIASEMFREHAKKLVEENISTALNNLNNR----  322

Query  1235  GEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
                T+V EE+  IL+FN +L  L N P   RF R
Sbjct  323   ---TQVVEEVKSILSFNGMLTVLSNFPGEERFVR  353



>gb|AAG13550.2|AC023240_23 putative chloroplast inner envelope protein [Oryza sativa Japonica 
Group]
Length=334

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 152/293 (52%), Positives = 209/293 (71%), Gaps = 8/293 (3%)
 Frame = +2

Query  335   DVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggaval  514
             +VFGG+REL+G+Q LV+++ P  R      + A A AAGY +G R GG+R   + GA AL
Sbjct  50    EVFGGRRELAGVQPLVEALPPVARAVVELAVVAAAAAAGYVVGLRAGGTRTTTVAGAAAL  109

Query  515   gaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAE  694
             GA     A A+N+  P VAA  LHNYVAG DDP  L+  +++AIA KYGVS +   F AE
Sbjct  110   GAVSVAGAAAVNSAVPGVAAAGLHNYVAGSDDPTKLESSEVEAIASKYGVSTEDATFKAE  169

Query  695   LCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLET  874
             LCD+Y R+V +++ PG EDL G EV+TIIKFK ALG++D DAA +HMEI +RI       
Sbjct  170   LCDLYGRFVFSLIHPGYEDLEGTEVETIIKFKKALGLNDIDAANVHMEIAKRI-------  222

Query  875   GDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASK  1054
              DR+  + Q++AF+KLI+V+N+VFRDA  +LLPWKR+F V ++Q++  +R++A+ LYAS 
Sbjct  223   -DRNAGVGQQQAFEKLIFVTNLVFRDAYEYLLPWKRLFGVHESQIDDVMRESAKSLYASL  281

Query  1055  LKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSIL  1213
             LKS+GR +++  L+ +R +QL+Y LSDE A  MFREH +KLVEENIS A++ L
Sbjct  282   LKSIGRGLDIGTLIEVRRSQLAYKLSDEIASEMFREHAKKLVEENISTALNNL  334



>ref|XP_001785732.1| predicted protein [Physcomitrella patens]
 gb|EDQ49467.1| predicted protein [Physcomitrella patens]
Length=860

 Score =   279 bits (713),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 136/232 (59%), Positives = 176/232 (76%), Gaps = 1/232 (0%)
 Frame = +2

Query  632   DIDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDD  811
             +ID +AKKYGVS+Q E FNAE+ ++Y  Y+T ++P GNEDLRGDEV++II FKNALG+DD
Sbjct  7     EIDELAKKYGVSRQDERFNAEIRELYASYITGIIPAGNEDLRGDEVESIIGFKNALGLDD  66

Query  812   PDAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFK  991
             PDAAAMH+E+GRR+FRQRLE GDR+G +E+RR FQKL+YVS +VF +AS FLLPWKR+FK
Sbjct  67    PDAAAMHIEVGRRLFRQRLEIGDREGAVEERRTFQKLVYVSTLVFGEASKFLLPWKRVFK  126

Query  992   VTDAQVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTR  1171
             VTDAQV+VAVRDNA RL+  +L SVG D  V Q+  LR+ QL   L+DE    +FR H +
Sbjct  127   VTDAQVDVAVRDNATRLFNVQLSSVGPDFGVQQIKDLRKIQLKLKLTDEVTAEVFRTHVQ  186

Query  1172  KLVEENISRAVSILKSRTRAPGEATRVT-EELDKILAFNNLLISLKNHPDAS  1324
             K +E++IS A+ ILKSR R       ++  +LD  LAFN  L S+ +  DA+
Sbjct  187   KQLEQHISSAMEILKSRARIKHVPASISLSDLDNALAFNAKLGSIASEADAN  238



>ref|XP_001757091.1| predicted protein [Physcomitrella patens]
 gb|EDQ77950.1| predicted protein [Physcomitrella patens]
Length=849

 Score =   277 bits (708),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 177/227 (78%), Gaps = 1/227 (0%)
 Frame = +2

Query  644   IAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAA  823
             I  +YG+S+Q+E FNAE+ D+Y  Y+T V+PPGN DL+GDEV++II FKNALG+DDPDAA
Sbjct  2     IVYRYGISRQNERFNAEIRDLYASYITGVIPPGNGDLKGDEVESIIAFKNALGLDDPDAA  61

Query  824   AMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDA  1003
             AMH+E+GRR+FRQRLE GDR+G +E+RR FQKL+YVS +VF +AS FLLPWKR+FKVTDA
Sbjct  62    AMHIEVGRRLFRQRLEIGDREGAVEERRTFQKLVYVSTLVFGEASKFLLPWKRVFKVTDA  121

Query  1004  QVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVE  1183
             QV+VAVRDNA RL++ +L S+G D +++Q+  LR+ QL   L+DE A  +FR H +K +E
Sbjct  122   QVDVAVRDNASRLFSVQLNSIGPDFDIEQIKDLRKTQLKLKLTDEVAAEVFRSHVQKQLE  181

Query  1184  ENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDAS  1324
             ++I  A+ ILKSR R   + T++  +LD  LAFN  L ++ +  DA+
Sbjct  182   QHIVSAMEILKSRARIK-DTTKIVRDLDNALAFNAKLGAIASGADAN  227



>gb|KCW55054.1| hypothetical protein EUGRSUZ_I01027 [Eucalyptus grandis]
Length=705

 Score =   274 bits (700),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +2

Query  827   MHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQ  1006
             MHMEIGRRIFRQRLETGDR+ D+EQRRAFQKLIYVS +VF +ASSFLLPWKR+FKVTDAQ
Sbjct  1     MHMEIGRRIFRQRLETGDREADVEQRRAFQKLIYVSTLVFGEASSFLLPWKRIFKVTDAQ  60

Query  1007  VEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEE  1186
             +EVAVRDNAQRLY SKLK++GRD+  +QL +LR AQLSY LSDE AE +F+EHTRKLVEE
Sbjct  61    IEVAVRDNAQRLYVSKLKAIGRDLKAEQLENLRAAQLSYRLSDELAEDLFKEHTRKLVEE  120

Query  1187  NISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             N+S AV+++KSRTRA    T+V E+LD+ILAFNNLL+SLKNHP+A  FAR
Sbjct  121   NVSAAVNVVKSRTRAATAVTQVVEQLDEILAFNNLLVSLKNHPNADHFAR  170



>dbj|BAF93201.1| putative chloroplast inner envelope protein [Hordeum vulgare]
Length=302

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/235 (54%), Positives = 169/235 (72%), Gaps = 12/235 (5%)
 Frame = +2

Query  632   DIDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDD  811
             ++ AIA KYGVS Q  AF +ELCD+Y  +V +VLPPG+EDL+G EV+ I KFK ALG+DD
Sbjct  4     EVAAIASKYGVSTQDAAFKSELCDLYASFVYSVLPPGHEDLKGTEVEAIKKFKKALGLDD  63

Query  812   PDAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFK  991
              DAA+MH+ IGRR++R+RL+            AFQKLI+VSN+VF DAS F+LPWK +F 
Sbjct  64    VDAASMHLAIGRRLYRERLD------------AFQKLIFVSNLVFGDASDFILPWKHLFG  111

Query  992   VTDAQVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTR  1171
             +TD Q+++A+R+NA+ LYA +LKS+GR +++  L+ +R  QL+Y L DE A  MF+EH +
Sbjct  112   ITDYQIDIAMRENAKSLYALELKSIGRGLDIGTLIEVRRIQLAYKLFDEVAADMFKEHAK  171

Query  1172  KLVEENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             KL++EN+S A+SILKS T A    T V  E++ ILAFN LL  L   P   RFAR
Sbjct  172   KLIQENVSSALSILKSNTSAGNIPTEVINEVNSILAFNRLLTVLSKFPQGDRFAR  226



>ref|XP_006431980.1| hypothetical protein CICLE_v10000209mg [Citrus clementina]
 gb|ESR45220.1| hypothetical protein CICLE_v10000209mg [Citrus clementina]
Length=687

 Score =   269 bits (688),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +2

Query  827   MHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQ  1006
             MH+EIGRRIFRQRLE GDRDGD+EQR AFQKLIYVS +VF +ASSFLLPWKR+FKVTD+Q
Sbjct  1     MHVEIGRRIFRQRLEVGDRDGDMEQRWAFQKLIYVSTLVFGEASSFLLPWKRVFKVTDSQ  60

Query  1007  VEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEE  1186
             VE+A+RDNA+RLYASKLKSVGRDV+ + +V LRE QLSY LSD  AE +FREHTRKLVEE
Sbjct  61    VEIAIRDNAKRLYASKLKSVGRDVDAEHIVRLREEQLSYRLSDALAEDLFREHTRKLVEE  120

Query  1187  NISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             NI  A+SILKSRTR      +V EELDK+LAFNNLLISLK HP+A RFAR
Sbjct  121   NIVTALSILKSRTRVVKGVAQVVEELDKVLAFNNLLISLKQHPNADRFAR  170



>ref|XP_002978024.1| hypothetical protein SELMODRAFT_443745 [Selaginella moellendorffii]
 gb|EFJ20681.1| hypothetical protein SELMODRAFT_443745 [Selaginella moellendorffii]
Length=1100

 Score =   272 bits (695),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 153/294 (52%), Positives = 207/294 (70%), Gaps = 6/294 (2%)
 Frame = +2

Query  449   GYGLGFRFGGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKK  628
             GY +G +  G+ NA L GA+ALGA G   A+ +N+ AP+VAA  +HN +    DP +L+ 
Sbjct  21    GYAVGSQAKGTPNAALAGAIALGAVGGATAFVVNSMAPDVAAAQVHNLLVNHPDPRSLRG  80

Query  629   EDIDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGID  808
             E+I+ I KK+G++K +E FN EL ++Y  +V++V+PPGNEDL+GDE  TI KFK ALG+D
Sbjct  81    EEIEGILKKFGINKTNEKFNTELRNLYDSFVSSVIPPGNEDLKGDEAATIRKFKEALGLD  140

Query  809   DPDAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMF  988
             DPDAAA+H+EI RRI RQRLETGDRD  +E+ RAFQKL+YVSN+VF +AS FLLPWKR+F
Sbjct  141   DPDAAAVHIEICRRIVRQRLETGDRDTAVEELRAFQKLVYVSNLVFGEASKFLLPWKRVF  200

Query  989   KVTDAQVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHT  1168
             KVTD+QV          LY +    V +DVN+DQL  LR  QL   LSDE    +F+ HT
Sbjct  201   KVTDSQVCFGC-----CLYTALTHVVYKDVNIDQLKELRRIQLKVQLSDEITSSLFKSHT  255

Query  1169  RKLVEENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRF  1330
             +KL+E  ISRA+ +LK+RTR   +  ++  EL+ +LA+N+LL +L    D+S  
Sbjct  256   QKLLEGYISRALEVLKARTRIK-DTKKLVMELENMLAYNDLLSALAKDADSSSL  308



>gb|EEC67227.1| hypothetical protein OsI_34144 [Oryza sativa Indica Group]
Length=448

 Score =   259 bits (662),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 135/290 (47%), Positives = 184/290 (63%), Gaps = 46/290 (16%)
 Frame = +2

Query  560   PEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPP  739
             P VAA  LHNYVAG DDP  L+  +++AIA KYGVS +   F AELCD+Y R+V +++ P
Sbjct  100   PGVAAAGLHNYVAGSDDPTKLESSEVEAIASKYGVSTEDATFKAELCDLYGRFVFSLIHP  159

Query  740   GNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQK  919
             G EDL G EV+TIIKFK ALG++D DAA +HMEI +RI        DR+  + Q++AF+K
Sbjct  160   GYEDLEGTEVETIIKFKKALGLNDIDAANVHMEIAKRI--------DRNAGVGQQQAFEK  211

Query  920   LIYVSNIVFRDASSFLLPWKRMFKVTDAQ-------------------------------  1006
             LI+V+N+VFRDA  +LLPWKR+F V ++Q                               
Sbjct  212   LIFVTNLVFRDAYEYLLPWKRLFGVHESQGCVHVMAGTSSDYNASLSILSVRDRSLTKTL  271

Query  1007  VEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEE  1186
             ++  +R++A+ LYAS LKS+GR +++  L+ +R +QL+Y LSDE A  MFREH +KLVEE
Sbjct  272   IDDVMRESAKSLYASLLKSIGRGLDIGTLIEVRRSQLAYKLSDEIAAEMFREHAKKLVEE  331

Query  1187  NISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             NIS A++ L +R       T+V EE+  IL+FN +L  L N P   RF R
Sbjct  332   NISTALNNLNNR-------TQVVEEVKSILSFNGMLTVLSNFPGEERFVR  374



>gb|KHN46101.1| Protein TIC110-like protein, chloroplastic [Glycine soja]
Length=781

 Score =   260 bits (664),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = +2

Query  827   MHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQ  1006
             MHMEIGR+ FRQRLE GDRD D+EQRRAFQKLIYVSN+VF DASSFLLPWKR+FKVTD+Q
Sbjct  1     MHMEIGRKFFRQRLEVGDRDADVEQRRAFQKLIYVSNLVFGDASSFLLPWKRVFKVTDSQ  60

Query  1007  VEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEE  1186
             +EVAVRDNAQRL+ASKLKSVGRD++ ++LV+LR+ Q    LSDE AE +FR+HTRKLVEE
Sbjct  61    IEVAVRDNAQRLFASKLKSVGRDIDAEKLVALRKEQQLCRLSDELAENLFRDHTRKLVEE  120

Query  1187  NISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             NIS A  ILKSRT+A   AT+   ELDK+LAFNNLLIS KNHPD   FAR
Sbjct  121   NISEANRILKSRTKAVPGATQAIAELDKVLAFNNLLISFKNHPDVDCFAR  170



>gb|EMT20952.1| hypothetical protein F775_05411 [Aegilops tauschii]
Length=282

 Score =   233 bits (593),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 151/228 (66%), Gaps = 23/228 (10%)
 Frame = +2

Query  653   KYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMH  832
             +YGVS Q  AF +ELCD+Y  +V +VLPPG+E L+G EV+ I KFK ALG+DD DAA MH
Sbjct  2     EYGVSTQDAAFKSELCDLYASFVYSVLPPGHEALKGTEVEAIKKFKKALGLDDVDAANMH  61

Query  833   MEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVE  1012
             M                        AFQKLI+VSN+VF DAS F+LPWK +F +TD Q++
Sbjct  62    M-----------------------AAFQKLIFVSNLVFGDASDFILPWKHLFGITDYQID  98

Query  1013  VAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENI  1192
             +A+R+NA+ LYA +LKS+GR +++  L+ +R  QL+Y L DE A  MF+EH +KLV+ENI
Sbjct  99    IAMRENAKILYALELKSIGRGLDIGTLIEVRRVQLAYKLFDEVAADMFKEHAKKLVQENI  158

Query  1193  SRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             S A+SILKS T A    T V  E++ ILAFN LL  L   P   RFAR
Sbjct  159   SSALSILKSNTSAGNIPTEVISEVNSILAFNKLLTVLSKFPQGDRFAR  206



>ref|NP_001176218.1| Os10g0492000 [Oryza sativa Japonica Group]
 dbj|BAH94946.1| Os10g0492000, partial [Oryza sativa Japonica Group]
Length=153

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +2

Query  803   IDDPDAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKR  982
             +DD DAA MHMEIGRRI+R+RLET DRD D+EQRRAFQKLIYVSN+VF DAS+FLLPWKR
Sbjct  1     LDDVDAANMHMEIGRRIYRERLETRDRDADMEQRRAFQKLIYVSNLVFGDASTFLLPWKR  60

Query  983   MFKVTDAQVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFRE  1162
             +F VTD+Q+++A+R+NA+ LYAS+LKS+GR +++  L+ +R AQL+Y LSDE A  MF+E
Sbjct  61    LFGVTDSQIDIAMRENAKILYASQLKSIGRGLDIGTLIEVRRAQLAYKLSDEIAAEMFKE  120

Query  1163  HTRKLVEENISRAVSILKSRTRAPGEATRV  1252
             H +KLV+ENIS A+ I+KSRT+A     R+
Sbjct  121   HAKKLVQENISSALDIVKSRTKAANTQHRL  150



>ref|XP_002464439.1| hypothetical protein SORBIDRAFT_01g018450 [Sorghum bicolor]
 gb|EER91437.1| hypothetical protein SORBIDRAFT_01g018450 [Sorghum bicolor]
Length=782

 Score =   221 bits (564),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 135/170 (79%), Gaps = 2/170 (1%)
 Frame = +2

Query  827   MHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQ  1006
             MHMEIGRRI+R+RLET DRD D+EQRRAFQKLIYVSN+VF DAS+FLLPWKR+F VTD+Q
Sbjct  1     MHMEIGRRIYRERLETSDRDADMEQRRAFQKLIYVSNLVFGDASAFLLPWKRLFGVTDSQ  60

Query  1007  VEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEE  1186
             +++A+R+NA+ LY+ +LKS+GR ++   L+ +R AQL+Y LSDE A  MFREH +KLV++
Sbjct  61    IDIAMRENAKSLYSVQLKSIGRGLDTGTLIDVRRAQLAYKLSDEIAAEMFREHVKKLVQD  120

Query  1187  NISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             NIS A+ ILKSR   P   T+  EE++ ++ FN+LL +L  HP A  FAR
Sbjct  121   NISSALDILKSRI--PDSLTQAVEEVNIVIKFNSLLTTLSKHPQADHFAR  168



>dbj|BAF93191.1| putative chloroplast inner envelope protein [Hordeum vulgare]
Length=162

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 131/174 (75%), Gaps = 12/174 (7%)
 Frame = +2

Query  710   CRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLETGDRDG  889
               +V +VLPPG+EDL+G EV+ I KFK ALG+DD DAA+MH+ IGRR++R+RL+      
Sbjct  1     ASFVYSVLPPGHEDLKGTEVEAIKKFKKALGLDDVDAASMHLAIGRRLYRERLD------  54

Query  890   DLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKSVG  1069
                   AFQKLI+VSN+VF DAS F+LPWK +F +TD Q+++A+R+NA+ LYA +LKS+G
Sbjct  55    ------AFQKLIFVSNLVFGDASDFILPWKHLFGITDYQIDIAMRENAKSLYALELKSIG  108

Query  1070  RDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRA  1231
             R +++  L+ +R  QL+Y L DE A  MF+EH +KL++EN+S A+SILKS T A
Sbjct  109   RGLDIGTLIEVRRIQLAYKLFDEVAADMFKEHAKKLIQENVSSALSILKSNTSA  162



>gb|EEE51192.1| hypothetical protein OsJ_31999 [Oryza sativa Japonica Group]
Length=330

 Score =   205 bits (522),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 109/242 (45%), Positives = 154/242 (64%), Gaps = 46/242 (19%)
 Frame = +2

Query  653   KYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMH  832
             +YGVS +   F AELCD+Y R+V +++ PG EDL G EV+TIIKFK ALG++D DAA +H
Sbjct  37    RYGVSPEDATFKAELCDLYGRFVFSLIHPGYEDLEGTEVETIIKFKKALGLNDIDAANVH  96

Query  833   MEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQ--  1006
             MEI +RI        DR+  + Q++AF+KLI+V+N+VFRDA  +LLPWKR+F V ++Q  
Sbjct  97    MEIAKRI--------DRNAGVGQQQAFEKLIFVTNLVFRDAYEYLLPWKRLFGVHESQGC  148

Query  1007  -----------------------------VEVAVRDNAQRLYASKLKSVGRDVNVDQLVS  1099
                                          ++  +R++A+ LYAS LKS+GR +++  L+ 
Sbjct  149   VHVMAGTSSDYNASLSIMSVRDRSLTKTLIDDVMRESAKSLYASLLKSIGRGLDIGTLIE  208

Query  1100  LREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEATRVTEELDKILA  1279
             +R +QL+Y LSDE A  MFREH +KLVEENIS A++ L +R       T+V EE+  IL+
Sbjct  209   VRRSQLAYKLSDEIASEMFREHAKKLVEENISTALNNLNNR-------TQVVEEVKSILS  261

Query  1280  FN  1285
             FN
Sbjct  262   FN  263



>gb|EMS45726.1| hypothetical protein TRIUR3_05353 [Triticum urartu]
Length=224

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 105/144 (73%), Gaps = 0/144 (0%)
 Frame = +2

Query  905   RAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKSVGRDVNV  1084
             +AFQKLI+VSN+VF DAS F+LPWK +F +TD Q+++A+R+NA+ LYA +LKS+GR +++
Sbjct  5     KAFQKLIFVSNLVFGDASDFILPWKHLFGITDYQIDIAMRENAKSLYALELKSIGRGLDI  64

Query  1085  DQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEATRVTEEL  1264
               L+ +R  QL+Y L DE A  MF+EH +KL++ENIS A+SILKS T A    T V  E+
Sbjct  65    GTLIEVRRVQLAYKLFDEVAADMFKEHAKKLIQENISSALSILKSNTSAGNIPTEVINEV  124

Query  1265  DKILAFNNLLISLKNHPDASRFAR  1336
             + ILAFN LL  L   P   RFAR
Sbjct  125   NSILAFNRLLTVLSKFPQGERFAR  148



>ref|XP_006661895.1| PREDICTED: protein TIC110, chloroplastic-like [Oryza brachyantha]
Length=227

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 117/168 (70%), Gaps = 15/168 (9%)
 Frame = +2

Query  833   MEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVE  1012
             MEIG+RI        DRD  + Q++AFQKLI+V+N+VFRDAS FLLPWKR+F V ++Q++
Sbjct  1     MEIGKRI--------DRDAGIGQQQAFQKLIFVTNLVFRDASEFLLPWKRLFGVHESQID  52

Query  1013  VAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENI  1192
               +R++A+ LYAS LKS+GR +++  L+ +R AQL+Y LSDE A  MFREH +KL+EENI
Sbjct  53    NVMRESAKSLYASLLKSIGRGLDIGTLIEVRRAQLAYKLSDEIAAEMFREHAKKLLEENI  112

Query  1193  SRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             S A+  L +R       T+V +E+  ILAFN+LL  L   P   RF R
Sbjct  113   SSALDNLNNR-------TQVVDEVKSILAFNSLLTILSKFPGEERFIR  153



>dbj|BAJ93915.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 107/151 (71%), Gaps = 0/151 (0%)
 Frame = +2

Query  884   DGDLEQRRAFQKLIYVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKS  1063
             D   E+  AFQKLI+VSN+VF DAS F+LPWK +F +TD Q+++A+R+NA+ LYA +LKS
Sbjct  64    DAYTERLDAFQKLIFVSNLVFGDASDFILPWKHLFGITDYQIDIAMRENAKSLYALELKS  123

Query  1064  VGRDVNVDQLVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEA  1243
             +GR +++  L+ +R  QL+Y L DE A  MF+EH +KL++EN+S A+SILKS T A    
Sbjct  124   IGRGLDIGTLIEVRRVQLAYKLFDEVAADMFKEHAKKLIQENVSSALSILKSNTSAGNIP  183

Query  1244  TRVTEELDKILAFNNLLISLKNHPDASRFAR  1336
             T V  E++ ILAFN LL  L   P   RFAR
Sbjct  184   TEVINEVNSILAFNRLLTVLSKFPQGDRFAR  214



>ref|XP_002957380.1| hypothetical protein VOLCADRAFT_98450 [Volvox carteri f. nagariensis]
 gb|EFJ41589.1| hypothetical protein VOLCADRAFT_98450 [Volvox carteri f. nagariensis]
Length=1055

 Score =   171 bits (434),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 97/259 (37%), Positives = 155/259 (60%), Gaps = 10/259 (4%)
 Frame = +2

Query  569   AAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNE  748
             A V+L+N +    D   L  E +  +  KYG++ Q +  +  L  IY +Y+ +V+P G+ 
Sbjct  145   AVVDLYNALVDLPDATDLTPETVSDVGSKYGINFQKDELDG-LKRIYGQYLESVIPVGDV  203

Query  749   DLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIY  928
              L+GDE   +  FK+ LG+ D DAA +H+E+GRR  R+  ET DR+   E+R+AFQ+LIY
Sbjct  204   QLKGDEAAKVAAFKDILGLADEDAAPVHIEVGRRFMREGFETKDRNAVFEKRKAFQRLIY  263

Query  929   VSNIVFRDA-SSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKSVGRDVNVDQLV--S  1099
             VS +VF D  ++FLLPW+R F + DAQ+ VA RDNA+ ++   L++ G  +  D+ V   
Sbjct  264   VSQVVFGDQKAAFLLPWRRTFNLNDAQIFVARRDNARAIFRQYLEARGGMLPADRHVLRE  323

Query  1100  LREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTR---APGEATRVT---EE  1261
             LRE Q +  L DE A  + R+  R+ +E +++RA+ + KS  +     G+A  +T   EE
Sbjct  324   LREKQTAIKLMDETAAEVVRDAARRTIESHLTRAIEVAKSTGKELTCAGKARDITLLVEE  383

Query  1262  LDKILAFNNLLISLKNHPD  1318
             +D +L ++  L+   +  D
Sbjct  384   VDAVLEYDRKLVKYGSEDD  402



>gb|AHA84145.1| chloroplast inner envelope protein, partial [Phaseolus vulgaris]
Length=223

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = +2

Query  353  RELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggavalgaagag  532
            ++L GI+ LVD +SPP R+A+SAI+ AGAVAAGYGLG RFGG+R A LGGAVALGAAG  
Sbjct  56   KDLKGIEVLVDKLSPPARLAASAIVVAGAVAAGYGLGSRFGGNRYAALGGAVALGAAGGA  115

Query  533  aayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAELCDIYC  712
            AAYALNA AP+VAAVNLHNYVA  DDP+ LKKE+IDAIA KYGVSKQ EAF AE+CDI  
Sbjct  116  AAYALNASAPQVAAVNLHNYVAAFDDPSKLKKEEIDAIASKYGVSKQDEAFKAEICDINS  175

Query  713  RYVTAVLPPGNEDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIF  856
             +V +V+PPG E+L+GD+VD    FK +LGIDDPDAAAMH+EIGR+IF
Sbjct  176  EFVFSVVPPGGEELKGDKVDKDGAFKISLGIDDPDAAAMHVEIGRKIF  223



>emb|CDP09260.1| unnamed protein product [Coffea canephora]
Length=202

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 155/204 (76%), Gaps = 6/204 (3%)
 Frame = +2

Query  116  MNPSLLLSTNPS-PNRKALFSPFLSPAPLRLTAASRNRYHFRYRIsavssssdqpstsis  292
            M+ S+ L+  PS    K LFSPFL P PLRL+  +   YH   R       + + ++  +
Sbjct  1    MDTSIFLTVRPSVAQPKVLFSPFLPPNPLRLS--TTPAYHQSRRRRRYRIPTIRSASIPT  58

Query  293  ssagtaaaaiPV---QPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLG  463
            S + ++++  P+   +PDVFGGK+EL+G QALVD+MSP +RIASSA+IFAGA+AAGYGLG
Sbjct  59   SLSASSSSDQPIKAIEPDVFGGKKELTGFQALVDAMSPTVRIASSALIFAGAIAAGYGLG  118

Query  464  FRFGGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDA  643
             +FGGSRN  +GGAVALG AGAG AYALN+C PEVAAVNLHNYVA  DDPAAL KED++A
Sbjct  119  SKFGGSRNVAMGGAVALGTAGAGVAYALNSCVPEVAAVNLHNYVADFDDPAALNKEDVEA  178

Query  644  IAKKYGVSKQHEAFNAELCDIYCR  715
            IA +YG+SKQ+EAFNAELCDIYCR
Sbjct  179  IANRYGISKQNEAFNAELCDIYCR  202



>ref|XP_005643849.1| hypothetical protein COCSUDRAFT_31183 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19305.1| hypothetical protein COCSUDRAFT_31183 [Coccomyxa subellipsoidea 
C-169]
Length=1104

 Score =   164 bits (415),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 97/252 (38%), Positives = 147/252 (58%), Gaps = 5/252 (2%)
 Frame = +2

Query  569   AAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNE  748
             A V LHN +   DDP+ + +E++ AI  + G +   +  + EL  +Y  Y+   +PPG+ 
Sbjct  160   AGVLLHNALVDKDDPSTVTREEVAAIGDRVGANLSVKLVD-ELKRVYDAYLENTVPPGDL  218

Query  749   DLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIY  928
              L+GDE D I  FK+A+G+ D DAA +H+++GRRI R R E G R G  EQ RA QKLIY
Sbjct  219   PLKGDEADRIKAFKDAIGLADEDAAPVHIDVGRRIMRSRFEAGSRSGSSEQFRALQKLIY  278

Query  929   VSNIVF-RDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKSVGR--DVNVDQLVS  1099
             VS++VF    ++FLLPW+R+F ++D+ + VA R+NA+ L+ S +K+ G     N   L  
Sbjct  279   VSDLVFGAQKAAFLLPWRRVFNLSDSSLYVARRENAKALFHSFIKARGGVLQANRAALAE  338

Query  1100  LREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEATRVTEELDKILA  1279
             L+  Q    L DE A    +E  R  VE  + R +   K RTR   + + V + + + +A
Sbjct  339   LKALQDKVRLEDEIASEAVKEAARAHVEAVLDRGIEATKRRTRVR-DYSDVVKAVKEAIA  397

Query  1280  FNNLLISLKNHP  1315
             ++  L SL + P
Sbjct  398   YSRALASLADDP  409



>ref|XP_002892366.1| hypothetical protein ARALYDRAFT_887896 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68625.1| hypothetical protein ARALYDRAFT_887896 [Arabidopsis lyrata subsp. 
lyrata]
Length=150

 Score =   149 bits (375),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 101/146 (69%), Gaps = 16/146 (11%)
 Frame = +2

Query  839   IGRRIFRQRLETGDRDGDLEQRR---------------AFQKLIYVSNIVFRDASSFLLP  973
             IGRRIFRQRLETG+R+GD EQRR               AF +L+YVS +VF DASSFLLP
Sbjct  5     IGRRIFRQRLETGEREGDAEQRRKESISVITSCMLPVQAFMRLVYVSALVFGDASSFLLP  64

Query  974   WKRMFKVTDAQVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGM  1153
             WKR+ KVTDAQ+   +      L+    K V   +NV+ LV L++AQLS+ LSDE AE +
Sbjct  65    WKRVLKVTDAQL-FFINLMHGNLHGYVSKHVLTAINVENLVDLKKAQLSFKLSDELAEDL  123

Query  1154  FREHTRKLVEENISRAVSILKSRTRA  1231
             FREHTR++V ENIS A+SILKSRT A
Sbjct  124   FREHTRRVVVENISSALSILKSRTLA  149



>ref|XP_005844387.1| hypothetical protein CHLNCDRAFT_139027 [Chlorella variabilis]
 gb|EFN52285.1| hypothetical protein CHLNCDRAFT_139027 [Chlorella variabilis]
Length=1083

 Score =   155 bits (392),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 112/261 (43%), Positives = 149/261 (57%), Gaps = 14/261 (5%)
 Frame = +2

Query  569   AAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNA-ELCDIYCRYVTAVLPPGN  745
             A + L N +    DP AL +E + AI  KYG S    A N  EL  IY  ++ AV+PPG+
Sbjct  137   AIIELSNLLVEMGDPTALTREQVAAIEAKYGAS--LAATNPDELKSIYGAFLEAVVPPGD  194

Query  746   EDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLI  925
               L G E   I  FK AL + D DAA  H+E+GRRI R R+E G R  D+E R+ FQKLI
Sbjct  195   APLTGSEPVLIQAFKAALALSDVDAAPAHIEVGRRILRGRMEAGSRADDVEARKTFQKLI  254

Query  926   YVSNIVFRD-ASSFLLPWKRMFKVTDAQ-------VEVAVRDNAQRLYASKLKSVGRDVN  1081
             YVSN+VF D  ++FLLPW R+F +T+AQ       V VA RDNA+ ++   L S G  + 
Sbjct  255   YVSNLVFGDRQAAFLLPWTRVFGLTEAQASARLSCVYVAKRDNAKGIFKQYLDSHGGQLQ  314

Query  1082  VDQ--LVSLREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEATRVT  1255
              D+  LV LR+AQ +  L+D+ A  + +E  R  VEE +  AV   K RTR   + T   
Sbjct  315   ADKAFLVGLRQAQAAARLADDEAAALVKEAARARVEELLESAVKSTKQRTRTR-DYTEAM  373

Query  1256  EELDKILAFNNLLISLKNHPD  1318
               L   +AFN  L +L + P+
Sbjct  374   AALTAAVAFNRGLAALSSDPE  394



>gb|KIY91916.1| hypothetical protein MNEG_16047 [Monoraphidium neglectum]
Length=210

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 106/166 (64%), Gaps = 2/166 (1%)
 Frame = +2

Query  566   VAAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGN  745
              A V+L N +   DDP+ L  +D+  +  KYG++ Q E     L  I+ +Y+  ++P G+
Sbjct  26    AAVVDLFNLLVALDDPSELTADDVSGVGAKYGINMQKEQMTG-LQQIFGQYLENIIPAGD  84

Query  746   EDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLI  925
               LRGDE   +I FK ALG+ D +AA + +E+GRR+ R   ET +R    EQR+AFQ+LI
Sbjct  85    TQLRGDEAPKLILFKEALGLGDEEAAPVFIEVGRRLSRAGYETKERSQQFEQRKAFQRLI  144

Query  926   YVSNIVFRDA-SSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKLK  1060
             YVS  VF D  ++FLLPW+R+F + D+Q+ VA RDNA+ ++   L+
Sbjct  145   YVSYAVFGDQKAAFLLPWRRVFNLNDSQLFVARRDNARAIFNQHLR  190



>ref|XP_007508341.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20445.1| predicted protein [Bathycoccus prasinos]
Length=1053

 Score =   152 bits (383),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 82/233 (35%), Positives = 143/233 (61%), Gaps = 5/233 (2%)
 Frame = +2

Query  608   DPAALKKEDIDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKF  787
             +P ++   ++ A+ +++G++        E+C +Y  Y+++++P G+  ++G E + + +F
Sbjct  145   NPLSVDASEVQAVGQRFGINNIGTQCPREICGLYDAYLSSLIPMGDAPVKGWEPEALRQF  204

Query  788   KNALGIDDPDAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVF-RDASSF  964
             +  LG++D +AA  H+E+GRR++R+R+E GD+D +LE R  FQKL+Y+S + F  + + F
Sbjct  205   RETLGLEDSEAAQAHLEVGRRLYRKRIELGDKDTELESRVEFQKLVYISQMTFGEEKARF  264

Query  965   LLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKSVGRDVNVDQ--LVSLRE-AQLSYLLSD  1135
             +LPW+R+F+VTDAQV +A++DNA +L+ + L   G   NVD   L   +E A    LLSD
Sbjct  265   MLPWRRVFRVTDAQVALALKDNASQLFRTFLVDNGAVANVDANGLAEAKEYANGDLLLSD  324

Query  1136  EFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLL  1294
             + A  + +   R  V E +  A  I K R  A    T V ++++ IL +N  L
Sbjct  325   DIAGEIVQSEARAHVVEIVESASEIAKQRGSARDVDT-VEKKIESILDYNGRL  376



>ref|XP_011395978.1| hypothetical protein F751_3299 [Auxenochlorella protothecoides]
 gb|KFM23108.1| hypothetical protein F751_3299 [Auxenochlorella protothecoides]
Length=1080

 Score =   150 bits (379),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 100/252 (40%), Positives = 136/252 (54%), Gaps = 12/252 (5%)
 Frame = +2

Query  569   AAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAELC-DIYCRYVTAVLPPGN  745
             A   LHN +      + L ++ + A+  + G      A + E    +Y  ++ A +P G+
Sbjct  140   AVAQLHNLLVSLPRASDLTRDQVAALEAQAGAP--LAAIDPEAVKSLYGTFIEATIPAGD  197

Query  746   EDLRGDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLI  925
               LRGDE   I  FK  LG+DD  A  +H+++GRRI R RLE G R  D     AFQKLI
Sbjct  198   APLRGDEHTRISAFKQTLGLDDEAAGPVHVDVGRRILRGRLEAGSRRED-----AFQKLI  252

Query  926   YVSNIVFRDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKSVGRDVNVDQ--LVS  1099
             YVS +VF +  S+L PW R F +TDAQV VA RDNA+ L+ + L + G  +   Q  L S
Sbjct  253   YVSYLVFAE-RSYLTPWARAFGLTDAQVYVARRDNARALFQAALAARGGVLVPTQEALTS  311

Query  1100  LREAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEATRVTEELDKILA  1279
             LRE + S  L+DE AEG+ RE  R  ++    RA+S++K R R    A  V  EL   + 
Sbjct  312   LREVKESVRLADEEAEGVVREAARATLQGFFDRALSVVKRRARQRDLAEAVA-ELRGAVE  370

Query  1280  FNNLLISLKNHP  1315
             FN  L  L   P
Sbjct  371   FNRALARLAGAP  382



>ref|XP_002889630.1| hypothetical protein ARALYDRAFT_887909 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65889.1| hypothetical protein ARALYDRAFT_887909 [Arabidopsis lyrata subsp. 
lyrata]
Length=806

 Score =   142 bits (358),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 102/180 (57%), Gaps = 61/180 (34%)
 Frame = +2

Query  839   IGRRIFRQRLETGDRDGDLEQRR---------------AFQKLIYVSNIVFRDASSFLLP  973
             IGRRIFRQRLETG+R+GD EQRR               AF +L+YVS +VF DASSFLLP
Sbjct  240   IGRRIFRQRLETGEREGDAEQRRKESISVITSCMLPVQAFMRLVYVSALVFGDASSFLLP  299

Query  974   WKRMFKVTDAQVEVAVRDNAQRLYASKLKSVGRDVNVDQLVSLREAQLSYLLSDEFAEGM  1153
             WKR+ KVTDAQ+                                            AE +
Sbjct  300   WKRVLKVTDAQL--------------------------------------------AEDL  315

Query  1154  FREHTRKLVEENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPDASRFA  1333
             FREHTRK+V ENIS A+SILKSRT A      V EEL+K+L FNNLL+SLK+H +A +FA
Sbjct  316   FREHTRKVVVENISSALSILKSRTLAA--LASVVEELEKVLEFNNLLVSLKSHSEADQFA  373



>ref|XP_003061195.1| chloroplast envelope anion channel-forming Tic110 family [Micromonas 
pusilla CCMP1545]
 gb|EEH54845.1| chloroplast envelope anion channel-forming Tic110 family [Micromonas 
pusilla CCMP1545]
Length=845

 Score =   141 bits (356),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 107/152 (70%), Gaps = 1/152 (1%)
 Frame = +2

Query  608   DPAALKKEDIDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKF  787
             DPA + K D+DAI  ++G++   +     + ++Y  Y+ +++P G+E ++G E + +  F
Sbjct  5     DPATITKADVDAIGARFGMNDMAKQCPEAVTELYDAYLMSIIPMGDEPVQGWEPEALTNF  64

Query  788   KNALGIDDPDAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASS-F  964
             +  LG++D DAA  H+E+GRR+FR+R+E GD+D DLE RR FQKL+++S   F +  + F
Sbjct  65    RRRLGLEDHDAANAHIEVGRRLFRKRIELGDKDADLESRREFQKLVFISTRTFGEKQAKF  124

Query  965   LLPWKRMFKVTDAQVEVAVRDNAQRLYASKLK  1060
             LLPW R+F+V+DAQV +A++++A +L  ++L+
Sbjct  125   LLPWNRIFRVSDAQVTLALKESASKLLKTRLE  156



>ref|XP_003080534.1| chloroplast inner envelope protein-related (ISS) [Ostreococcus 
tauri]
Length=1174

 Score =   141 bits (355),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/234 (35%), Positives = 142/234 (61%), Gaps = 6/234 (3%)
 Frame = +2

Query  608   DPAALKKEDIDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKF  787
             DP ++  E++ A+  ++G+S   +A + EL ++Y  Y+ +++P G + ++G E   + +F
Sbjct  103   DPLSVSPEEVAAVGARFGISNFGQACSTELTELYDVYLMSLVPQGMDPVQGWEAAALAQF  162

Query  788   KNALGIDDPDAAAMHMEIGRRIFRQRLETG--DRDGDLEQRRAFQKLIYVSNIVF-RDAS  958
             +  LGIDD  AA  H+E GRR+FR+R+E G  D+D DLE R+ FQKL+++S   F  + +
Sbjct  163   RGTLGIDDASAAQAHLEAGRRLFRKRIELGSADKDTDLESRKEFQKLVFISTQTFGEEQA  222

Query  959   SFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKS--VGRDVNVDQLVSLREAQLSYLLS  1132
              FLLPWKR+F+V+DAQV++A RDNA +L  + L +     +V+   + +  + + S  L 
Sbjct  223   RFLLPWKRVFRVSDAQVDLANRDNASQLLRTSLSNSNAIANVDAAAIAAGADYKASLNLD  282

Query  1133  DEFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLL  1294
             D+ A  + R+     V   ++  +S+ K R  A   A+ + + +D++L +N  L
Sbjct  283   DDAAGEIARDLATAHVAGIVNATISLNKERGSARDVAS-ICKNIDEVLGYNAKL  335



>emb|CEF98872.1| unnamed product [Ostreococcus tauri]
Length=1035

 Score =   140 bits (352),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 81/234 (35%), Positives = 142/234 (61%), Gaps = 6/234 (3%)
 Frame = +2

Query  608   DPAALKKEDIDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKF  787
             DP ++  E++ A+  ++G+S   +A + EL ++Y  Y+ +++P G + ++G E   + +F
Sbjct  143   DPLSVSPEEVAAVGARFGISNFGQACSTELTELYDVYLMSLVPQGMDPVQGWEAAALAQF  202

Query  788   KNALGIDDPDAAAMHMEIGRRIFRQRLETG--DRDGDLEQRRAFQKLIYVSNIVF-RDAS  958
             +  LGIDD  AA  H+E GRR+FR+R+E G  D+D DLE R+ FQKL+++S   F  + +
Sbjct  203   RGTLGIDDASAAQAHLEAGRRLFRKRIELGSADKDTDLESRKEFQKLVFISTQTFGEEQA  262

Query  959   SFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKS--VGRDVNVDQLVSLREAQLSYLLS  1132
              FLLPWKR+F+V+DAQV++A RDNA +L  + L +     +V+   + +  + + S  L 
Sbjct  263   RFLLPWKRVFRVSDAQVDLANRDNASQLLRTSLSNSNAIANVDAAAIAAGADYKASLNLD  322

Query  1133  DEFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLL  1294
             D+ A  + R+     V   ++  +S+ K R  A   A+ + + +D++L +N  L
Sbjct  323   DDAAGEIARDLATAHVAGIVNATISLNKERGSARDVAS-ICKNIDEVLGYNAKL  375



>ref|XP_002503178.1| chloroplast envelope anion channel-forming Tic110 family [Micromonas 
sp. RCC299]
 gb|ACO64436.1| chloroplast envelope anion channel-forming Tic110 family [Micromonas 
sp. RCC299]
Length=1038

 Score =   139 bits (351),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 105/155 (68%), Gaps = 1/155 (1%)
 Frame = +2

Query  608   DPAALKKEDIDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLRGDEVDTIIKF  787
             DPA + K D+DAI  K+G+    +     + ++Y  Y+ +++P G++ ++G E + +  F
Sbjct  144   DPATITKADVDAIGAKFGMKDMSKDCPEAVTELYDAYLQSIVPMGDDPVQGWEPEALRNF  203

Query  788   KNALGIDDPDAAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDASS-F  964
             +  LG++D DAA  H+E+GRR+FR+R+E GD+D DLE RR FQKL+++S   F +  + F
Sbjct  204   RQQLGLEDADAANAHIEVGRRLFRKRIELGDKDADLESRREFQKLVFISTRTFGEKQAKF  263

Query  965   LLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKSVG  1069
             LLPW R+F+V+DAQV +A++++A  L+ + +   G
Sbjct  264   LLPWNRIFRVSDAQVTLAMKESASNLFKNHVNESG  298



>ref|XP_001418787.1| Tic110 family transporter: chloroplast inner envelope protein 
Tic110 [Ostreococcus lucimarinus CCE9901]
 gb|ABO97080.1| Tic110 family transporter: chloroplast inner envelope protein 
Tic110 [Ostreococcus lucimarinus CCE9901]
Length=901

 Score =   138 bits (348),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/241 (33%), Positives = 144/241 (60%), Gaps = 7/241 (3%)
 Frame = +2

Query  578   NLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNEDLR  757
             +L N + G  DP ++  E+++A+  K+G++   ++    + ++Y  Y+ +++P G + ++
Sbjct  39    SLWNSLQG-RDPLSVTAEEVNAMGAKFGIANMGQSCATAMTELYDVYLMSLVPQGLDPVQ  97

Query  758   GDEVDTIIKFKNALGIDDPDAAAMHMEIGRRIFRQRLETG--DRDGDLEQRRAFQKLIYV  931
             G E   + +F+  LGIDD  AA  H+E GRR+FR+R+E G  D++ DLE R+ FQKL+++
Sbjct  98    GWEAAALAQFRQTLGIDDASAAQAHLEAGRRLFRKRIELGSTDKETDLESRKEFQKLVFI  157

Query  932   SNIVF-RDASSFLLPWKRMFKVTDAQVEVAVRDNAQRLYASKLKSVGRDVNVD--QLVSL  1102
             S   F  + + FLLPWKR+F+V+DAQV++A RDNA +L  + L       NVD   + S 
Sbjct  158   STQTFGEEQARFLLPWKRVFRVSDAQVDLANRDNASQLLRTSLSKSNAIANVDAAAIASA  217

Query  1103  REAQLSYLLSDEFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEATRVTEELDKILAF  1282
              + + S  L D+ A  + ++     V   ++  +++ K R  A    T + + ++++LA+
Sbjct  218   ADYKASLNLDDDAAGEIAQDLATAHVAGIVNGTITLNKERGSARDVGT-ICKNVEQVLAY  276

Query  1283  N  1285
             N
Sbjct  277   N  277



>gb|KIY98725.1| hypothetical protein MNEG_9237, partial [Monoraphidium neglectum]
Length=889

 Score =   127 bits (318),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 96/291 (33%), Positives = 142/291 (49%), Gaps = 47/291 (16%)
 Frame = +2

Query  569   AAVNLHNYVAGCDDPAALKKEDIDAIAKKYGVSKQHEAFNAELCDIYCRYVTAVLPPGNE  748
             A V+L N +   D+P+AL  +D+ A+  KYGV+ + +     L  I+ +Y+  V+P G+ 
Sbjct  120   AVVDLFNLLVYMDEPSALTPDDVSAVGAKYGVNMRRDQLEG-LVQIFGQYLEGVVPKGDA  178

Query  749   DLR-------------------------------------GDEVDTIIKFKNALGIDDPD  817
              LR                                     GDE   I+ FK+AL + D +
Sbjct  179   PLRRRPGGLAAAAWGMGPPASRADSAPGTWHAAAAAGRAGGDEASKILAFKDALSLTDEE  238

Query  818   AAAMHMEIGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRDA-SSFLLPWKRMFKV  994
             AA   +E+GRR+ R   E   R    EQR+AFQ+LIY+S     D  +  LLPW   F +
Sbjct  239   AAPAFIEVGRRLSRAGFEIQGRQAQFEQRKAFQRLIYLSYAALGDQKAGTLLPWGAEFGL  298

Query  995   TDAQVEVAVRDNAQRLYASK-LKSVGRDV--NVDQLVSLREAQLSYLLSDEFAEGMFREH  1165
              DAQ+ VA RDNA+ ++    L+S G D+  + D L +LRE Q +  L D+ AE   R  
Sbjct  299   NDAQLFVARRDNARAVFGQHLLESYGGDLPADADALRALREFQGTVKLLDDVAEDSVRAA  358

Query  1166  TRKLVEENISRAVSILKS--RTRAPGEATRVTEELDKILAFNNLLISLKNH  1312
              R  VE  ++ A+  L++   TR  G   RV EE+  IL ++  L +L   
Sbjct  359   ARSHVERQLAAALEQLRAPISTRDVG---RVVEEVHAILDYSRRLQALAGE  406



>gb|AAF82224.1|AC067971_32 Strong similarity to an import intermediate-associated 100K protein 
precursor - garden pea from Pisum sativum gb|Z68506. 
EST gb|W43650 comes from this gene. This gene may be cut off, 
partial [Arabidopsis thaliana]
Length=195

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 94/207 (45%), Positives = 130/207 (63%), Gaps = 19/207 (9%)
 Frame = +2

Query  116  MNPSLLLSTN----PSPNRKALFSPFLSPAPLRLTAA---SRNRYHFRYRIsavssssdq  274
            MNPSL+ + N    PSP R  L S FL   P R + +   SR RY   +  S+ +SS   
Sbjct  1    MNPSLVTAINAPISPSP-RSPLLSHFLPTLPHRFSKSECLSRRRYRVSFPRSSAASSDQL  59

Query  275  pstsisssagtaaaaiPVQPDVFGGKRELSGIQALVDsmsppiriassaiifagavaaGY  454
              ++ +             P + G K+EL+G+Q +V+ M+PP+R+A+SA++ A ++A GY
Sbjct  60   SVSTQAK-----------NPGIHGNKKELTGLQPIVEKMTPPVRLATSAVVLAASLATGY  108

Query  455  GLGFRFGGSRNaglggavalgaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKED  634
            GLG R  GSRN   GGA   GAAG    YALN+  PEVAA++LHNYVA  +DPA++ K+D
Sbjct  109  GLGLRLAGSRNIAFGGAAVAGAAGGAVVYALNSAVPEVAAISLHNYVAEFEDPASVTKDD  168

Query  635  IDAIAKKYGVSKQHEAFNAELCDIYCR  715
            ++ IA +YGV+K  EAF AE+CDIYCR
Sbjct  169  VEKIADRYGVNKGDEAFQAEICDIYCR  195



>ref|XP_001698524.1| 110 kDa translocon of chloroplast envelope inner membrane [Chlamydomonas 
reinhardtii]
 gb|EDP08017.1| 110 kDa translocon of chloroplast envelope inner membrane, partial 
[Chlamydomonas reinhardtii]
Length=703

 Score =   102 bits (253),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 96/163 (59%), Gaps = 13/163 (8%)
 Frame = +2

Query  839   IGRRIFRQRLETGDRDGDLEQRRAFQKLIYVSNIVFRD-ASSFLLPWKRMFKVTDAQVEV  1015
             +GRR+ R+  ET DR+   E+R+AFQ+LIYVS +VF D  ++FLLPW+R F + DAQ+ V
Sbjct  1     VGRRMMREGFETKDRNAVFEKRKAFQRLIYVSQVVFGDQKAAFLLPWRRTFNLNDAQIFV  60

Query  1016  AVRDNAQRLYASKLKSVGRDVNVDQ--LVSLREAQLSYLLSDEFAEGMFREHTRKLVEEN  1189
             A RDNA+ ++   L++ G  +  D+  L  LRE Q +  L DE A  + +E  RK VE +
Sbjct  61    ARRDNARAIFRQFLEARGGALPADRHFLRELREKQTAIKLFDETAAEVVKEAARKTVEAH  120

Query  1190  ISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHPD  1318
             +S+A+  + S          +  E+D +L +   L+   +  D
Sbjct  121   LSKAMRDVAS----------LVAEVDALLEYERKLVRYGSEDD  153



>ref|XP_008385016.1| PREDICTED: protein TIC110, chloroplastic-like [Malus domestica]
Length=680

 Score = 89.7 bits (221),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +2

Query  1136  EFAEGMFREHTRKLVEENISRAVSILKSRTRAPGEATRVTEELDKILAFNNLLISLKNHP  1315
             + AE +F+EH  KLVE NIS A+ ILKSRTR+    T V EELDK+L  NNLLISLKNHP
Sbjct  2     QHAEDLFKEHAXKLVEANISAALRILKSRTRSATGITEVVEELDKMLELNNLLISLKNHP  61

Query  1316  DASRFA  1333
             DA+RFA
Sbjct  62    DAARFA  67



>gb|AER92593.1| hypothetical protein [Linum usitatissimum]
Length=180

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  335  DVFGGKRELSGIQALVDsmsppiriassaiifagavaaGYGLGFRFGGSRNaglggaval  514
             VFGG++EL+GIQ LVDS+ PP+R+  SA+I AGAVAAGYGLG RFGG+RN  +GGA A+
Sbjct  72   SVFGGRKELTGIQPLVDSLPPPVRLTCSAVILAGAVAAGYGLGQRFGGTRNLAIGGAAAM  131

Query  515  gaagagaayalnacaPEVAAVNLHNYVAGCDDPAALKKEDIDAIAKK  655
            GAAG    YALNAC PEVAA +LHNYV G DDP  ++K+++D I KK
Sbjct  132  GAAGGAMVYALNACVPEVAAASLHNYVVGLDDPKGVEKDEVDQIVKK  178



>gb|AFW87324.1| hypothetical protein ZEAMMB73_975143 [Zea mays]
Length=206

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = +2

Query  800  GIDDPDAAAMHMEIGRRIFRQRLETGDRDGDLEQRRA-FQKLIY  928
            G+DD DAA MHMEI RRI+ +RLET DRD D+EQR A    LIY
Sbjct  162  GLDDVDAANMHMEISRRIYGERLETSDRDVDMEQRWACVYALIY  205



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3914270563976