BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3769

Length=686
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AGH30270.1|  autophagy-related protein 9                             175   7e-52   Nicotiana benthamiana
ref|XP_009763222.1|  PREDICTED: autophagy-related protein 9             181   8e-49   Nicotiana sylvestris
ref|XP_009588383.1|  PREDICTED: autophagy-related protein 9 isofo...    178   1e-47   Nicotiana tomentosiformis
ref|XP_009588387.1|  PREDICTED: autophagy-related protein 9 isofo...    178   1e-47   Nicotiana tomentosiformis
emb|CDP07994.1|  unnamed protein product                                173   6e-46   Coffea canephora [robusta coffee]
ref|XP_004237181.1|  PREDICTED: autophagy-related protein 9             173   1e-45   Solanum lycopersicum
ref|XP_002302054.2|  autophagy 9 family protein                         168   3e-45   
ref|XP_006355001.1|  PREDICTED: autophagy-related protein 9-like ...    170   7e-45   Solanum tuberosum [potatoes]
ref|XP_011028790.1|  PREDICTED: autophagy-related protein 9-like        168   5e-44   Populus euphratica
ref|XP_010652362.1|  PREDICTED: autophagy-related protein 9             168   8e-44   Vitis vinifera
emb|CBI37095.3|  unnamed protein product                                166   3e-43   Vitis vinifera
ref|XP_012085334.1|  PREDICTED: autophagy-related protein 9             163   4e-42   Jatropha curcas
ref|XP_006443860.1|  hypothetical protein CICLE_v10018809mg             162   4e-42   Citrus clementina [clementine]
gb|KDO68461.1|  hypothetical protein CISIN_1g002844mg                   162   5e-42   Citrus sinensis [apfelsine]
ref|XP_011080031.1|  PREDICTED: autophagy-related protein 9             161   2e-41   Sesamum indicum [beniseed]
ref|XP_002532369.1|  conserved hypothetical protein                     160   3e-41   
ref|XP_011025998.1|  PREDICTED: autophagy-related protein 9-like        158   2e-40   Populus euphratica
gb|KHN03870.1|  Autophagy-related protein 9                             155   2e-39   Glycine soja [wild soybean]
ref|XP_003536935.1|  PREDICTED: autophagy-related protein 9-like        155   2e-39   Glycine max [soybeans]
ref|XP_002306839.1|  autophagy 9 family protein                         154   5e-39   Populus trichocarpa [western balsam poplar]
ref|XP_003541347.1|  PREDICTED: autophagy-related protein 9-like        154   6e-39   Glycine max [soybeans]
gb|KHN44973.1|  Autophagy-related protein 9                             154   7e-39   Glycine soja [wild soybean]
gb|KCW84722.1|  hypothetical protein EUGRSUZ_B01536                     150   3e-38   Eucalyptus grandis [rose gum]
gb|EPS63710.1|  hypothetical protein M569_11073                         142   3e-38   Genlisea aurea
gb|KEH42560.1|  autophagy 9 (APG9) protein                              151   5e-38   Medicago truncatula
gb|EYU46469.1|  hypothetical protein MIMGU_mgv1a001180mg                150   1e-37   Erythranthe guttata [common monkey flower]
gb|KJB25992.1|  hypothetical protein B456_004G220200                    148   3e-37   Gossypium raimondii
ref|XP_010039166.1|  PREDICTED: autophagy-related protein 9 isofo...    148   4e-37   
ref|XP_008447441.1|  PREDICTED: autophagy-related protein 9 isofo...    148   4e-37   Cucumis melo [Oriental melon]
ref|XP_008447440.1|  PREDICTED: autophagy-related protein 9 isofo...    149   5e-37   
ref|XP_010039159.1|  PREDICTED: autophagy-related protein 9 isofo...    148   5e-37   Eucalyptus grandis [rose gum]
ref|XP_009354931.1|  PREDICTED: autophagy-related protein 9-like        148   6e-37   Pyrus x bretschneideri [bai li]
ref|XP_011651446.1|  PREDICTED: autophagy-related protein 9             148   7e-37   Cucumis sativus [cucumbers]
gb|KHG16698.1|  Autophagy-related 9                                     147   1e-36   Gossypium arboreum [tree cotton]
ref|XP_004495109.1|  PREDICTED: autophagy-related protein 9-like        147   1e-36   Cicer arietinum [garbanzo]
ref|XP_003520596.1|  PREDICTED: autophagy-related protein 9-like        147   2e-36   Glycine max [soybeans]
ref|XP_008235698.1|  PREDICTED: autophagy-related protein 9             145   5e-36   Prunus mume [ume]
gb|KJB22900.1|  hypothetical protein B456_004G072800                    145   7e-36   Gossypium raimondii
ref|XP_007162532.1|  hypothetical protein PHAVU_001G159900g             144   1e-35   Phaseolus vulgaris [French bean]
ref|XP_007200623.1|  hypothetical protein PRUPE_ppa001270mg             144   2e-35   Prunus persica
ref|XP_010679231.1|  PREDICTED: autophagy-related protein 9             143   3e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009369497.1|  PREDICTED: autophagy-related protein 9-like        142   6e-35   Pyrus x bretschneideri [bai li]
ref|XP_010557109.1|  PREDICTED: autophagy-related protein 9-like        141   1e-34   Tarenaya hassleriana [spider flower]
gb|KHN10731.1|  Autophagy-related protein 9                             141   2e-34   Glycine soja [wild soybean]
ref|XP_006604488.1|  PREDICTED: autophagy-related protein 9             141   2e-34   Glycine max [soybeans]
ref|XP_008382877.1|  PREDICTED: autophagy-related protein 9             140   2e-34   
emb|CCX35483.1|  hypothetical protein                                   140   2e-34   Malus domestica [apple tree]
emb|CCX35470.1|  hypothetical protein                                   140   2e-34   Malus domestica [apple tree]
ref|XP_010918784.1|  PREDICTED: autophagy-related protein 9-like        140   4e-34   Elaeis guineensis
gb|KHG23531.1|  atg9                                                    140   5e-34   Gossypium arboreum [tree cotton]
gb|AID50966.1|  autophagy-related protein 9                             140   5e-34   Malus domestica [apple tree]
ref|XP_004289924.1|  PREDICTED: autophagy-related protein 9             139   8e-34   Fragaria vesca subsp. vesca
ref|XP_010272081.1|  PREDICTED: autophagy-related protein 9-like        139   8e-34   Nelumbo nucifera [Indian lotus]
gb|KHG23532.1|  atg9                                                    139   1e-33   Gossypium arboreum [tree cotton]
ref|XP_010111903.1|  hypothetical protein L484_009787                   138   2e-33   
gb|KJB22902.1|  hypothetical protein B456_004G072800                    137   4e-33   Gossypium raimondii
gb|KEH23905.1|  autophagy 9 (APG9) protein                              137   4e-33   Medicago truncatula
gb|KJB22903.1|  hypothetical protein B456_004G072800                    137   4e-33   Gossypium raimondii
gb|KJB22901.1|  hypothetical protein B456_004G072800                    137   4e-33   Gossypium raimondii
gb|KJB42251.1|  hypothetical protein B456_007G145200                    137   4e-33   Gossypium raimondii
ref|XP_007144916.1|  hypothetical protein PHAVU_007G194300g             137   5e-33   Phaseolus vulgaris [French bean]
gb|ERM94913.1|  hypothetical protein AMTR_s00009p00170950               137   6e-33   Amborella trichopoda
ref|XP_010522159.1|  PREDICTED: autophagy-related protein 9             136   8e-33   Tarenaya hassleriana [spider flower]
ref|XP_007050324.1|  Autophagy 9                                        135   3e-32   
emb|CDY19070.1|  BnaA04g18100D                                          134   5e-32   Brassica napus [oilseed rape]
ref|XP_010255319.1|  PREDICTED: autophagy-related protein 9-like        134   7e-32   Nelumbo nucifera [Indian lotus]
emb|CDY15410.1|  BnaC04g42130D                                          133   1e-31   Brassica napus [oilseed rape]
ref|XP_006649742.1|  PREDICTED: autophagy-related protein 9-like        130   1e-30   Oryza brachyantha
ref|XP_003558362.1|  PREDICTED: autophagy-related protein 9             128   5e-30   Brachypodium distachyon [annual false brome]
ref|NP_001049553.1|  Os03g0248000                                       127   1e-29   
gb|AGW81798.1|  autophagy-related protein 9b                            127   2e-29   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010510220.1|  PREDICTED: autophagy-related protein 9-like        125   4e-29   Camelina sativa [gold-of-pleasure]
ref|XP_009390295.1|  PREDICTED: autophagy-related protein 9-like ...    125   4e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006293670.1|  hypothetical protein CARUB_v10022626mg             125   4e-29   Capsella rubella
ref|XP_009390303.1|  PREDICTED: autophagy-related protein 9-like ...    125   4e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010414154.1|  PREDICTED: autophagy-related protein 9-like ...    125   8e-29   Camelina sativa [gold-of-pleasure]
gb|AGW81797.1|  autophagy-related protein 9a                            125   8e-29   Triticum aestivum [Canadian hard winter wheat]
ref|NP_850164.1|  protein autophagy 9                                   125   9e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881168.1|  hypothetical protein ARALYDRAFT_482052             124   1e-28   
gb|EEE58700.1|  hypothetical protein OsJ_10136                          124   1e-28   Oryza sativa Japonica Group [Japonica rice]
gb|EAY89256.1|  hypothetical protein OsI_10753                          124   2e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_004985007.1|  PREDICTED: autophagy-related protein 9-like        124   2e-28   Setaria italica
emb|CDY10782.1|  BnaA05g11540D                                          121   3e-28   Brassica napus [oilseed rape]
gb|ABG65924.1|  Autophagy protein Apg9 containing protein, expressed    124   3e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009141144.1|  PREDICTED: autophagy-related protein 9             123   3e-28   Brassica rapa
ref|XP_008647652.1|  PREDICTED: uncharacterized protein LOC100502...    123   3e-28   
gb|EAZ00670.1|  hypothetical protein OsI_22690                          123   4e-28   Oryza sativa Indica Group [Indian rice]
gb|EAZ24012.1|  hypothetical protein OsJ_07737                          123   4e-28   Oryza sativa Japonica Group [Japonica rice]
gb|AAD20671.1|  unknown protein                                         122   6e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006827497.2|  PREDICTED: autophagy-related protein 9             121   2e-27   
ref|XP_008775955.1|  PREDICTED: autophagy-related protein 9-like        119   7e-27   Phoenix dactylifera
ref|XP_006846402.1|  PREDICTED: autophagy-related protein 9             118   2e-26   Amborella trichopoda
ref|XP_010935753.1|  PREDICTED: autophagy-related protein 9-like ...    118   2e-26   
ref|XP_010935754.1|  PREDICTED: autophagy-related protein 9-like ...    112   1e-24   
ref|XP_009420448.1|  PREDICTED: autophagy-related protein 9-like        112   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004982580.1|  PREDICTED: autophagy-related protein 9-like        112   3e-24   Setaria italica
ref|XP_006410258.1|  hypothetical protein EUTSA_v10016226mg             109   2e-23   Eutrema salsugineum [saltwater cress]
dbj|BAJ94790.1|  predicted protein                                      106   3e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAJ30207.1|  autophagy protein 9                                    105   5e-22   Hordeum vulgare [barley]
ref|XP_010469742.1|  PREDICTED: autophagy-related protein 9-like        105   5e-22   Camelina sativa [gold-of-pleasure]
emb|CAJ30212.1|  autophagy protein 9                                    105   7e-22   Triticum aestivum [Canadian hard winter wheat]
gb|EMS60913.1|  hypothetical protein TRIUR3_19436                       103   2e-21   Triticum urartu
ref|XP_010238045.1|  PREDICTED: autophagy-related protein 9-like        101   1e-20   Brachypodium distachyon [annual false brome]
ref|NP_001105821.1|  autophagy protein 9                                101   1e-20   
ref|XP_006661652.1|  PREDICTED: autophagy-related protein 9-like        100   2e-20   Oryza brachyantha
ref|XP_002465557.1|  hypothetical protein SORBIDRAFT_01g041090        99.4    5e-20   Sorghum bicolor [broomcorn]
emb|CAJ30210.1|  autophagy protein 9                                  99.4    5e-20   Sorghum bicolor [broomcorn]
emb|CAJ30211.1|  autophagy protein 9                                  97.4    3e-19   Saccharum officinarum [noble cane]
ref|XP_002466932.1|  hypothetical protein SORBIDRAFT_01g016890        96.3    7e-19   
ref|XP_008787388.1|  PREDICTED: autophagy-related protein 9-like      91.3    3e-17   Phoenix dactylifera
emb|CDY24745.1|  BnaC04g13500D                                        82.8    1e-15   Brassica napus [oilseed rape]
gb|KJB25993.1|  hypothetical protein B456_004G220200                  70.5    2e-10   Gossypium raimondii
ref|XP_001762984.1|  predicted protein                                63.9    2e-08   
ref|XP_001778713.1|  predicted protein                                63.2    3e-08   
ref|XP_002982911.1|  hypothetical protein SELMODRAFT_50960            60.5    2e-07   
ref|XP_002981932.1|  hypothetical protein SELMODRAFT_50959            60.5    2e-07   



>gb|AGH30270.1| autophagy-related protein 9, partial [Nicotiana benthamiana]
Length=119

 Score =   175 bits (444),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MMF G K A GLNIF+WKW GESSL TGLLDDVPPEIELSDY RAPS GSESPSGLLNGE
Sbjct  1    MMFGGQKGASGLNIFKWKWHGESSLRTGLLDDVPPEIELSDYCRAPSPGSESPSGLLNGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            S +VEPIADLDLFFERLY+Y+CEKGLWCIIIKWIFELL
Sbjct  61   SLNVEPIADLDLFFERLYNYYCEKGLWCIIIKWIFELL  98



>ref|XP_009763222.1| PREDICTED: autophagy-related protein 9 [Nicotiana sylvestris]
 ref|XP_009763223.1| PREDICTED: autophagy-related protein 9 [Nicotiana sylvestris]
 ref|XP_009763224.1| PREDICTED: autophagy-related protein 9 [Nicotiana sylvestris]
Length=858

 Score =   181 bits (459),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MMFSG K A GLNIF+WKW GESSL TGLLDDVPPEIELSDY RAPS GSESPSGLLNGE
Sbjct  1    MMFSGQKGASGLNIFKWKWHGESSLRTGLLDDVPPEIELSDYRRAPSPGSESPSGLLNGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
            S +VEPIADLDLFFERLY+Y+CEKGLWCIIIKWIFELL 
Sbjct  61   SLNVEPIADLDLFFERLYNYYCEKGLWCIIIKWIFELLS  99



>ref|XP_009588383.1| PREDICTED: autophagy-related protein 9 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009588384.1| PREDICTED: autophagy-related protein 9 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009588385.1| PREDICTED: autophagy-related protein 9 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009588386.1| PREDICTED: autophagy-related protein 9 isoform X1 [Nicotiana 
tomentosiformis]
Length=858

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MMFSG K A GLNIF+WKW GESSL TGLLDDVPPEIELSDY  APS GSESPSGLLNGE
Sbjct  1    MMFSGQKGASGLNIFKWKWHGESSLRTGLLDDVPPEIELSDYRIAPSPGSESPSGLLNGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
            S +VEPIADLDLFFERLY+Y+CEKGLWCIIIKWIFELL 
Sbjct  61   SLNVEPIADLDLFFERLYNYYCEKGLWCIIIKWIFELLS  99



>ref|XP_009588387.1| PREDICTED: autophagy-related protein 9 isoform X2 [Nicotiana 
tomentosiformis]
Length=844

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MMFSG K A GLNIF+WKW GESSL TGLLDDVPPEIELSDY  APS GSESPSGLLNGE
Sbjct  1    MMFSGQKGASGLNIFKWKWHGESSLRTGLLDDVPPEIELSDYRIAPSPGSESPSGLLNGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
            S +VEPIADLDLFFERLY+Y+CEKGLWCIIIKWIFELL 
Sbjct  61   SLNVEPIADLDLFFERLYNYYCEKGLWCIIIKWIFELLS  99



>emb|CDP07994.1| unnamed protein product [Coffea canephora]
Length=864

 Score =   173 bits (439),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MMF G K  + LNIF+WKW+ ESSL  GLL+DVPPEIELSDYHRAPS GSESPSGLLNG+
Sbjct  1    MMFRGQKGPNALNIFKWKWQNESSLEAGLLNDVPPEIELSDYHRAPSPGSESPSGLLNGD  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
            S SVEPIADLDLFFER+Y+Y+CEKGLWCIIIKWIFELL 
Sbjct  61   SSSVEPIADLDLFFERVYNYYCEKGLWCIIIKWIFELLS  99



>ref|XP_004237181.1| PREDICTED: autophagy-related protein 9 [Solanum lycopersicum]
Length=900

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MMFSG K A+GLNIF+W+  GESSL TGLLDDV PEIELSDY RAPS GSESPSGLLNGE
Sbjct  1    MMFSGQKGANGLNIFKWRRHGESSLRTGLLDDVHPEIELSDYRRAPSPGSESPSGLLNGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
            S SVEPI+DLDLFFERLY+Y+CEKGLWCIIIKWIFELL 
Sbjct  61   SVSVEPISDLDLFFERLYNYYCEKGLWCIIIKWIFELLS  99



>ref|XP_002302054.2| autophagy 9 family protein, partial [Populus trichocarpa]
 gb|EEE81327.2| autophagy 9 family protein, partial [Populus trichocarpa]
Length=502

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 87/98 (89%), Gaps = 1/98 (1%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MMFSG K  + L+IF+WKWRGESSLTT LLDDVPPEIELSDY R PS GSESPSGLLNGE
Sbjct  1    MMFSGQKF-NALSIFKWKWRGESSLTTSLLDDVPPEIELSDYRRVPSPGSESPSGLLNGE  59

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            S +VEPIADLDLFFERLY+Y+CEKGLWCIIIKWI EL 
Sbjct  60   SLNVEPIADLDLFFERLYNYYCEKGLWCIIIKWIVELF  97



>ref|XP_006355001.1| PREDICTED: autophagy-related protein 9-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006355002.1| PREDICTED: autophagy-related protein 9-like isoform X2 [Solanum 
tuberosum]
Length=868

 Score =   170 bits (431),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MMFSG K A+GLNIF+W+  GESSL  GLLDDV PEIELSDY RAPS GSESPSGLLNGE
Sbjct  1    MMFSGQKGANGLNIFKWRRHGESSLRIGLLDDVHPEIELSDYRRAPSPGSESPSGLLNGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
            S SVEPI+DLDLFFERLY+Y+CEKGLWCIIIKWIFELL 
Sbjct  61   SVSVEPISDLDLFFERLYNYYCEKGLWCIIIKWIFELLS  99



>ref|XP_011028790.1| PREDICTED: autophagy-related protein 9-like [Populus euphratica]
 ref|XP_011028792.1| PREDICTED: autophagy-related protein 9-like [Populus euphratica]
Length=866

 Score =   168 bits (425),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 87/99 (88%), Gaps = 1/99 (1%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MMFSG K  + L+IF+WKWRGESSLTT LLDDVPPEIELSDY R PS GSESPSGLLNGE
Sbjct  1    MMFSGQKF-NALSIFKWKWRGESSLTTSLLDDVPPEIELSDYRRVPSPGSESPSGLLNGE  59

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
            S +VEPIADLDLFFERLY+Y+CEKGLWCIIIKWI EL  
Sbjct  60   SLNVEPIADLDLFFERLYNYYCEKGLWCIIIKWIVELFS  98



>ref|XP_010652362.1| PREDICTED: autophagy-related protein 9 [Vitis vinifera]
 ref|XP_010652363.1| PREDICTED: autophagy-related protein 9 [Vitis vinifera]
 ref|XP_010652364.1| PREDICTED: autophagy-related protein 9 [Vitis vinifera]
 ref|XP_010652365.1| PREDICTED: autophagy-related protein 9 [Vitis vinifera]
 ref|XP_002263784.2| PREDICTED: autophagy-related protein 9 [Vitis vinifera]
Length=958

 Score =   168 bits (425),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MMF G K A+ L+IF+WKW GESSLTTGLL+DVPPEIELSDY R PS GS+SPSGLLNGE
Sbjct  1    MMFRGQKGANALSIFKWKWHGESSLTTGLLNDVPPEIELSDYRRIPSPGSDSPSGLLNGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
            S +VEPI DLDLFFERLY+Y+CEKGLWCIIIKWI ELL 
Sbjct  61   SRNVEPITDLDLFFERLYNYYCEKGLWCIIIKWIVELLS  99



>emb|CBI37095.3| unnamed protein product [Vitis vinifera]
Length=816

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = +3

Query  393  MFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGES  572
            MF G K A+ L+IF+WKW GESSLTTGLL+DVPPEIELSDY R PS GS+SPSGLLNGES
Sbjct  1    MFRGQKGANALSIFKWKWHGESSLTTGLLNDVPPEIELSDYRRIPSPGSDSPSGLLNGES  60

Query  573  FSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
             +VEPI DLDLFFERLY+Y+CEKGLWCIIIKWI ELL
Sbjct  61   RNVEPITDLDLFFERLYNYYCEKGLWCIIIKWIVELL  97



>ref|XP_012085334.1| PREDICTED: autophagy-related protein 9 [Jatropha curcas]
 gb|KDP26550.1| hypothetical protein JCGZ_17708 [Jatropha curcas]
Length=864

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MMF   KA++ L+IF+W+  GES+LTTGLL DVPPEIELSDY R PS GSESPSGLLNGE
Sbjct  1    MMFGRQKASNALSIFKWRSHGESTLTTGLLKDVPPEIELSDYGRVPSPGSESPSGLLNGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            S +VEPIADLDLFFERLYSY+CEKGLWCIIIKWI ELL
Sbjct  61   SLNVEPIADLDLFFERLYSYYCEKGLWCIIIKWIVELL  98



>ref|XP_006443860.1| hypothetical protein CICLE_v10018809mg [Citrus clementina]
 ref|XP_006479555.1| PREDICTED: autophagy-related protein 9-like isoform X1 [Citrus 
sinensis]
 ref|XP_006479556.1| PREDICTED: autophagy-related protein 9-like isoform X2 [Citrus 
sinensis]
 gb|ESR57100.1| hypothetical protein CICLE_v10018809mg [Citrus clementina]
Length=874

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 88/101 (87%), Gaps = 2/101 (2%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYH--RAPSAGSESPSGLLN  563
            MMFSG + A+ L++FRWKWRG+SSLTTGLL+DVPPEIELSDY   R PS GSESP+GLLN
Sbjct  1    MMFSGQRGANPLSVFRWKWRGDSSLTTGLLNDVPPEIELSDYAHGRVPSPGSESPAGLLN  60

Query  564  GESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
            GES +V PIADLDLFFERLYSY+CEKGL CIIIKWI ELL 
Sbjct  61   GESLNVAPIADLDLFFERLYSYYCEKGLRCIIIKWIVELLS  101



>gb|KDO68461.1| hypothetical protein CISIN_1g002844mg [Citrus sinensis]
 gb|KDO68462.1| hypothetical protein CISIN_1g002844mg [Citrus sinensis]
 gb|KDO68463.1| hypothetical protein CISIN_1g002844mg [Citrus sinensis]
 gb|KDO68464.1| hypothetical protein CISIN_1g002844mg [Citrus sinensis]
 gb|KDO68465.1| hypothetical protein CISIN_1g002844mg [Citrus sinensis]
Length=874

 Score =   162 bits (411),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 88/101 (87%), Gaps = 2/101 (2%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYH--RAPSAGSESPSGLLN  563
            MMFSG + A+ L++FRWKWRG+SSLTTGLL+DVPPEIELSDY   R PS GSESP+GLLN
Sbjct  1    MMFSGQRGANPLSVFRWKWRGDSSLTTGLLNDVPPEIELSDYAHGRVPSPGSESPAGLLN  60

Query  564  GESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
            GES +V PIADLDLFFERLYSY+CEKGL CIIIKWI ELL 
Sbjct  61   GESLNVAPIADLDLFFERLYSYYCEKGLRCIIIKWIVELLS  101



>ref|XP_011080031.1| PREDICTED: autophagy-related protein 9 [Sesamum indicum]
Length=864

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +3

Query  393  MFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGES  572
            MFSG K  H LNIF+WKWR  SSLT+GLL+DVP  IELSDYH+APS  SESPSGLL+GE+
Sbjct  1    MFSGQKGVHSLNIFKWKWRSTSSLTSGLLNDVPHGIELSDYHKAPSICSESPSGLLDGET  60

Query  573  FSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
             + EPI DLDLFFER+Y+Y+CEKGLWCIIIKWIFELL
Sbjct  61   LNAEPIDDLDLFFERIYTYYCEKGLWCIIIKWIFELL  97



>ref|XP_002532369.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30012.1| conserved hypothetical protein [Ricinus communis]
Length=864

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +3

Query  393  MFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGES  572
            M+S  K +  L+IF+W+ RGES+LTTGLL+DVPPEIELSDY R PS GSESPSG LNGES
Sbjct  1    MYSWKKGSTALSIFKWRLRGESTLTTGLLNDVPPEIELSDYGRVPSPGSESPSGFLNGES  60

Query  573  FSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
             +VEPIADLDLFFERLYSY+CEKGLWCIIIKWI ELL
Sbjct  61   LNVEPIADLDLFFERLYSYYCEKGLWCIIIKWIVELL  97



>ref|XP_011025998.1| PREDICTED: autophagy-related protein 9-like [Populus euphratica]
Length=877

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 84/99 (85%), Gaps = 1/99 (1%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MMFSG +  + L+IF+WKW GESSL+  LLDDVPPEIELSDY R PS G ESPSGLLNGE
Sbjct  1    MMFSG-QNFNALSIFKWKWHGESSLSNRLLDDVPPEIELSDYRRVPSPGCESPSGLLNGE  59

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
            S +VEPIADLDLFFERLY+Y+CEKGLWCIIIKWI EL  
Sbjct  60   SLNVEPIADLDLFFERLYNYYCEKGLWCIIIKWIVELFS  98



>gb|KHN03870.1| Autophagy-related protein 9 [Glycine soja]
Length=849

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +3

Query  393  MFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGES  572
            MF+  + A   N+  WK +GESS+TTGLL DVPPEIELSDY R PS GSESPS LLNGES
Sbjct  1    MFNKPRGASAFNVLNWKRQGESSVTTGLLQDVPPEIELSDYRRIPSPGSESPSDLLNGES  60

Query  573  FSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
             +VEPIADLD FFERLYSY+CEKGLWCIIIKWI ELL
Sbjct  61   LNVEPIADLDFFFERLYSYYCEKGLWCIIIKWIVELL  97



>ref|XP_003536935.1| PREDICTED: autophagy-related protein 9-like [Glycine max]
Length=863

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +3

Query  393  MFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGES  572
            MF+  + A   N+  WK +GESS+TTGLL DVPPEIELSDY R PS GSESPS LLNGES
Sbjct  1    MFNKPRGASAFNVLNWKRQGESSVTTGLLQDVPPEIELSDYRRIPSPGSESPSDLLNGES  60

Query  573  FSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
             +VEPIADLD FFERLYSY+CEKGLWCIIIKWI ELL
Sbjct  61   LNVEPIADLDFFFERLYSYYCEKGLWCIIIKWIVELL  97



>ref|XP_002306839.1| autophagy 9 family protein [Populus trichocarpa]
 gb|EEE93835.1| autophagy 9 family protein [Populus trichocarpa]
Length=876

 Score =   154 bits (389),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MMFSG +  + L+IF+WKWRGESSL+  LLDDVPPEIELSDY R PS G ESPSGLLNG+
Sbjct  1    MMFSG-QNFNALSIFKWKWRGESSLSNRLLDDVPPEIELSDYRRVPSPGCESPSGLLNGD  59

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
              +VE +ADLDLFFERLY+Y+CEKGLWCIIIKWI EL  
Sbjct  60   RLNVETVADLDLFFERLYNYYCEKGLWCIIIKWIVELFS  98



>ref|XP_003541347.1| PREDICTED: autophagy-related protein 9-like [Glycine max]
Length=868

 Score =   154 bits (388),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  393  MFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGES  572
            MF+  + A   N+  WK +GESS+TTGLL DVPPEIELSDY R PS GSESPS LLNGES
Sbjct  1    MFNRPRGARAFNVLNWKHQGESSVTTGLLQDVPPEIELSDYRRIPSPGSESPSDLLNGES  60

Query  573  FSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
             +VEPIADLD FFERLY Y+CEKGLWCIIIKWI ELL 
Sbjct  61   LNVEPIADLDFFFERLYCYYCEKGLWCIIIKWIVELLS  98



>gb|KHN44973.1| Autophagy-related protein 9 [Glycine soja]
Length=868

 Score =   154 bits (388),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  393  MFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGES  572
            MF+  + A   N+  WK +GESS+TTGLL DVPPEIELSDY R PS GSESPS LLNGES
Sbjct  1    MFNRPRGARAFNVLNWKHQGESSVTTGLLQDVPPEIELSDYRRIPSPGSESPSDLLNGES  60

Query  573  FSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
             +VEPIADLD FFERLY Y+CEKGLWCIIIKWI ELL 
Sbjct  61   LNVEPIADLDFFFERLYCYYCEKGLWCIIIKWIVELLS  98



>gb|KCW84722.1| hypothetical protein EUGRSUZ_B01536 [Eucalyptus grandis]
Length=608

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +3

Query  393  MFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGES  572
            MF   K  + L  F+ KW+ ESSLTTGLL DVPPEIELS+Y R PS GSESPS LLNGES
Sbjct  1    MFGSRKGGNALGRFKLKWQRESSLTTGLLGDVPPEIELSEYGRVPSPGSESPSALLNGES  60

Query  573  FSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
             ++EPI DLDLFFERLYSY+CEKGLWCIIIKWI ELL 
Sbjct  61   LNLEPITDLDLFFERLYSYYCEKGLWCIIIKWIVELLS  98



>gb|EPS63710.1| hypothetical protein M569_11073, partial [Genlisea aurea]
Length=192

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            +MFS  +A H LNIFRWK R +SSLT   L+    EIEL DYH+APS GSESPSGLL+G+
Sbjct  1    VMFSVQRALHSLNIFRWKKRSKSSLTDVFLNGEDLEIELPDYHKAPSTGSESPSGLLDGD  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
            + + EPI DLDLFFER+YSY+C+KGLWCIIIKWIFELL 
Sbjct  61   TLNSEPIEDLDLFFERVYSYYCDKGLWCIIIKWIFELLS  99



>gb|KEH42560.1| autophagy 9 (APG9) protein [Medicago truncatula]
Length=866

 Score =   151 bits (381),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  393  MFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGES  572
            MF+ S+ A    IF+WK +GESS+T  L+ DVPPEIELSDY R PS GSESPSGLLNG+S
Sbjct  1    MFTRSRNASAFGIFKWKRQGESSVTESLIQDVPPEIELSDYRRIPSPGSESPSGLLNGDS  60

Query  573  FSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
             ++EPI DLDLFFERLYSY+CEKGLWCIIIKWI ELL 
Sbjct  61   PNIEPIGDLDLFFERLYSYYCEKGLWCIIIKWIVELLS  98



>gb|EYU46469.1| hypothetical protein MIMGU_mgv1a001180mg [Erythranthe guttata]
Length=871

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 81/98 (83%), Gaps = 1/98 (1%)
 Frame = +3

Query  393  MFSGSKAAHGLNIFRWKWRGESSLTTGLLDD-VPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MFSG K  H LN+ +W WR  SSLTTGLL+D    EIELSDYH+APS GSESPSGLL+GE
Sbjct  1    MFSGQKGIHALNVLKWNWRSTSSLTTGLLNDNFNQEIELSDYHKAPSPGSESPSGLLDGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            + + E I DLDLFFER+Y+Y+CEKGLWCIIIKWIFELL
Sbjct  61   TLNGEQIEDLDLFFERIYNYYCEKGLWCIIIKWIFELL  98



>gb|KJB25992.1| hypothetical protein B456_004G220200 [Gossypium raimondii]
Length=754

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 82/99 (83%), Gaps = 1/99 (1%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAP-SAGSESPSGLLNG  566
            MMF G +AA+ L +FR +W GESSLTTGLL DVPPEIELSDY R P S  SE P GLLNG
Sbjct  1    MMFWGQRAANALGMFRLRWGGESSLTTGLLGDVPPEIELSDYGRLPASPRSECPLGLLNG  60

Query  567  ESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            ES +VEPIADLDLFFERLYSY+CEKGLW IIIKWI ELL
Sbjct  61   ESLNVEPIADLDLFFERLYSYYCEKGLWYIIIKWIVELL  99



>ref|XP_010039166.1| PREDICTED: autophagy-related protein 9 isoform X2 [Eucalyptus 
grandis]
Length=809

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +3

Query  393  MFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGES  572
            MF   K  + L  F+ KW+ ESSLTTGLL DVPPEIELS+Y R PS GSESPS LLNGES
Sbjct  1    MFGSRKGGNALGRFKLKWQRESSLTTGLLGDVPPEIELSEYGRVPSPGSESPSALLNGES  60

Query  573  FSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
             ++EPI DLDLFFERLYSY+CEKGLWCIIIKWI ELL
Sbjct  61   LNLEPITDLDLFFERLYSYYCEKGLWCIIIKWIVELL  97



>ref|XP_008447441.1| PREDICTED: autophagy-related protein 9 isoform X2 [Cucumis melo]
Length=872

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MM SG+  A  + IFRWK  GESSLT+ LL DVPPEIELS + R P+ GSESP+GLL+GE
Sbjct  1    MMLSGTAGADNVGIFRWKSHGESSLTSALLKDVPPEIELSTFGRVPNPGSESPTGLLDGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
              +VEPIADLDLFFERLYSY+C+KGLWCII KWI ELL
Sbjct  61   RLNVEPIADLDLFFERLYSYYCDKGLWCIITKWIVELL  98



>ref|XP_008447440.1| PREDICTED: autophagy-related protein 9 isoform X1 [Cucumis melo]
Length=890

 Score =   149 bits (375),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MM SG+  A  + IFRWK  GESSLT+ LL DVPPEIELS + R P+ GSESP+GLL+GE
Sbjct  1    MMLSGTAGADNVGIFRWKSHGESSLTSALLKDVPPEIELSTFGRVPNPGSESPTGLLDGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
              +VEPIADLDLFFERLYSY+C+KGLWCII KWI ELL
Sbjct  61   RLNVEPIADLDLFFERLYSYYCDKGLWCIITKWIVELL  98



>ref|XP_010039159.1| PREDICTED: autophagy-related protein 9 isoform X1 [Eucalyptus 
grandis]
 gb|KCW84721.1| hypothetical protein EUGRSUZ_B01536 [Eucalyptus grandis]
Length=869

 Score =   148 bits (374),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +3

Query  393  MFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGES  572
            MF   K  + L  F+ KW+ ESSLTTGLL DVPPEIELS+Y R PS GSESPS LLNGES
Sbjct  1    MFGSRKGGNALGRFKLKWQRESSLTTGLLGDVPPEIELSEYGRVPSPGSESPSALLNGES  60

Query  573  FSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
             ++EPI DLDLFFERLYSY+CEKGLWCIIIKWI ELL
Sbjct  61   LNLEPITDLDLFFERLYSYYCEKGLWCIIIKWIVELL  97



>ref|XP_009354931.1| PREDICTED: autophagy-related protein 9-like [Pyrus x bretschneideri]
Length=873

 Score =   148 bits (373),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 81/98 (83%), Gaps = 2/98 (2%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MMF   K    L I +WK  G+SSLT+GLL DV PE+ELSDY RAPS GSESPSGLLNGE
Sbjct  1    MMFRRLKGVTSLGILKWK--GDSSLTSGLLRDVAPEVELSDYGRAPSPGSESPSGLLNGE  58

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            S +VEPIADLDLFFERLYSY+CEKGLWCIIIKW+ ELL
Sbjct  59   SINVEPIADLDLFFERLYSYYCEKGLWCIIIKWMVELL  96



>ref|XP_011651446.1| PREDICTED: autophagy-related protein 9 [Cucumis sativus]
 gb|KGN57929.1| hypothetical protein Csa_3G393920 [Cucumis sativus]
Length=873

 Score =   148 bits (373),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MM SG+  A  + IFRWK  GESSLT+ LL DVPPEIELS + R P+ GSESP+GLL+GE
Sbjct  1    MMLSGTGGADNVGIFRWKSHGESSLTSALLKDVPPEIELSTFGRVPNPGSESPTGLLDGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
              +VEPIADLDLFFERLYSY+C+KGLWCII KWI ELL
Sbjct  61   RLNVEPIADLDLFFERLYSYYCDKGLWCIITKWIVELL  98



>gb|KHG16698.1| Autophagy-related 9 [Gossypium arboreum]
Length=867

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 82/99 (83%), Gaps = 1/99 (1%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAP-SAGSESPSGLLNG  566
            MMF G +AA+ L +FR +W GESSLTTGLL DVP EIE+SDY R P S  SE PSGLLNG
Sbjct  1    MMFWGQRAANALGMFRLRWGGESSLTTGLLGDVPHEIEVSDYGRLPASPRSECPSGLLNG  60

Query  567  ESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            ES +VEPIADLDLFFERLY Y+CEKGLWCIIIKWI ELL
Sbjct  61   ESLNVEPIADLDLFFERLYIYYCEKGLWCIIIKWIVELL  99



>ref|XP_004495109.1| PREDICTED: autophagy-related protein 9-like [Cicer arietinum]
Length=893

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = +3

Query  393  MFSGSKAAHGLNIFRWKW-RGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MF+ S+ A   +IF+WK  +GESS+   LL DV PEIELSDY R PS GSESPSGLLNGE
Sbjct  1    MFTRSRDASAFSIFKWKKGQGESSMNAALLQDVSPEIELSDYRRIPSPGSESPSGLLNGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
            S +V+PIADLDLFFERLYSY+CEKGLWCIIIKWI ELL 
Sbjct  61   SLNVDPIADLDLFFERLYSYYCEKGLWCIIIKWIVELLS  99



>ref|XP_003520596.1| PREDICTED: autophagy-related protein 9-like [Glycine max]
Length=872

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +3

Query  393  MFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGES  572
            MFS  + A   +IF+WK  G SSLT GLL + PPEIELS Y + PS GSESPSGLLNGES
Sbjct  1    MFSRQRGASAFSIFKWKHPGASSLTAGLLQEDPPEIELSYYGKIPSPGSESPSGLLNGES  60

Query  573  FSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
             +VEPIADLDLFFERLYSY+CEKGLWCIIIKWI ELL
Sbjct  61   LNVEPIADLDLFFERLYSYYCEKGLWCIIIKWIVELL  97



>ref|XP_008235698.1| PREDICTED: autophagy-related protein 9 [Prunus mume]
 ref|XP_008235699.1| PREDICTED: autophagy-related protein 9 [Prunus mume]
Length=868

 Score =   145 bits (367),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 79/98 (81%), Gaps = 2/98 (2%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MMF   K    L IF  K  GESSLT  LL DVPPE+ELS+Y RAPS GSESPSGLLNGE
Sbjct  1    MMFRWLKGVKSLGIF--KLNGESSLTAALLRDVPPEVELSEYGRAPSPGSESPSGLLNGE  58

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            S +VEPIADLDLFFERLYSY+CEKGLWCIIIKWI ELL
Sbjct  59   SVNVEPIADLDLFFERLYSYYCEKGLWCIIIKWIVELL  96



>gb|KJB22900.1| hypothetical protein B456_004G072800 [Gossypium raimondii]
Length=908

 Score =   145 bits (366),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 84/113 (74%), Gaps = 1/113 (1%)
 Frame = +3

Query  351  NGQAVLA*HQHI*MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPS  530
            NG A+   HQ + MMF G KAA+ L IF+W+W GESSLTTGLL DVP  IELSDY R P 
Sbjct  30   NGLALFPCHQDLQMMFRGQKAANALGIFKWRWGGESSLTTGLLGDVPSVIELSDYGRVPP  89

Query  531  AGSESPSG-LLNGESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
            +        LLNGE+ + EPIADLDLFFERLYSY+CEKGLWCIIIKWI ELL 
Sbjct  90   SPGSESPSGLLNGETLNAEPIADLDLFFERLYSYYCEKGLWCIIIKWIVELLS  142



>ref|XP_007162532.1| hypothetical protein PHAVU_001G159900g [Phaseolus vulgaris]
 ref|XP_007162533.1| hypothetical protein PHAVU_001G159900g [Phaseolus vulgaris]
 gb|ESW34526.1| hypothetical protein PHAVU_001G159900g [Phaseolus vulgaris]
 gb|ESW34527.1| hypothetical protein PHAVU_001G159900g [Phaseolus vulgaris]
Length=857

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +3

Query  393  MFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGES  572
            MFS  + A   +IF+WK  G SSLT GLL +  PEIELSDY + PS GSESPSGLLNG+S
Sbjct  1    MFSRPRGASAFSIFKWKQPGASSLTAGLLQEDQPEIELSDYGKIPSPGSESPSGLLNGDS  60

Query  573  FSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
             +VEPI+DLDLFFERLYSY+CEKGLWCIIIKWI ELL
Sbjct  61   LNVEPISDLDLFFERLYSYYCEKGLWCIIIKWIVELL  97



>ref|XP_007200623.1| hypothetical protein PRUPE_ppa001270mg [Prunus persica]
 gb|EMJ01822.1| hypothetical protein PRUPE_ppa001270mg [Prunus persica]
Length=867

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 78/98 (80%), Gaps = 2/98 (2%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MMF   K    L IF  K  GESSLT  LL DVPPE+ELS+Y RAPS GSESPSGLLNGE
Sbjct  1    MMFRWLKGVKSLGIF--KLNGESSLTAALLRDVPPEVELSEYGRAPSPGSESPSGLLNGE  58

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            S + EPIADLDLFFERLYSY+CEKGLWCIIIKWI ELL
Sbjct  59   SVNAEPIADLDLFFERLYSYYCEKGLWCIIIKWIVELL  96



>ref|XP_010679231.1| PREDICTED: autophagy-related protein 9 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010679232.1| PREDICTED: autophagy-related protein 9 [Beta vulgaris subsp. 
vulgaris]
Length=900

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +3

Query  393  MFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGES  572
            M S     + L+IF+W+  G+ SL+TGLL+DVPPEIELS Y R PS GSESPSGLLNGES
Sbjct  1    MSSWQGGRNALSIFKWRRPGDPSLSTGLLNDVPPEIELSGYGRVPSPGSESPSGLLNGES  60

Query  573  FSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
              VEPI+DLDLFFERLYSY+CEKG+WCII+KWI ELL
Sbjct  61   LKVEPISDLDLFFERLYSYYCEKGIWCIIVKWICELL  97



>ref|XP_009369497.1| PREDICTED: autophagy-related protein 9-like [Pyrus x bretschneideri]
Length=875

 Score =   142 bits (359),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 79/98 (81%), Gaps = 2/98 (2%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MMF   K    L I +WK  G+SSLT+ LL  V PE+ELS+Y RAPS GSESPSGLLNGE
Sbjct  1    MMFGRLKGVTSLGILKWK--GDSSLTSALLRGVAPEVELSEYGRAPSPGSESPSGLLNGE  58

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            S +VEPIADLDLFFERLYSY+CEKGLWCIIIKWI ELL
Sbjct  59   SINVEPIADLDLFFERLYSYYCEKGLWCIIIKWIVELL  96



>ref|XP_010557109.1| PREDICTED: autophagy-related protein 9-like [Tarenaya hassleriana]
 ref|XP_010557110.1| PREDICTED: autophagy-related protein 9-like [Tarenaya hassleriana]
Length=883

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESS-LTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNG  566
            MM++G KA +    F+WK RGESS LTTGLL +V  E+ELS+Y   PS GSESPSGLLNG
Sbjct  1    MMYTGQKALNLFRCFKWKQRGESSSLTTGLLHNVSNEVELSNYGGIPSPGSESPSGLLNG  60

Query  567  ESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            ES SVEPIADLDLFFERLYSY+C+KG+WCIIIKW  ELL
Sbjct  61   ESLSVEPIADLDLFFERLYSYYCDKGIWCIIIKWAVELL  99



>gb|KHN10731.1| Autophagy-related protein 9 [Glycine soja]
Length=919

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  405  SKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGESFSVE  584
             + A   +IF+WK  G SSLT GLL + PPEIELS Y + PS GSESPSGLLNGES +VE
Sbjct  52   QRGASAFSIFKWKHPGASSLTAGLLQEDPPEIELSYYGKIPSPGSESPSGLLNGESLNVE  111

Query  585  PIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            PIADLDLFFERLYSY+CEKGLWCIIIKWI ELL
Sbjct  112  PIADLDLFFERLYSYYCEKGLWCIIIKWIVELL  144



>ref|XP_006604488.1| PREDICTED: autophagy-related protein 9 [Glycine max]
Length=869

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +3

Query  393  MFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGES  572
            MFS  + A   +IF+WK  G SSLTT LL +  PEIELSDY + PS GSESPSGLLNGES
Sbjct  1    MFSRQRGASAFSIFKWKHPGASSLTTALLQEDLPEIELSDYGKIPSPGSESPSGLLNGES  60

Query  573  FSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
             +VEPI+DLDLF ERLYSY+CEKGLWCI+IKWI ELL 
Sbjct  61   LNVEPISDLDLFSERLYSYYCEKGLWCIVIKWIVELLS  98



>ref|XP_008382877.1| PREDICTED: autophagy-related protein 9 [Malus domestica]
Length=874

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  441  KWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGESFSVEPIADLDLFFERL  620
            KW+G+SSLT+ LL DV PE+ELS+Y RAPS GSESPSGLLNGES +VEPIADLDLFFERL
Sbjct  15   KWKGDSSLTSALLRDVAPEVELSEYGRAPSPGSESPSGLLNGESINVEPIADLDLFFERL  74

Query  621  YSYHCEKGLWCIIIKWIFELL  683
            YSY+CEKGLWCIIIKWI ELL
Sbjct  75   YSYYCEKGLWCIIIKWIVELL  95



>emb|CCX35483.1| hypothetical protein [Malus domestica]
Length=873

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  441  KWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGESFSVEPIADLDLFFERL  620
            KW+G+SSLT+ LL DV PE+ELS+Y RAPS GSESPSGLLNGES +VEPIADLDLFFERL
Sbjct  14   KWKGDSSLTSALLRDVAPEVELSEYGRAPSPGSESPSGLLNGESINVEPIADLDLFFERL  73

Query  621  YSYHCEKGLWCIIIKWIFELL  683
            YSY+CEKGLWCIIIKWI ELL
Sbjct  74   YSYYCEKGLWCIIIKWIVELL  94



>emb|CCX35470.1| hypothetical protein [Malus domestica]
Length=873

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  441  KWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGESFSVEPIADLDLFFERL  620
            KW+G+SSLT+ LL DV PE+ELS+Y RAPS GSESPSGLLNGES +VEPIADLDLFFERL
Sbjct  14   KWKGDSSLTSALLRDVAPEVELSEYGRAPSPGSESPSGLLNGESINVEPIADLDLFFERL  73

Query  621  YSYHCEKGLWCIIIKWIFELL  683
            YSY+CEKGLWCIIIKWI ELL
Sbjct  74   YSYYCEKGLWCIIIKWIVELL  94



>ref|XP_010918784.1| PREDICTED: autophagy-related protein 9-like [Elaeis guineensis]
Length=873

 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MM S  K A   + F W WR E+SLTT LL D PPEIELSDY R P +GSESPSGLLN E
Sbjct  1    MMSSAQKGAIAPSRFEWPWRSEASLTTQLLSDAPPEIELSDYRRLPRSGSESPSGLLNDE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
                EPIADLDLFFERLY+Y+CEKGL CIIIKWI E+L 
Sbjct  61   GLKSEPIADLDLFFERLYNYYCEKGLRCIIIKWIVEILN  99



>gb|KHG23531.1| atg9 [Gossypium arboreum]
Length=1502

 Score =   140 bits (354),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSG-LLNG  566
            MMF+G KAA+ L IF+W+W GESSL+TGLL DVPPEIELS Y R P +        LLNG
Sbjct  1    MMFTGKKAANSLGIFKWRWGGESSLSTGLLGDVPPEIELSGYGRVPPSPGSESPSGLLNG  60

Query  567  ESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            E+ + EPIADLDLFFERLYSY+CEKGLWCIIIKWI ELL
Sbjct  61   ETLNAEPIADLDLFFERLYSYYCEKGLWCIIIKWIVELL  99



>gb|AID50966.1| autophagy-related protein 9 [Malus domestica]
Length=873

 Score =   140 bits (352),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  441  KWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGESFSVEPIADLDLFFERL  620
            KW+G+SSLT+ LL DV PE+ELS+Y RAPS GSESPSGLLNGE+ +VEPIADLDLFFERL
Sbjct  14   KWKGDSSLTSALLRDVAPEVELSEYGRAPSPGSESPSGLLNGENINVEPIADLDLFFERL  73

Query  621  YSYHCEKGLWCIIIKWIFELL  683
            YSY+CEKGLWCIIIKWI ELL
Sbjct  74   YSYYCEKGLWCIIIKWIVELL  94



>ref|XP_004289924.1| PREDICTED: autophagy-related protein 9 [Fragaria vesca subsp. 
vesca]
Length=886

 Score =   139 bits (351),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 79/101 (78%), Gaps = 4/101 (4%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRA--PSAGSESPSGLLN  563
            MMF   K    +  F  KWRGESSLTT LL DV PE+ELS Y RA  PS GSESP+GLLN
Sbjct  1    MMFGWLKGVKSIGSF--KWRGESSLTTSLLRDVAPEVELSQYGRALSPSPGSESPTGLLN  58

Query  564  GESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
            GES +VEPIADLDLFFERLYSY+C+KGLWCI+IKWI ELL 
Sbjct  59   GESVNVEPIADLDLFFERLYSYYCDKGLWCIVIKWIVELLS  99



>ref|XP_010272081.1| PREDICTED: autophagy-related protein 9-like [Nelumbo nucifera]
 ref|XP_010272082.1| PREDICTED: autophagy-related protein 9-like [Nelumbo nucifera]
Length=873

 Score =   139 bits (350),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MM SG K A+  NIF+WKW GESSLT  LL+DVPPEIELSDY R PS+GSESPSGLLNGE
Sbjct  1    MMSSGQKGANAPNIFKWKWNGESSLTKELLNDVPPEIELSDYRRLPSSGSESPSGLLNGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
               VEPI DLDLFFERLY+Y+CEKGLWCIIIKWI ELL
Sbjct  61   GLKVEPITDLDLFFERLYNYYCEKGLWCIIIKWIVELL  98



>gb|KHG23532.1| atg9 [Gossypium arboreum]
Length=866

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSG-LLNG  566
            MMF+G KAA+ L IF+W+W GESSL+TGLL DVPPEIELS Y R P +        LLNG
Sbjct  1    MMFTGKKAANSLGIFKWRWGGESSLSTGLLGDVPPEIELSGYGRVPPSPGSESPSGLLNG  60

Query  567  ESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            E+ + EPIADLDLFFERLYSY+CEKGLWCIIIKWI ELL
Sbjct  61   ETLNAEPIADLDLFFERLYSYYCEKGLWCIIIKWIVELL  99



>ref|XP_010111903.1| hypothetical protein L484_009787 [Morus notabilis]
 gb|EXC31937.1| hypothetical protein L484_009787 [Morus notabilis]
Length=870

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 84/98 (86%), Gaps = 1/98 (1%)
 Frame = +3

Query  393  MFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRA-PSAGSESPSGLLNGE  569
            MF+GSK A+   IF+WKW G+SSL+ GLL DVPPEIELSDY R   S GSESPSGLLNGE
Sbjct  1    MFNGSKGANSRGIFKWKWHGQSSLSEGLLKDVPPEIELSDYGRILSSPGSESPSGLLNGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            S +VEPIADLDLFFERLYSY+CEKGLWCIIIKWI ELL
Sbjct  61   SLNVEPIADLDLFFERLYSYYCEKGLWCIIIKWIVELL  98



>gb|KJB22902.1| hypothetical protein B456_004G072800 [Gossypium raimondii]
Length=806

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 77/99 (78%), Gaps = 1/99 (1%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSG-LLNG  566
            MMF G KAA+ L IF+W+W GESSLTTGLL DVP  IELSDY R P +        LLNG
Sbjct  1    MMFRGQKAANALGIFKWRWGGESSLTTGLLGDVPSVIELSDYGRVPPSPGSESPSGLLNG  60

Query  567  ESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            E+ + EPIADLDLFFERLYSY+CEKGLWCIIIKWI ELL
Sbjct  61   ETLNAEPIADLDLFFERLYSYYCEKGLWCIIIKWIVELL  99



>gb|KEH23905.1| autophagy 9 (APG9) protein [Medicago truncatula]
Length=893

 Score =   137 bits (346),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = +3

Query  393  MFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGES  572
            MFS    +   +IF+WK +G SSLT GLL D  PEIELS+Y R PS GSESPS  LNGES
Sbjct  1    MFSRPSGSGAFSIFKWKQKGASSLTRGLLHDDSPEIELSNYGRIPSPGSESPSDFLNGES  60

Query  573  FSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
              VEPIADLDLFFERLY Y+CEKGLWCI+ KWI ELL 
Sbjct  61   VYVEPIADLDLFFERLYGYYCEKGLWCIVTKWIVELLS  98



>gb|KJB22903.1| hypothetical protein B456_004G072800 [Gossypium raimondii]
Length=866

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 77/99 (78%), Gaps = 1/99 (1%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSG-LLNG  566
            MMF G KAA+ L IF+W+W GESSLTTGLL DVP  IELSDY R P +        LLNG
Sbjct  1    MMFRGQKAANALGIFKWRWGGESSLTTGLLGDVPSVIELSDYGRVPPSPGSESPSGLLNG  60

Query  567  ESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            E+ + EPIADLDLFFERLYSY+CEKGLWCIIIKWI ELL
Sbjct  61   ETLNAEPIADLDLFFERLYSYYCEKGLWCIIIKWIVELL  99



>gb|KJB22901.1| hypothetical protein B456_004G072800 [Gossypium raimondii]
Length=822

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 77/99 (78%), Gaps = 1/99 (1%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSG-LLNG  566
            MMF G KAA+ L IF+W+W GESSLTTGLL DVP  IELSDY R P +        LLNG
Sbjct  1    MMFRGQKAANALGIFKWRWGGESSLTTGLLGDVPSVIELSDYGRVPPSPGSESPSGLLNG  60

Query  567  ESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            E+ + EPIADLDLFFERLYSY+CEKGLWCIIIKWI ELL
Sbjct  61   ETLNAEPIADLDLFFERLYSYYCEKGLWCIIIKWIVELL  99



>gb|KJB42251.1| hypothetical protein B456_007G145200 [Gossypium raimondii]
 gb|KJB42252.1| hypothetical protein B456_007G145200 [Gossypium raimondii]
 gb|KJB42253.1| hypothetical protein B456_007G145200 [Gossypium raimondii]
 gb|KJB42254.1| hypothetical protein B456_007G145200 [Gossypium raimondii]
Length=866

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 78/99 (79%), Gaps = 1/99 (1%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSG-LLNG  566
            MMF G KAA+ L IF+W+W GESSL+TGLL DVPPEIELS Y   P +        LLNG
Sbjct  1    MMFRGQKAANSLGIFKWRWGGESSLSTGLLGDVPPEIELSGYGTVPPSPGSESPSGLLNG  60

Query  567  ESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            E+ +VEPIADLDLFFERLYSY+CEKGLWCIIIKWI ELL
Sbjct  61   ETLNVEPIADLDLFFERLYSYYCEKGLWCIIIKWIVELL  99



>ref|XP_007144916.1| hypothetical protein PHAVU_007G194300g [Phaseolus vulgaris]
 gb|ESW16910.1| hypothetical protein PHAVU_007G194300g [Phaseolus vulgaris]
Length=873

 Score =   137 bits (344),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = +3

Query  393  MFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGES  572
            MF+  +     N F WK +GESS   GLL DVP EIE+SDY   P AGSESPS LL+GES
Sbjct  1    MFNWPRDVSAFNAFNWKRQGESSERKGLLQDVPAEIEMSDYTSIPIAGSESPSSLLDGES  60

Query  573  FSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
             +V+PIADLD FFERLYSY+CEKGLWCIIIKWI ELL 
Sbjct  61   LNVQPIADLDFFFERLYSYYCEKGLWCIIIKWIVELLS  98



>gb|ERM94913.1| hypothetical protein AMTR_s00009p00170950 [Amborella trichopoda]
Length=1034

 Score =   137 bits (345),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = +3

Query  393  MFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGES  572
            M    K A+    F+W+  GESS+T  LL DVPPEIELSDY R   A SESPSGLLNGES
Sbjct  1    MSGEQKGANYFGRFKWRRHGESSMTERLLHDVPPEIELSDYQRLSDADSESPSGLLNGES  60

Query  573  FSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
               EPIADLDLFFERLY+Y+CEKGLWCII KWI ELL
Sbjct  61   LKAEPIADLDLFFERLYNYYCEKGLWCIITKWIVELL  97



>ref|XP_010522159.1| PREDICTED: autophagy-related protein 9 [Tarenaya hassleriana]
Length=875

 Score =   136 bits (343),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 80/99 (81%), Gaps = 1/99 (1%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESS-LTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNG  566
            MM++  KA +  ++F+WK R ESS LTT LL +VP EIELS+Y   PS GSESPSGLLNG
Sbjct  1    MMYTRQKAPNSFSLFKWKQRDESSSLTTSLLHNVPNEIELSNYGGIPSPGSESPSGLLNG  60

Query  567  ESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            ES +VE IADLDLFFERLYSY+C+KGLWCIIIKW  ELL
Sbjct  61   ESLNVELIADLDLFFERLYSYYCDKGLWCIIIKWAVELL  99



>ref|XP_007050324.1| Autophagy 9 [Theobroma cacao]
 gb|EOX94481.1| Autophagy 9 [Theobroma cacao]
Length=866

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 77/99 (78%), Gaps = 2/99 (2%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSG-LLNG  566
            MMF   KAA+ L I RW+W GE+SL TGLL DVPPEIELSDY R P +        LLNG
Sbjct  1    MMFRVQKAANALGI-RWRWSGETSLATGLLGDVPPEIELSDYGRVPPSPGSESPSGLLNG  59

Query  567  ESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            ES +VEPIADLDLFFERLYSY+CEKGLWCIIIKWI ELL
Sbjct  60   ESLNVEPIADLDLFFERLYSYYCEKGLWCIIIKWIVELL  98



>emb|CDY19070.1| BnaA04g18100D [Brassica napus]
Length=993

 Score =   134 bits (338),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 82/113 (73%), Gaps = 3/113 (3%)
 Frame = +3

Query  351  NGQAVLA*HQHI*MMFSGSKAAHGLNIFRWKWRGE--SSLTTGLLDDVPPEIELSDYHRA  524
            NG   L   Q   MM  G K     N F+W+ RGE  SSLTTGLLD+V  EIELS+Y   
Sbjct  132  NGLVALVNRQSFRMMSGGQKPPSVFNFFKWQ-RGEPSSSLTTGLLDNVSHEIELSNYGGV  190

Query  525  PSAGSESPSGLLNGESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            PS GSESPSGLLNGES +V+PIADLDLFFE+LYSY+ +KGLWCII+KW  ELL
Sbjct  191  PSPGSESPSGLLNGESLNVQPIADLDLFFEKLYSYYRDKGLWCIIVKWAVELL  243



>ref|XP_010255319.1| PREDICTED: autophagy-related protein 9-like [Nelumbo nucifera]
Length=866

 Score =   134 bits (336),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MM +G K  +  +IF WKW GESSLT GLL DVPPEIELSDY R PS+GSESPSG L+GE
Sbjct  1    MMSTGQKGRNAFSIFNWKWCGESSLTRGLLSDVPPEIELSDYRRPPSSGSESPSGFLDGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
               +EPIADLDLFFERLY+Y+CEKGLWCIIIKWI ELL
Sbjct  61   GLKLEPIADLDLFFERLYNYYCEKGLWCIIIKWIVELL  98



>emb|CDY15410.1| BnaC04g42130D [Brassica napus]
Length=909

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 84/113 (74%), Gaps = 3/113 (3%)
 Frame = +3

Query  351  NGQAVLA*HQHI*MMFSGSKAAHGLNIFRWKWRGE--SSLTTGLLDDVPPEIELSDYHRA  524
            NG  VLA  Q + MM  G K  +  N F+W+ RGE  SSLTTGLLD+   EIELS+Y   
Sbjct  31   NGLVVLANCQSLRMMSGGQKPPNVFNFFKWQ-RGEPSSSLTTGLLDNASHEIELSNYGGV  89

Query  525  PSAGSESPSGLLNGESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            PS GSESPSGLLNGES +V+PIADLDLF E+LYSY+ +KGLWCII+KW  ELL
Sbjct  90   PSPGSESPSGLLNGESLNVQPIADLDLFVEKLYSYYRDKGLWCIIVKWAVELL  142



>ref|XP_006649742.1| PREDICTED: autophagy-related protein 9-like [Oryza brachyantha]
Length=893

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MM   SK  +    F W WR ES L+  LL D+PPEIELSDY R P +GSESPSGLL+GE
Sbjct  1    MMSFRSKDTNAQTQFNWPWRSESPLSAQLLIDIPPEIELSDYRRLPGSGSESPSGLLHGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
             F  EPIADLD+FFERLY Y C KGL CI+ KWI E+L 
Sbjct  61   GFKEEPIADLDIFFERLYEYFCAKGLRCIVTKWIIEMLN  99



>ref|XP_003558362.1| PREDICTED: autophagy-related protein 9 [Brachypodium distachyon]
Length=887

 Score =   128 bits (322),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MM    K  +   IF+W WR ES L+T LL D+PPEIELSDY R PS+G+ESPSGLL GE
Sbjct  1    MMSFPLKDTNSQTIFKWPWRSESPLSTQLLIDIPPEIELSDYRRLPSSGNESPSGLLRGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
                EPI+DLD+FFERLY Y C KGL CI+ KWI E L 
Sbjct  61   GIKEEPISDLDIFFERLYEYFCAKGLRCIVTKWIIEFLN  99



>ref|NP_001049553.1| Os03g0248000 [Oryza sativa Japonica Group]
 gb|ABF94961.1| Autophagy protein Apg9 containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11467.1| Os03g0248000 [Oryza sativa Japonica Group]
Length=902

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MM   SK  +    F W WR ES L+  LL D+PPEIELSDY R P +GSESPSGLL+GE
Sbjct  1    MMSFRSKDRNVQPRFNWPWRSESPLSAQLLIDIPPEIELSDYRRLPGSGSESPSGLLHGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
             F  EPIADLD+FFERLY Y C KGL CI+ KWI E+L 
Sbjct  61   GFKDEPIADLDIFFERLYEYFCAKGLRCIVTKWIIEMLN  99



>gb|AGW81798.1| autophagy-related protein 9b [Triticum aestivum]
Length=885

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MM   SK  +   +F+W WR ES L+  LL D+PPEIELSDY R PS+GSESPS LL+GE
Sbjct  1    MMSFPSKDTNSQTLFKWPWRRESPLSAQLLIDIPPEIELSDYRRLPSSGSESPSRLLDGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
                EPI DLD+FFERLY Y C KGL CII KWI E+L 
Sbjct  61   GVKEEPIPDLDIFFERLYEYFCTKGLRCIITKWIIEILN  99



>ref|XP_010510220.1| PREDICTED: autophagy-related protein 9-like [Camelina sativa]
Length=863

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 77/100 (77%), Gaps = 3/100 (3%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESS--LTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLN  563
            MM SG K  +  N F+W+ RGESS  LTTGLL +   EIELS+Y   PS GSESPSGLLN
Sbjct  1    MMSSGQKGPNVFNFFKWQ-RGESSSSLTTGLLHNESHEIELSNYGGIPSPGSESPSGLLN  59

Query  564  GESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            GES +V+PIADLDLF ERLYSY+ +KGLWCII+KW  ELL
Sbjct  60   GESLNVQPIADLDLFVERLYSYYRDKGLWCIIVKWAVELL  99



>ref|XP_009390295.1| PREDICTED: autophagy-related protein 9-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=878

 Score =   125 bits (315),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 58/98 (59%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MMFS  K     + ++ + R +  LTT LL DVPPEIELSDY + P +G+ESP+GLL+GE
Sbjct  1    MMFSSRKGLIAADRWKGQQRSDLPLTTKLLSDVPPEIELSDYGKLPDSGTESPTGLLDGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            +   E I DLD+FF RLYSY+CEKGLWCII KWI E+L
Sbjct  61   NLRAETIVDLDIFFRRLYSYYCEKGLWCIITKWIVEIL  98



>ref|XP_006293670.1| hypothetical protein CARUB_v10022626mg [Capsella rubella]
 gb|EOA26568.1| hypothetical protein CARUB_v10022626mg [Capsella rubella]
Length=853

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 77/101 (76%), Gaps = 3/101 (3%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESS--LTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLN  563
            MM SG K  +  N F+W+ RGESS  LTTGLL +   EIELS+Y   PS GSESPSGLLN
Sbjct  1    MMSSGQKGPNVFNFFKWQ-RGESSSSLTTGLLHNESHEIELSNYGGIPSPGSESPSGLLN  59

Query  564  GESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
            GES +V+PIADLDLF ERLYSY+ +KGLWCII+KW  ELL 
Sbjct  60   GESLNVQPIADLDLFVERLYSYYRDKGLWCIIVKWAVELLS  100



>ref|XP_009390303.1| PREDICTED: autophagy-related protein 9-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=834

 Score =   125 bits (315),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 58/98 (59%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MMFS  K     + ++ + R +  LTT LL DVPPEIELSDY + P +G+ESP+GLL+GE
Sbjct  1    MMFSSRKGLIAADRWKGQQRSDLPLTTKLLSDVPPEIELSDYGKLPDSGTESPTGLLDGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            +   E I DLD+FF RLYSY+CEKGLWCII KWI E+L
Sbjct  61   NLRAETIVDLDIFFRRLYSYYCEKGLWCIITKWIVEIL  98



>ref|XP_010414154.1| PREDICTED: autophagy-related protein 9-like isoform X1 [Camelina 
sativa]
 ref|XP_010414156.1| PREDICTED: autophagy-related protein 9-like isoform X2 [Camelina 
sativa]
 ref|XP_010414157.1| PREDICTED: autophagy-related protein 9-like isoform X1 [Camelina 
sativa]
 ref|XP_010414158.1| PREDICTED: autophagy-related protein 9-like isoform X1 [Camelina 
sativa]
 ref|XP_010414159.1| PREDICTED: autophagy-related protein 9-like isoform X1 [Camelina 
sativa]
 ref|XP_010414160.1| PREDICTED: autophagy-related protein 9-like isoform X3 [Camelina 
sativa]
Length=864

 Score =   125 bits (313),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 76/100 (76%), Gaps = 3/100 (3%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESS--LTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLN  563
            MM SG K  +  N F+W+ RGESS  LTTGLL     EIELS+Y   PS GSESPSGLLN
Sbjct  1    MMSSGQKGPNVFNFFKWQ-RGESSSSLTTGLLHHESHEIELSNYGGIPSPGSESPSGLLN  59

Query  564  GESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            GES +V+PIADLDLF ERLYSY+ +KGLWCII+KW  ELL
Sbjct  60   GESLNVQPIADLDLFVERLYSYYRDKGLWCIIVKWAVELL  99



>gb|AGW81797.1| autophagy-related protein 9a [Triticum aestivum]
Length=887

 Score =   125 bits (313),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 69/99 (70%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MM   SK  +   +F+W WR ES L+  LL D+PPEIELSDY R PS+GSESPS LL+GE
Sbjct  1    MMSFPSKDTNSQTLFKWPWRRESPLSAQLLIDIPPEIELSDYRRLPSSGSESPSRLLDGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
                EPI DLD+FFERLY Y C KGL CII  WI E+L 
Sbjct  61   GVKEEPIPDLDIFFERLYEYFCTKGLRCIITNWIIEILN  99



>ref|NP_850164.1| protein autophagy 9 [Arabidopsis thaliana]
 gb|AAL91630.1| At2g31260/F16D14.10 [Arabidopsis thaliana]
 dbj|BAB88386.1| autophagy 9 [Arabidopsis thaliana]
 gb|AAM20495.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15562.1| unknown protein [Arabidopsis thaliana]
 gb|AAN33191.1| At2g31260/F16D14.10 [Arabidopsis thaliana]
 gb|AEC08515.1| protein autophagy 9 [Arabidopsis thaliana]
Length=866

 Score =   125 bits (313),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 77/101 (76%), Gaps = 3/101 (3%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESS--LTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLN  563
            MM SG K  +  N F+W+ RGESS  LTTGLL +   EIELS+Y   PS GSESPSGLLN
Sbjct  1    MMSSGHKGPNVRNFFKWQ-RGESSSSLTTGLLHNESHEIELSNYGGIPSPGSESPSGLLN  59

Query  564  GESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
            GES +V+PIADLDLF ERLYSY+ +KGLWCII+KW  ELL 
Sbjct  60   GESLNVQPIADLDLFVERLYSYYRDKGLWCIIVKWAVELLS  100



>ref|XP_002881168.1| hypothetical protein ARALYDRAFT_482052 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57427.1| hypothetical protein ARALYDRAFT_482052 [Arabidopsis lyrata subsp. 
lyrata]
Length=863

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 77/101 (76%), Gaps = 3/101 (3%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESS--LTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLN  563
            MM SG K  +  N F+W+ RGESS  LTTGLL +   EIELS+Y   PS GSESPSGLLN
Sbjct  1    MMSSGHKGPNVRNFFKWQ-RGESSSSLTTGLLHNESHEIELSNYGGIPSPGSESPSGLLN  59

Query  564  GESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
            GES +V+PIADLDLF ERLYSY+ +KGLWCII+KW  ELL 
Sbjct  60   GESLNVQPIADLDLFVERLYSYYRDKGLWCIIVKWAVELLS  100



>gb|EEE58700.1| hypothetical protein OsJ_10136 [Oryza sativa Japonica Group]
Length=936

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +3

Query  432  FRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGESFSVEPIADLDLFF  611
            F W WR ES L+  LL D+PPEIELSDY R P +GSESPSGLL+GE F  EPIADLD+FF
Sbjct  14   FNWPWRSESPLSAQLLIDIPPEIELSDYRRLPGSGSESPSGLLHGEGFKDEPIADLDIFF  73

Query  612  ERLYSYHCEKGLWCIIIKWIFELLG  686
            ERLY Y C KGL CI+ KWI E+L 
Sbjct  74   ERLYEYFCAKGLRCIVTKWIIEMLN  98



>gb|EAY89256.1| hypothetical protein OsI_10753 [Oryza sativa Indica Group]
Length=936

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +3

Query  432  FRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGESFSVEPIADLDLFF  611
            F W WR ES L+  LL D+PPEIELSDY R P +GSESPSGLL+GE F  EPIADLD+FF
Sbjct  14   FNWPWRSESPLSAQLLIDIPPEIELSDYRRLPGSGSESPSGLLHGEGFKDEPIADLDIFF  73

Query  612  ERLYSYHCEKGLWCIIIKWIFELLG  686
            ERLY Y C KGL CI+ KWI E+L 
Sbjct  74   ERLYEYFCAKGLRCIVTKWIIEMLN  98



>ref|XP_004985007.1| PREDICTED: autophagy-related protein 9-like [Setaria italica]
Length=881

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 68/99 (69%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MM   SK  +    F W WR +S L+  LL D+PPEIEL DY R P +GSESPSGLL+GE
Sbjct  1    MMSFLSKDTNAQTRFNWPWRSQSPLSAQLLVDIPPEIELLDYRRLPGSGSESPSGLLHGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
             F  EPI DLD+FFERLY Y C KGL CII KWI E+L 
Sbjct  61   GFKDEPIPDLDIFFERLYEYFCAKGLRCIITKWIIEILN  99



>emb|CDY10782.1| BnaA05g11540D [Brassica napus]
Length=542

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 76/102 (75%), Gaps = 4/102 (4%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGE--SSLTTGLLDDVPPEIELSDYHRA-PSAGSESPSGLL  560
            MM +  KA +  N F+W+ R E  SSLTTGLLD+   EIELS+Y    PS GSESPSGLL
Sbjct  1    MMSTWQKAPNVFNFFKWQ-RTEPSSSLTTGLLDNASHEIELSNYGGVIPSPGSESPSGLL  59

Query  561  NGESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
            NGES +V+PI DLDLFFERLYSY+  KGLWCII+KW  ELL 
Sbjct  60   NGESLTVQPITDLDLFFERLYSYYRYKGLWCIIVKWAVELLS  101



>gb|ABG65924.1| Autophagy protein Apg9 containing protein, expressed [Oryza sativa 
Japonica Group]
Length=927

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 68/99 (69%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MM    K       F+W WRGES L+  LL D+PPEIELSDY R PS G+ESPSGLL+GE
Sbjct  1    MMSFLPKGKTTQTAFKWPWRGESQLSAHLLIDIPPEIELSDYRRLPSPGNESPSGLLHGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
             F  E I DLD+FFERLY Y C KGL CII KWI E+L 
Sbjct  61   DFKEEVIPDLDIFFERLYEYFCAKGLRCIITKWIIEILN  99



>ref|XP_009141144.1| PREDICTED: autophagy-related protein 9 [Brassica rapa]
Length=857

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 78/102 (76%), Gaps = 5/102 (5%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGE--SSLTTGLLDDVPPEIELSDYHRA--PSAGSESPSGL  557
            MM  G K  +  N F+W+ RGE  SSLTTGLLD+   EIELS+Y     PS GSESPSGL
Sbjct  1    MMSGGQKPPNVFNFFKWQ-RGEPSSSLTTGLLDNASHEIELSNYGGIGIPSPGSESPSGL  59

Query  558  LNGESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            LNGES +V+PIADLDLFFE+LYSY+ +KGLWCII+KW  ELL
Sbjct  60   LNGESLNVQPIADLDLFFEKLYSYYRDKGLWCIIVKWAVELL  101



>ref|XP_008647652.1| PREDICTED: uncharacterized protein LOC100502331 isoform X1 [Zea 
mays]
 tpg|DAA44377.1| TPA: autophagy protein 9 [Zea mays]
Length=888

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 67/99 (68%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MM   SK AH      W WR +S L+  LL D+PPEIELSDY R PS+ SESPSGLL+ E
Sbjct  1    MMSFRSKDAHAQTRLNWPWRSQSPLSAQLLVDIPPEIELSDYRRLPSSRSESPSGLLHDE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
                EPI DLD+FFERLY Y C KGL CII KWI E+L 
Sbjct  61   GVKEEPIPDLDIFFERLYEYFCAKGLRCIITKWIIEILN  99



>gb|EAZ00670.1| hypothetical protein OsI_22690 [Oryza sativa Indica Group]
Length=925

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = +3

Query  408  KAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGESFSVEP  587
            K       F+W WRGES L+  LL D+PPEIELSDY R PS G+ESPSGLL+GE F  E 
Sbjct  6    KGKTTQTAFKWPWRGESQLSAHLLIDIPPEIELSDYRRLPSPGNESPSGLLHGEDFKEEV  65

Query  588  IADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
            I DLD+FFERLY Y C KGL CII KWI E+L 
Sbjct  66   IPDLDIFFERLYEYFCAKGLRCIITKWIIEILN  98



>gb|EAZ24012.1| hypothetical protein OsJ_07737 [Oryza sativa Japonica Group]
Length=926

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = +3

Query  408  KAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGESFSVEP  587
            K       F+W WRGES L+  LL D+PPEIELSDY R PS G+ESPSGLL+GE F  E 
Sbjct  6    KGKTTQTAFKWPWRGESQLSAHLLIDIPPEIELSDYRRLPSPGNESPSGLLHGEDFKEEV  65

Query  588  IADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
            I DLD+FFERLY Y C KGL CII KWI E+L 
Sbjct  66   IPDLDIFFERLYEYFCAKGLRCIITKWIIEILN  98



>gb|AAD20671.1| unknown protein [Arabidopsis thaliana]
Length=865

 Score =   122 bits (307),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 76/100 (76%), Gaps = 3/100 (3%)
 Frame = +3

Query  393  MFSGSKAAHGLNIFRWKWRGESS--LTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNG  566
            M SG K  +  N F+W+ RGESS  LTTGLL +   EIELS+Y   PS GSESPSGLLNG
Sbjct  1    MSSGHKGPNVRNFFKWQ-RGESSSSLTTGLLHNESHEIELSNYGGIPSPGSESPSGLLNG  59

Query  567  ESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
            ES +V+PIADLDLF ERLYSY+ +KGLWCII+KW  ELL 
Sbjct  60   ESLNVQPIADLDLFVERLYSYYRDKGLWCIIVKWAVELLS  99



>ref|XP_006827497.2| PREDICTED: autophagy-related protein 9 [Amborella trichopoda]
Length=1011

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +3

Query  462  LTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGESFSVEPIADLDLFFERLYSYHCEK  641
            +T  LL DVPPEIELSDY R   A SESPSGLLNGES   EPIADLDLFFERLY+Y+CEK
Sbjct  1    MTERLLHDVPPEIELSDYQRLSDADSESPSGLLNGESLKAEPIADLDLFFERLYNYYCEK  60

Query  642  GLWCIIIKWIFELL  683
            GLWCII KWI ELL
Sbjct  61   GLWCIITKWIVELL  74



>ref|XP_008775955.1| PREDICTED: autophagy-related protein 9-like [Phoenix dactylifera]
 ref|XP_008775956.1| PREDICTED: autophagy-related protein 9-like [Phoenix dactylifera]
Length=872

 Score =   119 bits (298),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MM S  K A   + F+W WR ESSLTT LL + PPEIELSDY R PS+GSESPSGLLN E
Sbjct  1    MMTSAQKGAIAPSRFKWPWRSESSLTTQLLSETPPEIELSDYRRLPSSGSESPSGLLNDE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
                EPIADLDLFFERLY+Y+CEKGL CIIIKWI E+L 
Sbjct  61   GLKSEPIADLDLFFERLYNYYCEKGLRCIIIKWIVEILN  99



>ref|XP_006846402.1| PREDICTED: autophagy-related protein 9 [Amborella trichopoda]
 gb|ERN08077.1| hypothetical protein AMTR_s00012p00264860 [Amborella trichopoda]
Length=823

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 3/90 (3%)
 Frame = +3

Query  423  LNIFRWKW---RGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGESFSVEPIA  593
            L   RW W    G++S+T GLL D+PPEIELS+Y R PS  +E+P GLLN ES  VE + 
Sbjct  3    LGKIRWPWNVYHGDASVTKGLLSDIPPEIELSEYQRLPSGDTENPPGLLNDESLKVETVT  62

Query  594  DLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            DLDLF+ R+YSY+CEKGLWCI+ KWI E+L
Sbjct  63   DLDLFYSRVYSYYCEKGLWCIVTKWIVEIL  92



>ref|XP_010935753.1| PREDICTED: autophagy-related protein 9-like isoform X1 [Elaeis 
guineensis]
Length=871

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MMFS  K     + F+W+WR ES LT  ++DDVPPEIELS Y R PS+GSESPSGLLN E
Sbjct  1    MMFSARKGGKTSSRFKWQWRSESPLTAPMVDDVPPEIELSAYRRLPSSGSESPSGLLNDE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
                EPIADLDLFFER+Y+Y+CEKGL CII KWIFE+L 
Sbjct  61   GPKAEPIADLDLFFERMYNYYCEKGLTCIITKWIFEILS  99



>ref|XP_010935754.1| PREDICTED: autophagy-related protein 9-like isoform X2 [Elaeis 
guineensis]
Length=871

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            M  S  K     + F+W+WR ES LT  ++DDVPPEIELS Y R PS+GSESPSGLLN E
Sbjct  1    MTNSARKGGKTSSRFKWQWRSESPLTAPMVDDVPPEIELSAYRRLPSSGSESPSGLLNDE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
                EPIADLDLFFER+Y+Y+CEKGL CII KWIFE+L 
Sbjct  61   GPKAEPIADLDLFFERMYNYYCEKGLTCIITKWIFEILS  99



>ref|XP_009420448.1| PREDICTED: autophagy-related protein 9-like [Musa acuminata subsp. 
malaccensis]
Length=856

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +3

Query  411  AAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGESFSVEPI  590
            + H L+ F W WR +S LTT LLDD P ++ELS Y + P    +SPSGLLNGE  + EPI
Sbjct  3    SRHVLSRFEWPWRSKSPLTTQLLDDRPTDVELSVYSKLPGPDPDSPSGLLNGEELNTEPI  62

Query  591  ADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
             DLDLFF  LY+Y+CEKGL CI +KWI E+L 
Sbjct  63   VDLDLFFGSLYNYYCEKGLRCITLKWIVEILS  94



>ref|XP_004982580.1| PREDICTED: autophagy-related protein 9-like [Setaria italica]
Length=933

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 68/99 (69%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MM    KA +   + +W  R ES+L+T LL ++PPE+ELSDY R PS+  ESP+GLL+GE
Sbjct  1    MMSFLLKATNIKRLLKWPLRRESALSTHLLAEIPPEVELSDYRRLPSSYCESPTGLLHGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
                E + DLD+FFERLY Y C KGL CII KWI E+L 
Sbjct  61   DLKAELVPDLDIFFERLYEYFCAKGLRCIITKWIIEILN  99



>ref|XP_006410258.1| hypothetical protein EUTSA_v10016226mg [Eutrema salsugineum]
 gb|ESQ51711.1| hypothetical protein EUTSA_v10016226mg [Eutrema salsugineum]
Length=874

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 75/100 (75%), Gaps = 1/100 (1%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRW-KWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNG  566
            MM SG KA +  N  +W +    SSLT+GLL +   EIELS+Y   PS GSESPSGLLNG
Sbjct  1    MMSSGQKALNVFNFLKWQRSESSSSLTSGLLHNASHEIELSNYGGIPSPGSESPSGLLNG  60

Query  567  ESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
            ES +V+PIADLDLFFERLYSY+ +KGLWCII+KW  ELL 
Sbjct  61   ESLNVQPIADLDLFFERLYSYYRDKGLWCIIVKWAVELLS  100



>dbj|BAJ94790.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=894

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 71/99 (72%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MM   SK  +   +F+W WR ES L+  LL D+PPEIELSDY R PS+GSESPSGLL+GE
Sbjct  1    MMSFPSKDTNSQTVFKWPWRRESPLSAQLLIDIPPEIELSDYRRLPSSGSESPSGLLHGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
                EPI DLD+FFERLY Y C KGL CI+ KWI E+L 
Sbjct  61   GVKEEPIPDLDIFFERLYEYFCAKGLRCIVTKWIIEILN  99



>emb|CAJ30207.1| autophagy protein 9 [Hordeum vulgare]
Length=890

 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 71/99 (72%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MM   SK  +   +F+W WR ES L+  LL D+PPEIELSDY R PS+GSESPSGLL+GE
Sbjct  1    MMSFPSKDTNSQPVFKWPWRRESPLSAQLLIDIPPEIELSDYRRLPSSGSESPSGLLHGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
                EPI DLD+FFERLY Y C KGL CI+ KWI E+L 
Sbjct  61   GVKEEPIPDLDIFFERLYEYFCAKGLRCIVTKWIIEILN  99



>ref|XP_010469742.1| PREDICTED: autophagy-related protein 9-like [Camelina sativa]
Length=863

 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 76/101 (75%), Gaps = 3/101 (3%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESS--LTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLN  563
            MM SG K  +  N F+W+ RGESS  LTTGLL +   EIELS+Y    S GSESPSGLLN
Sbjct  1    MMSSGQKGPNVFNFFKWQ-RGESSSSLTTGLLHNESHEIELSNYGGISSPGSESPSGLLN  59

Query  564  GESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
            GES +V+PIADLDLF ERLYSY+ +KGLWCII+KW  ELL 
Sbjct  60   GESLNVQPIADLDLFVERLYSYYRDKGLWCIIVKWAVELLS  100



>emb|CAJ30212.1| autophagy protein 9 [Triticum aestivum]
Length=887

 Score =   105 bits (261),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 71/99 (72%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MM   +K  +   +F+W WR ES L+  LL D+PPEIELSDY R PS+GSESPSGLL+GE
Sbjct  1    MMSFPAKDTNSQTLFKWPWRRESPLSAQLLIDIPPEIELSDYRRLPSSGSESPSGLLHGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
                EPI DLD+FFERLY Y C KGL CI+ KWI E+L 
Sbjct  61   GVKEEPIPDLDIFFERLYEYFCAKGLRCIVTKWIIEILN  99



>gb|EMS60913.1| hypothetical protein TRIUR3_19436 [Triticum urartu]
Length=884

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = +3

Query  405  SKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGESFSVE  584
            SK  +   +F+W WR ES L+  LL D+PPEIELSDY R PS+GSESPSGLL+GE    E
Sbjct  5    SKDTNSQTLFKWPWRRESPLSAQLLIDIPPEIELSDYRRLPSSGSESPSGLLHGEGVKEE  64

Query  585  PIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
            PI DLD+FFERLY Y C KGL CI+ KWI E+L 
Sbjct  65   PIPDLDIFFERLYEYFCAKGLRCIVTKWIIEILN  98



>ref|XP_010238045.1| PREDICTED: autophagy-related protein 9-like [Brachypodium distachyon]
 ref|XP_010238046.1| PREDICTED: autophagy-related protein 9-like [Brachypodium distachyon]
 ref|XP_010238047.1| PREDICTED: autophagy-related protein 9-like [Brachypodium distachyon]
Length=937

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = +3

Query  393  MFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGES  572
            M S  K      +F+W WR +  L+  LL DVPP+IELSDY R PS+ SE+PS LL+GE 
Sbjct  1    MMSFLKGTPTQTVFKWPWRSQPQLSAHLLADVPPQIELSDYRRLPSSASETPSRLLHGED  60

Query  573  FSVEPIADLDLFFERLYSYHCEKGLWC  653
               + I DLD+FFERLY Y C KGL C
Sbjct  61   IKADLIPDLDIFFERLYEYFCAKGLRC  87



>ref|NP_001105821.1| autophagy protein 9 [Zea mays]
 emb|CAJ30214.1| autophagy protein 9 [Zea mays]
Length=889

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 66/99 (67%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MM   SK AH      W WR +S L+  LL D+PPEIELSDY R PS+ S SPSGLL+GE
Sbjct  1    MMSFRSKDAHAQTRLNWPWRSQSPLSAQLLVDIPPEIELSDYRRLPSSRSGSPSGLLHGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
                EPI + D+FFERLY Y C KGL CII KWI E+L 
Sbjct  61   GVKEEPIPERDIFFERLYEYFCAKGLRCIITKWIIEILN  99



>ref|XP_006661652.1| PREDICTED: autophagy-related protein 9-like [Oryza brachyantha]
Length=930

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MM    K    L+ F+W WRGES L+  L+D +P EIELSDY R PS G+ESPSGLL+GE
Sbjct  1    MMSFLPKGRTTLSEFKWPWRGESQLSAHLID-IPAEIELSDYRRLPSTGNESPSGLLHGE  59

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWC  653
              + + I DLD+FFER+Y Y C KGL C
Sbjct  60   DCNADVIPDLDIFFERIYEYFCAKGLRC  87



>ref|XP_002465557.1| hypothetical protein SORBIDRAFT_01g041090 [Sorghum bicolor]
 gb|EER92555.1| hypothetical protein SORBIDRAFT_01g041090 [Sorghum bicolor]
Length=888

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 67/99 (68%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MM   SK  H      W WR +S L+  LL D+PPEIELSDY R PS+GSESPSGLL+GE
Sbjct  1    MMSFLSKDTHAQTRLNWPWRSQSPLSAQLLVDIPPEIELSDYRRLPSSGSESPSGLLHGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
                E I DLD+FFERLY Y C KGL CII KWI E+L 
Sbjct  61   GIKEEHIPDLDIFFERLYEYFCAKGLRCIITKWIIEVLN  99



>emb|CAJ30210.1| autophagy protein 9 [Sorghum bicolor]
Length=888

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 67/99 (68%), Gaps = 0/99 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MM   SK  H      W WR +S L+  LL D+PPEIELSDY R PS+GSESPSGLL+GE
Sbjct  1    MMSFLSKDTHAQTRLNWPWRSQSPLSAQLLVDIPPEIELSDYRRLPSSGSESPSGLLHGE  60

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
                E I DLD+FFERLY Y C KGL CII KWI E+L 
Sbjct  61   GIKEEHIPDLDIFFERLYEYFCAKGLRCIITKWIIEVLN  99



>emb|CAJ30211.1| autophagy protein 9 [Saccharum officinarum]
Length=896

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = +3

Query  405  SKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGESFSVE  584
            SK  H      W WR +S L+  LL D+PPEIELSDY R PS+GSESPSGLL+GE    E
Sbjct  13   SKDTHAQTRLNWPWRSQSPLSAQLLVDIPPEIELSDYRRLPSSGSESPSGLLHGEGVKEE  72

Query  585  PIADLDLFFERLYSYHCEKGLWCIIIKWIFELLG  686
             I DLD+FFERLY Y C KGL CII KWI E+L 
Sbjct  73   HIPDLDIFFERLYEYFCAKGLRCIITKWIIEVLS  106



>ref|XP_002466932.1| hypothetical protein SORBIDRAFT_01g016890 [Sorghum bicolor]
 gb|EER93930.1| hypothetical protein SORBIDRAFT_01g016890 [Sorghum bicolor]
Length=958

 Score = 96.3 bits (238),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAPSAGSESPSGLLNGE  569
            MM    K  +   +F+W  R ES+L+T LL ++ PE+ELSDY R PS+  ESP+GLL+GE
Sbjct  32   MMSFFLKGTNIKRLFKWPLRRESTLSTHLLAEILPEVELSDYRRLPSSYCESPTGLLHGE  91

Query  570  SFSVEPIADLDLFFERLYSYHCEKGLWCI  656
             F  E I DLD+FFERLY Y C KGL CI
Sbjct  92   YFKAELIPDLDIFFERLYEYFCAKGLRCI  120



>ref|XP_008787388.1| PREDICTED: autophagy-related protein 9-like [Phoenix dactylifera]
Length=842

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  474  LLDDVPPEIELSDYHRAPSAGSESPSGLLNGESFSVEPIADLDLFFERLYSYHCEKGLWC  653
            ++DDVPPEIELS Y R PS+GSESPSGLLN E    EPIADLDLFF+RLY+Y+CEKGL C
Sbjct  1    MVDDVPPEIELSAYQRLPSSGSESPSGLLNDEGPKAEPIADLDLFFDRLYNYYCEKGLSC  60

Query  654  IIIKWIFELLG  686
            II+KWIFE+L 
Sbjct  61   IIVKWIFEILS  71



>emb|CDY24745.1| BnaC04g13500D [Brassica napus]
Length=273

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  498  IELSDYHRAPSAGSESPSGLLNGESFSVEPIADLDLFFERLYSYHCEKGLWCII  659
            IELS+    PS G E+PSGL NGES +V+PI+DLDLFFERLYSY+ +KGLWCII
Sbjct  35   IELSNCGEVPSPGRENPSGLFNGESLTVQPISDLDLFFERLYSYYIDKGLWCII  88



>gb|KJB25993.1| hypothetical protein B456_004G220200 [Gossypium raimondii]
Length=704

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 41/54 (76%), Gaps = 1/54 (2%)
 Frame = +3

Query  390  MMFSGSKAAHGLNIFRWKWRGESSLTTGLLDDVPPEIELSDYHRAP-SAGSESP  548
            MMF G +AA+ L +FR +W GESSLTTGLL DVPPEIELSDY R P S  SE P
Sbjct  1    MMFWGQRAANALGMFRLRWGGESSLTTGLLGDVPPEIELSDYGRLPASPRSECP  54



>ref|XP_001762984.1| predicted protein [Physcomitrella patens]
 gb|EDQ72189.1| predicted protein, partial [Physcomitrella patens]
Length=585

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = +3

Query  495  EIELSDYHRAPSA-GSESPSGLLNGESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWI  671
            E+EL +YHR      +E P     GE+     + DLD FF+R+Y Y+C+KG WCI I+W+
Sbjct  1    EVELPEYHRLHGGEDAEGPPDFFRGETSKWGAVTDLDEFFQRVYQYYCDKGFWCIFIQWL  60

Query  672  FEL  680
             EL
Sbjct  61   CEL  63



>ref|XP_001778713.1| predicted protein [Physcomitrella patens]
 gb|EDQ56506.1| predicted protein, partial [Physcomitrella patens]
Length=593

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 39/70 (56%), Gaps = 1/70 (1%)
 Frame = +3

Query  477  LDDVPPEIELSDYHRAPSA-GSESPSGLLNGESFSVEPIADLDLFFERLYSYHCEKGLWC  653
            L  V  E+EL DYH       S  P      E+F    + DLD FF+R+Y Y+C+KG WC
Sbjct  8    LRGVQHEVELPDYHELHGGEDSAGPPDFFGAETFKSGGVTDLDEFFQRVYQYYCDKGFWC  67

Query  654  IIIKWIFELL  683
            +  KW+ EL+
Sbjct  68   MFTKWLCELV  77



>ref|XP_002982911.1| hypothetical protein SELMODRAFT_50960, partial [Selaginella moellendorffii]
 gb|EFJ16156.1| hypothetical protein SELMODRAFT_50960, partial [Selaginella moellendorffii]
Length=570

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  525  PSAGSESPSGLLNGESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            P   S SP   +  ES   + ++DLD FF RLY YH E+G WCI+ +W+ ELL
Sbjct  3    PGDDSSSPVDFMKEESLKFDAVSDLDRFFVRLYEYHREQGFWCIVTQWVLELL  55



>ref|XP_002981932.1| hypothetical protein SELMODRAFT_50959, partial [Selaginella moellendorffii]
 gb|EFJ17025.1| hypothetical protein SELMODRAFT_50959, partial [Selaginella moellendorffii]
Length=570

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  525  PSAGSESPSGLLNGESFSVEPIADLDLFFERLYSYHCEKGLWCIIIKWIFELL  683
            P   S SP   +  ES   + ++DLD FF RLY YH E+G WCI+ +W+ ELL
Sbjct  3    PGDDSSSPVDFMKEESLKFDAVSDLDRFFVRLYEYHREQGFWCIVTQWVLELL  55



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1175390270628