BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3784

Length=602
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009619733.1|  PREDICTED: probable beta-1,3-galactosyltrans...    127   3e-32   Nicotiana tomentosiformis
ref|XP_009775405.1|  PREDICTED: probable beta-1,3-galactosyltrans...    124   2e-30   Nicotiana sylvestris
ref|XP_009604808.1|  PREDICTED: probable beta-1,3-galactosyltrans...    119   3e-28   Nicotiana tomentosiformis
ref|XP_009794167.1|  PREDICTED: probable beta-1,3-galactosyltrans...    116   2e-27   Nicotiana sylvestris
ref|XP_011082755.1|  PREDICTED: probable beta-1,3-galactosyltrans...    116   3e-27   Sesamum indicum [beniseed]
ref|XP_004244265.1|  PREDICTED: probable beta-1,3-galactosyltrans...    113   3e-26   Solanum lycopersicum
ref|XP_011098232.1|  PREDICTED: probable beta-1,3-galactosyltrans...    112   5e-26   Sesamum indicum [beniseed]
ref|XP_006360051.1|  PREDICTED: probable beta-1,3-galactosyltrans...    112   7e-26   Solanum tuberosum [potatoes]
gb|EYU26331.1|  hypothetical protein MIMGU_mgv1a009062mg                108   2e-24   Erythranthe guttata [common monkey flower]
ref|XP_006348294.1|  PREDICTED: probable beta-1,3-galactosyltrans...    108   3e-24   Solanum tuberosum [potatoes]
ref|XP_004248247.1|  PREDICTED: probable beta-1,3-galactosyltrans...    107   3e-24   Solanum lycopersicum
ref|XP_003556804.1|  PREDICTED: probable beta-1,3-galactosyltrans...    100   1e-21   Glycine max [soybeans]
gb|KJB61588.1|  hypothetical protein B456_009G368400                  99.4    2e-21   Gossypium raimondii
emb|CDP05998.1|  unnamed protein product                              97.4    9e-21   Coffea canephora [robusta coffee]
gb|KJB61589.1|  hypothetical protein B456_009G368400                  97.1    2e-20   Gossypium raimondii
ref|XP_010277772.1|  PREDICTED: probable beta-1,3-galactosyltrans...  96.3    2e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010277771.1|  PREDICTED: probable beta-1,3-galactosyltrans...  96.3    3e-20   Nelumbo nucifera [Indian lotus]
ref|XP_007021705.1|  Galactosyltransferase family protein isoform 1   96.3    3e-20   
ref|XP_007021706.1|  Galactosyltransferase family protein isoform 2   95.9    4e-20   
ref|XP_006407028.1|  hypothetical protein EUTSA_v10021058mg           95.5    6e-20   Eutrema salsugineum [saltwater cress]
gb|AGI37815.1|  cotton galactosyltransferase 1                        95.5    6e-20   Gossypium hirsutum [American cotton]
ref|XP_002885062.1|  galactosyltransferase family protein             95.5    6e-20   Arabidopsis lyrata subsp. lyrata
gb|KHG09438.1|  putative beta-1,3-galactosyltransferase 14 -like ...  95.5    6e-20   Gossypium arboreum [tree cotton]
ref|XP_011006518.1|  PREDICTED: probable beta-1,3-galactosyltrans...  95.5    7e-20   Populus euphratica
ref|XP_006493604.1|  PREDICTED: probable beta-1,3-galactosyltrans...  95.1    8e-20   Citrus sinensis [apfelsine]
ref|XP_007133197.1|  hypothetical protein PHAVU_011G159800g           95.1    9e-20   Phaseolus vulgaris [French bean]
ref|XP_006370169.1|  galactosyltransferase family protein             94.7    1e-19   Populus trichocarpa [western balsam poplar]
gb|KDO48769.1|  hypothetical protein CISIN_1g018669mg                 94.4    1e-19   Citrus sinensis [apfelsine]
ref|XP_010502377.1|  PREDICTED: probable beta-1,3-galactosyltrans...  94.4    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_006298046.1|  hypothetical protein CARUB_v10014091mg           94.4    2e-19   Capsella rubella
ref|XP_003527208.1|  PREDICTED: probable beta-1,3-galactosyltrans...  94.0    2e-19   Glycine max [soybeans]
gb|KDO48767.1|  hypothetical protein CISIN_1g018669mg                 94.4    2e-19   Citrus sinensis [apfelsine]
ref|XP_006442538.1|  hypothetical protein CICLE_v10020877mg           94.0    2e-19   Citrus clementina [clementine]
ref|XP_002317466.2|  galactosyltransferase family protein             93.6    3e-19   Populus trichocarpa [western balsam poplar]
gb|KFK38847.1|  hypothetical protein AALP_AA3G167900                  93.6    3e-19   Arabis alpina [alpine rockcress]
ref|NP_188114.1|  putative beta-1,3-galactosyltransferase 13          93.6    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010268841.1|  PREDICTED: probable beta-1,3-galactosyltrans...  93.2    4e-19   Nelumbo nucifera [Indian lotus]
gb|ACJ84378.1|  unknown                                               93.2    4e-19   Medicago truncatula
ref|XP_010465428.1|  PREDICTED: probable beta-1,3-galactosyltrans...  92.4    8e-19   Camelina sativa [gold-of-pleasure]
ref|XP_004146030.1|  PREDICTED: probable beta-1,3-galactosyltrans...  92.0    1e-18   Cucumis sativus [cucumbers]
ref|XP_008463729.1|  PREDICTED: probable beta-1,3-galactosyltrans...  91.7    1e-18   Cucumis melo [Oriental melon]
ref|XP_010487310.1|  PREDICTED: probable beta-1,3-galactosyltrans...  91.7    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_004294097.1|  PREDICTED: probable beta-1,3-galactosyltrans...  91.7    1e-18   Fragaria vesca subsp. vesca
gb|KCW69940.1|  hypothetical protein EUGRSUZ_F03260                   90.5    2e-18   Eucalyptus grandis [rose gum]
ref|XP_012078580.1|  PREDICTED: probable beta-1,3-galactosyltrans...  91.3    2e-18   Jatropha curcas
gb|KCW69941.1|  hypothetical protein EUGRSUZ_F03260                   90.1    3e-18   Eucalyptus grandis [rose gum]
ref|XP_010062808.1|  PREDICTED: probable beta-1,3-galactosyltrans...  90.1    5e-18   Eucalyptus grandis [rose gum]
gb|KCW69939.1|  hypothetical protein EUGRSUZ_F03260                   89.7    5e-18   Eucalyptus grandis [rose gum]
ref|XP_011029556.1|  PREDICTED: probable beta-1,3-galactosyltrans...  89.7    6e-18   Populus euphratica
ref|XP_009146301.1|  PREDICTED: probable beta-1,3-galactosyltrans...  88.2    2e-17   Brassica rapa
ref|XP_004516077.1|  PREDICTED: probable beta-1,3-galactosyltrans...  87.0    4e-17   Cicer arietinum [garbanzo]
gb|KEH38625.1|  beta-1,3-galactosyltransferase-like protein           86.7    5e-17   Medicago truncatula
gb|KEH38624.1|  beta-1,3-galactosyltransferase-like protein           86.7    6e-17   Medicago truncatula
ref|XP_010535043.1|  PREDICTED: probable beta-1,3-galactosyltrans...  86.7    8e-17   Tarenaya hassleriana [spider flower]
ref|NP_175736.2|  putative beta-1,3-galactosyltransferase 14          85.9    1e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AAF69535.1|AC008007_10  F12M16.19                                  85.9    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009340101.1|  PREDICTED: probable beta-1,3-galactosyltrans...  85.5    1e-16   Pyrus x bretschneideri [bai li]
emb|CDX97620.1|  BnaA05g24590D                                        85.1    3e-16   
ref|XP_002891740.1|  galactosyltransferase family protein             85.1    3e-16   
ref|XP_006305250.1|  hypothetical protein CARUB_v10009620mg           84.0    4e-16   
ref|XP_009340109.1|  PREDICTED: probable beta-1,3-galactosyltrans...  83.6    6e-16   
ref|XP_006305251.1|  hypothetical protein CARUB_v10009620mg           83.6    9e-16   Capsella rubella
ref|XP_009409699.1|  PREDICTED: probable beta-1,3-galactosyltrans...  84.0    1e-15   
ref|XP_008786078.1|  PREDICTED: probable beta-1,3-galactosyltrans...  84.0    1e-15   Phoenix dactylifera
ref|XP_006392804.1|  hypothetical protein EUTSA_v10011624mg           83.2    1e-15   Eutrema salsugineum [saltwater cress]
ref|XP_009340093.1|  PREDICTED: probable beta-1,3-galactosyltrans...  83.2    2e-15   Pyrus x bretschneideri [bai li]
emb|CDX82456.1|  BnaA03g33650D                                        82.4    2e-15   
ref|XP_008386244.1|  PREDICTED: probable beta-1,3-galactosyltrans...  82.0    4e-15   Malus domestica [apple tree]
ref|XP_009135415.1|  PREDICTED: probable beta-1,3-galactosyltrans...  80.9    8e-15   Brassica rapa
ref|XP_008226526.1|  PREDICTED: probable beta-1,3-galactosyltrans...  80.9    8e-15   Prunus mume [ume]
emb|CDX75799.1|  BnaC03g38820D                                        80.9    8e-15   
ref|XP_010675418.1|  PREDICTED: probable beta-1,3-galactosyltrans...  80.9    9e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010500968.1|  PREDICTED: probable beta-1,3-galactosyltrans...  80.5    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010462209.1|  PREDICTED: probable beta-1,3-galactosyltrans...  80.1    1e-14   Camelina sativa [gold-of-pleasure]
gb|EPS63358.1|  hypothetical protein M569_11427                       80.1    2e-14   Genlisea aurea
gb|KJB13203.1|  hypothetical protein B456_002G062000                  80.1    2e-14   Gossypium raimondii
ref|XP_008382063.1|  PREDICTED: probable beta-1,3-galactosyltrans...  79.7    2e-14   
ref|XP_007211503.1|  hypothetical protein PRUPE_ppa007915mg           79.0    4e-14   Prunus persica
ref|XP_003543216.1|  PREDICTED: probable beta-1,3-galactosyltrans...  79.0    4e-14   Glycine max [soybeans]
ref|XP_009342281.1|  PREDICTED: probable beta-1,3-galactosyltrans...  79.0    5e-14   Pyrus x bretschneideri [bai li]
ref|XP_004489037.1|  PREDICTED: probable beta-1,3-galactosyltrans...  78.6    5e-14   Cicer arietinum [garbanzo]
ref|XP_009335180.1|  PREDICTED: probable beta-1,3-galactosyltrans...  78.6    6e-14   Pyrus x bretschneideri [bai li]
ref|XP_010108248.1|  putative beta-1,3-galactosyltransferase 14       78.6    6e-14   
gb|AFW85777.1|  hypothetical protein ZEAMMB73_228985                  75.9    7e-14   
emb|CDY55848.1|  BnaCnng29350D                                        77.8    1e-13   Brassica napus [oilseed rape]
emb|CDY55849.1|  BnaCnng29360D                                        77.8    1e-13   Brassica napus [oilseed rape]
ref|XP_008648801.1|  PREDICTED: probable beta-1,3-galactosyltrans...  74.7    2e-13   Zea mays [maize]
ref|XP_002524276.1|  Beta-1,3-galactosyltransferase sqv-2, putative   77.0    2e-13   Ricinus communis
ref|XP_004964801.1|  PREDICTED: probable beta-1,3-galactosyltrans...  76.6    4e-13   Setaria italica
ref|XP_010925703.1|  PREDICTED: probable beta-1,3-galactosyltrans...  75.5    4e-13   
gb|AFW85775.1|  hypothetical protein ZEAMMB73_228985                  75.5    6e-13   
ref|XP_009380506.1|  PREDICTED: probable beta-1,3-galactosyltrans...  75.5    7e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001152267.1|  beta-1,3-galactosyltransferase 6                 75.5    1e-12   Zea mays [maize]
ref|XP_010925702.1|  PREDICTED: probable beta-1,3-galactosyltrans...  75.1    1e-12   Elaeis guineensis
emb|CDX98518.1|  BnaC05g38570D                                        74.7    1e-12   
ref|NP_001145078.1|  uncharacterized protein LOC100278279             72.0    1e-12   
ref|XP_002436508.1|  hypothetical protein SORBIDRAFT_10g003920        73.6    4e-12   
ref|XP_002283081.1|  PREDICTED: probable beta-1,3-galactosyltrans...  73.2    5e-12   Vitis vinifera
gb|ABL11234.1|  UCW98, putative galactosyltransferease                72.4    1e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94890.1|  predicted protein                                    72.4    1e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007149400.1|  hypothetical protein PHAVU_005G067100g           71.6    1e-11   Phaseolus vulgaris [French bean]
ref|XP_006655808.1|  PREDICTED: probable beta-1,3-galactosyltrans...  71.2    2e-11   Oryza brachyantha
gb|KFK35710.1|  hypothetical protein AALP_AA4G027000                  70.9    3e-11   Arabis alpina [alpine rockcress]
emb|CAN65751.1|  hypothetical protein VITISV_026338                   70.1    8e-11   Vitis vinifera
ref|XP_003564304.1|  PREDICTED: probable beta-1,3-galactosyltrans...  68.2    3e-10   Brachypodium distachyon [annual false brome]
ref|XP_009144781.1|  PREDICTED: probable beta-1,3-galactosyltrans...  67.0    6e-10   Brassica rapa
ref|XP_009144780.1|  PREDICTED: probable beta-1,3-galactosyltrans...  67.0    6e-10   Brassica rapa
emb|CDY25866.1|  BnaA05g14570D                                        67.0    6e-10   Brassica napus [oilseed rape]
ref|NP_001056857.1|  Os06g0156900                                     66.6    9e-10   
ref|XP_011626263.1|  PREDICTED: probable beta-1,3-galactosyltrans...  66.6    1e-09   Amborella trichopoda
gb|KHN46033.1|  Putative beta-1,3-galactosyltransferase 14            64.7    2e-09   Glycine soja [wild soybean]
gb|AFW75580.1|  hypothetical protein ZEAMMB73_628468                  65.5    2e-09   
gb|ERN13900.1|  hypothetical protein AMTR_s00021p00087240             65.5    3e-09   Amborella trichopoda
gb|AFW75579.1|  hypothetical protein ZEAMMB73_628468                  65.1    3e-09   
ref|XP_002880742.1|  galactosyltransferase family protein             61.6    5e-08   Arabidopsis lyrata subsp. lyrata
emb|CBI20203.3|  unnamed protein product                              59.7    1e-07   Vitis vinifera
ref|XP_007223350.1|  hypothetical protein PRUPE_ppa007437mg           60.1    2e-07   Prunus persica
ref|XP_010262123.1|  PREDICTED: probable beta-1,3-galactosyltrans...  59.7    2e-07   Nelumbo nucifera [Indian lotus]
ref|XP_008782540.1|  PREDICTED: probable beta-1,3-galactosyltrans...  59.7    2e-07   Phoenix dactylifera
ref|XP_008782541.1|  PREDICTED: probable beta-1,3-galactosyltrans...  59.3    3e-07   
ref|XP_008220476.1|  PREDICTED: probable beta-1,3-galactosyltrans...  59.3    3e-07   Prunus mume [ume]
gb|KJB65555.1|  hypothetical protein B456_010G100900                  59.3    3e-07   Gossypium raimondii
ref|XP_002279252.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.9    4e-07   Vitis vinifera
ref|XP_012077286.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.9    4e-07   Jatropha curcas
ref|XP_006450841.1|  hypothetical protein CICLE_v10010334mg           58.5    5e-07   
emb|CAN63091.1|  hypothetical protein VITISV_032018                   58.5    6e-07   Vitis vinifera
ref|XP_010915251.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.5    6e-07   Elaeis guineensis
ref|XP_010915253.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.2    6e-07   Elaeis guineensis
ref|XP_009361904.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.2    7e-07   Pyrus x bretschneideri [bai li]
ref|XP_010915252.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.2    7e-07   Elaeis guineensis
ref|XP_008377681.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.2    7e-07   
ref|XP_010915250.1|  PREDICTED: probable beta-1,3-galactosyltrans...  57.8    1e-06   Elaeis guineensis
ref|XP_007012283.1|  Beta-1,3-galactosyltransferase 12                57.0    2e-06   
emb|CDP08259.1|  unnamed protein product                              56.2    3e-06   Coffea canephora [robusta coffee]
gb|KHG29258.1|  putative beta-1,3-galactosyltransferase 12 -like ...  56.2    3e-06   Gossypium arboreum [tree cotton]
ref|XP_002308559.1|  hypothetical protein POPTR_0006s24530g           56.2    3e-06   Populus trichocarpa [western balsam poplar]
ref|XP_011019461.1|  PREDICTED: probable beta-1,3-galactosyltrans...  56.2    4e-06   Populus euphratica
ref|XP_006382014.1|  hypothetical protein POPTR_0006s24530g           55.8    4e-06   
ref|XP_011019464.1|  PREDICTED: probable beta-1,3-galactosyltrans...  55.8    4e-06   Populus euphratica
ref|XP_010526149.1|  PREDICTED: probable beta-1,3-galactosyltrans...  55.5    6e-06   Tarenaya hassleriana [spider flower]
ref|XP_008393644.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  55.5    6e-06   
gb|KFK32543.1|  hypothetical protein AALP_AA6G256600                  55.1    8e-06   Arabis alpina [alpine rockcress]
ref|XP_002516443.1|  Beta-1,3-galactosyltransferase sqv-2, putative   53.9    2e-05   
ref|XP_010097064.1|  putative beta-1,3-galactosyltransferase 12       53.5    2e-05   Morus notabilis
ref|XP_010429624.1|  PREDICTED: probable beta-1,3-galactosyltrans...  53.5    3e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010417388.1|  PREDICTED: probable beta-1,3-galactosyltrans...  53.5    3e-05   Camelina sativa [gold-of-pleasure]
emb|CDP14127.1|  unnamed protein product                              52.0    3e-05   Coffea canephora [robusta coffee]
ref|XP_006293482.1|  hypothetical protein CARUB_v10023358mg           53.1    4e-05   
ref|XP_011628529.1|  PREDICTED: probable beta-1,3-galactosyltrans...  52.8    5e-05   Amborella trichopoda
emb|CAN78053.1|  hypothetical protein VITISV_015866                   50.4    5e-05   Vitis vinifera
gb|AAC31227.1|  unknown protein                                       52.4    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180179.2|  putative beta-1,3-galactosyltransferase 12          52.4    6e-05   Arabidopsis thaliana [mouse-ear cress]
gb|ERN19820.1|  hypothetical protein AMTR_s00064p00175400             52.4    6e-05   Amborella trichopoda
ref|XP_004291040.1|  PREDICTED: probable beta-1,3-galactosyltrans...  52.4    7e-05   Fragaria vesca subsp. vesca
emb|CDX77030.1|  BnaC04g38250D                                        52.0    9e-05   
ref|XP_010472638.1|  PREDICTED: probable beta-1,3-galactosyltrans...  51.6    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010060689.1|  PREDICTED: probable beta-1,3-galactosyltrans...  51.6    1e-04   Eucalyptus grandis [rose gum]
ref|XP_006450845.1|  hypothetical protein CICLE_v10008876mg           51.2    1e-04   
ref|XP_010667259.1|  PREDICTED: probable beta-1,3-galactosyltrans...  51.6    1e-04   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY35316.1|  BnaA04g15310D                                        51.2    1e-04   Brassica napus [oilseed rape]
ref|XP_009140723.1|  PREDICTED: probable beta-1,3-galactosyltrans...  51.2    2e-04   Brassica rapa
ref|XP_006371886.1|  hypothetical protein POPTR_0018s05200g           50.8    2e-04   
gb|EMS61789.1|  putative beta-1,3-galactosyltransferase 14            50.8    2e-04   Triticum urartu
ref|XP_009403487.1|  PREDICTED: probable beta-1,3-galactosyltrans...  50.8    2e-04   
ref|XP_006408850.1|  hypothetical protein EUTSA_v10002018mg           50.4    3e-04   Eutrema salsugineum [saltwater cress]
ref|XP_002978257.1|  glycosyltransferase-like protein                 50.1    4e-04   
ref|XP_002966312.1|  glycosyltransferase-like protein                 49.3    8e-04   



>ref|XP_009619733.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Nicotiana 
tomentosiformis]
Length=236

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 95/124 (77%), Gaps = 5/124 (4%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRSV  307
            MPSSPK F A P +   +SRRST LIL  LIGLAGFVFGFIA SRQ LGH+C+  +PRSV
Sbjct  1    MPSSPKSFNAWPSSSPLNSRRSTVLILCSLIGLAGFVFGFIAISRQGLGHKCKYAEPRSV  60

Query  308  SVVWDRSSARVSSGDG-----VDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQ  472
            SVVWD+SS++ S   G     +D  QKRHKVMGFVGIQTGF S  RRRSLRQTWFPSD Q
Sbjct  61   SVVWDKSSSKASGATGKDTGLLDEGQKRHKVMGFVGIQTGFGSTGRRRSLRQTWFPSDHQ  120

Query  473  GLQK  484
            GLQ+
Sbjct  121  GLQR  124



>ref|XP_009775405.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Nicotiana 
sylvestris]
Length=344

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 94/119 (79%), Gaps = 2/119 (2%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRSV  307
            MPSSPK F A P +   +SRRST LIL  LIGLAGFVFGFIA SRQ LGH+C+  +PRSV
Sbjct  1    MPSSPKSFNAWPSSSPLNSRRSTVLILCSLIGLAGFVFGFIAISRQGLGHKCKYAEPRSV  60

Query  308  SVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGLQK  484
            SVVWD+SS++ +    +D  QKRHKVMGFVGIQTGF S  RRRSLRQTWFPSD QGLQ+
Sbjct  61   SVVWDKSSSKATGL--LDEGQKRHKVMGFVGIQTGFGSTGRRRSLRQTWFPSDHQGLQR  117



>ref|XP_009604808.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Nicotiana 
tomentosiformis]
Length=345

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 85/122 (70%), Gaps = 6/122 (5%)
 Frame = +2

Query  128  MPSSPKYFTARPLT--YSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPR  301
            MPS PK F AR  +  Y  +SRRST LIL  L+   GF   FI   R+ LG+ C+  KPR
Sbjct  1    MPSYPKNFNARTSSSYYFHNSRRSTILILCFLLIFTGFFSVFIVILRRGLGYNCKYAKPR  60

Query  302  SVSVVWDRSSARVSSGDGV-DGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            SVSV+WD     VS G+G+ DGE KR KVMGFVGIQTGF S ARRRSLRQTWFPSD QGL
Sbjct  61   SVSVLWD---GTVSKGNGLSDGEYKRQKVMGFVGIQTGFGSVARRRSLRQTWFPSDHQGL  117

Query  479  QK  484
            QK
Sbjct  118  QK  119



>ref|XP_009794167.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Nicotiana 
sylvestris]
Length=345

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 87/122 (71%), Gaps = 6/122 (5%)
 Frame = +2

Query  128  MPSSPKYFTARPLT--YSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPR  301
            MPS PK FTAR  +  Y  +SRRST LIL  L+   GF  GFI   R+ LG+ C+  KPR
Sbjct  1    MPSYPKNFTARTSSSYYFPNSRRSTILILCFLLIFTGFFSGFIVILRRGLGYNCKYAKPR  60

Query  302  SVSVVWDRSSARVSSGDGV-DGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            SVSV+WD     +S G+G+ DGE KR KVMGFVGIQTGF S ARRRSLRQTWFPSD +GL
Sbjct  61   SVSVLWD---GTLSEGNGLSDGEYKRQKVMGFVGIQTGFGSVARRRSLRQTWFPSDHRGL  117

Query  479  QK  484
            QK
Sbjct  118  QK  119



>ref|XP_011082755.1| PREDICTED: probable beta-1,3-galactosyltransferase 13 [Sesamum 
indicum]
Length=341

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 86/119 (72%), Gaps = 4/119 (3%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRSV  307
            MPSSPK F AR    S S RRSTP I+  LI L GF+ GF+A SR+SL ++C+  KP SV
Sbjct  1    MPSSPKAFYARQ---SFSPRRSTPQIICFLIVLLGFIIGFVAISRRSLDYKCKYDKPLSV  57

Query  308  SVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGLQK  484
            SV WD+SS     G   D  QKRHKVMGFVGIQTGFAS  RRR+LRQTWFPSD QGLQ+
Sbjct  58   SVTWDKSS-NGGGGSVTDEGQKRHKVMGFVGIQTGFASVGRRRALRQTWFPSDHQGLQR  115



>ref|XP_004244265.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Solanum 
lycopersicum]
Length=351

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 93/124 (75%), Gaps = 5/124 (4%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRS---TPlilflliglagfvfgfiaSSRQSLGHRCENIKP  298
            MPSSPK F A P + SSS+  S   T LI   LIG+AGF+FGFIA S+Q LG  C+  +P
Sbjct  1    MPSSPKSFNAWPSSSSSSTIYSRRSTVLIFCSLIGVAGFIFGFIAISKQGLGSNCKYAEP  60

Query  299  RSVSVVWDRSSARVSSG-DGVDGE-QKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQ  472
            RSVSVVWDRS ++ S   DGV  E QKRHKVMGFVGIQTGFAS  RRRSLRQTWFPSD +
Sbjct  61   RSVSVVWDRSGSKASEDTDGVSDEGQKRHKVMGFVGIQTGFASTGRRRSLRQTWFPSDHE  120

Query  473  GLQK  484
            GLQK
Sbjct  121  GLQK  124



>ref|XP_011098232.1| PREDICTED: probable beta-1,3-galactosyltransferase 13 [Sesamum 
indicum]
Length=344

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 91/121 (75%), Gaps = 5/121 (4%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRSV  307
            MPSSPK F ARP   SS SRRST LIL  LIGL+GF+FGF+  SR+  G+ C+N KP SV
Sbjct  1    MPSSPKLFYARP---SSYSRRSTFLILCSLIGLSGFIFGFVGLSRRGFGYDCKNGKPLSV  57

Query  308  SVVWDRSSARVSSGDGV--DGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGLQ  481
            SV WD+SS   +S  G   D  QKRHKVMGFVGIQTGF SA RRR+LRQTWFPSD QGLQ
Sbjct  58   SVTWDKSSTGSTSSGGGVSDEGQKRHKVMGFVGIQTGFGSAGRRRALRQTWFPSDHQGLQ  117

Query  482  K  484
            +
Sbjct  118  R  118



>ref|XP_006360051.1| PREDICTED: probable beta-1,3-galactosyltransferase 14-like [Solanum 
tuberosum]
Length=348

 Score =   112 bits (280),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 91/122 (75%), Gaps = 3/122 (2%)
 Frame = +2

Query  128  MPSSPKYFTARP-LTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRS  304
            MPS+PK FTAR   +Y   SRRS  LIL  LIG AGFVFGFIA SR+ LG+ C+  +PRS
Sbjct  1    MPSNPKIFTARSSYSYFYHSRRSKILILCFLIGFAGFVFGFIAISRRGLGNSCKYAEPRS  60

Query  305  VSVVWDRS-SARVSSGDGVDGE-QKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            VSV WDR+  +R  +G GV G   KRHKVMGFVGIQTGF S ARRRSLR+TWFPSD  GL
Sbjct  61   VSVAWDRNVMSREENGIGVTGGGYKRHKVMGFVGIQTGFGSVARRRSLRRTWFPSDHNGL  120

Query  479  QK  484
            QK
Sbjct  121  QK  122



>gb|EYU26331.1| hypothetical protein MIMGU_mgv1a009062mg [Erythranthe guttata]
Length=354

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 90/130 (69%), Gaps = 14/130 (11%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRSV  307
            MPSSPK F ARP   SS SRRS  LI  LLIG +GFVFGFIA SRQ LG  C+  KP SV
Sbjct  1    MPSSPKLFYARP---SSYSRRSAVLIFCLLIGFSGFVFGFIAISRQGLGSNCKFGKPLSV  57

Query  308  SVVWDRSS-----------ARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTW  454
            SV WD+SS           +R S G   +  QKRHKVMGFVGIQTGF SA RR+SLRQTW
Sbjct  58   SVTWDKSSIVSGGGGGGGLSRRSGGGFTNEGQKRHKVMGFVGIQTGFGSAGRRKSLRQTW  117

Query  455  FPSDRQGLQK  484
            FPSD QGLQ+
Sbjct  118  FPSDHQGLQR  127



>ref|XP_006348294.1| PREDICTED: probable beta-1,3-galactosyltransferase 14-like [Solanum 
tuberosum]
Length=350

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 89/123 (72%), Gaps = 4/123 (3%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRS--TPlilflliglagfvfgfiaSSRQSLGHRCENIKPR  301
            MPSSPK F A P + SSS      T LIL  LIG+AGF+FGFIA S+Q LG  C+  + R
Sbjct  1    MPSSPKSFNAWPSSSSSSIYSRRSTVLILCSLIGVAGFMFGFIAISKQGLGSNCKYAERR  60

Query  302  SVSVVWDRSSARVSSGDG--VDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQG  475
            SVSVVWDR+ ++ S   G   D  QKRHKVMGFVGIQTGFAS  RRRSLRQTWFPSD QG
Sbjct  61   SVSVVWDRTGSKASEDTGGVSDEGQKRHKVMGFVGIQTGFASTGRRRSLRQTWFPSDHQG  120

Query  476  LQK  484
            LQK
Sbjct  121  LQK  123



>ref|XP_004248247.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Solanum 
lycopersicum]
Length=348

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 89/122 (73%), Gaps = 3/122 (2%)
 Frame = +2

Query  128  MPSSPKYFTARP-LTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRS  304
            MPS+PK FTAR   ++   SRRS  LIL  LIG AGF+FGFIA SR+  G  C+  +PRS
Sbjct  1    MPSNPKIFTARSSYSHFYHSRRSKILILCCLIGFAGFLFGFIAISRRGFGDSCKYAEPRS  60

Query  305  VSVVWDRS-SARVSSGDGVDGE-QKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            VSV WDR+  +R  +G GV G   KRHKVMGFVGIQTGF S ARRRSLR+TWFPSD  GL
Sbjct  61   VSVAWDRNVMSREENGIGVTGGGYKRHKVMGFVGIQTGFGSVARRRSLRRTWFPSDHNGL  120

Query  479  QK  484
            QK
Sbjct  121  QK  122



>ref|XP_003556804.1| PREDICTED: probable beta-1,3-galactosyltransferase 14-like [Glycine 
max]
Length=338

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = +2

Query  272  GHRCENIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQT  451
            G RC N  PRSV +VW+ S+   ++G GV G+  RHKVMGFVGIQTGF SA RR SLR+T
Sbjct  43   GSRCVNAHPRSVRIVWEHSAGNGAAGSGV-GDGDRHKVMGFVGIQTGFTSAGRRESLRKT  101

Query  452  WFPSDRQGLQK  484
            WFPSDRQGLQ+
Sbjct  102  WFPSDRQGLQR  112



>gb|KJB61588.1| hypothetical protein B456_009G368400 [Gossypium raimondii]
Length=299

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 76/129 (59%), Gaps = 9/129 (7%)
 Frame = +2

Query  128  MPSSPKYFTAR---PLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKP  298
            MPSSPK+F AR   P T  + S       L     L+         S    G+RC N  P
Sbjct  1    MPSSPKFFHARTSPPATPHTRSTLLIFAFLLTFAILSFLFALSSFLSSGGSGYRCRNSDP  60

Query  299  RSVSVVWDRS----SARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSD  466
            RSV V+WD++    + R ++GD  D   KRHK+MGFVGIQTGF S  RR+SLR+TW PSD
Sbjct  61   RSVRVIWDKTGHGNNGRSAAGD--DDGTKRHKIMGFVGIQTGFGSTGRRQSLRKTWMPSD  118

Query  467  RQGLQKYSF  493
            RQGLQ+ +F
Sbjct  119  RQGLQRLAF  127



>emb|CDP05998.1| unnamed protein product [Coffea canephora]
Length=296

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 92/130 (71%), Gaps = 14/130 (11%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRSV  307
            MPSSPK+F AR    SS SRRST LIL LL+GLAGF  GF+  S+Q LG+ C+  KP SV
Sbjct  1    MPSSPKFFPAR--PSSSKSRRSTVLILCLLVGLAGFFLGFLVVSKQGLGYSCKYAKPISV  58

Query  308  SVVWDRSSARV-----------SSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTW  454
            SVVWDR+++             ++G+ V G QKR+K  GFVGIQTGF SA RRR+LRQTW
Sbjct  59   SVVWDRTNSGNSFSSSSDGDNGANGNSVRG-QKRYKATGFVGIQTGFGSAGRRRALRQTW  117

Query  455  FPSDRQGLQK  484
            FPSD QGLQ+
Sbjct  118  FPSDPQGLQR  127



>gb|KJB61589.1| hypothetical protein B456_009G368400 [Gossypium raimondii]
Length=350

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 74/126 (59%), Gaps = 9/126 (7%)
 Frame = +2

Query  128  MPSSPKYFTAR---PLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKP  298
            MPSSPK+F AR   P T  + S       L     L+         S    G+RC N  P
Sbjct  1    MPSSPKFFHARTSPPATPHTRSTLLIFAFLLTFAILSFLFALSSFLSSGGSGYRCRNSDP  60

Query  299  RSVSVVWDRS----SARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSD  466
            RSV V+WD++    + R ++GD  D   KRHK+MGFVGIQTGF S  RR+SLR+TW PSD
Sbjct  61   RSVRVIWDKTGHGNNGRSAAGD--DDGTKRHKIMGFVGIQTGFGSTGRRQSLRKTWMPSD  118

Query  467  RQGLQK  484
            RQGLQ+
Sbjct  119  RQGLQR  124



>ref|XP_010277772.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 isoform 
X2 [Nelumbo nucifera]
Length=278

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 83/124 (67%), Gaps = 10/124 (8%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRSV  307
            MPSSPK +  RP  YS   RRS+ L   LLIG+  F FG ++  + + G++C+N   RSV
Sbjct  1    MPSSPKAYYPRPSRYSYV-RRSSFLAFCLLIGITSFAFGLVSILKPAPGYKCKNSVARSV  59

Query  308  SVVWDRSS-----ARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQ  472
            SVVW++        RVSS     G QKR+KVMGFVGIQTGF S  RRRSLR+TW PSD+Q
Sbjct  60   SVVWEKGKHVEDLNRVSSV----GNQKRYKVMGFVGIQTGFGSVGRRRSLRKTWMPSDKQ  115

Query  473  GLQK  484
            GLQ+
Sbjct  116  GLQR  119



>ref|XP_010277771.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 isoform 
X1 [Nelumbo nucifera]
Length=344

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 83/124 (67%), Gaps = 10/124 (8%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRSV  307
            MPSSPK +  RP  YS   RRS+ L   LLIG+  F FG ++  + + G++C+N   RSV
Sbjct  1    MPSSPKAYYPRPSRYSYV-RRSSFLAFCLLIGITSFAFGLVSILKPAPGYKCKNSVARSV  59

Query  308  SVVWDRSS-----ARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQ  472
            SVVW++        RVSS     G QKR+KVMGFVGIQTGF S  RRRSLR+TW PSD+Q
Sbjct  60   SVVWEKGKHVEDLNRVSSV----GNQKRYKVMGFVGIQTGFGSVGRRRSLRKTWMPSDKQ  115

Query  473  GLQK  484
            GLQ+
Sbjct  116  GLQR  119



>ref|XP_007021705.1| Galactosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOY13230.1| Galactosyltransferase family protein isoform 1 [Theobroma cacao]
Length=350

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 76/124 (61%), Gaps = 5/124 (4%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPl---ilflliglagfvfgfiaSSRQSLGHRCENIKP  298
            MPSSPK+F AR  + ++   RST L    L +   ++  +      S    G+RC +  P
Sbjct  1    MPSSPKFFNARTSSLATRPTRSTVLIFSALLVFAIVSFLLALSSFLSSGGSGYRCRSSDP  60

Query  299  RSVSVVWDRSSARVSSGDGVDGEQ--KRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQ  472
            RSV V+WDR+    +   G D +   KRHKVMGFVGIQTGF S  RRRSLR+TW PSDRQ
Sbjct  61   RSVRVLWDRAGNGNNGVAGGDDDNGTKRHKVMGFVGIQTGFGSTGRRRSLRKTWMPSDRQ  120

Query  473  GLQK  484
            GLQ+
Sbjct  121  GLQR  124



>ref|XP_007021706.1| Galactosyltransferase family protein isoform 2 [Theobroma cacao]
 gb|EOY13231.1| Galactosyltransferase family protein isoform 2 [Theobroma cacao]
Length=334

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 76/124 (61%), Gaps = 5/124 (4%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPl---ilflliglagfvfgfiaSSRQSLGHRCENIKP  298
            MPSSPK+F AR  + ++   RST L    L +   ++  +      S    G+RC +  P
Sbjct  1    MPSSPKFFNARTSSLATRPTRSTVLIFSALLVFAIVSFLLALSSFLSSGGSGYRCRSSDP  60

Query  299  RSVSVVWDRSSARVSSGDGVDGEQ--KRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQ  472
            RSV V+WDR+    +   G D +   KRHKVMGFVGIQTGF S  RRRSLR+TW PSDRQ
Sbjct  61   RSVRVLWDRAGNGNNGVAGGDDDNGTKRHKVMGFVGIQTGFGSTGRRRSLRKTWMPSDRQ  120

Query  473  GLQK  484
            GLQ+
Sbjct  121  GLQR  124



>ref|XP_006407028.1| hypothetical protein EUTSA_v10021058mg [Eutrema salsugineum]
 gb|ESQ48481.1| hypothetical protein EUTSA_v10021058mg [Eutrema salsugineum]
Length=346

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 77/125 (62%), Gaps = 11/125 (9%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCE------N  289
            MPSSPK F ARP   S  +RRST LI+F  +      F F  SS    G R        N
Sbjct  1    MPSSPKLFHARP---SFFTRRSTDLIVFTSLVFGLTGFLFGLSSIVFPGLRLSGLTCLTN  57

Query  290  IKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDR  469
              P++V +VWD   A  S+G+G  GE KRHKVMGFVGIQTGFASA RRR+LR TW PSD 
Sbjct  58   SPPKTVRIVWD--VAGNSNGNGARGEIKRHKVMGFVGIQTGFASAGRRRALRNTWMPSDP  115

Query  470  QGLQK  484
             GL++
Sbjct  116  DGLRR  120



>gb|AGI37815.1| cotton galactosyltransferase 1 [Gossypium hirsutum]
Length=350

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 71/124 (57%), Gaps = 5/124 (4%)
 Frame = +2

Query  128  MPSSPKYFTAR---PLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKP  298
            MPSSPK+F AR   P T  + S       L     ++         S    G+RC N  P
Sbjct  1    MPSSPKFFHARTSPPATPHTRSTLLIFASLLTFAIVSFLFALSSFLSSGGSGYRCRNSDP  60

Query  299  RSVSVVWDRSSARVS--SGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQ  472
            RSV V+WD++    +  S  G D   KRHK+MGFVGIQTGF S  RR+SLR+TW PSDRQ
Sbjct  61   RSVRVIWDKTGHGNNGLSAAGDDDGTKRHKIMGFVGIQTGFGSTGRRQSLRKTWMPSDRQ  120

Query  473  GLQK  484
            GLQ+
Sbjct  121  GLQR  124



>ref|XP_002885062.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61321.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=343

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 76/125 (61%), Gaps = 14/125 (11%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCE------N  289
            MPSSPK F ARP   S  +RRSTPLI+F  + +    F F  S+    G R        N
Sbjct  1    MPSSPKLFNARP---SLFTRRSTPLIVFTSLAIGLTGFLFGLSTILFPGLRLSGRTCLTN  57

Query  290  IKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDR  469
            + P++V + WD     V     V+GE KRHKVMGFVGIQTGF SA RRR+LR TW PSD 
Sbjct  58   LPPKTVKIAWD-----VVGNSIVNGEVKRHKVMGFVGIQTGFRSAGRRRALRNTWMPSDP  112

Query  470  QGLQK  484
            +GL++
Sbjct  113  EGLRR  117



>gb|KHG09438.1| putative beta-1,3-galactosyltransferase 14 -like protein [Gossypium 
arboreum]
Length=350

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 71/124 (57%), Gaps = 5/124 (4%)
 Frame = +2

Query  128  MPSSPKYFTAR---PLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKP  298
            MPSSPK+F AR   P T  + S       L     ++         S    G+RC N  P
Sbjct  1    MPSSPKFFHARTSPPATPHTRSTLLIFASLLTFAIVSFLFALSSFLSSGGSGYRCRNSDP  60

Query  299  RSVSVVWDRSSARVS--SGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQ  472
            RSV V+WD++    +  S  G D   KRHK+MGFVGIQTGF S  RR+SLR+TW PSDRQ
Sbjct  61   RSVRVIWDKTGHGNNGLSAAGDDDGTKRHKIMGFVGIQTGFGSTGRRQSLRKTWMPSDRQ  120

Query  473  GLQK  484
            GLQ+
Sbjct  121  GLQR  124



>ref|XP_011006518.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Populus 
euphratica]
 ref|XP_011006519.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Populus 
euphratica]
Length=351

 Score = 95.5 bits (236),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 83/127 (65%), Gaps = 9/127 (7%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQ-SLGHRC-ENIKPR  301
            MPSSPK+F +R L+  S+SRRST LIL  L+         + S    S  +RC  N  PR
Sbjct  1    MPSSPKFFHSR-LSQPSNSRRSTVLILSCLLIGISGFIFGLTSFLTCSHTYRCLNNSPPR  59

Query  302  SVSVVWDRSSARVSSGDG----VDGEQKRH--KVMGFVGIQTGFASAARRRSLRQTWFPS  463
            SV VVW  ++ +  +G G    +DGE++R   KVMGFVGIQTGF S+ RRRSLR+TW PS
Sbjct  60   SVRVVWGTNTNKNDNGVGNALLLDGEERRERQKVMGFVGIQTGFGSSGRRRSLRKTWMPS  119

Query  464  DRQGLQK  484
            DRQGLQ+
Sbjct  120  DRQGLQR  126



>ref|XP_006493604.1| PREDICTED: probable beta-1,3-galactosyltransferase 14-like [Citrus 
sinensis]
Length=352

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 74/132 (56%), Gaps = 18/132 (14%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLG---HRCENIKP  298
            MPSSPK+F AR  + +S S R + +++F  + +    F    S+    G   HRC N  P
Sbjct  1    MPSSPKFFYAR--SAASPSHRKSTVLIFSCLIIGIVGFVLGISAFLYAGRGAHRCSNFNP  58

Query  299  RSVSVVWDRSSARVSSGDGVDGEQ----------KRHKVMGFVGIQTGFASAARRRSLRQ  448
             SV VVWD         +G+ G Q          KRHKVMGFVGIQTGF S  RRRSLR 
Sbjct  59   TSVRVVWDNHG---EGSNGISGSQDDDNNNNNNIKRHKVMGFVGIQTGFGSGGRRRSLRM  115

Query  449  TWFPSDRQGLQK  484
            TW PSD QGLQ+
Sbjct  116  TWMPSDHQGLQQ  127



>ref|XP_007133197.1| hypothetical protein PHAVU_011G159800g [Phaseolus vulgaris]
 gb|ESW05191.1| hypothetical protein PHAVU_011G159800g [Phaseolus vulgaris]
Length=347

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 78/121 (64%), Gaps = 2/121 (2%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSS--SSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPR  301
            MPSSPK +      Y S  ++RRST  +L L   L  F+F  ++   Q   +RC N+ PR
Sbjct  1    MPSSPKSYALPYARYPSPFATRRSTLSLLLLSALLILFLFAVVSLIAQIRHNRCINVHPR  60

Query  302  SVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGLQ  481
            SV VVW+ ++   ++     G+ +RHKVMGFVGIQTGF SA RR +LR+TWFPSD QGLQ
Sbjct  61   SVRVVWEHAANANANAAVGVGDGERHKVMGFVGIQTGFGSAGRREALRKTWFPSDHQGLQ  120

Query  482  K  484
            +
Sbjct  121  R  121



>ref|XP_006370169.1| galactosyltransferase family protein [Populus trichocarpa]
 gb|ERP66738.1| galactosyltransferase family protein [Populus trichocarpa]
Length=351

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 82/127 (65%), Gaps = 9/127 (7%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQ-SLGHRC-ENIKPR  301
            MPSSPK+F +R L+  S+SRRST LIL  L+         + S    S  +RC  N  PR
Sbjct  1    MPSSPKFFHSR-LSQPSNSRRSTVLILSCLLIGISGFIFGLTSFLTCSHTYRCFNNSPPR  59

Query  302  SVSVVWDRSSARVSSGDG----VDGEQKRH--KVMGFVGIQTGFASAARRRSLRQTWFPS  463
            SV VVW  +S    +G G    +DGE++R   KVMGFVGIQTGF S+ RRRSLR+TW PS
Sbjct  60   SVRVVWGTNSNMNDNGVGNAVLLDGEERRERQKVMGFVGIQTGFGSSGRRRSLRKTWMPS  119

Query  464  DRQGLQK  484
            DRQGLQ+
Sbjct  120  DRQGLQR  126



>gb|KDO48769.1| hypothetical protein CISIN_1g018669mg [Citrus sinensis]
Length=329

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 72/131 (55%), Gaps = 16/131 (12%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSL--GHRCENIKPR  301
            MPSSPK+F AR    S S R+ST LI   LI         I++   +    HRC N  P 
Sbjct  1    MPSSPKFFYARSAA-SPSPRKSTVLIFSCLIIGIAGFVLGISAFLYAGRGAHRCSNFNPT  59

Query  302  SVSVVWDRSSARVSSGDGVDGEQ----------KRHKVMGFVGIQTGFASAARRRSLRQT  451
            SV VVWD         +G+ G Q          KRHKVMGFVGIQTGF S  RRRSLR T
Sbjct  60   SVRVVWDNHG---EGSNGISGSQDDDNNNNNNIKRHKVMGFVGIQTGFGSGGRRRSLRMT  116

Query  452  WFPSDRQGLQK  484
            W PSD QGLQ+
Sbjct  117  WMPSDHQGLQQ  127



>ref|XP_010502377.1| PREDICTED: probable beta-1,3-galactosyltransferase 13 [Camelina 
sativa]
 ref|XP_010502385.1| PREDICTED: probable beta-1,3-galactosyltransferase 13 [Camelina 
sativa]
Length=348

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 78/125 (62%), Gaps = 10/125 (8%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCE------N  289
            MPSSPK F ARP   S  +RRSTPLI+F  + +    F F  S+    G R        N
Sbjct  1    MPSSPKLFHARP---SFFTRRSTPLIVFASLAIGLTGFLFGLSTILFPGLRLSGRTCLTN  57

Query  290  IKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDR  469
            + P++V +VWD +   + + +G  G+ KRHKVMGFVGIQTGF SA RRR+LR TW PSD 
Sbjct  58   LPPKTVRIVWDVAGNSIVN-NGAGGQVKRHKVMGFVGIQTGFRSAGRRRALRNTWMPSDP  116

Query  470  QGLQK  484
             GL++
Sbjct  117  DGLRR  121



>ref|XP_006298046.1| hypothetical protein CARUB_v10014091mg [Capsella rubella]
 gb|EOA30944.1| hypothetical protein CARUB_v10014091mg [Capsella rubella]
Length=347

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 79/125 (63%), Gaps = 11/125 (9%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCE------N  289
            MPSSPK F ARP   S  +RRSTPLI+F  + +    F F  S+    G R        +
Sbjct  1    MPSSPKLFHARP---SFFTRRSTPLIVFTSLAIGLTGFLFGLSAILFPGLRLSGRTCLTS  57

Query  290  IKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDR  469
            + P++V VVWD +   + +G G  G+ KRHKVMGFVGIQTGF SA RRR+LR TW PSD 
Sbjct  58   LPPKTVRVVWDVAGNSIVNGAG--GQVKRHKVMGFVGIQTGFRSAGRRRALRNTWMPSDP  115

Query  470  QGLQK  484
            +GL++
Sbjct  116  EGLRR  120



>ref|XP_003527208.1| PREDICTED: probable beta-1,3-galactosyltransferase 14-like isoform 
X1 [Glycine max]
 ref|XP_006582130.1| PREDICTED: probable beta-1,3-galactosyltransferase 14-like isoform 
X2 [Glycine max]
Length=338

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 78/120 (65%), Gaps = 9/120 (8%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRSV  307
            MPSSPK +    ++Y+    R + L LFL   L  F+FG +A   Q  G RC N  PRSV
Sbjct  1    MPSSPKSYA---ISYARQPTRRSTLYLFLSALLLLFLFGIVAFLAQIRGSRCVNAHPRSV  57

Query  308  SVVWDRSS-ARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGLQK  484
             VVW+ S+ A   +GDG      RHKVMGFVGIQTGF SA RR SLR+TWFPSDRQGLQ+
Sbjct  58   RVVWEHSAGAGTVAGDG-----GRHKVMGFVGIQTGFGSAGRRVSLRKTWFPSDRQGLQR  112



>gb|KDO48767.1| hypothetical protein CISIN_1g018669mg [Citrus sinensis]
 gb|KDO48768.1| hypothetical protein CISIN_1g018669mg [Citrus sinensis]
Length=352

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 74/132 (56%), Gaps = 18/132 (14%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLG---HRCENIKP  298
            MPSSPK+F AR  + +S S R + +++F  + +    F    S+    G   HRC N  P
Sbjct  1    MPSSPKFFYAR--SAASPSPRKSTVLIFSCLIIGIAGFVLGISAFLYAGRGAHRCSNFNP  58

Query  299  RSVSVVWDRSSARVSSGDGVDGEQ----------KRHKVMGFVGIQTGFASAARRRSLRQ  448
             SV VVWD         +G+ G Q          KRHKVMGFVGIQTGF S  RRRSLR 
Sbjct  59   TSVRVVWDNHG---EGSNGISGSQDDDNNNNNNIKRHKVMGFVGIQTGFGSGGRRRSLRM  115

Query  449  TWFPSDRQGLQK  484
            TW PSD QGLQ+
Sbjct  116  TWMPSDHQGLQQ  127



>ref|XP_006442538.1| hypothetical protein CICLE_v10020877mg [Citrus clementina]
 gb|ESR55778.1| hypothetical protein CICLE_v10020877mg [Citrus clementina]
Length=352

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 74/132 (56%), Gaps = 18/132 (14%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLG---HRCENIKP  298
            MPSSPK+F AR  + +S S R + +++F  + +    F    S+    G   HRC N  P
Sbjct  1    MPSSPKFFYAR--SAASPSPRKSTVLIFSCLIIGIAGFVLGISAFLYAGRGAHRCSNFNP  58

Query  299  RSVSVVWDRSSARVSSGDGVDGEQ----------KRHKVMGFVGIQTGFASAARRRSLRQ  448
             SV +VWD         +G+ G Q          KRHKVMGFVGIQTGF S  RRRSLR 
Sbjct  59   TSVRIVWDNHG---EGSNGISGSQDDDNNNNNNIKRHKVMGFVGIQTGFGSGGRRRSLRM  115

Query  449  TWFPSDRQGLQK  484
            TW PSD QGLQ+
Sbjct  116  TWMPSDHQGLQQ  127



>ref|XP_002317466.2| galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE98078.2| galactosyltransferase family protein [Populus trichocarpa]
Length=351

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 82/127 (65%), Gaps = 9/127 (7%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaS-SRQSLGHRCENIKP-R  301
            MPSSPK+F +R ++   +SRRSTPLIL  L            S    S  +RC N  P R
Sbjct  1    MPSSPKFFHSR-ISQPFNSRRSTPLILTFLFIGISGFIFGFTSFLTSSHNYRCSNNSPSR  59

Query  302  SVSVVWDRSSARVSSGDG----VDGE--QKRHKVMGFVGIQTGFASAARRRSLRQTWFPS  463
            SV VVW+ S+ R  +G G    +DGE  ++RHKVMGFVGIQTGF S+ RRRSLR TW PS
Sbjct  60   SVRVVWETSNNRNDNGGGNAVVLDGEDRKERHKVMGFVGIQTGFESSGRRRSLRNTWMPS  119

Query  464  DRQGLQK  484
            DRQGLQ+
Sbjct  120  DRQGLQR  126



>gb|KFK38847.1| hypothetical protein AALP_AA3G167900 [Arabis alpina]
Length=345

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 76/122 (62%), Gaps = 11/122 (9%)
 Frame = +2

Query  137  SPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCE------NIKP  298
            SPK F ARP   S  +RRSTPLI+F  + +    F F  S+    G R        N  P
Sbjct  3    SPKLFHARP---SFFTRRSTPLIVFTSLAIGLTGFLFGLSAIVFPGIRLSGRTCLTNTPP  59

Query  299  RSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            ++V VVWD +  R+  G+GV GE KRHKVMGFVGIQTGF S  RRR+LR TW PSD +GL
Sbjct  60   KTVRVVWDVAGNRI--GNGVGGEVKRHKVMGFVGIQTGFRSFGRRRALRNTWMPSDPEGL  117

Query  479  QK  484
            ++
Sbjct  118  KR  119



>ref|NP_188114.1| putative beta-1,3-galactosyltransferase 13 [Arabidopsis thaliana]
 sp|Q9LKA9.1|B3GTD_ARATH RecName: Full=Probable beta-1,3-galactosyltransferase 13 [Arabidopsis 
thaliana]
 dbj|BAA97059.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL49894.1| putative galactosyltransferase [Arabidopsis thaliana]
 gb|AAM91662.1| putative galactosyltransferase [Arabidopsis thaliana]
 gb|AEE75594.1| putative beta-1,3-galactosyltransferase 13 [Arabidopsis thaliana]
 gb|AHL38765.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=343

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 77/125 (62%), Gaps = 14/125 (11%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCE------N  289
            M SSPK F ARP   S  +RRSTPLI+F  + +    F F  S+    G R        N
Sbjct  1    MSSSPKLFHARP---SFFTRRSTPLIVFTSLAIGLTGFLFGLSTILFPGLRLSGRSCLTN  57

Query  290  IKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDR  469
            + P++V +VWD     V+    V+GE KRHKVMGFVGIQTGF SA RRR+LR TW PSD 
Sbjct  58   LPPKTVKIVWD-----VAGNSIVNGEVKRHKVMGFVGIQTGFRSAGRRRALRNTWMPSDP  112

Query  470  QGLQK  484
            +GL++
Sbjct  113  EGLRR  117



>ref|XP_010268841.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Nelumbo 
nucifera]
 ref|XP_010268842.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Nelumbo 
nucifera]
Length=344

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 84/123 (68%), Gaps = 8/123 (7%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRSV  307
            MPS  K F  RP T    +RRS+ L+  LLIG+ GF FG +A  + + G++C N + RSV
Sbjct  1    MPSPSKSFYLRP-TGLFYARRSSILVFCLLIGVTGFAFGLVAILKPTSGYKCRNGEARSV  59

Query  308  SVVWDRSSARVSSGD----GVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQG  475
            SVVW+R   R   GD      DG+QKR+KVMGFVGIQTGF S  RRRSLR+TW P+D+QG
Sbjct  60   SVVWER---RNDVGDQNHVDSDGDQKRYKVMGFVGIQTGFGSVGRRRSLRKTWMPADKQG  116

Query  476  LQK  484
            L++
Sbjct  117  LKR  119



>gb|ACJ84378.1| unknown [Medicago truncatula]
 gb|KEH19561.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
Length=342

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +2

Query  272  GHRCENIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQT  451
            G+RC N  PRSV VVW+ S+A   +G        RHKVMGFVGIQTGF S  RR+SLR T
Sbjct  46   GNRCLNSNPRSVKVVWEHSAAAAVTGSHDQVSNHRHKVMGFVGIQTGFGSVGRRQSLRNT  105

Query  452  WFPSDRQGLQK  484
            WFPSD Q LQ+
Sbjct  106  WFPSDHQSLQR  116



>ref|XP_010465428.1| PREDICTED: probable beta-1,3-galactosyltransferase 13 [Camelina 
sativa]
 ref|XP_010465429.1| PREDICTED: probable beta-1,3-galactosyltransferase 13 [Camelina 
sativa]
Length=348

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 78/125 (62%), Gaps = 10/125 (8%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCE------N  289
            MPSSPK F ARP   S  +RRSTPLI+F  + +    F F  S+    G R        +
Sbjct  1    MPSSPKLFHARP---SFFTRRSTPLIVFASLAIGLTGFLFGLSTILFPGLRLSGRTCLTS  57

Query  290  IKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDR  469
            + P++V +VWD +   + + +G  G+ KRHKVMGFVGIQTGF SA RRR+LR TW PSD 
Sbjct  58   LPPKTVKIVWDVAGNSIVN-NGAGGQVKRHKVMGFVGIQTGFRSAGRRRALRNTWMPSDP  116

Query  470  QGLQK  484
             GL++
Sbjct  117  DGLRR  121



>ref|XP_004146030.1| PREDICTED: probable beta-1,3-galactosyltransferase 13 isoform 
X1 [Cucumis sativus]
 gb|KGN55076.1| hypothetical protein Csa_4G627260 [Cucumis sativus]
Length=347

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 52/72 (72%), Gaps = 2/72 (3%)
 Frame = +2

Query  269  LGHRCENIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQ  448
            L + C N +PR+V VVWDR+    +   G D   KRHKVMGFVGIQTGF+S  RRRSLR 
Sbjct  51   LRNNCSNRQPRTVRVVWDRAPDSAALTTGSDA--KRHKVMGFVGIQTGFSSVGRRRSLRN  108

Query  449  TWFPSDRQGLQK  484
            TW PSDR+GLQ+
Sbjct  109  TWLPSDREGLQR  120



>ref|XP_008463729.1| PREDICTED: probable beta-1,3-galactosyltransferase 13 isoform 
X1 [Cucumis melo]
Length=348

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 55/75 (73%), Gaps = 7/75 (9%)
 Frame = +2

Query  269  LGHRCENIKPRSVSVVWDR---SSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRS  439
            L + C N +PR+V VVWD+   S A V++G     + KRHKVMGFVGIQTGF+S  RRRS
Sbjct  51   LPYNCSNRQPRTVRVVWDKAPDSGASVTTG----SDAKRHKVMGFVGIQTGFSSVGRRRS  106

Query  440  LRQTWFPSDRQGLQK  484
            LR TW PSDR+GLQ+
Sbjct  107  LRNTWLPSDREGLQR  121



>ref|XP_010487310.1| PREDICTED: probable beta-1,3-galactosyltransferase 13 [Camelina 
sativa]
Length=348

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 78/125 (62%), Gaps = 10/125 (8%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCE------N  289
            MPSSPK F ARP   S  +RRSTPLI+F  + +    F F  S+    G R        +
Sbjct  1    MPSSPKLFHARP---SFFTRRSTPLIVFASLAIGFTGFLFGLSTILFPGLRLSGRTCLTS  57

Query  290  IKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDR  469
            + P++V +VWD +   + + +G  G+ KRHKVMGFVGIQTGF SA RRR+LR TW PSD 
Sbjct  58   LPPKTVRIVWDVAGNSIVN-NGAGGQVKRHKVMGFVGIQTGFRSAGRRRALRNTWMPSDP  116

Query  470  QGLQK  484
             GL++
Sbjct  117  DGLRR  121



>ref|XP_004294097.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Fragaria 
vesca subsp. vesca]
Length=347

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 77/124 (62%), Gaps = 8/124 (6%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRSV  307
            MPSSPK+F AR   +  S RRST LI+   +      F F   + +S  ++C   + RSV
Sbjct  1    MPSSPKFFHAR---HPPSGRRSTVLIISFCLVFGLSGFIFGLVALRSSHYKCITSQSRSV  57

Query  308  SVVWDRSSARVSSGDGV---DGE--QKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQ  472
             VVW+R     S+ +G+   DG+   +RHKVMGFVGIQTGF S  RR SLR+TW PSD Q
Sbjct  58   RVVWERIGTTRSTENGLVLSDGDVSAQRHKVMGFVGIQTGFGSVGRRESLRKTWMPSDAQ  117

Query  473  GLQK  484
            GLQ+
Sbjct  118  GLQR  121



>gb|KCW69940.1| hypothetical protein EUGRSUZ_F03260 [Eucalyptus grandis]
Length=251

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 79/126 (63%), Gaps = 16/126 (13%)
 Frame = +2

Query  128  MPSSPKYF-TARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRS  304
            MP SPK+F  +RP     S RRST LIL   + +    F F   +    G +C   +PRS
Sbjct  1    MPPSPKFFHQSRP-----SPRRSTVLILGCCLLIGLSGFVFGLIAILRPG-KCSVHEPRS  54

Query  305  VSVVWDRSSARVSSGDGV----DGEQK--RHKVMGFVGIQTGFASAARRRSLRQTWFPSD  466
            V +VW+R      +GDG+    DG ++  RHKVMGFVGIQTGF SA RRRSLRQTW PSD
Sbjct  55   VRIVWEREDG---AGDGLNSAGDGVRRTDRHKVMGFVGIQTGFGSAGRRRSLRQTWMPSD  111

Query  467  RQGLQK  484
            RQGLQ+
Sbjct  112  RQGLQR  117



>ref|XP_012078580.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Jatropha 
curcas]
 gb|KDP32525.1| hypothetical protein JCGZ_14728 [Jatropha curcas]
Length=348

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 77/126 (61%), Gaps = 11/126 (9%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENI--KPR  301
            MPSSPKY  +R L+  S SRRS  L+ F L      +   + +     G+RC +    PR
Sbjct  1    MPSSPKYLHSR-LSPPSPSRRSAFLMFFCLFIGISGLIFGLTAPS---GYRCSHTTADPR  56

Query  302  SVSVVWDRSSARVSSGDGVDG-----EQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSD  466
            SV VVWD +S    + +  DG     E+KRHKVMGFVGIQTGF SA RR SLR+TW PSD
Sbjct  57   SVRVVWDINSNTNLNNNNNDGSVLNTEKKRHKVMGFVGIQTGFGSAGRRESLRKTWMPSD  116

Query  467  RQGLQK  484
             QGLQ+
Sbjct  117  LQGLQR  122



>gb|KCW69941.1| hypothetical protein EUGRSUZ_F03260 [Eucalyptus grandis]
Length=275

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 79/126 (63%), Gaps = 16/126 (13%)
 Frame = +2

Query  128  MPSSPKYF-TARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRS  304
            MP SPK+F  +RP     S RRST LIL   + +    F F   +    G +C   +PRS
Sbjct  1    MPPSPKFFHQSRP-----SPRRSTVLILGCCLLIGLSGFVFGLIAILRPG-KCSVHEPRS  54

Query  305  VSVVWDRSSARVSSGDGV----DGEQK--RHKVMGFVGIQTGFASAARRRSLRQTWFPSD  466
            V +VW+R      +GDG+    DG ++  RHKVMGFVGIQTGF SA RRRSLRQTW PSD
Sbjct  55   VRIVWEREDG---AGDGLNSAGDGVRRTDRHKVMGFVGIQTGFGSAGRRRSLRQTWMPSD  111

Query  467  RQGLQK  484
            RQGLQ+
Sbjct  112  RQGLQR  117



>ref|XP_010062808.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Eucalyptus 
grandis]
 ref|XP_010062809.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Eucalyptus 
grandis]
 gb|KCW69937.1| hypothetical protein EUGRSUZ_F03260 [Eucalyptus grandis]
 gb|KCW69938.1| hypothetical protein EUGRSUZ_F03260 [Eucalyptus grandis]
Length=343

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 76/124 (61%), Gaps = 12/124 (10%)
 Frame = +2

Query  128  MPSSPKYF-TARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRS  304
            MP SPK+F  +RP     S RRST LIL   + +    F F   +    G +C   +PRS
Sbjct  1    MPPSPKFFHQSRP-----SPRRSTVLILGCCLLIGLSGFVFGLIAILRPG-KCSVHEPRS  54

Query  305  VSVVWDRSSA----RVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQ  472
            V +VW+R         S+GDGV     RHKVMGFVGIQTGF SA RRRSLRQTW PSDRQ
Sbjct  55   VRIVWEREDGAGDGLNSAGDGVR-RTDRHKVMGFVGIQTGFGSAGRRRSLRQTWMPSDRQ  113

Query  473  GLQK  484
            GLQ+
Sbjct  114  GLQR  117



>gb|KCW69939.1| hypothetical protein EUGRSUZ_F03260 [Eucalyptus grandis]
Length=323

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 76/124 (61%), Gaps = 12/124 (10%)
 Frame = +2

Query  128  MPSSPKYF-TARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRS  304
            MP SPK+F  +RP     S RRST LIL   + +    F F   +    G +C   +PRS
Sbjct  1    MPPSPKFFHQSRP-----SPRRSTVLILGCCLLIGLSGFVFGLIAILRPG-KCSVHEPRS  54

Query  305  VSVVWDRSSA----RVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQ  472
            V +VW+R         S+GDGV     RHKVMGFVGIQTGF SA RRRSLRQTW PSDRQ
Sbjct  55   VRIVWEREDGAGDGLNSAGDGVR-RTDRHKVMGFVGIQTGFGSAGRRRSLRQTWMPSDRQ  113

Query  473  GLQK  484
            GLQ+
Sbjct  114  GLQR  117



>ref|XP_011029556.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Populus 
euphratica]
Length=351

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 81/127 (64%), Gaps = 9/127 (7%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaS-SRQSLGHRC-ENIKPR  301
            MPSSPK+F +R ++   +  RSTPLIL  L+           S    S  +RC  N  PR
Sbjct  1    MPSSPKFFHSR-ISQPFNPSRSTPLILTFLLIGISGFIFGFTSFLTSSHNYRCSNNSPPR  59

Query  302  SVSVVWDRSSARVSSGDG----VDGE--QKRHKVMGFVGIQTGFASAARRRSLRQTWFPS  463
            SV VVW+ S+ R  +G G    +DGE  ++RHKVMGFVGIQTGF S+ RRRSLR TW PS
Sbjct  60   SVRVVWETSNNRNDNGGGNAVVLDGEDRKERHKVMGFVGIQTGFESSGRRRSLRNTWMPS  119

Query  464  DRQGLQK  484
            DRQGLQ+
Sbjct  120  DRQGLQR  126



>ref|XP_009146301.1| PREDICTED: probable beta-1,3-galactosyltransferase 13 [Brassica 
rapa]
Length=343

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 77/122 (63%), Gaps = 8/122 (7%)
 Frame = +2

Query  128  MPSSP--KYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRC-ENIKP  298
            MPSSP  K F AR    S S+RRST LI+   + +  F F F  S+       C  N  P
Sbjct  1    MPSSPRLKLFHART---SPSTRRSTSLIVLTSLAIGLFGFIFGLSAIVFPSRTCLTNSPP  57

Query  299  RSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            ++V VVWD   A  S+G+G+ G  KRHKVMGFVGIQTGF SA RRR+LR TW PSD +GL
Sbjct  58   KTVKVVWD--VAGNSNGNGLSGGVKRHKVMGFVGIQTGFGSAGRRRALRSTWMPSDPEGL  115

Query  479  QK  484
            ++
Sbjct  116  RR  117



>ref|XP_004516077.1| PREDICTED: probable beta-1,3-galactosyltransferase 14-like [Cicer 
arietinum]
Length=334

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 49/71 (69%), Gaps = 4/71 (6%)
 Frame = +2

Query  272  GHRCENIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQT  451
            G+RC +  PRSV VVW+ S+     G G      RHKVMGFVGIQTGF S  RR SLR+T
Sbjct  42   GNRCIHSNPRSVKVVWEHSTG----GAGSHVVSNRHKVMGFVGIQTGFGSVRRRESLRKT  97

Query  452  WFPSDRQGLQK  484
            WFPSD QGLQ+
Sbjct  98   WFPSDHQGLQR  108



>gb|KEH38625.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
Length=316

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 47/71 (66%), Gaps = 4/71 (6%)
 Frame = +2

Query  272  GHRCENIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQT  451
             +RC N  PRSV VVWD  +A  + G G      RHKVM FVGIQTGF S  RR+SLR T
Sbjct  44   NNRCLNTNPRSVRVVWDHGTAAATIGGG----NYRHKVMAFVGIQTGFRSVGRRQSLRNT  99

Query  452  WFPSDRQGLQK  484
            WFPSD  GLQ+
Sbjct  100  WFPSDPNGLQR  110



>gb|KEH38624.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
Length=335

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 47/71 (66%), Gaps = 4/71 (6%)
 Frame = +2

Query  272  GHRCENIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQT  451
             +RC N  PRSV VVWD  +A  + G G      RHKVM FVGIQTGF S  RR+SLR T
Sbjct  44   NNRCLNTNPRSVRVVWDHGTAAATIGGG----NYRHKVMAFVGIQTGFRSVGRRQSLRNT  99

Query  452  WFPSDRQGLQK  484
            WFPSD  GLQ+
Sbjct  100  WFPSDPNGLQR  110



>ref|XP_010535043.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Tarenaya 
hassleriana]
Length=346

 Score = 86.7 bits (213),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 76/125 (61%), Gaps = 11/125 (9%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQS-----LGHRC-EN  289
            MPSSPK F ARP   S S+RRST LI+F  + +    F F  ++  S     +G  C  N
Sbjct  1    MPSSPKLFHARP---SLSTRRSTVLIVFTSLAIGIAGFLFGLAAILSPGLRFVGRNCLSN  57

Query  290  IKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDR  469
              P +V VVWD S     +G G   E KRHKVMGFVGIQTGF SA RRR+LR TW PSD 
Sbjct  58   APPATVRVVWDVSGNGNGNGAGG--EVKRHKVMGFVGIQTGFGSAGRRRALRMTWMPSDP  115

Query  470  QGLQK  484
             GL++
Sbjct  116  DGLRR  120



>ref|NP_175736.2| putative beta-1,3-galactosyltransferase 14 [Arabidopsis thaliana]
 sp|Q8L7M1.1|B3GTE_ARATH RecName: Full=Probable beta-1,3-galactosyltransferase 14 [Arabidopsis 
thaliana]
 gb|AAM91579.1| unknown protein [Arabidopsis thaliana]
 gb|AAP68270.1| At1g53290 [Arabidopsis thaliana]
 gb|AEE32919.1| putative beta-1,3-galactosyltransferase 14 [Arabidopsis thaliana]
 gb|AHL38904.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=345

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 52/72 (72%), Gaps = 4/72 (6%)
 Frame = +2

Query  272  GHRC-ENIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQ  448
            G  C  N  P++V VVWD +    +S   V GE+KRHKVMGFVGIQTGF SA RRRSLR+
Sbjct  51   GRNCLTNTPPKTVRVVWDVAG---NSNGVVSGEKKRHKVMGFVGIQTGFGSAGRRRSLRK  107

Query  449  TWFPSDRQGLQK  484
            TW PSD +GL++
Sbjct  108  TWMPSDPEGLRR  119



>gb|AAF69535.1|AC008007_10 F12M16.19 [Arabidopsis thaliana]
Length=353

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 52/72 (72%), Gaps = 4/72 (6%)
 Frame = +2

Query  272  GHRC-ENIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQ  448
            G  C  N  P++V VVWD +    +S   V GE+KRHKVMGFVGIQTGF SA RRRSLR+
Sbjct  51   GRNCLTNTPPKTVRVVWDVAG---NSNGVVSGEKKRHKVMGFVGIQTGFGSAGRRRSLRK  107

Query  449  TWFPSDRQGLQK  484
            TW PSD +GL++
Sbjct  108  TWMPSDPEGLRR  119



>ref|XP_009340101.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 isoform 
X2 [Pyrus x bretschneideri]
Length=301

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 73/133 (55%), Gaps = 14/133 (11%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRSV  307
            MPSSPK+F AR     S+ R +  ++ F L+         I S      +RC     RSV
Sbjct  1    MPSSPKFFHAR--QPPSTLRTTVLIVAFSLVFGLSGFIFGIVSVLHPSQYRCLTGNARSV  58

Query  308  SVVWDRSSARVSS-----------GDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTW  454
             VVW++S                 GDG D E KRHKVMGFVGIQTGF S  RR+SLR+TW
Sbjct  59   KVVWEKSGGGGGGSSTQNGLVSGVGDGND-ENKRHKVMGFVGIQTGFRSTGRRQSLRKTW  117

Query  455  FPSDRQGLQKYSF  493
             PS+ QGLQ+ +F
Sbjct  118  MPSNTQGLQRLAF  130



>emb|CDX97620.1| BnaA05g24590D [Brassica napus]
Length=342

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 50/66 (76%), Gaps = 2/66 (3%)
 Frame = +2

Query  287  NIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSD  466
            N  P++V VVWD   A  S+G+G+ G  KRHKVMGFVGIQTGF SA RRR+LR TW PSD
Sbjct  54   NSPPKTVKVVWD--VAGNSNGNGLSGGVKRHKVMGFVGIQTGFGSAGRRRALRSTWMPSD  111

Query  467  RQGLQK  484
             +GL++
Sbjct  112  PEGLRR  117



>ref|XP_002891740.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67999.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=349

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 52/72 (72%), Gaps = 4/72 (6%)
 Frame = +2

Query  272  GHRC-ENIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQ  448
            G  C  N  P++V VVWD +    +S   V GE+KRHKVMGFVGIQTGF SA RRRSLR+
Sbjct  51   GRNCLTNTPPKTVRVVWDVAG---NSNGVVGGERKRHKVMGFVGIQTGFGSAGRRRSLRK  107

Query  449  TWFPSDRQGLQK  484
            TW PSD +GL++
Sbjct  108  TWMPSDPEGLRR  119



>ref|XP_006305250.1| hypothetical protein CARUB_v10009620mg [Capsella rubella]
 gb|EOA38148.1| hypothetical protein CARUB_v10009620mg [Capsella rubella]
Length=276

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 51/72 (71%), Gaps = 4/72 (6%)
 Frame = +2

Query  272  GHRC-ENIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQ  448
            G  C  N  P++V VVWD +    +S   V GE+KRHKVMGFVGIQTGF SA RRR+LR+
Sbjct  51   GRNCLTNSPPKTVRVVWDVTG---NSNGVVGGEEKRHKVMGFVGIQTGFGSAGRRRALRK  107

Query  449  TWFPSDRQGLQK  484
            TW PSD  GL++
Sbjct  108  TWMPSDPDGLRR  119



>ref|XP_009340109.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 isoform 
X3 [Pyrus x bretschneideri]
Length=294

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 72/131 (55%), Gaps = 16/131 (12%)
 Frame = +2

Query  128  MPSSPKYFTAR-PLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRS  304
            MPSSPK+F AR P    S+ R +  ++ F L+         I S      +RC     RS
Sbjct  1    MPSSPKFFHARQP---PSTLRTTVLIVAFSLVFGLSGFIFGIVSVLHPSQYRCLTGNARS  57

Query  305  VSVVWDRSSARVSS-----------GDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQT  451
            V VVW++S                 GDG D E KRHKVMGFVGIQTGF S  RR+SLR+T
Sbjct  58   VKVVWEKSGGGGGGSSTQNGLVSGVGDGND-ENKRHKVMGFVGIQTGFRSTGRRQSLRKT  116

Query  452  WFPSDRQGLQK  484
            W PS+ QGLQ+
Sbjct  117  WMPSNTQGLQR  127



>ref|XP_006305251.1| hypothetical protein CARUB_v10009620mg [Capsella rubella]
 gb|EOA38149.1| hypothetical protein CARUB_v10009620mg [Capsella rubella]
Length=345

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 51/72 (71%), Gaps = 4/72 (6%)
 Frame = +2

Query  272  GHRC-ENIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQ  448
            G  C  N  P++V VVWD +    +S   V GE+KRHKVMGFVGIQTGF SA RRR+LR+
Sbjct  51   GRNCLTNSPPKTVRVVWDVTG---NSNGVVGGEEKRHKVMGFVGIQTGFGSAGRRRALRK  107

Query  449  TWFPSDRQGLQK  484
            TW PSD  GL++
Sbjct  108  TWMPSDPDGLRR  119



>ref|XP_009409699.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Musa acuminata 
subsp. malaccensis]
Length=377

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 46/68 (68%), Gaps = 6/68 (9%)
 Frame = +2

Query  281  CENIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFP  460
            C  ++PRSVSVVWDR     S      G  +RHKVM FVGIQTGF S  RRRS+RQTW P
Sbjct  92   CPGLEPRSVSVVWDRGGGTGS------GTPERHKVMAFVGIQTGFGSVGRRRSIRQTWLP  145

Query  461  SDRQGLQK  484
            SDR GL +
Sbjct  146  SDRPGLLR  153



>ref|XP_008786078.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Phoenix 
dactylifera]
Length=408

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 50/78 (64%), Gaps = 9/78 (12%)
 Frame = +2

Query  278  RCENIKPRSVSVVWDRSSARVSSGDG---------VDGEQKRHKVMGFVGIQTGFASAAR  430
            +C + +P SVSVVWDR +      +G           G  KRHKVMGFVGIQTGF S  R
Sbjct  106  KCADFEPISVSVVWDRGAGSKLVAEGRPDLIGGDDGGGSGKRHKVMGFVGIQTGFGSVGR  165

Query  431  RRSLRQTWFPSDRQGLQK  484
            RRSLR+TWFPSDRQ L +
Sbjct  166  RRSLRKTWFPSDRQSLLR  183



>ref|XP_006392804.1| hypothetical protein EUTSA_v10011624mg [Eutrema salsugineum]
 gb|ESQ30090.1| hypothetical protein EUTSA_v10011624mg [Eutrema salsugineum]
Length=344

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 51/72 (71%), Gaps = 5/72 (7%)
 Frame = +2

Query  272  GHRC-ENIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQ  448
            G  C  N  P++V VVWD +     + + V GE KRHKVMGFVGIQTGF SA RRR+LR+
Sbjct  51   GRNCLTNSPPKTVRVVWDVAG----NSNAVGGEGKRHKVMGFVGIQTGFGSAGRRRALRK  106

Query  449  TWFPSDRQGLQK  484
            TW PSD +GL++
Sbjct  107  TWMPSDPEGLRR  118



>ref|XP_009340093.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 isoform 
X1 [Pyrus x bretschneideri]
Length=352

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 71/130 (55%), Gaps = 14/130 (11%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRSV  307
            MPSSPK+F AR     S+ R +  ++ F L+         I S      +RC     RSV
Sbjct  1    MPSSPKFFHAR--QPPSTLRTTVLIVAFSLVFGLSGFIFGIVSVLHPSQYRCLTGNARSV  58

Query  308  SVVWDRSSARVSS-----------GDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTW  454
             VVW++S                 GDG D E KRHKVMGFVGIQTGF S  RR+SLR+TW
Sbjct  59   KVVWEKSGGGGGGSSTQNGLVSGVGDGND-ENKRHKVMGFVGIQTGFRSTGRRQSLRKTW  117

Query  455  FPSDRQGLQK  484
             PS+ QGLQ+
Sbjct  118  MPSNTQGLQR  127



>emb|CDX82456.1| BnaA03g33650D [Brassica napus]
Length=342

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 76/127 (60%), Gaps = 19/127 (15%)
 Frame = +2

Query  128  MPSSP--KYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCE-----  286
            MPSSP  K F ARP      SRR T LI+   I +  F F F  S+    G R       
Sbjct  1    MPSSPRLKLFHARP------SRRPTSLIVITSIAIGLFGFLFGLSAIIFPGIRLSSRTCL  54

Query  287  -NIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPS  463
             N  P++V +VWD +  R ++G GV    KRHKVMGFVGIQTGFASA RRR+LR TW PS
Sbjct  55   TNSPPKTVRIVWDVAGNRNANG-GV----KRHKVMGFVGIQTGFASAGRRRALRNTWMPS  109

Query  464  DRQGLQK  484
            D QGL++
Sbjct  110  DPQGLRR  116



>ref|XP_008386244.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Malus 
domestica]
Length=354

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 72/133 (54%), Gaps = 18/133 (14%)
 Frame = +2

Query  128  MPSSPKYFTAR-PLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRS  304
            MPSSPK+F AR P    S+ R +  ++ F L+         I S      ++C     RS
Sbjct  1    MPSSPKFFHARQP---PSTLRPTVLIVAFSLVFGLSGFIFGIVSILHPSQYKCLAGNARS  57

Query  305  VSVVWDRSSARVSS-------------GDGVDGEQKRHKVMGFVGIQTGFASAARRRSLR  445
            V VVW++S                   GDG D E KRHKVMGFVGIQTGF S  RR+SLR
Sbjct  58   VKVVWEKSGGGGGGGSSSTQNGLVSGVGDGND-ENKRHKVMGFVGIQTGFRSTGRRQSLR  116

Query  446  QTWFPSDRQGLQK  484
            +TW PSD QGLQ+
Sbjct  117  KTWMPSDTQGLQR  129



>ref|XP_009135415.1| PREDICTED: probable beta-1,3-galactosyltransferase 13 [Brassica 
rapa]
Length=343

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 76/127 (60%), Gaps = 19/127 (15%)
 Frame = +2

Query  128  MPSSP--KYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCE-----  286
            MPSSP  K F ARP      SRR T LI+   I +  F F F  S+    G R       
Sbjct  2    MPSSPRLKLFHARP------SRRPTSLIVITSIAIGLFGFLFGLSAIIFPGIRLSSRTCL  55

Query  287  -NIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPS  463
             N  P++V +VWD +  R ++G GV    KRHKVMGFVGIQTGF+SA RRR+LR TW PS
Sbjct  56   TNSPPKTVRIVWDVAGNRNANG-GV----KRHKVMGFVGIQTGFSSAGRRRALRNTWMPS  110

Query  464  DRQGLQK  484
            D QGL++
Sbjct  111  DPQGLRR  117



>ref|XP_008226526.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Prunus 
mume]
Length=351

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 72/130 (55%), Gaps = 15/130 (12%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGH--RCENIKPR  301
            MPSSPK+F AR      S+ R T L++   +      F F   S     H  +C   K R
Sbjct  1    MPSSPKFFHARQ---PPSALRPTVLLVGFCLVFGLSGFIFGLVSLLHPSHQYKCLTSKSR  57

Query  302  SVSVVWDR---------SSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTW  454
            SV V+W+R         +   ++ GDG D   KR KVMGFVGIQTGF S  RR+SLR+TW
Sbjct  58   SVKVIWERGSSSSSSSQNGIVLNVGDGNDN-NKRKKVMGFVGIQTGFRSTGRRQSLRKTW  116

Query  455  FPSDRQGLQK  484
             PSD QGLQ+
Sbjct  117  MPSDAQGLQR  126



>emb|CDX75799.1| BnaC03g38820D [Brassica napus]
Length=342

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 76/127 (60%), Gaps = 19/127 (15%)
 Frame = +2

Query  128  MPSSP--KYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCE-----  286
            MPSSP  K F ARP      SRR T LI+   I +  F F F  S+    G R       
Sbjct  1    MPSSPRLKLFHARP------SRRPTSLIVIASIAIGLFGFLFGLSAIIFPGIRLSARTCL  54

Query  287  -NIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPS  463
             N  P++V +VWD +  R ++G GV    KRHKVMGFVGIQTGF+SA RRR+LR TW PS
Sbjct  55   TNSPPKTVRIVWDVAGNRNTNG-GV----KRHKVMGFVGIQTGFSSAGRRRALRNTWMPS  109

Query  464  DRQGLQK  484
            D QGL++
Sbjct  110  DPQGLRR  116



>ref|XP_010675418.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Beta vulgaris 
subsp. vulgaris]
Length=352

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 56/86 (65%), Gaps = 13/86 (15%)
 Frame = +2

Query  257  SRQSLGHRCENIKPRSVSVVWDRSS----------ARVSSGDGVDGEQKRHKVMGFVGIQ  406
            SR  L + C++++P +VSVVW+ ++          A++S    +   + RHKVMGFVGI 
Sbjct  47   SRPLLHYNCKSLQPTTVSVVWENNANANANANANGAQISQSKDM---KNRHKVMGFVGIF  103

Query  407  TGFASAARRRSLRQTWFPSDRQGLQK  484
            TGF S  RRRSLRQTW PSDR GLQ+
Sbjct  104  TGFGSVGRRRSLRQTWLPSDRDGLQR  129



>ref|XP_010500968.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Camelina 
sativa]
Length=348

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +2

Query  272  GHRC-ENIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQ  448
            G  C  N  P++V VVWD +    +   G  GE KRHKVMGFVGIQTGF SA RRRSLR+
Sbjct  51   GRNCLTNTPPKTVRVVWDVTGNSNNGDVGGGGEGKRHKVMGFVGIQTGFGSAGRRRSLRK  110

Query  449  TWFPSDRQGLQK  484
            TW PSD +GL++
Sbjct  111  TWMPSDPEGLRR  122



>ref|XP_010462209.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Camelina 
sativa]
Length=348

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +2

Query  272  GHRC-ENIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQ  448
            G  C  N  P++V VVWD +    +   G  GE KRHKVMGFVGIQTGF SA RRRSLR+
Sbjct  51   GRNCLTNTPPKTVRVVWDVTGNSNNGDVGGGGEGKRHKVMGFVGIQTGFGSAGRRRSLRK  110

Query  449  TWFPSDRQGLQK  484
            TW PSD +GL++
Sbjct  111  TWMPSDPEGLRR  122



>gb|EPS63358.1| hypothetical protein M569_11427 [Genlisea aurea]
Length=340

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 68/121 (56%), Gaps = 10/121 (8%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSR-QSLGHRCENIKPRS  304
            MPSSPK    RP  YS  S  S   +L  + G    +       + +   HR     P S
Sbjct  1    MPSSPKSSNFRPSIYSYRSAASCLYLLIGISGFVFGLSALSLRGQTRDFKHR----NPLS  56

Query  305  VSVVWDRSSARVSSGDGV-DGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGLQ  481
            VSV WDRSS       G+ D + KR KVMGFVG+QTGF S +RRR+LRQTWFPSD Q L+
Sbjct  57   VSVRWDRSSTDA----GIPDDDSKRRKVMGFVGVQTGFGSGSRRRALRQTWFPSDHQQLE  112

Query  482  K  484
            +
Sbjct  113  R  113



>gb|KJB13203.1| hypothetical protein B456_002G062000 [Gossypium raimondii]
Length=351

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 75/123 (61%), Gaps = 7/123 (6%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRSV  307
            MPSSPK+F +R    ++   RST LI+F  +     ++ F++S+    GH+C +   RSV
Sbjct  1    MPSSPKFFHSRHPPPATRLTRSTALIVFSTLSFLFSLYVFLSST--DCGHQCLS-DLRSV  57

Query  308  SVVWDR----SSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQG  475
             V+ D+    +    S GD      KRHKVMGFVGIQTGF S  RRRSLR+TW PS  QG
Sbjct  58   RVLLDKPGNVNITATSDGDVDVNGTKRHKVMGFVGIQTGFRSVGRRRSLRKTWMPSYHQG  117

Query  476  LQK  484
            LQ+
Sbjct  118  LQR  120



>ref|XP_008382063.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Malus 
domestica]
Length=349

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 70/127 (55%), Gaps = 11/127 (9%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRSV  307
            MPSSPK+F AR     S+ R +  ++ F L+         I S  +   + C     RSV
Sbjct  1    MPSSPKFFHAR--QPPSALRPTVLIVAFSLVIGLSGFIVGIVSVLRPSQYNCLTGSARSV  58

Query  308  SVVWD--------RSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPS  463
             VVW+        +    +  GDG D + KRHKVMGFVGIQTGF S  RR+SLR+TW PS
Sbjct  59   KVVWETSGGGSSTQXGLVLGVGDGND-DNKRHKVMGFVGIQTGFQSTGRRQSLRKTWMPS  117

Query  464  DRQGLQK  484
            D  GLQ+
Sbjct  118  DALGLQR  124



>ref|XP_007211503.1| hypothetical protein PRUPE_ppa007915mg [Prunus persica]
 gb|EMJ12702.1| hypothetical protein PRUPE_ppa007915mg [Prunus persica]
Length=351

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 73/130 (56%), Gaps = 15/130 (12%)
 Frame = +2

Query  128  MPSSPKYFTAR--PLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPR  301
            MPSSPK+F AR  P     +       +LF L G    +   +  SRQ   ++C   K R
Sbjct  1    MPSSPKFFHARQPPSALRPTVLLIGFCLLFGLSGFIFGLVSLLHPSRQ---YKCLTSKSR  57

Query  302  SVSVVWD---------RSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTW  454
            SV V+W+         ++   ++ GDG D   KR KVMGFVGIQTGF S  RR+SLR+TW
Sbjct  58   SVKVIWETGSSSSSSSQNGLVLNVGDGNDN-NKRKKVMGFVGIQTGFRSTGRRQSLRKTW  116

Query  455  FPSDRQGLQK  484
             PSD QGLQ+
Sbjct  117  MPSDAQGLQR  126



>ref|XP_003543216.1| PREDICTED: probable beta-1,3-galactosyltransferase 13-like [Glycine 
max]
Length=336

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 61/118 (52%), Gaps = 8/118 (7%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRSV  307
            MP  PK F ARP       RR++ L+   L         F A  R      C N  PRSV
Sbjct  1    MPPFPKTFYARP-----PPRRTSFLVFSCLFLSLSLFVFFFAFLRPLRDPPCPNRVPRSV  55

Query  308  SVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGLQ  481
             V+WD    R+S        + RHKVM FVGIQTGF S  RR+SLR TWFPSD  GLQ
Sbjct  56   KVLWDH---RLSGDSNNAPVETRHKVMAFVGIQTGFRSVGRRQSLRNTWFPSDPHGLQ  110



>ref|XP_009342281.1| PREDICTED: probable beta-1,3-galactosyltransferase 13 [Pyrus 
x bretschneideri]
Length=352

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 70/130 (54%), Gaps = 14/130 (11%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRSV  307
            MPSSPK+F AR     S+ R +  ++ F L+         I S      + C     RSV
Sbjct  1    MPSSPKFFHAR--QPPSALRPTVLIVAFSLVIGLSGFIVGIVSVLHPSQYNCRIGSARSV  58

Query  308  SVVWD-----------RSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTW  454
             VVW+           ++   +  GDG D + KRHKVMGFVGIQTGF S  RR+SLR+TW
Sbjct  59   KVVWETSGGGGTSSSTQNGLVLGVGDGND-DNKRHKVMGFVGIQTGFRSTGRRKSLRKTW  117

Query  455  FPSDRQGLQK  484
             PSD  GLQ+
Sbjct  118  MPSDALGLQR  127



>ref|XP_004489037.1| PREDICTED: probable beta-1,3-galactosyltransferase 14-like isoform 
X1 [Cicer arietinum]
 ref|XP_004489038.1| PREDICTED: probable beta-1,3-galactosyltransferase 14-like isoform 
X2 [Cicer arietinum]
 ref|XP_004489039.1| PREDICTED: probable beta-1,3-galactosyltransferase 14-like isoform 
X3 [Cicer arietinum]
 ref|XP_004489040.1| PREDICTED: probable beta-1,3-galactosyltransferase 14-like isoform 
X4 [Cicer arietinum]
Length=333

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 46/69 (67%), Gaps = 4/69 (6%)
 Frame = +2

Query  278  RCENIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWF  457
            RC NI PRSV V WD ++   ++   V  E  RHKVM FVGIQTGF S  RR+SLR TWF
Sbjct  44   RCLNINPRSVRVHWDHTA---TARQNVVAED-RHKVMAFVGIQTGFGSVGRRKSLRSTWF  99

Query  458  PSDRQGLQK  484
            PS   GLQ+
Sbjct  100  PSHPNGLQR  108



>ref|XP_009335180.1| PREDICTED: probable beta-1,3-galactosyltransferase 13 [Pyrus 
x bretschneideri]
Length=352

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 70/130 (54%), Gaps = 14/130 (11%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRSV  307
            MPSSPK+F AR     S+ R +  ++ F L+         I S      + C     RSV
Sbjct  1    MPSSPKFFHAR--QPPSALRPTVLIVAFSLVIGLSGFIVGIVSVLHPSQYNCRIGSARSV  58

Query  308  SVVWD-----------RSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTW  454
             VVW+           ++   +  GDG D + KRHKVMGFVGIQTGF S  RR+SLR+TW
Sbjct  59   KVVWETSGGGGTSSSTQNGLVLGVGDGND-DNKRHKVMGFVGIQTGFRSTGRRKSLRKTW  117

Query  455  FPSDRQGLQK  484
             PSD  GLQ+
Sbjct  118  MPSDALGLQR  127



>ref|XP_010108248.1| putative beta-1,3-galactosyltransferase 14 [Morus notabilis]
 gb|EXC18488.1| putative beta-1,3-galactosyltransferase 14 [Morus notabilis]
Length=359

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 71/127 (56%), Gaps = 17/127 (13%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRCENIKPRSV  307
            MPSSPK+F AR      S+RRST LI+   + +    F F  +S      +C +  PRSV
Sbjct  1    MPSSPKFFRARQ---PHSARRSTVLIVAGCLLVGIAGFAFGLASLFR-PIKCSHGDPRSV  56

Query  308  SVVWDRSSAR---------VSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFP  460
             VVW+R S           VS G G      R KVMGFVGIQTGF S  RRRSLR TW P
Sbjct  57   RVVWERGSGGGGGRDGHGAVSDGGG----NNRRKVMGFVGIQTGFGSVGRRRSLRMTWMP  112

Query  461  SDRQGLQ  481
            SD QGL+
Sbjct  113  SDPQGLR  119



>gb|AFW85777.1| hypothetical protein ZEAMMB73_228985 [Zea mays]
Length=142

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 50/77 (65%), Gaps = 8/77 (10%)
 Frame = +2

Query  278  RC-ENIKPRSVSVVWDRSSARVSSGDGVD-------GEQKRHKVMGFVGIQTGFASAARR  433
            RC ++ +P SVSV WDRS    S+G   +       G + RHKVM FVGI TGF S  RR
Sbjct  58   RCPDSSRPLSVSVAWDRSPGDGSAGGSAELPASLATGSRGRHKVMAFVGIFTGFGSIGRR  117

Query  434  RSLRQTWFPSDRQGLQK  484
            R+LR+TW P+DRQGL +
Sbjct  118  RALRRTWLPADRQGLLR  134



>emb|CDY55848.1| BnaCnng29350D [Brassica napus]
Length=348

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 50/74 (68%), Gaps = 8/74 (11%)
 Frame = +2

Query  272  GHRC-ENIKPRSVSVVWDR--SSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSL  442
            G  C  N  P++V VVWD   +S  V  GDG     KRHKVMGFVGIQTGF S  RR++L
Sbjct  51   GRNCLTNAPPKTVRVVWDVVGNSKGVGGGDG-----KRHKVMGFVGIQTGFGSTGRRQAL  105

Query  443  RQTWFPSDRQGLQK  484
            R+TW PSD +GL++
Sbjct  106  RKTWMPSDPEGLRR  119



>emb|CDY55849.1| BnaCnng29360D [Brassica napus]
Length=348

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 50/74 (68%), Gaps = 8/74 (11%)
 Frame = +2

Query  272  GHRC-ENIKPRSVSVVWDR--SSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSL  442
            G  C  N  P++V VVWD   +S  V  GDG     KRHKVMGFVGIQTGF S  RR++L
Sbjct  51   GRNCLTNAPPKTVRVVWDVVGNSKGVGGGDG-----KRHKVMGFVGIQTGFGSTGRRQAL  105

Query  443  RQTWFPSDRQGLQK  484
            R+TW PSD +GL++
Sbjct  106  RKTWMPSDPEGLRR  119



>ref|XP_008648801.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Zea mays]
Length=142

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 49/77 (64%), Gaps = 8/77 (10%)
 Frame = +2

Query  278  RC-ENIKPRSVSVVWDRSSARVSSGDGVD-------GEQKRHKVMGFVGIQTGFASAARR  433
            RC ++ +P SVS+ WDRS    S+    +       G + RHKVM FVGI TGF S  RR
Sbjct  58   RCPDSSRPLSVSIAWDRSPGDGSASGSAELPASLATGSRGRHKVMAFVGIFTGFGSIGRR  117

Query  434  RSLRQTWFPSDRQGLQK  484
            R+LRQTW P+DRQGL +
Sbjct  118  RALRQTWLPADRQGLLR  134



>ref|XP_002524276.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
 gb|EEF38115.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
Length=343

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 50/75 (67%), Gaps = 4/75 (5%)
 Frame = +2

Query  266  SLGHRCENI--KPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRS  439
            S G+RC     +PRSV V WD ++   +  +     + RHKVMGFVGIQTGF+S  RR+S
Sbjct  46   SAGYRCSYSVSEPRSVRVQWDNNNNDATLSNA--AAKNRHKVMGFVGIQTGFSSVGRRQS  103

Query  440  LRQTWFPSDRQGLQK  484
            LR+TW PSDR  LQ+
Sbjct  104  LRKTWMPSDRIALQR  118



>ref|XP_004964801.1| PREDICTED: probable beta-1,3-galactosyltransferase 14-like [Setaria 
italica]
Length=365

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 50/74 (68%), Gaps = 5/74 (7%)
 Frame = +2

Query  278  RC-ENIKPRSVSVVWDRSSARVSSGDG----VDGEQKRHKVMGFVGIQTGFASAARRRSL  442
            RC ++ +P SVSV WDR     S+ D       G + RHKVM FVGI TGF+S  RRR+L
Sbjct  61   RCPDSSRPLSVSVAWDRRPGDSSAADLPAHLATGSRGRHKVMAFVGIFTGFSSIGRRRAL  120

Query  443  RQTWFPSDRQGLQK  484
            R+TW P+DRQGLQ+
Sbjct  121  RRTWLPADRQGLQR  134



>ref|XP_010925703.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 isoform 
X2 [Elaeis guineensis]
Length=294

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 49/83 (59%), Gaps = 19/83 (23%)
 Frame = +2

Query  272  GHRCENIKPRSVSVVWDRSSARVSSGDGVDGEQ--------------KRHKVMGFVGIQT  409
            G +C + +P SVSV WDR +     G  +  E+              +R KVMGFVGIQT
Sbjct  56   GRKCTDFEPISVSVSWDRGA-----GSKLVAEERPGLIGGAGGGGSRERQKVMGFVGIQT  110

Query  410  GFASAARRRSLRQTWFPSDRQGL  478
            GF S  RRRSLR+TWFPSDR+ L
Sbjct  111  GFGSVGRRRSLRKTWFPSDRESL  133



>gb|AFW85775.1| hypothetical protein ZEAMMB73_228985 [Zea mays]
Length=335

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 50/77 (65%), Gaps = 8/77 (10%)
 Frame = +2

Query  278  RC-ENIKPRSVSVVWDRSSARVSSGDGVD-------GEQKRHKVMGFVGIQTGFASAARR  433
            RC ++ +P SVSV WDRS    S+G   +       G + RHKVM FVGI TGF S  RR
Sbjct  58   RCPDSSRPLSVSVAWDRSPGDGSAGGSAELPASLATGSRGRHKVMAFVGIFTGFGSIGRR  117

Query  434  RSLRQTWFPSDRQGLQK  484
            R+LR+TW P+DRQGL +
Sbjct  118  RALRRTWLPADRQGLLR  134



>ref|XP_009380506.1| PREDICTED: probable beta-1,3-galactosyltransferase 13 [Musa acuminata 
subsp. malaccensis]
Length=337

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 45/69 (65%), Gaps = 5/69 (7%)
 Frame = +2

Query  278  RCENIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWF  457
            RC +++PRSVSVVWD        G       +R KVM FVGIQTGF S  RRRS+R+TW 
Sbjct  50   RCLDMEPRSVSVVWDHGGGTGGGGTA-----ERRKVMAFVGIQTGFGSVGRRRSIRRTWL  104

Query  458  PSDRQGLQK  484
            PS RQGL +
Sbjct  105  PSHRQGLLR  113



>ref|NP_001152267.1| beta-1,3-galactosyltransferase 6 [Zea mays]
 gb|ACG46706.1| beta-1,3-galactosyltransferase 6 [Zea mays]
 gb|AFW85776.1| beta-1,3-galactosyltransferase 6 [Zea mays]
Length=364

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 50/77 (65%), Gaps = 8/77 (10%)
 Frame = +2

Query  278  RC-ENIKPRSVSVVWDRSSARVSSGDGVD-------GEQKRHKVMGFVGIQTGFASAARR  433
            RC ++ +P SVSV WDRS    S+G   +       G + RHKVM FVGI TGF S  RR
Sbjct  58   RCPDSSRPLSVSVAWDRSPGDGSAGGSAELPASLATGSRGRHKVMAFVGIFTGFGSIGRR  117

Query  434  RSLRQTWFPSDRQGLQK  484
            R+LR+TW P+DRQGL +
Sbjct  118  RALRRTWLPADRQGLLR  134



>ref|XP_010925702.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 isoform 
X1 [Elaeis guineensis]
Length=360

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 49/83 (59%), Gaps = 19/83 (23%)
 Frame = +2

Query  272  GHRCENIKPRSVSVVWDRSSARVSSGDGVDGEQ--------------KRHKVMGFVGIQT  409
            G +C + +P SVSV WDR +     G  +  E+              +R KVMGFVGIQT
Sbjct  56   GRKCTDFEPISVSVSWDRGA-----GSKLVAEERPGLIGGAGGGGSRERQKVMGFVGIQT  110

Query  410  GFASAARRRSLRQTWFPSDRQGL  478
            GF S  RRRSLR+TWFPSDR+ L
Sbjct  111  GFGSVGRRRSLRKTWFPSDRESL  133



>emb|CDX98518.1| BnaC05g38570D [Brassica napus]
Length=351

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 71/122 (58%), Gaps = 7/122 (6%)
 Frame = +2

Query  128  MPSSP--KYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRC-ENIKP  298
            MPSSP  K F AR    S S+RRST LI+   + +  F F F  ++       C  N  P
Sbjct  1    MPSSPRLKLFHART---SPSTRRSTSLIVLTSLAIGLFGFIFGLAAIVFPSRTCLTNSPP  57

Query  299  RSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            ++V VVWD +           G  KRHKVMGFVGIQTGF SA RRR+LR TW PSD +GL
Sbjct  58   KTVRVVWDVAGNSNGGNGLS-GGVKRHKVMGFVGIQTGFGSAGRRRALRSTWMPSDPEGL  116

Query  479  QK  484
            ++
Sbjct  117  RR  118



>ref|NP_001145078.1| uncharacterized protein LOC100278279 [Zea mays]
 gb|ACG44835.1| hypothetical protein [Zea mays]
Length=142

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 69/139 (50%), Gaps = 25/139 (18%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRS--------TPlilflli---glagfvfgfiaSSRQSLG  274
            MP SPK F A     SS+SRRS        +P      +              S   S+ 
Sbjct  1    MPGSPKVFFA-----SSASRRSGALRRLLSSPAFSAACLFFGLAGFLTAALTLSRSPSIT  55

Query  275  H-RC-ENIKPRSVSVVWDRSSARVSSGDGVD-------GEQKRHKVMGFVGIQTGFASAA  427
            H RC ++ +P SVSV WDR     S+    +       G + RHKVM FVGI TGF S  
Sbjct  56   HSRCPDSSRPLSVSVAWDRRPGDGSAAGSAELPASLATGSRGRHKVMAFVGIFTGFGSIG  115

Query  428  RRRSLRQTWFPSDRQGLQK  484
            RRR+LR+TW P+DRQGL +
Sbjct  116  RRRALRRTWLPADRQGLLR  134



>ref|XP_002436508.1| hypothetical protein SORBIDRAFT_10g003920 [Sorghum bicolor]
 gb|EER87875.1| hypothetical protein SORBIDRAFT_10g003920 [Sorghum bicolor]
Length=364

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 69/139 (50%), Gaps = 25/139 (18%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRR--------STPlilflliglagf---vfgfiaSSRQSLG  274
            MP SPK F A     SS+SRR        STP      +              S   S+ 
Sbjct  1    MPGSPKVFFA-----SSASRRGGALRRLLSTPAFSAACLLFGLAGFLAAALTLSRSPSVT  55

Query  275  H-RC-ENIKPRSVSVVWDRSSARVSSGDGVD-------GEQKRHKVMGFVGIQTGFASAA  427
            H RC ++ +P SVSV WDR     S+    +       G + RHKVM FVGI TGF S  
Sbjct  56   HSRCPDSSRPLSVSVAWDRRPGDGSAAGSAELPASLATGSRGRHKVMAFVGIFTGFGSIG  115

Query  428  RRRSLRQTWFPSDRQGLQK  484
            RRR+LR+TW P+DRQGL +
Sbjct  116  RRRALRRTWLPADRQGLLR  134



>ref|XP_002283081.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Vitis 
vinifera]
Length=348

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 47/66 (71%), Gaps = 4/66 (6%)
 Frame = +2

Query  299  RSVSVVWDRSSARVSSGDGVDGEQ----KRHKVMGFVGIQTGFASAARRRSLRQTWFPSD  466
            RSVSVVWD+S      G G  G      KR+KVMGFVGIQTGF S  RRRSLR++W P+D
Sbjct  58   RSVSVVWDKSGGGGGGGSGDGGGGDGGGKRYKVMGFVGIQTGFGSVGRRRSLRKSWMPAD  117

Query  467  RQGLQK  484
            RQGLQ+
Sbjct  118  RQGLQR  123



>gb|ABL11234.1| UCW98, putative galactosyltransferease [Hordeum vulgare subsp. 
vulgare]
Length=365

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 46/76 (61%), Gaps = 7/76 (9%)
 Frame = +2

Query  278  RC-ENIKPRSVSVVWDRSSARVSSG------DGVDGEQKRHKVMGFVGIQTGFASAARRR  436
            RC ++  P SVSV WDR     + G          G + RHKVM FVGI TGF S  RRR
Sbjct  60   RCPDSSHPLSVSVAWDRRPGDAAGGATEFPAGHATGSRGRHKVMAFVGIFTGFGSVGRRR  119

Query  437  SLRQTWFPSDRQGLQK  484
            +LR+TW PSDRQGL +
Sbjct  120  ALRRTWLPSDRQGLLR  135



>dbj|BAJ94890.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 46/76 (61%), Gaps = 7/76 (9%)
 Frame = +2

Query  278  RC-ENIKPRSVSVVWDRSSARVSSG------DGVDGEQKRHKVMGFVGIQTGFASAARRR  436
            RC ++  P SVSV WDR     + G          G + RHKVM FVGI TGF S  RRR
Sbjct  60   RCPDSSHPLSVSVAWDRRPGDAAGGATELPAGHATGSRGRHKVMAFVGIFTGFGSVGRRR  119

Query  437  SLRQTWFPSDRQGLQK  484
            +LR+TW PSDRQGL +
Sbjct  120  ALRRTWLPSDRQGLLR  135



>ref|XP_007149400.1| hypothetical protein PHAVU_005G067100g [Phaseolus vulgaris]
 gb|ESW21394.1| hypothetical protein PHAVU_005G067100g [Phaseolus vulgaris]
Length=332

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 39/67 (58%), Gaps = 4/67 (6%)
 Frame = +2

Query  281  CENIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFP  460
            C N  P SV V+WD S     +         RHKVM FVG+QTGF S  RR+SLR TWFP
Sbjct  44   CPNRTPTSVRVLWDHSPTTHHNP----PLHNRHKVMAFVGVQTGFGSVGRRQSLRNTWFP  99

Query  461  SDRQGLQ  481
            SD   LQ
Sbjct  100  SDPHALQ  106



>ref|XP_006655808.1| PREDICTED: probable beta-1,3-galactosyltransferase 14-like [Oryza 
brachyantha]
Length=358

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 48/72 (67%), Gaps = 3/72 (4%)
 Frame = +2

Query  278  RC-ENIKPRSVSVVWDR--SSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQ  448
            RC ++ +P SVSV WDR   +A  +      G + RHKVM FVGI TGF S  RRR+LR+
Sbjct  59   RCPDSSRPLSVSVAWDRRPGAAADARASHATGSRGRHKVMAFVGIFTGFGSVGRRRALRR  118

Query  449  TWFPSDRQGLQK  484
            TW PSDRQGL +
Sbjct  119  TWLPSDRQGLLR  130



>gb|KFK35710.1| hypothetical protein AALP_AA4G027000 [Arabis alpina]
Length=345

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 48/72 (67%), Gaps = 5/72 (7%)
 Frame = +2

Query  272  GHRC-ENIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQ  448
            G  C  N  P++V VVW+ +      G    GE KRHKVMGFVGIQTGF S  RRRSLR+
Sbjct  51   GRNCLTNSPPKTVKVVWEVAGVGNVGG----GEGKRHKVMGFVGIQTGFGSVDRRRSLRK  106

Query  449  TWFPSDRQGLQK  484
            TW PSD +GL++
Sbjct  107  TWMPSDPEGLRR  118



>emb|CAN65751.1| hypothetical protein VITISV_026338 [Vitis vinifera]
Length=398

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 77/128 (60%), Gaps = 8/128 (6%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRSTPlilflliglagfvfgfiaSSRQSLGHRC--ENIKPR  301
            MPSSPK+F AR     S S+ +  ++L L+ G  GF+FG +A  R   G+ C       R
Sbjct  1    MPSSPKFFHAR--QPPSRSKFTFFILLCLVTGFGGFLFGIVAFLRPGSGYSCIGGGGPVR  58

Query  302  SVSVVWDRSSARVSSGDGVDGEQK----RHKVMGFVGIQTGFASAARRRSLRQTWFPSDR  469
            SVSVVWD+S        G  G       R+KVMGFVGIQTGF S  RR+SLR++W P+DR
Sbjct  59   SVSVVWDKSGGGGGGXSGDGGGGDGGGZRYKVMGFVGIQTGFGSVGRRQSLRKSWMPADR  118

Query  470  QGLQKYSF  493
            QGLQ+ S 
Sbjct  119  QGLQRNSL  126



>ref|XP_003564304.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Brachypodium 
distachyon]
Length=363

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 47/76 (62%), Gaps = 7/76 (9%)
 Frame = +2

Query  278  RC-ENIKPRSVSVVWDRSSARVSSGDG------VDGEQKRHKVMGFVGIQTGFASAARRR  436
            RC ++ +P SVSV WDR     ++           G + RHKVM FVGI TGF S  RRR
Sbjct  60   RCPDSSRPLSVSVAWDRRPGDAAAAAADLPVGLATGSRGRHKVMAFVGIFTGFGSVGRRR  119

Query  437  SLRQTWFPSDRQGLQK  484
            +LR+TW P+DRQGL +
Sbjct  120  ALRRTWLPADRQGLLR  135



>ref|XP_009144781.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 isoform 
X2 [Brassica rapa]
Length=340

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 50/72 (69%), Gaps = 4/72 (6%)
 Frame = +2

Query  272  GHRC-ENIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQ  448
            G  C  N  P++V VVWD +  R  +G G   + +RHKVMGFVGIQTGF S  RR++LR+
Sbjct  51   GRNCLTNAPPKTVRVVWDVAGNRNGAGGG---DGRRHKVMGFVGIQTGFGSTGRRQALRK  107

Query  449  TWFPSDRQGLQK  484
            TW PSD +GL++
Sbjct  108  TWMPSDPEGLRR  119



>ref|XP_009144780.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 isoform 
X1 [Brassica rapa]
Length=345

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 50/72 (69%), Gaps = 4/72 (6%)
 Frame = +2

Query  272  GHRC-ENIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQ  448
            G  C  N  P++V VVWD +  R  +G G   + +RHKVMGFVGIQTGF S  RR++LR+
Sbjct  51   GRNCLTNAPPKTVRVVWDVAGNRNGAGGG---DGRRHKVMGFVGIQTGFGSTGRRQALRK  107

Query  449  TWFPSDRQGLQK  484
            TW PSD +GL++
Sbjct  108  TWMPSDPEGLRR  119



>emb|CDY25866.1| BnaA05g14570D [Brassica napus]
Length=348

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 4/72 (6%)
 Frame = +2

Query  272  GHRC-ENIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQ  448
            G  C  N  P++V VVWD +  R  +     G+ +RHKVMGFVGIQTGF S  RR++LR+
Sbjct  51   GRNCLTNAPPKTVRVVWDVAGNRNGA---GGGDGRRHKVMGFVGIQTGFGSTGRRQALRK  107

Query  449  TWFPSDRQGLQK  484
            TW PSD +GL++
Sbjct  108  TWMPSDPEGLRR  119



>ref|NP_001056857.1| Os06g0156900 [Oryza sativa Japonica Group]
 dbj|BAD69423.1| putative Avr9 elicitor response protein [Oryza sativa Japonica 
Group]
 dbj|BAF18771.1| Os06g0156900 [Oryza sativa Japonica Group]
 gb|EAY99759.1| hypothetical protein OsI_21744 [Oryza sativa Indica Group]
 gb|EAZ35885.1| hypothetical protein OsJ_20186 [Oryza sativa Japonica Group]
 dbj|BAG99017.1| unnamed protein product [Oryza sativa Japonica Group]
Length=368

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 47/83 (57%), Gaps = 14/83 (17%)
 Frame = +2

Query  278  RC-ENIKPRSVSVVWDRSSARVSS-------------GDGVDGEQKRHKVMGFVGIQTGF  415
            RC ++ +P SVSV WDR     S+                  G + RHKVM FVGI TGF
Sbjct  58   RCPDSSRPLSVSVAWDRRPGDASAGAVAAAGAAVDLPASHATGSRGRHKVMAFVGIFTGF  117

Query  416  ASAARRRSLRQTWFPSDRQGLQK  484
             S  RRR+LR+TW P+DRQGL +
Sbjct  118  GSVGRRRALRRTWLPADRQGLLR  140



>ref|XP_011626263.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Amborella 
trichopoda]
Length=350

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = +2

Query  257  SRQSLGHRCENIKPRSVSVVW---DRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAA  427
            SR    ++C N + +S+SV W   D +     +G        RH VMGFVGIQTGF S  
Sbjct  47   SRPISTYKCNNFRVKSLSVNWVGHDVNEVSRVAGSENAVNSNRHNVMGFVGIQTGFGSVE  106

Query  428  RRRSLRQTWFPSDRQGLQK  484
            RR++LR+TW PSD   L++
Sbjct  107  RRKALRRTWMPSDPDSLRR  125



>gb|KHN46033.1| Putative beta-1,3-galactosyltransferase 14 [Glycine soja]
Length=259

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  386  MGFVGIQTGFASAARRRSLRQTWFPSDRQGLQK  484
            MGFVGIQTGF SA RR SLR+TWFPSDRQGLQ+
Sbjct  1    MGFVGIQTGFTSAGRRESLRKTWFPSDRQGLQR  33



>gb|AFW75580.1| hypothetical protein ZEAMMB73_628468 [Zea mays]
Length=340

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 68/139 (49%), Gaps = 26/139 (19%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRS--------TPlilflli---glagfvfgfiaSSRQSLG  274
            MP SPK F A     SS+SRRS        +P      +              S   S+ 
Sbjct  1    MPGSPKVFFA-----SSASRRSGALRRLLSSPAFSAACLFFGLAGFLAATLTLSRSPSIT  55

Query  275  H-RC-ENIKPRSVSVVWDRSSARVSSGDGVD-------GEQKRHKVMGFVGIQTGFASAA  427
            H RC ++ +P SVSV WDR     S+    +       G + RHKV  FVGI TGF S  
Sbjct  56   HSRCPDSSRPLSVSVAWDRRPGDGSAAGSAELPASLATGSRGRHKV-AFVGIFTGFGSIG  114

Query  428  RRRSLRQTWFPSDRQGLQK  484
            RRR+LR+TW P+DRQGL +
Sbjct  115  RRRALRRTWLPADRQGLLR  133



>gb|ERN13900.1| hypothetical protein AMTR_s00021p00087240 [Amborella trichopoda]
Length=423

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 44/73 (60%), Gaps = 3/73 (4%)
 Frame = +2

Query  275  HRCENIKPRSVSVVW---DRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLR  445
            ++C N + +S+SV W   D +     +G        RH VMGFVGIQTGF S  RR++LR
Sbjct  53   YKCNNFRVKSLSVNWVGHDVNEVSRVAGSENAVNSNRHNVMGFVGIQTGFGSVERRKALR  112

Query  446  QTWFPSDRQGLQK  484
            +TW PSD   L++
Sbjct  113  RTWMPSDPDSLRR  125



>gb|AFW75579.1| hypothetical protein ZEAMMB73_628468 [Zea mays]
Length=363

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 68/139 (49%), Gaps = 26/139 (19%)
 Frame = +2

Query  128  MPSSPKYFTARPLTYSSSSRRS--------TPlilflli---glagfvfgfiaSSRQSLG  274
            MP SPK F A     SS+SRRS        +P      +              S   S+ 
Sbjct  1    MPGSPKVFFA-----SSASRRSGALRRLLSSPAFSAACLFFGLAGFLAATLTLSRSPSIT  55

Query  275  H-RC-ENIKPRSVSVVWDRSSARVSSGDGVD-------GEQKRHKVMGFVGIQTGFASAA  427
            H RC ++ +P SVSV WDR     S+    +       G + RHKV  FVGI TGF S  
Sbjct  56   HSRCPDSSRPLSVSVAWDRRPGDGSAAGSAELPASLATGSRGRHKV-AFVGIFTGFGSIG  114

Query  428  RRRSLRQTWFPSDRQGLQK  484
            RRR+LR+TW P+DRQGL +
Sbjct  115  RRRALRRTWLPADRQGLLR  133



>ref|XP_002880742.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57001.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=367

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 43/70 (61%), Gaps = 4/70 (6%)
 Frame = +2

Query  275  HRCENIKPRSVSVVWDRSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTW  454
            +RC   K  S  V    S++R   GDG +G  +R K++GFVGIQTGF S  RR +LR TW
Sbjct  74   YRCGGSKDTSRVV----SASRKLGGDGGNGVVERRKLLGFVGIQTGFDSGDRRTALRSTW  129

Query  455  FPSDRQGLQK  484
            FPSD   L +
Sbjct  130  FPSDPDSLLR  139



>emb|CBI20203.3| unnamed protein product [Vitis vinifera]
Length=258

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  386  MGFVGIQTGFASAARRRSLRQTWFPSDRQGLQK  484
            MGFVGIQTGF S  RRRSLR++W P+DRQGLQ+
Sbjct  1    MGFVGIQTGFGSVGRRRSLRKSWMPADRQGLQR  33



>ref|XP_007223350.1| hypothetical protein PRUPE_ppa007437mg [Prunus persica]
 gb|EMJ24549.1| hypothetical protein PRUPE_ppa007437mg [Prunus persica]
Length=368

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  347  GDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            GD   G   R K++GFVGIQTGF SA RR +LR+TWFPSD  GL
Sbjct  97   GDKNGGLVDRPKLLGFVGIQTGFGSADRRAALRRTWFPSDPDGL  140



>ref|XP_010262123.1| PREDICTED: probable beta-1,3-galactosyltransferase 12 [Nelumbo 
nucifera]
Length=372

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +2

Query  323  RSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGLQK  484
            RSS     GD  DG   R K++GFVGIQTGF+SA RR +LR +WFPSD  GL +
Sbjct  94   RSSGSRKLGDN-DGLVDRPKLLGFVGIQTGFSSADRRAALRSSWFPSDPDGLLR  146



>ref|XP_008782540.1| PREDICTED: probable beta-1,3-galactosyltransferase 12 isoform 
X1 [Phoenix dactylifera]
Length=370

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  353  GVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            G DG   R KV+GFVG+QTGF+S+ RR +LR TWFP D +GL
Sbjct  100  GKDGVVARPKVLGFVGVQTGFSSSDRRAALRSTWFPPDPEGL  141



>ref|XP_008782541.1| PREDICTED: probable beta-1,3-galactosyltransferase 12 isoform 
X2 [Phoenix dactylifera]
Length=347

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  353  GVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            G DG   R KV+GFVG+QTGF+S+ RR +LR TWFP D +GL
Sbjct  100  GKDGVVARPKVLGFVGVQTGFSSSDRRAALRSTWFPPDPEGL  141



>ref|XP_008220476.1| PREDICTED: probable beta-1,3-galactosyltransferase 12 [Prunus 
mume]
Length=368

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  347  GDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGLQK  484
            GD   G   R K++GFVGIQTGF SA RR +LR TWFPSD  GL +
Sbjct  97   GDKNGGLVDRPKLLGFVGIQTGFGSADRRAALRSTWFPSDPDGLLR  142



>gb|KJB65555.1| hypothetical protein B456_010G100900 [Gossypium raimondii]
Length=372

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  347  GDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            GD   G   R K++GFVGIQTGF S  RR +LR TWFPSD  GL
Sbjct  101  GDSYKGLVDRPKLLGFVGIQTGFESGERRSALRSTWFPSDPDGL  144



>ref|XP_002279252.1| PREDICTED: probable beta-1,3-galactosyltransferase 12 [Vitis 
vinifera]
 emb|CBI20664.3| unnamed protein product [Vitis vinifera]
Length=361

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  374  RHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            R KV+GFVGIQTGF+SA+RR +LR TWFPSD  GL
Sbjct  99   RPKVLGFVGIQTGFSSASRRSALRSTWFPSDPDGL  133



>ref|XP_012077286.1| PREDICTED: probable beta-1,3-galactosyltransferase 12 [Jatropha 
curcas]
 gb|KDP34098.1| hypothetical protein JCGZ_07669 [Jatropha curcas]
Length=363

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 2/50 (4%)
 Frame = +2

Query  329  SARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            S R+  GDG   +  R K++GFVGIQTGF S  RR +LR TWFPSD  GL
Sbjct  88   SNRLGGGDGALND--RPKLLGFVGIQTGFDSVNRRAALRSTWFPSDPDGL  135



>ref|XP_006450841.1| hypothetical protein CICLE_v10010334mg [Citrus clementina]
 gb|ESR64081.1| hypothetical protein CICLE_v10010334mg [Citrus clementina]
Length=328

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  374  RHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGLQK  484
            R K++GFVGIQTGFASA RR +LR+TWFPSD  GL +
Sbjct  86   RPKLLGFVGIQTGFASADRRAALRRTWFPSDPDGLLR  122



>emb|CAN63091.1| hypothetical protein VITISV_032018 [Vitis vinifera]
Length=580

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  374  RHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            R KV+GFVGIQTGF+SA+RR +LR TWFPSD  GL
Sbjct  99   RPKVLGFVGIQTGFSSASRRSALRSTWFPSDPDGL  133



>ref|XP_010915251.1| PREDICTED: probable beta-1,3-galactosyltransferase 12 isoform 
X2 [Elaeis guineensis]
Length=369

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  359  DGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            DG   R K++GFVG+QT F+SA RR +LR TWFPSD +GL
Sbjct  101  DGVVARPKILGFVGVQTSFSSADRRAALRSTWFPSDPEGL  140



>ref|XP_010915253.1| PREDICTED: probable beta-1,3-galactosyltransferase 12 isoform 
X4 [Elaeis guineensis]
Length=340

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  359  DGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            DG   R K++GFVG+QT F+SA RR +LR TWFPSD +GL
Sbjct  101  DGVVARPKILGFVGVQTSFSSADRRAALRSTWFPSDPEGL  140



>ref|XP_009361904.1| PREDICTED: probable beta-1,3-galactosyltransferase 12 [Pyrus 
x bretschneideri]
Length=368

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  344  SGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            +GD   G   R K++G VGIQTGF SA RR +LR TWFPSD  GL
Sbjct  96   AGDKNGGLVDRPKLLGLVGIQTGFGSADRRAALRNTWFPSDPDGL  140



>ref|XP_010915252.1| PREDICTED: probable beta-1,3-galactosyltransferase 12 isoform 
X3 [Elaeis guineensis]
Length=340

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  359  DGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            DG   R K++GFVG+QT F+SA RR +LR TWFPSD +GL
Sbjct  101  DGVVARPKILGFVGVQTSFSSADRRAALRSTWFPSDPEGL  140



>ref|XP_008377681.1| PREDICTED: probable beta-1,3-galactosyltransferase 12 [Malus 
domestica]
Length=372

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  347  GDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQG  475
            GD   G   R K++GFVGIQTGF SA RR +LR TWFPSD  G
Sbjct  101  GDKNGGLVDRPKLLGFVGIQTGFGSADRRAALRNTWFPSDPDG  143



>ref|XP_010915250.1| PREDICTED: probable beta-1,3-galactosyltransferase 12 isoform 
X1 [Elaeis guineensis]
Length=380

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  359  DGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            DG   R K++GFVG+QT F+SA RR +LR TWFPSD +GL
Sbjct  101  DGVVARPKILGFVGVQTSFSSADRRAALRSTWFPSDPEGL  140



>ref|XP_007012283.1| Beta-1,3-galactosyltransferase 12 [Theobroma cacao]
 gb|EOY29902.1| Beta-1,3-galactosyltransferase 12 [Theobroma cacao]
Length=365

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  344  SGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGLQK  484
            + D  +G   R K +GFVGIQTGF S  RR +LR TWFPSD  GL +
Sbjct  93   ADDNNEGLVDRPKFLGFVGIQTGFESGDRRDALRSTWFPSDPDGLLR  139



>emb|CDP08259.1| unnamed protein product [Coffea canephora]
Length=367

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  341  SSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
             SG G     +R K++GFVGIQTGF+SA RR +LR TW PS+ +GL
Sbjct  94   DSGVGNATGMERRKLLGFVGIQTGFSSADRREALRSTWLPSEPEGL  139



>gb|KHG29258.1| putative beta-1,3-galactosyltransferase 12 -like protein [Gossypium 
arboreum]
Length=372

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +2

Query  350  DGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            D   G   R K++GFVGIQTGF S  RR +LR TWFPSD  GL
Sbjct  102  DSNKGLVDRPKLLGFVGIQTGFESGERRSALRSTWFPSDPDGL  144



>ref|XP_002308559.1| hypothetical protein POPTR_0006s24530g [Populus trichocarpa]
 gb|EEE92082.1| hypothetical protein POPTR_0006s24530g [Populus trichocarpa]
Length=364

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  347  GDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGLQK  484
            GD       R K++GFVGIQTGF S  RR +LR TWFPSD  GL +
Sbjct  93   GDDNGALIDRPKLLGFVGIQTGFESGDRRAALRSTWFPSDPDGLLR  138



>ref|XP_011019461.1| PREDICTED: probable beta-1,3-galactosyltransferase 12 isoform 
X1 [Populus euphratica]
 ref|XP_011019462.1| PREDICTED: probable beta-1,3-galactosyltransferase 12 isoform 
X1 [Populus euphratica]
Length=364

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  347  GDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGLQK  484
            GD       R K++GFVGIQTGF S  RR +LR TWFPSD  GL +
Sbjct  93   GDDNGALIDRPKLLGFVGIQTGFESGDRRAALRSTWFPSDPDGLLR  138



>ref|XP_006382014.1| hypothetical protein POPTR_0006s24530g [Populus trichocarpa]
 gb|ERP59811.1| hypothetical protein POPTR_0006s24530g [Populus trichocarpa]
Length=360

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  347  GDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGLQK  484
            GD       R K++GFVGIQTGF S  RR +LR TWFPSD  GL +
Sbjct  93   GDDNGALIDRPKLLGFVGIQTGFESGDRRAALRSTWFPSDPDGLLR  138



>ref|XP_011019464.1| PREDICTED: probable beta-1,3-galactosyltransferase 12 isoform 
X2 [Populus euphratica]
Length=296

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +2

Query  347  GDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            GD       R K++GFVGIQTGF S  RR +LR TWFPSD  GL
Sbjct  93   GDDNGALIDRPKLLGFVGIQTGFESGDRRAALRSTWFPSDPDGL  136



>ref|XP_010526149.1| PREDICTED: probable beta-1,3-galactosyltransferase 12 [Tarenaya 
hassleriana]
Length=373

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  371  KRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            +R K++GFVGIQTGF S  RR +LR TWFPSD  GL
Sbjct  107  ERPKLLGFVGIQTGFESGDRREALRSTWFPSDPDGL  142



>ref|XP_008393644.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
12 [Malus domestica]
Length=371

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  344  SGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            +GD   G   R K++G VGIQTGF SA RR +LR TWFPS   GL
Sbjct  99   AGDKNGGLVDRPKLLGLVGIQTGFGSANRRAALRNTWFPSGPDGL  143



>gb|KFK32543.1| hypothetical protein AALP_AA6G256600 [Arabis alpina]
Length=372

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = +2

Query  326  SSARVSSGDGVDG--EQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            SS+R   GD  +G    +R K++G VGIQTGF S  RR +LR TWFPSD  GL
Sbjct  90   SSSRKLGGDSGNGGVVTERRKLLGLVGIQTGFDSGDRRSALRSTWFPSDPDGL  142



>ref|XP_002516443.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
 gb|EEF45784.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
Length=381

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 30/44 (68%), Gaps = 1/44 (2%)
 Frame = +2

Query  347  GDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            GD  +    R K +GFVGIQTGF S+ RR +LR TWFPSD  GL
Sbjct  93   GDN-NNNNDRPKFLGFVGIQTGFDSSDRRAALRSTWFPSDPYGL  135



>ref|XP_010097064.1| putative beta-1,3-galactosyltransferase 12 [Morus notabilis]
 gb|EXB66865.1| putative beta-1,3-galactosyltransferase 12 [Morus notabilis]
Length=364

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  362  GEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            G   R K++GFVGIQTGF SA RR +LR TWF SD  GL
Sbjct  98   GLVDRPKLLGFVGIQTGFGSADRRAALRATWFSSDPDGL  136



>ref|XP_010429624.1| PREDICTED: probable beta-1,3-galactosyltransferase 12 [Camelina 
sativa]
Length=376

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  371  KRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            +R K++GFVGIQTGF S  RR SLR TWFPSD   L
Sbjct  111  ERRKLLGFVGIQTGFDSGDRRASLRSTWFPSDPDAL  146



>ref|XP_010417388.1| PREDICTED: probable beta-1,3-galactosyltransferase 12 [Camelina 
sativa]
Length=376

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  371  KRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            +R K++GFVGIQTGF S  RR SLR TWFPSD   L
Sbjct  111  ERRKLLGFVGIQTGFDSGDRRASLRSTWFPSDPDAL  146



>emb|CDP14127.1| unnamed protein product [Coffea canephora]
Length=180

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 4/55 (7%)
 Frame = +2

Query  326  SSARVSSGD----GVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            S+ R+  GD       G + R K++GFVGIQT F+SA RR +LR TW PS+ +GL
Sbjct  95   SAWRLGGGDSGIGNATGTRGRRKLLGFVGIQTRFSSADRREALRSTWLPSEPEGL  149



>ref|XP_006293482.1| hypothetical protein CARUB_v10023358mg [Capsella rubella]
 gb|EOA26380.1| hypothetical protein CARUB_v10023358mg [Capsella rubella]
Length=400

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  371  KRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            +R K++GFVGIQTGF S  RR SLR TWFPSD   L
Sbjct  112  ERPKLLGFVGIQTGFDSGDRRASLRSTWFPSDPDAL  147



>ref|XP_011628529.1| PREDICTED: probable beta-1,3-galactosyltransferase 12 [Amborella 
trichopoda]
Length=358

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  359  DGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            D    R K++G VGIQTGF+S  RR++LR+TWFPS+  GL
Sbjct  89   DPLVDRPKLLGMVGIQTGFSSKDRRQALRETWFPSNPDGL  128



>emb|CAN78053.1| hypothetical protein VITISV_015866 [Vitis vinifera]
Length=127

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  386  MGFVGIQTGFASAARRRSLRQTWFPSDRQGLQK  484
            MGFVGIQT F S  R+RSL+++W P+D+QG+Q+
Sbjct  1    MGFVGIQTRFGSVGRQRSLKKSWMPADQQGVQR  33



>gb|AAC31227.1| unknown protein [Arabidopsis thaliana]
Length=333

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  371  KRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            +R K++GFVGIQTGF S  RR +LR TWFPSD   L
Sbjct  106  ERRKLLGFVGIQTGFDSGDRRTALRSTWFPSDPDSL  141



>ref|NP_180179.2| putative beta-1,3-galactosyltransferase 12 [Arabidopsis thaliana]
 sp|Q66GS2.1|B3GTC_ARATH RecName: Full=Probable beta-1,3-galactosyltransferase 12 [Arabidopsis 
thaliana]
 gb|AAU05453.1| At2g26100 [Arabidopsis thaliana]
 gb|AAU45204.1| At2g26100 [Arabidopsis thaliana]
 gb|AEC07794.1| putative beta-1,3-galactosyltransferase 12 [Arabidopsis thaliana]
 gb|AHL38837.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=371

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  371  KRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            +R K++GFVGIQTGF S  RR +LR TWFPSD   L
Sbjct  106  ERRKLLGFVGIQTGFDSGDRRTALRSTWFPSDPDSL  141



>gb|ERN19820.1| hypothetical protein AMTR_s00064p00175400 [Amborella trichopoda]
Length=435

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  359  DGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            D    R K++G VGIQTGF+S  RR++LR+TWFPS+  GL
Sbjct  89   DPLVDRPKLLGMVGIQTGFSSKDRRQALRETWFPSNPDGL  128



>ref|XP_004291040.1| PREDICTED: probable beta-1,3-galactosyltransferase 12 [Fragaria 
vesca subsp. vesca]
Length=363

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  362  GEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGLQK  484
            G  +R K++GFVGI TGF  A RR ++R TWFPSD  GL +
Sbjct  97   GLLERPKLLGFVGILTGFRGADRRAAMRSTWFPSDPDGLLR  137



>emb|CDX77030.1| BnaC04g38250D [Brassica napus]
Length=363

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 30/44 (68%), Gaps = 1/44 (2%)
 Frame = +2

Query  347  GDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            G+G D   +R KV+GFVGIQTGF    RR +LR TWFPSD   L
Sbjct  90   GNG-DVLPERRKVIGFVGIQTGFDYGDRRAALRSTWFPSDPDAL  132



>ref|XP_010472638.1| PREDICTED: probable beta-1,3-galactosyltransferase 12 [Camelina 
sativa]
Length=376

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  371  KRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            +R K++GFVGIQTGF S  RR SLR TWFPS+   L
Sbjct  111  ERRKLLGFVGIQTGFDSGDRRASLRSTWFPSEPDAL  146



>ref|XP_010060689.1| PREDICTED: probable beta-1,3-galactosyltransferase 14 [Eucalyptus 
grandis]
 gb|KCW67490.1| hypothetical protein EUGRSUZ_F01224 [Eucalyptus grandis]
Length=349

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 46/74 (62%), Gaps = 3/74 (4%)
 Frame = +2

Query  272  GHRCENIKPRSVSVVWDRSSARVSSGDGV-DGEQ--KRHKVMGFVGIQTGFASAARRRSL  442
            G RC   +PR + V W   +     G  V DG +  +R KV GFVGIQTGF S  RRRS+
Sbjct  51   GSRCSGAEPRLLRVSWSGEARDGGGGLLVRDGGKVLRRRKVKGFVGIQTGFGSVGRRRSV  110

Query  443  RQTWFPSDRQGLQK  484
            R+TW PSDR+ LQ+
Sbjct  111  RRTWMPSDREKLQR  124



>ref|XP_006450845.1| hypothetical protein CICLE_v10008876mg [Citrus clementina]
 gb|ESR64085.1| hypothetical protein CICLE_v10008876mg [Citrus clementina]
Length=333

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  374  RHKVMGFVGIQTGFASAARRRSLRQTWFPSD  466
            R K++GFVGIQ+GF SA RR +LR TWFPSD
Sbjct  102  RPKLLGFVGIQSGFGSADRRAALRSTWFPSD  132



>ref|XP_010667259.1| PREDICTED: probable beta-1,3-galactosyltransferase 12 [Beta vulgaris 
subsp. vulgaris]
Length=370

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 31/49 (63%), Gaps = 1/49 (2%)
 Frame = +2

Query  335  RVSSGDGVDGEQ-KRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            R S+ +GV G    R K +GFVGI T   S  RR +LR TWFPSD QGL
Sbjct  91   RSSNINGVAGNSLDRPKFLGFVGILTEIDSVDRRNALRSTWFPSDPQGL  139



>emb|CDY35316.1| BnaA04g15310D [Brassica napus]
Length=363

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  371  KRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            +R KV+G VGIQTGF S  RR +LR TWFPSD   L
Sbjct  97   ERRKVIGLVGIQTGFDSGDRRAALRSTWFPSDPDAL  132



>ref|XP_009140723.1| PREDICTED: probable beta-1,3-galactosyltransferase 12 [Brassica 
rapa]
Length=363

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  371  KRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            +R KV+G VGIQTGF S  RR +LR TWFPSD   L
Sbjct  97   ERRKVIGLVGIQTGFDSGDRRAALRSTWFPSDPDAL  132



>ref|XP_006371886.1| hypothetical protein POPTR_0018s05200g [Populus trichocarpa]
 gb|ERP49683.1| hypothetical protein POPTR_0018s05200g [Populus trichocarpa]
Length=245

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 28/42 (67%), Gaps = 1/42 (2%)
 Frame = +2

Query  356  VDGEQ-KRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            VDG    R K++GFVG QTGF S  RR +LR TWFP D  G+
Sbjct  53   VDGALIDRPKLLGFVGTQTGFESGDRRAALRSTWFPCDPDGI  94



>gb|EMS61789.1| putative beta-1,3-galactosyltransferase 14 [Triticum urartu]
Length=280

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +2

Query  386  MGFVGIQTGFASAARRRSLRQTWFPSDRQGLQK  484
            M FVGI  GF S  RRR+LR+TW PSDRQGL +
Sbjct  1    MAFVGIFPGFGSVGRRRALRRTWLPSDRQGLLR  33



>ref|XP_009403487.1| PREDICTED: probable beta-1,3-galactosyltransferase 12 [Musa acuminata 
subsp. malaccensis]
Length=376

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +2

Query  323  RSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGLQK  484
            RS +  ++G   +G   R KV+G VG+ TGF+S+ RR +LR TWFP D   L +
Sbjct  94   RSKSLAATGRPEEGVAARPKVIGVVGVLTGFSSSDRRAALRDTWFPRDPDALSR  147



>ref|XP_006408850.1| hypothetical protein EUTSA_v10002018mg [Eutrema salsugineum]
 gb|ESQ50303.1| hypothetical protein EUTSA_v10002018mg [Eutrema salsugineum]
Length=371

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +2

Query  374  RHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            R K++GFVGIQT F S  RR +LR TWFPSD   L
Sbjct  107  RQKLLGFVGIQTSFDSGDRRAALRSTWFPSDPDAL  141



>ref|XP_002978257.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ20914.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=366

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  323  RSSARVSSGDGVDGEQKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            RSS    SG   +  + R KV+G VGIQTGF S  RR++LR+TW P   +GL
Sbjct  64   RSSEAWRSGVLQEPLESRPKVLGVVGIQTGFGSRERRKALRETWMPDSPEGL  115



>ref|XP_002966312.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ32339.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=364

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  368  QKRHKVMGFVGIQTGFASAARRRSLRQTWFPSDRQGL  478
            + R KV+G VGIQTGF S  RR++LR+TW P   +GL
Sbjct  79   ESRPKVLGVVGIQTGFGSRERRKALRETWMPDSPEGL  115



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 819153862622