BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3745

Length=1056
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001274713.1|  leucine-rich repeat receptor-like serine/thr...    379   8e-119   Solanum lycopersicum
dbj|BAK52389.1|  leucine rich repeat receptor protein kinase CLAV...    378   2e-118   Solanum pennellii
ref|XP_006357743.1|  PREDICTED: leucine-rich repeat receptor-like...    377   3e-118   Solanum tuberosum [potatoes]
dbj|BAK52390.1|  leucine rich repeat receptor protein kinase CLAV...    376   9e-118   Solanum peruvianum [Peruvian tomato]
ref|XP_009613990.1|  PREDICTED: leucine-rich repeat receptor-like...    371   1e-115   Nicotiana tomentosiformis
ref|XP_011073654.1|  PREDICTED: leucine-rich repeat receptor-like...    370   1e-115   Sesamum indicum [beniseed]
emb|CDP02660.1|  unnamed protein product                                370   3e-115   Coffea canephora [robusta coffee]
ref|XP_011099433.1|  PREDICTED: leucine-rich repeat receptor-like...    369   4e-115   Sesamum indicum [beniseed]
ref|XP_009786199.1|  PREDICTED: leucine-rich repeat receptor-like...    367   2e-114   Nicotiana sylvestris
ref|XP_009771232.1|  PREDICTED: leucine-rich repeat receptor-like...    367   5e-114   Nicotiana sylvestris
ref|XP_009605676.1|  PREDICTED: leucine-rich repeat receptor-like...    362   2e-112   Nicotiana tomentosiformis
ref|XP_008344369.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    360   1e-111   
ref|XP_006364007.1|  PREDICTED: leucine-rich repeat receptor-like...    360   2e-111   Solanum tuberosum [potatoes]
ref|XP_009375880.1|  PREDICTED: leucine-rich repeat receptor-like...    359   2e-111   Pyrus x bretschneideri [bai li]
ref|XP_009354585.1|  PREDICTED: leucine-rich repeat receptor-like...    359   3e-111   Pyrus x bretschneideri [bai li]
ref|XP_008354741.1|  PREDICTED: leucine-rich repeat receptor-like...    356   3e-110   
ref|XP_004234641.1|  PREDICTED: leucine-rich repeat receptor-like...    356   5e-110   Solanum lycopersicum
gb|EYU41357.1|  hypothetical protein MIMGU_mgv1a000718mg                355   8e-110   Erythranthe guttata [common monkey flower]
ref|XP_008393812.1|  PREDICTED: leucine-rich repeat receptor-like...    354   2e-109   
gb|AIT56194.1|  leucine-rich repeat receptor-like serine/threonin...    352   2e-108   Dimocarpus longan [longan]
ref|XP_010271550.1|  PREDICTED: leucine-rich repeat receptor-like...    351   5e-108   Nelumbo nucifera [Indian lotus]
ref|XP_007208421.1|  hypothetical protein PRUPE_ppa000739mg             350   5e-108   Prunus persica
ref|XP_010268646.1|  PREDICTED: leucine-rich repeat receptor-like...    348   4e-107   Nelumbo nucifera [Indian lotus]
gb|KDO78771.1|  hypothetical protein CISIN_1g001816mg                   348   5e-107   Citrus sinensis [apfelsine]
ref|XP_006426178.1|  hypothetical protein CICLE_v10024796mg             348   5e-107   Citrus clementina [clementine]
ref|XP_006466390.1|  PREDICTED: leucine-rich repeat receptor-like...    347   7e-107   Citrus sinensis [apfelsine]
ref|XP_010105101.1|  Leucine-rich repeat receptor-like serine/thr...    347   2e-106   Morus notabilis
ref|XP_002875982.1|  hypothetical protein ARALYDRAFT_906265             344   8e-106   Arabidopsis lyrata subsp. lyrata
ref|XP_004288299.1|  PREDICTED: leucine-rich repeat receptor-like...    342   8e-105   Fragaria vesca subsp. vesca
emb|CBI35733.3|  unnamed protein product                                340   1e-104   Vitis vinifera
ref|XP_003635561.1|  PREDICTED: leucine-rich repeat receptor-like...    340   4e-104   Vitis vinifera
gb|KHG04200.1|  Leucine-rich repeat receptor-like serine/threonin...    338   1e-103   Gossypium arboreum [tree cotton]
gb|KJB18115.1|  hypothetical protein B456_003G034500                    338   2e-103   Gossypium raimondii
ref|NP_190536.1|  CLAVATA1-related receptor kinase-like protein         338   2e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004509039.1|  PREDICTED: leucine-rich repeat receptor-like...    338   2e-103   Cicer arietinum [garbanzo]
ref|XP_006404116.1|  hypothetical protein EUTSA_v10010092mg             338   3e-103   
ref|XP_002310320.2|  hypothetical protein POPTR_0007s14500g             338   3e-103   Populus trichocarpa [western balsam poplar]
ref|NP_001235080.1|  receptor-like protein kinase 3 precursor           337   8e-103   
ref|XP_010028033.1|  PREDICTED: leucine-rich repeat receptor-like...    336   2e-102   Eucalyptus grandis [rose gum]
ref|XP_010683073.1|  PREDICTED: leucine-rich repeat receptor-like...    335   2e-102   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK34238.1|  hypothetical protein AALP_AA5G119100                    335   2e-102   Arabis alpina [alpine rockcress]
ref|XP_006290548.1|  hypothetical protein CARUB_v10016631mg             335   2e-102   Capsella rubella
gb|KJB48795.1|  hypothetical protein B456_008G087500                    334   8e-102   Gossypium raimondii
gb|EPS74129.1|  hypothetical protein M569_00625                         333   9e-102   Genlisea aurea
gb|KHG03710.1|  Leucine-rich repeat receptor-like serine/threonin...    332   4e-101   Gossypium arboreum [tree cotton]
gb|KJB18113.1|  hypothetical protein B456_003G034400                    332   4e-101   Gossypium raimondii
ref|XP_007047661.1|  Leucine-rich receptor-like protein kinase fa...    332   6e-101   
ref|XP_011021820.1|  PREDICTED: leucine-rich repeat receptor-like...    332   6e-101   Populus euphratica
ref|XP_010515326.1|  PREDICTED: leucine-rich repeat receptor-like...    330   2e-100   Camelina sativa [gold-of-pleasure]
ref|NP_001237715.1|  receptor-like protein kinase 2 precursor           330   2e-100   Glycine max [soybeans]
ref|XP_010426489.1|  PREDICTED: leucine-rich repeat receptor-like...    328   9e-100   Camelina sativa [gold-of-pleasure]
ref|XP_002864974.1|  hypothetical protein ARALYDRAFT_496807             328   9e-100   
ref|XP_010547579.1|  PREDICTED: leucine-rich repeat receptor-like...    328   1e-99    Tarenaya hassleriana [spider flower]
ref|NP_201371.1|  leucine-rich repeat receptor-like serine/threon...    327   3e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006393995.1|  hypothetical protein EUTSA_v10003584mg             327   4e-99    
ref|XP_004511796.1|  PREDICTED: leucine-rich repeat receptor-like...    327   4e-99    
ref|XP_007155783.1|  hypothetical protein PHAVU_003G231400g             327   4e-99    Phaseolus vulgaris [French bean]
ref|XP_004143422.1|  PREDICTED: leucine-rich repeat receptor-like...    327   5e-99    Cucumis sativus [cucumbers]
ref|XP_010484412.1|  PREDICTED: leucine-rich repeat receptor-like...    326   6e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010444585.1|  PREDICTED: leucine-rich repeat receptor-like...    326   7e-99    Camelina sativa [gold-of-pleasure]
ref|XP_012079496.1|  PREDICTED: leucine-rich repeat receptor-like...    325   1e-98    Jatropha curcas
ref|XP_010463501.1|  PREDICTED: leucine-rich repeat receptor-like...    325   2e-98    Camelina sativa [gold-of-pleasure]
ref|XP_006279943.1|  hypothetical protein CARUB_v10025808mg             324   4e-98    Capsella rubella
ref|XP_009150662.1|  PREDICTED: leucine-rich repeat receptor-like...    323   7e-98    Brassica rapa
ref|XP_010503631.1|  PREDICTED: leucine-rich repeat receptor-like...    323   9e-98    Camelina sativa [gold-of-pleasure]
ref|NP_001235065.1|  receptor-like protein kinase 1 precursor           322   2e-97    Glycine max [soybeans]
gb|KFK28239.1|  hypothetical protein AALP_AA8G490400                    322   2e-97    Arabis alpina [alpine rockcress]
ref|XP_002531999.1|  Receptor protein kinase CLAVATA1 precursor, ...    319   2e-96    Ricinus communis
ref|NP_001237688.1|  receptor-like protein kinase precursor             317   2e-95    Glycine max [soybeans]
ref|XP_010939309.1|  PREDICTED: leucine-rich repeat receptor-like...    316   4e-95    Elaeis guineensis
ref|XP_009136515.1|  PREDICTED: leucine-rich repeat receptor-like...    314   1e-94    Brassica rapa
ref|XP_010518800.1|  PREDICTED: leucine-rich repeat receptor-like...    314   2e-94    Tarenaya hassleriana [spider flower]
ref|XP_008441113.1|  PREDICTED: leucine-rich repeat receptor-like...    311   2e-93    Cucumis melo [Oriental melon]
gb|AES94465.2|  LRR receptor-like kinase family protein                 310   7e-93    Medicago truncatula
ref|XP_008237309.1|  PREDICTED: leucine-rich repeat receptor-like...    308   1e-92    
ref|XP_008787359.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    309   1e-92    
ref|XP_003611507.1|  Receptor-like protein kinase                       310   2e-92    
ref|XP_008790445.1|  PREDICTED: leucine-rich repeat receptor-like...    306   1e-91    Phoenix dactylifera
ref|XP_009397330.1|  PREDICTED: leucine-rich repeat receptor-like...    305   4e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003608587.1|  Receptor-like protein kinase                       305   6e-91    Medicago truncatula
ref|XP_010941985.1|  PREDICTED: leucine-rich repeat receptor-like...    303   2e-90    Elaeis guineensis
emb|CDY08759.1|  BnaA06g24650D                                          301   6e-90    Brassica napus [oilseed rape]
ref|XP_009394785.1|  PREDICTED: leucine-rich repeat receptor-like...    301   7e-90    
ref|XP_010936307.1|  PREDICTED: leucine-rich repeat receptor-like...    301   9e-90    
ref|XP_007156674.1|  hypothetical protein PHAVU_002G007600g             301   2e-89    Phaseolus vulgaris [French bean]
ref|XP_009395647.1|  PREDICTED: leucine-rich repeat receptor-like...    296   6e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011626372.1|  PREDICTED: leucine-rich repeat receptor-like...    293   4e-87    
ref|XP_006852730.1|  PREDICTED: leucine-rich repeat receptor-like...    294   6e-87    
ref|XP_009408581.1|  PREDICTED: leucine-rich repeat receptor-like...    293   9e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009394620.1|  PREDICTED: leucine-rich repeat receptor-like...    293   1e-86    Musa acuminata subsp. malaccensis [pisang utan]
gb|ADB85326.1|  putative receptor protein kinase                        274   1e-86    Phyllostachys edulis [kikko-chiku]
ref|XP_008665503.1|  PREDICTED: leucine-rich repeat receptor-like...    290   2e-85    Zea mays [maize]
ref|XP_002466378.1|  hypothetical protein SORBIDRAFT_01g006690          289   5e-85    Sorghum bicolor [broomcorn]
ref|XP_006650665.1|  PREDICTED: leucine-rich repeat receptor-like...    287   1e-84    Oryza brachyantha
ref|XP_004981595.1|  PREDICTED: leucine-rich repeat receptor-like...    287   1e-84    Setaria italica
emb|CDY02112.1|  BnaA03g40550D                                          286   2e-84    
ref|XP_009396449.1|  PREDICTED: leucine-rich repeat receptor-like...    286   2e-84    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY23037.1|  BnaC07g31500D                                          283   2e-83    Brassica napus [oilseed rape]
ref|NP_001058840.2|  Os07g0134200                                       282   2e-83    
dbj|BAJ84911.1|  predicted protein                                      283   5e-83    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAC82955.1|  putative OsLRK1(receptor-type protein kinase)          282   1e-82    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ02682.1|  hypothetical protein OsI_24796                          282   1e-82    Oryza sativa Indica Group [Indian rice]
ref|XP_004955422.1|  PREDICTED: leucine-rich repeat receptor-like...    280   5e-82    
ref|XP_009411355.1|  PREDICTED: leucine-rich repeat receptor-like...    279   1e-81    Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA59489.1|  TPA: putative leucine-rich repeat receptor-like ...    280   1e-81    
emb|CDY45620.1|  BnaCnng13280D                                          277   5e-81    Brassica napus [oilseed rape]
ref|XP_008787754.1|  PREDICTED: leucine-rich repeat receptor-like...    276   1e-80    Phoenix dactylifera
gb|ABF99108.1|  Receptor protein kinase CLAVATA1 precursor, putat...    273   1e-80    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010943209.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    276   2e-80    
gb|EAY92008.1|  hypothetical protein OsI_13698                          274   8e-80    Oryza sativa Indica Group [Indian rice]
gb|AAP68887.1|  putative receptor-like protein kinase 1                 274   9e-80    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002461427.1|  hypothetical protein SORBIDRAFT_02g002450          274   1e-79    Sorghum bicolor [broomcorn]
gb|EEE60014.1|  hypothetical protein OsJ_12761                          272   3e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003558681.1|  PREDICTED: leucine-rich repeat receptor-like...    269   8e-78    Brachypodium distachyon [annual false brome]
ref|XP_009399076.1|  PREDICTED: leucine-rich repeat receptor-like...    266   6e-77    Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ89729.1|  predicted protein                                      265   2e-76    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006853709.1|  PREDICTED: leucine-rich repeat receptor-like...    263   2e-76    Amborella trichopoda
ref|XP_008440463.1|  PREDICTED: leucine-rich repeat receptor-like...    259   2e-74    Cucumis melo [Oriental melon]
ref|XP_004143533.1|  PREDICTED: leucine-rich repeat receptor-like...    257   7e-74    Cucumis sativus [cucumbers]
ref|XP_003557615.1|  PREDICTED: leucine-rich repeat receptor-like...    252   5e-72    Brachypodium distachyon [annual false brome]
ref|XP_009418700.1|  PREDICTED: leucine-rich repeat receptor-like...    251   2e-71    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAF73373.1|AF193835_1  LRK1 protein                                  249   5e-71    Oryza sativa [red rice]
ref|XP_004295533.1|  PREDICTED: leucine-rich repeat receptor-like...    247   4e-70    Fragaria vesca subsp. vesca
ref|XP_007214567.1|  hypothetical protein PRUPE_ppa000837mg             246   5e-70    Prunus persica
gb|AHJ14779.1|  CLAVATA1                                                246   9e-70    Rhododendron ovatum
ref|XP_010260843.1|  PREDICTED: leucine-rich repeat receptor-like...    244   3e-69    Nelumbo nucifera [Indian lotus]
ref|XP_009405747.1|  PREDICTED: leucine-rich repeat receptor-like...    243   1e-68    
ref|XP_009415746.1|  PREDICTED: leucine-rich repeat receptor-like...    243   1e-68    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008225951.1|  PREDICTED: leucine-rich repeat receptor-like...    243   1e-68    Prunus mume [ume]
ref|XP_002985227.1|  hypothetical protein SELMODRAFT_121783             242   2e-68    
ref|XP_011004294.1|  PREDICTED: leucine-rich repeat receptor-like...    241   4e-68    Populus euphratica
ref|XP_008808401.1|  PREDICTED: leucine-rich repeat receptor-like...    241   4e-68    Phoenix dactylifera
ref|XP_002264952.1|  PREDICTED: leucine-rich repeat receptor-like...    241   4e-68    Vitis vinifera
ref|XP_011004295.1|  PREDICTED: leucine-rich repeat receptor-like...    240   4e-68    Populus euphratica
ref|XP_007040964.1|  Leucine-rich receptor-like protein kinase fa...    239   1e-67    
ref|XP_006448558.1|  hypothetical protein CICLE_v10014145mg             238   5e-67    Citrus clementina [clementine]
emb|CDP04113.1|  unnamed protein product                                238   7e-67    Coffea canephora [robusta coffee]
ref|XP_008357152.1|  PREDICTED: receptor protein kinase CLAVATA1-...    236   7e-67    
ref|XP_009393965.1|  PREDICTED: leucine-rich repeat receptor-like...    233   8e-67    
ref|XP_002304615.1|  leucine-rich repeat transmembrane protein ki...    237   1e-66    Populus trichocarpa [western balsam poplar]
ref|XP_011022287.1|  PREDICTED: leucine-rich repeat receptor-like...    236   1e-66    Populus euphratica
ref|XP_008364929.1|  PREDICTED: receptor protein kinase CLAVATA1-...    236   1e-66    
ref|XP_004960969.1|  PREDICTED: leucine-rich repeat receptor-like...    236   2e-66    Setaria italica
ref|XP_002297907.2|  leucine-rich repeat transmembrane protein ki...    235   4e-66    Populus trichocarpa [western balsam poplar]
ref|XP_001754727.1|  CLL1A clavata1-like receptor S/T protein kin...    235   4e-66    
ref|XP_003530709.1|  PREDICTED: leucine-rich repeat receptor-like...    235   5e-66    Glycine max [soybeans]
ref|XP_008793129.1|  PREDICTED: leucine-rich repeat receptor-like...    234   1e-65    
ref|XP_004499483.1|  PREDICTED: leucine-rich repeat receptor-like...    234   1e-65    Cicer arietinum [garbanzo]
gb|KEH33614.1|  LRR receptor-like kinase family protein                 234   1e-65    Medicago truncatula
ref|XP_001752668.1|  CLL1B clavata1-like receptor S/T protein kin...    234   1e-65    
ref|XP_010266811.1|  PREDICTED: receptor protein kinase CLAVATA1        234   1e-65    
ref|XP_006468613.1|  PREDICTED: leucine-rich repeat receptor-like...    233   1e-65    Citrus sinensis [apfelsine]
ref|XP_006468612.1|  PREDICTED: leucine-rich repeat receptor-like...    234   1e-65    Citrus sinensis [apfelsine]
ref|XP_008356104.1|  PREDICTED: leucine-rich repeat receptor-like...    233   2e-65    
ref|XP_010228930.1|  PREDICTED: leucine-rich repeat receptor-like...    233   2e-65    
ref|XP_004985112.1|  PREDICTED: leucine-rich repeat receptor-like...    233   4e-65    Setaria italica
ref|XP_011628818.1|  PREDICTED: leucine-rich repeat receptor-like...    232   6e-65    
dbj|BAJ99137.1|  predicted protein                                      232   7e-65    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009108464.1|  PREDICTED: leucine-rich repeat receptor-like...    232   7e-65    Brassica rapa
ref|XP_002970036.1|  hypothetical protein SELMODRAFT_146738             231   9e-65    
ref|XP_011045060.1|  PREDICTED: receptor protein kinase CLAVATA1-...    231   9e-65    Populus euphratica
ref|XP_008808621.1|  PREDICTED: leucine-rich repeat receptor-like...    231   1e-64    
ref|XP_006649672.1|  PREDICTED: leucine-rich repeat receptor-like...    231   1e-64    Oryza brachyantha
ref|XP_008799579.1|  PREDICTED: leucine-rich repeat receptor-like...    231   2e-64    Phoenix dactylifera
ref|XP_010935096.1|  PREDICTED: leucine-rich repeat receptor-like...    231   2e-64    Elaeis guineensis
ref|XP_007017845.1|  Leucine-rich receptor-like protein kinase fa...    230   2e-64    
ref|XP_007146301.1|  hypothetical protein PHAVU_006G029000g             230   3e-64    Phaseolus vulgaris [French bean]
ref|XP_002307734.1|  receptor protein kinase                            229   4e-64    Populus trichocarpa [western balsam poplar]
ref|XP_012073772.1|  PREDICTED: receptor protein kinase CLAVATA1        229   5e-64    Jatropha curcas
ref|XP_006856744.2|  PREDICTED: receptor protein kinase CLAVATA1        229   6e-64    
gb|ERN18211.1|  hypothetical protein AMTR_s00055p00012250               229   8e-64    Amborella trichopoda
ref|XP_002510557.1|  Receptor protein kinase CLAVATA1 precursor, ...    228   1e-63    
ref|XP_010918071.1|  PREDICTED: leucine-rich repeat receptor-like...    228   2e-63    Elaeis guineensis
ref|XP_003545159.1|  PREDICTED: leucine-rich repeat receptor-like...    228   2e-63    Glycine max [soybeans]
ref|XP_002532709.1|  Receptor protein kinase CLAVATA1 precursor, ...    227   3e-63    Ricinus communis
ref|XP_002971751.1|  hypothetical protein SELMODRAFT_172284             227   3e-63    
ref|XP_002991545.1|  hypothetical protein SELMODRAFT_186143             227   3e-63    
tpg|DAA44225.1|  TPA: putative leucine-rich repeat receptor-like ...    227   4e-63    
ref|XP_009334873.1|  PREDICTED: receptor protein kinase CLAVATA1        227   4e-63    Pyrus x bretschneideri [bai li]
ref|XP_006602289.1|  PREDICTED: leucine-rich repeat receptor-like...    226   5e-63    Glycine max [soybeans]
ref|XP_010471715.1|  PREDICTED: receptor protein kinase CLAVATA1 ...    226   6e-63    
ref|XP_006283067.1|  hypothetical protein CARUB_v10004060mg             226   9e-63    Capsella rubella
emb|CDX87661.1|  BnaA07g32120D                                          226   1e-62    
ref|XP_004291349.1|  PREDICTED: receptor protein kinase CLAVATA1        225   1e-62    Fragaria vesca subsp. vesca
ref|XP_006300675.1|  hypothetical protein CARUB_v10019714mg             225   1e-62    Capsella rubella
ref|XP_008647501.1|  PREDICTED: uncharacterized LOC100272700 isof...    226   2e-62    Zea mays [maize]
emb|CDX73202.1|  BnaC06g36500D                                          225   2e-62    
ref|XP_002526451.1|  Receptor protein kinase CLAVATA1 precursor, ...    225   2e-62    Ricinus communis
ref|XP_008647500.1|  PREDICTED: uncharacterized LOC100272700 isof...    226   2e-62    
ref|XP_010428620.1|  PREDICTED: receptor protein kinase CLAVATA1-...    225   2e-62    Camelina sativa [gold-of-pleasure]
ref|XP_008647502.1|  PREDICTED: uncharacterized LOC100272700 isof...    226   3e-62    
ref|XP_009106236.1|  PREDICTED: receptor protein kinase CLAVATA1        224   3e-62    Brassica rapa
ref|XP_006655663.1|  PREDICTED: leucine-rich repeat receptor-like...    224   3e-62    Oryza brachyantha
gb|EEC79804.1|  hypothetical protein OsI_21242                          224   4e-62    Oryza sativa Indica Group [Indian rice]
ref|NP_001051418.1|  Os03g0773700                                       223   5e-62    
ref|XP_009415217.1|  PREDICTED: leucine-rich repeat receptor-like...    224   5e-62    
ref|XP_010924539.1|  PREDICTED: leucine-rich repeat receptor-like...    223   6e-62    Elaeis guineensis
gb|KJB32927.1|  hypothetical protein B456_005G268400                    223   6e-62    Gossypium raimondii
ref|XP_009415213.1|  PREDICTED: leucine-rich repeat receptor-like...    223   6e-62    
ref|XP_006858565.2|  PREDICTED: leucine-rich repeat receptor-like...    223   7e-62    Amborella trichopoda
ref|NP_001174552.1|  Os05g0595950                                       223   8e-62    
gb|KHN38370.1|  Leucine-rich repeat receptor-like serine/threonin...    223   8e-62    Glycine soja [wild soybean]
gb|AAP49010.1|  CLV1-like receptor kinase                               223   9e-62    Brassica napus [oilseed rape]
ref|XP_010416487.1|  PREDICTED: receptor protein kinase CLAVATA1-...    223   1e-61    Camelina sativa [gold-of-pleasure]
ref|XP_010110004.1|  Receptor protein kinase CLAVATA1                   223   1e-61    
ref|XP_006473681.1|  PREDICTED: receptor protein kinase CLAVATA1-...    223   1e-61    Citrus sinensis [apfelsine]
gb|ADD64789.1|  CLAVATA1                                                223   1e-61    Brassica napus [oilseed rape]
emb|CBI29704.3|  unnamed protein product                                223   1e-61    Vitis vinifera
ref|XP_003518489.2|  PREDICTED: leucine-rich repeat receptor-like...    223   1e-61    
ref|XP_009368577.1|  PREDICTED: leucine-rich repeat receptor-like...    223   1e-61    Pyrus x bretschneideri [bai li]
ref|XP_002263291.2|  PREDICTED: leucine-rich repeat receptor-like...    223   1e-61    Vitis vinifera
emb|CAN71863.1|  hypothetical protein VITISV_023530                     222   1e-61    Vitis vinifera
ref|XP_010246813.1|  PREDICTED: receptor protein kinase CLAVATA1-...    222   2e-61    Nelumbo nucifera [Indian lotus]
gb|AAM27467.1|AC099732_4  Putative receptor-like protein kinase         222   2e-61    Oryza sativa Japonica Group [Japonica rice]
gb|KHG23359.1|  Leucine-rich repeat receptor-like serine/threonin...    222   2e-61    Gossypium arboreum [tree cotton]
ref|NP_001049453.1|  Os03g0228800                                       222   2e-61    
gb|EEC74807.1|  hypothetical protein OsI_10619                          222   3e-61    Oryza sativa Indica Group [Indian rice]
ref|XP_011092305.1|  PREDICTED: leucine-rich repeat receptor-like...    222   3e-61    Sesamum indicum [beniseed]
gb|KDO84901.1|  hypothetical protein CISIN_1g002010mg                   221   3e-61    Citrus sinensis [apfelsine]
ref|XP_006390268.1|  hypothetical protein EUTSA_v10018069mg             221   3e-61    Eutrema salsugineum [saltwater cress]
ref|XP_006435205.1|  hypothetical protein CICLE_v10000156mg             221   3e-61    Citrus clementina [clementine]
ref|XP_002889046.1|  hypothetical protein ARALYDRAFT_476729             221   5e-61    
ref|XP_010030176.1|  PREDICTED: leucine-rich repeat receptor-like...    221   7e-61    Eucalyptus grandis [rose gum]
ref|XP_012088603.1|  PREDICTED: leucine-rich repeat receptor-like...    220   9e-61    Jatropha curcas
ref|XP_008349109.1|  PREDICTED: leucine-rich repeat receptor-like...    220   9e-61    Malus domestica [apple tree]
ref|XP_002441645.1|  hypothetical protein SORBIDRAFT_09g030870          220   1e-60    Sorghum bicolor [broomcorn]
gb|KJB29653.1|  hypothetical protein B456_005G112100                    219   2e-60    Gossypium raimondii
ref|NP_177710.1|  receptor protein kinase CLAVATA1                      218   3e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007041221.1|  Leucine-rich receptor-like protein kinase fa...    219   3e-60    
ref|XP_006413888.1|  hypothetical protein EUTSA_v10024310mg             219   3e-60    Eutrema salsugineum [saltwater cress]
ref|XP_010449207.1|  PREDICTED: leucine-rich repeat receptor-like...    219   3e-60    Camelina sativa [gold-of-pleasure]
ref|XP_002300697.2|  receptor protein kinase                            218   4e-60    
pir||E96787  protein T4O12.5 [imported] - Arabidopsis thaliana          218   4e-60 
gb|KFK42020.1|  hypothetical protein AALP_AA2G201900                    218   4e-60    Arabis alpina [alpine rockcress]
gb|KCW58273.1|  hypothetical protein EUGRSUZ_H00964                     218   4e-60    Eucalyptus grandis [rose gum]
ref|XP_009363288.1|  PREDICTED: leucine-rich repeat receptor-like...    218   5e-60    Pyrus x bretschneideri [bai li]
emb|CBI19895.3|  unnamed protein product                                217   5e-60    Vitis vinifera
ref|XP_012066670.1|  PREDICTED: leucine-rich repeat receptor-like...    218   5e-60    Jatropha curcas
ref|XP_010026074.1|  PREDICTED: receptor protein kinase CLAVATA1        218   6e-60    Eucalyptus grandis [rose gum]
ref|XP_010439602.1|  PREDICTED: leucine-rich repeat receptor-like...    218   6e-60    Camelina sativa [gold-of-pleasure]
ref|XP_002279563.1|  PREDICTED: receptor protein kinase CLAVATA1        217   1e-59    Vitis vinifera
ref|XP_010671767.1|  PREDICTED: receptor protein kinase CLAVATA1        217   2e-59    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006492589.1|  PREDICTED: leucine-rich repeat receptor-like...    216   2e-59    Citrus sinensis [apfelsine]
gb|KDO44093.1|  hypothetical protein CISIN_1g001922mg                   216   2e-59    Citrus sinensis [apfelsine]
ref|XP_010023395.1|  PREDICTED: leucine-rich repeat receptor-like...    215   3e-59    
gb|AAB58929.1|  CLV1 receptor kinase                                    216   4e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004966471.1|  PREDICTED: leucine-rich repeat receptor-like...    216   4e-59    Setaria italica
gb|AAD02501.1|  receptor kinase                                         215   4e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004150938.1|  PREDICTED: leucine-rich repeat receptor-like...    216   4e-59    Cucumis sativus [cucumbers]
ref|XP_008387933.1|  PREDICTED: receptor protein kinase CLAVATA1        215   5e-59    Malus domestica [apple tree]
gb|KHG17337.1|  Leucine-rich repeat receptor-like serine/threonin...    215   6e-59    Gossypium arboreum [tree cotton]
ref|XP_002869943.1|  hypothetical protein ARALYDRAFT_492844             215   6e-59    
ref|XP_004230451.1|  PREDICTED: leucine-rich repeat receptor-like...    215   7e-59    Solanum lycopersicum
ref|XP_011035024.1|  PREDICTED: receptor protein kinase CLAVATA1-...    214   7e-59    Populus euphratica
gb|KHG24572.1|  Receptor protein kinase CLAVATA1                        215   7e-59    Gossypium arboreum [tree cotton]
ref|XP_006431638.1|  hypothetical protein CICLE_v10000148mg             214   1e-58    
ref|XP_009403711.1|  PREDICTED: leucine-rich repeat receptor-like...    214   2e-58    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011035001.1|  PREDICTED: receptor protein kinase CLAVATA1-...    214   2e-58    Populus euphratica
ref|XP_010243899.1|  PREDICTED: leucine-rich repeat receptor-like...    213   2e-58    Nelumbo nucifera [Indian lotus]
gb|ACN59341.1|  leucine-rich repeat receptor-like protein kinase        213   2e-58    Arabidopsis thaliana [mouse-ear cress]
emb|CDO97616.1|  unnamed protein product                                213   3e-58    Coffea canephora [robusta coffee]
ref|XP_009603651.1|  PREDICTED: leucine-rich repeat receptor-like...    213   3e-58    Nicotiana tomentosiformis
ref|NP_193760.1|  leucine-rich receptor-like protein kinase BAM3        213   4e-58    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004983327.1|  PREDICTED: leucine-rich repeat receptor-like...    206   5e-58    Setaria italica
ref|XP_010243895.1|  PREDICTED: leucine-rich repeat receptor-like...    212   5e-58    Nelumbo nucifera [Indian lotus]
dbj|BAI82122.1|  CLV1-like LRR receptor kinase                          212   6e-58    Silene latifolia
ref|XP_011083584.1|  PREDICTED: receptor protein kinase CLAVATA1        212   7e-58    Sesamum indicum [beniseed]
ref|XP_009401113.1|  PREDICTED: leucine-rich repeat receptor-like...    212   7e-58    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004238370.1|  PREDICTED: receptor protein kinase CLAVATA1        212   7e-58    Solanum lycopersicum
gb|KJB16198.1|  hypothetical protein B456_002G217000                    211   8e-58    Gossypium raimondii
ref|XP_009763204.1|  PREDICTED: leucine-rich repeat receptor-like...    212   8e-58    Nicotiana sylvestris
ref|XP_010539846.1|  PREDICTED: receptor protein kinase CLAVATA1        212   8e-58    Tarenaya hassleriana [spider flower]
gb|KCW59634.1|  hypothetical protein EUGRSUZ_H023832                    211   1e-57    Eucalyptus grandis [rose gum]
gb|KCW62729.1|  hypothetical protein EUGRSUZ_G00319                     211   1e-57    Eucalyptus grandis [rose gum]
ref|XP_010536408.1|  PREDICTED: receptor protein kinase CLAVATA1-...    211   2e-57    Tarenaya hassleriana [spider flower]
ref|XP_010065309.1|  PREDICTED: leucine-rich repeat receptor-like...    211   2e-57    Eucalyptus grandis [rose gum]
ref|XP_008221401.1|  PREDICTED: receptor protein kinase CLAVATA1        210   2e-57    
gb|KJB43996.1|  hypothetical protein B456_007G228700                    209   3e-57    Gossypium raimondii
ref|XP_007225356.1|  hypothetical protein PRUPE_ppa000916mg             210   3e-57    
ref|XP_007224667.1|  hypothetical protein PRUPE_ppa026134mg             210   4e-57    
ref|XP_011087678.1|  PREDICTED: leucine-rich repeat receptor-like...    210   4e-57    
gb|KJB16199.1|  hypothetical protein B456_002G217000                    210   5e-57    
emb|CAD42181.1|  serine-threonine protein kinase                        209   5e-57    
ref|XP_009600411.1|  PREDICTED: leucine-rich repeat receptor-like...    209   7e-57    
ref|XP_011028346.1|  PREDICTED: leucine-rich repeat receptor-like...    209   8e-57    
ref|XP_010529317.1|  PREDICTED: leucine-rich repeat receptor-like...    209   1e-56    
ref|XP_010687839.1|  PREDICTED: leucine-rich repeat receptor-like...    209   1e-56    
ref|XP_008233100.1|  PREDICTED: receptor protein kinase CLAVATA1-...    209   1e-56    
ref|XP_010675918.1|  PREDICTED: leucine-rich repeat receptor-like...    208   1e-56    
ref|XP_007131793.1|  hypothetical protein PHAVU_011G042000g             209   1e-56    
ref|XP_009415664.1|  PREDICTED: leucine-rich repeat receptor-like...    208   1e-56    
ref|XP_007213482.1|  hypothetical protein PRUPE_ppa023389mg             208   1e-56    
gb|AIT55304.1|  nodulation autoregulation receptor kinase               208   1e-56    
emb|CDP07377.1|  unnamed protein product                                207   2e-56    
gb|EPS62062.1|  protein kinase                                          208   2e-56    
ref|NP_001058593.1|  Os06g0717200                                       207   3e-56    
ref|XP_009353760.1|  PREDICTED: leucine-rich repeat receptor-like...    207   3e-56    
ref|XP_002962293.1|  hypothetical protein SELMODRAFT_77558              207   5e-56    
ref|XP_008339390.1|  PREDICTED: leucine-rich repeat receptor-like...    207   6e-56    
ref|XP_009787949.1|  PREDICTED: leucine-rich repeat receptor-like...    206   7e-56    
ref|XP_002965214.1|  hypothetical protein SELMODRAFT_83051              206   9e-56    
ref|XP_006356981.1|  PREDICTED: leucine-rich repeat receptor-like...    206   9e-56    
gb|AAW71475.1|  CLV1-like receptor kinase                               206   9e-56    
ref|XP_007131794.1|  hypothetical protein PHAVU_011G042100g             204   9e-56    
ref|XP_008218726.1|  PREDICTED: leucine-rich repeat receptor-like...    206   1e-55    
gb|KHG26020.1|  Receptor protein kinase CLAVATA1                        206   1e-55    
gb|KJB58082.1|  hypothetical protein B456_009G193600                    205   2e-55    
gb|EAZ02372.1|  hypothetical protein OsI_24476                          206   2e-55    
ref|XP_009392569.1|  PREDICTED: leucine-rich repeat receptor-like...    204   2e-55    
ref|XP_010094628.1|  Leucine-rich repeat receptor-like serine/thr...    206   2e-55    
emb|CAD42335.1|  hypernodulation aberrant root formation protein        205   2e-55    
dbj|BAJ98758.1|  predicted protein                                      205   3e-55    
ref|XP_010685023.1|  PREDICTED: receptor-like protein 12                203   3e-55    
ref|XP_009392568.1|  PREDICTED: leucine-rich repeat receptor-like...    205   4e-55    
ref|XP_008452253.1|  PREDICTED: leucine-rich repeat receptor-like...    204   4e-55    
ref|XP_004229499.1|  PREDICTED: leucine-rich repeat receptor-like...    204   4e-55    
ref|XP_006385034.1|  hypothetical protein POPTR_0004s23260g             204   4e-55    
gb|KJB47871.1|  hypothetical protein B456_008G045400                    204   6e-55    
ref|XP_008786484.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    204   6e-55    
ref|XP_003606988.1|  Receptor protein kinase CLAVATA1                   203   9e-55    
gb|EYU26470.1|  hypothetical protein MIMGU_mgv1a019834mg                203   1e-54    
gb|ABE79572.2|  Protein kinase                                          203   1e-54    
ref|XP_011074693.1|  PREDICTED: receptor protein kinase CLAVATA1-...    203   1e-54    
ref|XP_004301907.1|  PREDICTED: leucine-rich repeat receptor-like...    203   1e-54    
ref|XP_006656496.1|  PREDICTED: leucine-rich repeat receptor-like...    203   2e-54    
ref|XP_003592924.1|  Receptor-like protein kinase                       202   2e-54    
ref|XP_010668145.1|  PREDICTED: receptor protein kinase CLAVATA1-...    199   3e-54    
ref|XP_009355307.1|  PREDICTED: leucine-rich repeat receptor-like...    202   3e-54    
ref|XP_008347921.1|  PREDICTED: leucine-rich repeat receptor-like...    202   4e-54    
ref|XP_008377848.1|  PREDICTED: receptor protein kinase CLAVATA1-...    201   4e-54    
ref|XP_006349327.1|  PREDICTED: leucine-rich repeat receptor-like...    202   4e-54    
ref|XP_008466473.1|  PREDICTED: receptor protein kinase CLAVATA1        201   8e-54    
ref|XP_006590881.1|  PREDICTED: receptor protein kinase CLAVATA1-...    198   8e-54    
dbj|BAC41332.1|  LRR receptor-like kinase                               201   9e-54    
ref|NP_001238004.1|  receptor protein kinase-like protein precursor     201   9e-54    
ref|XP_006342066.1|  PREDICTED: receptor protein kinase CLAVATA1-...    200   1e-53    
gb|EEC67924.1|  hypothetical protein OsI_35629                          201   1e-53    
ref|XP_004136488.1|  PREDICTED: receptor protein kinase CLAVATA1        200   2e-53    
gb|AAX96206.1|  Similar to receptor-like protein kinase 3               200   2e-53    
gb|KJB59753.1|  hypothetical protein B456_009G269700                    197   2e-53    
ref|XP_002439033.1|  hypothetical protein SORBIDRAFT_10g030270          201   2e-53    
ref|NP_001238576.1|  receptor protein kinase-like protein precursor     199   4e-53    
gb|EYU36796.1|  hypothetical protein MIMGU_mgv1a020841mg                198   5e-53    
gb|KHN25406.1|  Receptor protein kinase CLAVATA1                        198   6e-53    
ref|XP_003614937.1|  Somatic embryogenesis receptor kinase              190   7e-53    
ref|XP_004491265.1|  PREDICTED: leucine-rich repeat receptor-like...    198   7e-53    
ref|XP_008678021.1|  PREDICTED: leucine-rich repeat receptor-like...    197   2e-52    
ref|XP_003576141.1|  PREDICTED: leucine-rich repeat receptor-like...    197   2e-52    
gb|KJB32855.1|  hypothetical protein B456_005G265400                    197   2e-52    
ref|XP_010912647.1|  PREDICTED: leucine-rich repeat receptor-like...    197   2e-52    
ref|XP_002450588.1|  hypothetical protein SORBIDRAFT_05g007480          197   3e-52    
ref|XP_010520784.1|  PREDICTED: leucine-rich repeat receptor-like...    194   1e-51    
dbj|BAJ90459.1|  predicted protein                                      195   1e-51    
ref|XP_010520783.1|  PREDICTED: leucine-rich repeat receptor-like...    194   1e-51    
gb|EPS70741.1|  hypothetical protein M569_04011                         194   1e-51    
ref|XP_004507478.1|  PREDICTED: LOW QUALITY PROTEIN: receptor pro...    194   2e-51    
ref|XP_009137141.1|  PREDICTED: leucine-rich repeat receptor-like...    194   2e-51    
emb|CDY62258.1|  BnaCnng39750D                                          192   3e-51    
ref|XP_008645089.1|  PREDICTED: leucine-rich repeat receptor-like...    193   5e-51    
gb|KHG14208.1|  Leucine-rich repeat receptor-like serine/threonin...    193   6e-51    
gb|KFK28659.1|  hypothetical protein AALP_AA7G028700                    192   6e-51    
ref|XP_003560328.2|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    193   6e-51    
ref|XP_003617299.1|  Receptor-like protein kinase                       191   2e-50    
ref|XP_009592786.1|  PREDICTED: receptor protein kinase CLAVATA1        191   2e-50    
tpg|DAA41870.1|  TPA: putative leucine-rich repeat receptor-like ...    191   2e-50    
ref|XP_004485432.1|  PREDICTED: leucine-rich repeat receptor-like...    191   3e-50    
gb|AFY06667.1|  receptor protein kinase CLAVATA1                        190   4e-50    
gb|EMT20446.1|  Receptor protein kinase CLAVATA1                        189   6e-50    
ref|XP_003606987.1|  CLV1-like receptor kinase                          187   7e-50    
gb|AAX14781.1|  RLP1 leucine-rich repeat receptor-like protein          187   7e-50    
ref|XP_006657429.1|  PREDICTED: leucine-rich repeat receptor-like...    188   8e-50    
emb|CDM84408.1|  unnamed protein product                                183   1e-49    
ref|XP_008795253.1|  PREDICTED: leucine-rich repeat receptor-like...    189   1e-49    
emb|CDY66353.1|  BnaA01g35050D                                          187   2e-49    
ref|XP_006435207.1|  hypothetical protein CICLE_v10003935mg             184   3e-49    
ref|XP_010930574.1|  PREDICTED: leucine-rich repeat receptor-like...    188   3e-49    
ref|XP_009133589.1|  PREDICTED: leucine-rich repeat receptor-like...    187   5e-49    
ref|XP_004979026.1|  PREDICTED: leucine-rich repeat receptor-like...    187   5e-49    
ref|XP_009766393.1|  PREDICTED: receptor protein kinase CLAVATA1        187   5e-49    
ref|XP_010676066.1|  PREDICTED: LRR receptor-like serine/threonin...    186   7e-49    
gb|KEH37840.1|  LRR receptor-like kinase family protein                 186   8e-49    
gb|KHN01704.1|  Leucine-rich repeat receptor-like serine/threonin...    185   9e-49    
ref|XP_009333802.1|  PREDICTED: receptor protein kinase CLAVATA1-...    186   1e-48    
ref|XP_009333803.1|  PREDICTED: receptor protein kinase CLAVATA1-...    186   1e-48    
gb|EEE51888.1|  hypothetical protein OsJ_33462                          184   2e-48    
ref|XP_010087435.1|  Leucine-rich repeat receptor-like serine/thr...    184   9e-48    
gb|KJB11032.1|  hypothetical protein B456_001G237400                    184   1e-47    
ref|XP_003625388.1|  Receptor-like protein kinase                       184   1e-47    
ref|XP_009341482.1|  PREDICTED: receptor protein kinase CLAVATA1-...    183   1e-47    
ref|XP_011024490.1|  PREDICTED: leucine-rich repeat receptor-like...    183   2e-47    
ref|XP_010667968.1|  PREDICTED: leucine-rich repeat receptor-like...    182   4e-47    
gb|KHN28525.1|  Leucine-rich repeat receptor-like serine/threonin...    181   4e-47    
gb|EMS67650.1|  Leucine-rich repeat receptor-like serine/threonin...    180   6e-47    
gb|EAZ38296.1|  hypothetical protein OsJ_22674                          181   8e-47    
ref|XP_011019593.1|  PREDICTED: probably inactive leucine-rich re...    180   1e-46    
gb|KDO84904.1|  hypothetical protein CISIN_1g0460551mg                  176   2e-46    
ref|XP_009340605.1|  PREDICTED: leucine-rich repeat receptor-like...    179   4e-46    
gb|EAY84170.1|  hypothetical protein OsI_05549                          179   6e-46    
ref|XP_002308597.2|  hypothetical protein POPTR_0006s25380g             178   9e-46    
gb|KHG05767.1|  Leucine-rich repeat receptor-like protein kinase ...    178   1e-45    
gb|KHG03063.1|  Leucine-rich repeat receptor-like protein kinase ...    178   1e-45    
ref|XP_004952135.1|  PREDICTED: leucine-rich repeat receptor-like...    177   1e-45    
ref|XP_004986996.1|  PREDICTED: leucine-rich repeat receptor-like...    177   1e-45    
ref|XP_007050157.1|  Leucine-rich repeat receptor-like protein ki...    178   2e-45    
ref|XP_009626660.1|  PREDICTED: probably inactive leucine-rich re...    177   2e-45    
gb|EYU33271.1|  hypothetical protein MIMGU_mgv1a0010741mg               175   2e-45    
ref|XP_009374467.1|  PREDICTED: leucine-rich repeat receptor-like...    177   3e-45    
ref|XP_007012155.1|  Probably inactive leucine-rich repeat recept...    176   3e-45    
ref|XP_008375993.1|  PREDICTED: leucine-rich repeat receptor-like...    177   3e-45    
ref|XP_002301848.1|  leucine-rich repeat transmembrane protein ki...    177   3e-45    
ref|XP_011083069.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    177   4e-45    
ref|XP_004292244.2|  PREDICTED: leucine-rich repeat receptor-like...    177   4e-45    
gb|EAZ21469.1|  hypothetical protein OsJ_05076                          176   4e-45    
ref|NP_001045656.1|  Os02g0111800                                       176   6e-45    
gb|KJB10046.1|  hypothetical protein B456_001G181900                    176   6e-45    
gb|KJB10047.1|  hypothetical protein B456_001G181900                    176   6e-45    
gb|KHG13927.1|  Leucine-rich repeat receptor-like serine/threonin...    176   7e-45    
ref|XP_002453157.1|  hypothetical protein SORBIDRAFT_04g000920          176   8e-45    
ref|XP_006382044.1|  hypothetical protein POPTR_0006s25380g             175   9e-45    
ref|XP_010091806.1|  Leucine-rich repeat receptor-like protein ki...    175   1e-44    
ref|XP_008234497.1|  PREDICTED: leucine-rich repeat receptor-like...    175   1e-44    
ref|XP_010069807.1|  PREDICTED: receptor protein kinase CLAVATA1-...    175   1e-44    
ref|NP_001048946.2|  Os03g0145000                                       175   2e-44    
ref|XP_007220284.1|  hypothetical protein PRUPE_ppa000681mg             175   2e-44    
gb|KCW58271.1|  hypothetical protein EUGRSUZ_H00963                     174   2e-44    
ref|XP_008793131.1|  PREDICTED: leucine-rich repeat receptor-like...    173   2e-44    
ref|XP_010693707.1|  PREDICTED: leucine-rich repeat receptor-like...    174   2e-44    
ref|XP_009370509.1|  PREDICTED: leucine-rich repeat receptor-like...    174   2e-44    
gb|KJB45779.1|  hypothetical protein B456_007G327400                    168   2e-44    
gb|EAY88517.1|  hypothetical protein OsI_09989                          174   2e-44    
ref|XP_009372861.1|  PREDICTED: leucine-rich repeat receptor-like...    174   3e-44    
gb|AES64720.2|  LRR receptor-like kinase family protein                 173   4e-44    
ref|XP_003594469.1|  Receptor-like kinase                               173   4e-44    
ref|XP_004493833.1|  PREDICTED: leucine-rich repeat receptor-like...    173   5e-44    
ref|XP_009769366.1|  PREDICTED: leucine-rich repeat receptor-like...    173   5e-44    
ref|XP_008803980.1|  PREDICTED: leucine-rich repeat receptor-like...    173   6e-44    
ref|XP_008376399.1|  PREDICTED: leucine-rich repeat receptor-like...    173   6e-44    
ref|XP_002281133.1|  PREDICTED: probably inactive leucine-rich re...    172   6e-44    
ref|XP_011081775.1|  PREDICTED: probably inactive leucine-rich re...    172   8e-44    
ref|XP_011081773.1|  PREDICTED: probably inactive leucine-rich re...    172   8e-44    
ref|XP_010264856.1|  PREDICTED: leucine-rich repeat receptor-like...    172   8e-44    
ref|XP_008645155.1|  PREDICTED: leucine-rich repeat receptor-like...    172   9e-44    
ref|XP_010934709.1|  PREDICTED: leucine-rich repeat receptor-like...    172   1e-43    
ref|XP_002973575.1|  hypothetical protein SELMODRAFT_30446              172   1e-43    
ref|XP_009621074.1|  PREDICTED: probable leucine-rich repeat rece...    171   1e-43    
emb|CDP03798.1|  unnamed protein product                                172   1e-43    
emb|CAN61202.1|  hypothetical protein VITISV_009745                     171   1e-43    
ref|XP_002975602.1|  hypothetical protein SELMODRAFT_30447              172   1e-43    
gb|EYU46395.1|  hypothetical protein MIMGU_mgv1a000683mg                172   2e-43    
ref|XP_012085218.1|  PREDICTED: leucine-rich repeat receptor-like...    171   2e-43    
gb|KDP26461.1|  hypothetical protein JCGZ_17619                         171   2e-43    
gb|KJB07488.1|  hypothetical protein B456_001G026700                    171   3e-43    
ref|XP_010941424.1|  PREDICTED: leucine-rich repeat receptor-like...    171   3e-43    
ref|XP_004514666.1|  PREDICTED: leucine-rich repeat receptor-like...    171   4e-43    
ref|XP_006848766.1|  PREDICTED: leucine-rich repeat receptor-like...    171   4e-43    
gb|KFK41560.1|  hypothetical protein AALP_AA2G145000                    171   4e-43    
ref|XP_004247132.1|  PREDICTED: leucine-rich repeat receptor-like...    170   5e-43    
gb|AAX19025.1|  Hcr2-p3                                                 169   6e-43    
gb|KHN37138.1|  Leucine-rich repeat receptor-like protein kinase TDR    169   8e-43    
ref|XP_009384053.1|  PREDICTED: leucine-rich repeat receptor-like...    169   9e-43    
emb|CDY31445.1|  BnaC03g63790D                                          169   9e-43    
gb|EYU17948.1|  hypothetical protein MIMGU_mgv1a022168mg                169   1e-42    
ref|XP_006587146.1|  PREDICTED: leucine-rich repeat receptor-like...    169   1e-42    
ref|XP_002535195.1|  Receptor protein kinase CLAVATA1 precursor, ...    169   2e-42    
ref|XP_010941444.1|  PREDICTED: leucine-rich repeat receptor-like...    167   2e-42    
ref|XP_010456432.1|  PREDICTED: leucine-rich repeat receptor prot...    169   3e-42    
gb|EDN70504.1|  conserved hypothetical protein                          169   3e-42    
ref|XP_009621771.1|  PREDICTED: leucine-rich repeat receptor-like...    168   3e-42    
ref|XP_007138433.1|  hypothetical protein PHAVU_009G208500g             167   4e-42    
emb|CDP11441.1|  unnamed protein product                                168   4e-42    
emb|CDY54567.1|  BnaA08g30460D                                          167   4e-42    
ref|XP_003553510.2|  PREDICTED: leucine-rich repeat receptor-like...    167   4e-42    
ref|XP_006648220.1|  PREDICTED: leucine-rich repeat receptor-like...    167   4e-42    
gb|KJB51410.1|  hypothetical protein B456_008G215400                    167   5e-42    
emb|CBI25609.3|  unnamed protein product                                166   6e-42    
dbj|BAJ89535.1|  predicted protein                                      167   6e-42    
ref|XP_006403018.1|  hypothetical protein EUTSA_v10005775mg             167   6e-42    
ref|XP_006355906.1|  PREDICTED: leucine-rich repeat receptor-like...    167   7e-42    
ref|XP_006359740.1|  PREDICTED: probably inactive leucine-rich re...    167   7e-42    
gb|KJB51409.1|  hypothetical protein B456_008G215400                    167   8e-42    
emb|CDP21987.1|  unnamed protein product                                163   9e-42    
ref|XP_004985730.1|  PREDICTED: leucine-rich repeat receptor-like...    167   9e-42    
ref|XP_011080119.1|  PREDICTED: leucine-rich repeat receptor-like...    166   1e-41    
ref|XP_009769280.1|  PREDICTED: probably inactive leucine-rich re...    166   1e-41    
gb|KEH42461.1|  LRR receptor-like kinase family protein                 166   1e-41    
ref|XP_010249537.1|  PREDICTED: probably inactive leucine-rich re...    166   1e-41    
ref|XP_008372397.1|  PREDICTED: leucine-rich repeat receptor-like...    166   1e-41    
ref|XP_002264530.2|  PREDICTED: leucine-rich repeat receptor-like...    166   1e-41    
ref|XP_010249536.1|  PREDICTED: probably inactive leucine-rich re...    166   2e-41    
ref|XP_010106880.1|  Leucine-rich repeat receptor-like protein ki...    166   2e-41    
ref|XP_009341847.1|  PREDICTED: leucine-rich repeat receptor-like...    165   2e-41    
ref|XP_009777391.1|  PREDICTED: leucine-rich repeat receptor-like...    166   2e-41    
ref|XP_006651034.1|  PREDICTED: leucine-rich repeat receptor-like...    166   2e-41    
ref|XP_004495057.1|  PREDICTED: leucine-rich repeat receptor-like...    166   2e-41    
gb|AAX19029.1|  Hcr2-p6                                                 159   2e-41    
ref|XP_009341809.1|  PREDICTED: leucine-rich repeat receptor-like...    165   2e-41    
ref|XP_010918931.1|  PREDICTED: leucine-rich repeat receptor-like...    165   2e-41    
gb|EEC69149.1|  hypothetical protein OsI_38088                          162   3e-41    
ref|XP_008235589.1|  PREDICTED: leucine-rich repeat receptor-like...    165   3e-41    
ref|XP_007144405.1|  hypothetical protein PHAVU_007G153400g             165   3e-41    



>ref|NP_001274713.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1-like precursor [Solanum lycopersicum]
 dbj|BAK52388.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
 dbj|BAK52391.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
Length=1016

 Score =   379 bits (973),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 207/292 (71%), Positives = 238/292 (82%), Gaps = 0/292 (0%)
 Frame = +2

Query  179   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsl  358
             H     AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SL
Sbjct  12    HFTDFSAGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSL  71

Query  359   dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  538
             D+SG NL+G L P+VG L FL NLS+A NQ +GPVP EIS I  L +LNLSNNIFG  FP
Sbjct  72    DISGFNLTGTLPPEVGNLRFLQNLSVAVNQFTGPVPVEISFIPNLSYLNLSNNIFGMEFP  131

Query  539   HQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL  718
              QL +L NLQVLDLYNNN+TG+LPVEVY+MT LRHLHLGGN+FSGRIPPEYGRFP+LEYL
Sbjct  132   SQLTRLRNLQVLDLYNNNMTGELPVEVYQMTKLRHLHLGGNFFSGRIPPEYGRFPSLEYL  191

Query  719   AVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGEL  898
             AVSGN L G IP EIGN+  L++LY+GY+N F+GGIPP +GNLSQL+RFDAANCGL+G++
Sbjct  192   AVSGNALVGEIPPEIGNIATLQQLYVGYYNTFTGGIPPAIGNLSQLLRFDAANCGLSGKI  251

Query  899   PVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             P EIGKL+NLDTLFLQVN LSGSL PEIGYLK+LKSLDLSNN FSGEIP +F
Sbjct  252   PPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTF  303


 Score =   107 bits (267),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 111/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             +LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  
Sbjct  270   SLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIED  329

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L+VL L+ NN TG +P  +   + L+ L L  N  +G +PP      NL+ +   GN
Sbjct  330   LPELEVLQLWENNFTGSIPQGLGTKSKLKTLDLSSNKLTGNLPPNMCSGNNLQTIITLGN  389

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  +G    L  + +G  N  +G IP  + +L  L + +  N  LTG  P    
Sbjct  390   FLFGPIPESLGRCESLNRIRMGE-NYLNGSIPKGLLSLPHLSQVELQNNILTGTFPDISS  448

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             K  +L  + L  N L+G L P IG     + L L  N FSG IP
Sbjct  449   KSNSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIP  492


 Score = 99.4 bits (246),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 112/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L  +    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  366   KLTGNLPPNMCSGNNLQTIITLGNFLFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLS  425

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L +L  ++L NN LTG  P    K  SL  + L  N  +G +PP  G F   + L + GN
Sbjct  426   LPHLSQVELQNNILTGTFPDISSKSNSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGN  485

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP+EIG L +L ++   + N  SG I PE+     L   D +   L+GE+P EI 
Sbjct  486   KFSGRIPAEIGKLQQLSKIDFSH-NNLSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEIT  544

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L S+D S N FSG +P
Sbjct  545   GMRILNYLNLSRNHLVGSIPAPISSMQSLTSVDFSYNNFSGLVP  588


 Score = 99.4 bits (246),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 80/249 (32%), Positives = 121/249 (49%), Gaps = 26/249 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL-----------------N  505
              SG + P+ G+ P L  L+++ N L G +PPEI  I+TL+ L                 N
Sbjct  174   FSGRIPPEYGRFPSLEYLAVSGNALVGEIPPEIGNIATLQQLYVGYYNTFTGGIPPAIGN  233

Query  506   LS--------NNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  661
             LS        N       P ++ +L NL  L L  N+L+G L  E+  + SL+ L L  N
Sbjct  234   LSQLLRFDAANCGLSGKIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNN  293

Query  662   YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
              FSG IPP +    N+  + +  N L G IP  I +L +L+ L + + N F+G IP  +G
Sbjct  294   MFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIEDLPELEVLQL-WENNFTGSIPQGLG  352

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
               S+L   D ++  LTG LP  +    NL T+    N L G +   +G  ++L  + +  
Sbjct  353   TKSKLKTLDLSSNKLTGNLPPNMCSGNNLQTIITLGNFLFGPIPESLGRCESLNRIRMGE  412

Query  1022  nAFSGEIPE  1048
             N  +G IP+
Sbjct  413   NYLNGSIPK  421



>dbj|BAK52389.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
pennellii]
Length=1016

 Score =   378 bits (970),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 206/286 (72%), Positives = 236/286 (83%), Gaps = 0/286 (0%)
 Frame = +2

Query  197   AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  376
             AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SLD+SG N
Sbjct  18    AGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSLDISGFN  77

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G L P+VG L FL NLS+A NQ +GPVP EIS I  L +LNLSNNIFG  FP QL +L
Sbjct  78    LTGTLPPEVGNLRFLQNLSVAVNQFTGPVPVEISFIPNLSYLNLSNNIFGMEFPSQLTRL  137

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NLQVLDLYNNN+TG+LPVEVY+MT LRHLHLGGN+F GRIPPEYGRFP+LEYLAVSGN 
Sbjct  138   RNLQVLDLYNNNMTGELPVEVYQMTKLRHLHLGGNFFGGRIPPEYGRFPSLEYLAVSGNA  197

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L G IP EIGN+  L++LY+GY+N F+GGIPP +GNLSQL+RFDAANCGL+GE+P EIGK
Sbjct  198   LVGEIPPEIGNIATLQQLYVGYYNTFTGGIPPAIGNLSQLLRFDAANCGLSGEIPPEIGK  257

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             L+NLDTLFLQVN LSGSL PEIGYLK+LKSLDLSNN FSGEIP +F
Sbjct  258   LQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTF  303


 Score =   107 bits (267),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 111/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             +LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  
Sbjct  270   SLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIED  329

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L+VL L+ NN TG +P  +   + L+ L L  N  +G +PP      NL+ +   GN
Sbjct  330   LPELEVLQLWENNFTGSIPQGLGTKSKLKTLDLSSNKLTGNLPPNMCSGNNLQTIITLGN  389

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  +G    L  + +G  N  +G IP  + +L  L + +  N  LTG  P    
Sbjct  390   FLFGPIPESLGRCESLNRIRMGE-NYLNGSIPKGLLSLPHLSQVELQNNILTGTFPDISS  448

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             K  +L  + L  N L+G L P IG     + L L  N FSG IP
Sbjct  449   KSNSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIP  492


 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 112/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L  +    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  366   KLTGNLPPNMCSGNNLQTIITLGNFLFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLS  425

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L +L  ++L NN LTG  P    K  SL  + L  N  +G +PP  G F   + L + GN
Sbjct  426   LPHLSQVELQNNILTGTFPDISSKSNSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGN  485

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP+EIG L +L ++   + N  SG I PE+     L   D +   L+GE+P EI 
Sbjct  486   KFSGRIPAEIGKLQQLSKIDFSH-NNLSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEIT  544

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L S+D S N FSG +P
Sbjct  545   GMRILNYLNLSRNHLVGSIPAPISSMQSLTSVDFSYNNFSGLVP  588


 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 79/247 (32%), Positives = 120/247 (49%), Gaps = 26/247 (11%)
 Frame = +2

Query  383   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL-----------------NLS  511
             G + P+ G+ P L  L+++ N L G +PPEI  I+TL+ L                 NLS
Sbjct  176   GRIPPEYGRFPSLEYLAVSGNALVGEIPPEIGNIATLQQLYVGYYNTFTGGIPPAIGNLS  235

Query  512   --------NNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYF  667
                     N       P ++ +L NL  L L  N+L+G L  E+  + SL+ L L  N F
Sbjct  236   QLLRFDAANCGLSGEIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMF  295

Query  668   SGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNL  847
             SG IPP +    N+  + +  N L G IP  I +L +L+ L + + N F+G IP  +G  
Sbjct  296   SGEIPPTFAELKNITLVNLFRNKLYGSIPEFIEDLPELEVLQL-WENNFTGSIPQGLGTK  354

Query  848   SQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnA  1027
             S+L   D ++  LTG LP  +    NL T+    N L G +   +G  ++L  + +  N 
Sbjct  355   SKLKTLDLSSNKLTGNLPPNMCSGNNLQTIITLGNFLFGPIPESLGRCESLNRIRMGENY  414

Query  1028  FSGEIPE  1048
              +G IP+
Sbjct  415   LNGSIPK  421



>ref|XP_006357743.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1017

 Score =   377 bits (969),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 206/292 (71%), Positives = 239/292 (82%), Gaps = 0/292 (0%)
 Frame = +2

Query  179   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsl  358
             H     AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SL
Sbjct  12    HFTDFSAGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSL  71

Query  359   dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  538
             D+SG NL+G L P+VG L FL NLS+A NQ +GP+P EIS I  L +LNLSNNIFG  FP
Sbjct  72    DISGFNLTGTLPPEVGNLRFLQNLSVAVNQFTGPIPVEISFIPNLGYLNLSNNIFGMEFP  131

Query  539   HQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL  718
              QL +L NLQVLDLYNNN+TG+LP+EVY+MT+LRHLHLGGN+F GRIPPEYGRFP+LEYL
Sbjct  132   PQLTRLRNLQVLDLYNNNMTGELPLEVYQMTNLRHLHLGGNFFGGRIPPEYGRFPSLEYL  191

Query  719   AVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGEL  898
             AVSGN L G IP EIGN+T L++LY+GY+N F+GGIPP +GNLSQL+RFDAANCGL+GE+
Sbjct  192   AVSGNALVGEIPPEIGNITTLQQLYVGYYNTFTGGIPPAIGNLSQLLRFDAANCGLSGEI  251

Query  899   PVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             P EIGKL+NLDTLFLQVN LSGSL PEIGYLK+LKSLDLSNN FSGEIP +F
Sbjct  252   PPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTF  303


 Score =   107 bits (266),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 113/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             +LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  
Sbjct  270   SLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIED  329

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L+VL L+ NN TG +P  +   + L+++ L  N  +G +PP      NL+ +   GN
Sbjct  330   LPELEVLQLWENNFTGSIPQGLGTKSKLKNVDLSSNKLTGNLPPNMCSGNNLQTIITLGN  389

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  +G    L  + +G  N  +G IP  + +L +L + +  N  LTG  P    
Sbjct  390   FLFGPIPESLGRCESLNRIRMGE-NYLNGSIPKGLLSLPRLSQVELQNNILTGTFPDISS  448

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             K  +L  + L  N L+G L P IG     + L L  N FSG IP
Sbjct  449   KSNSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIP  492


 Score = 99.0 bits (245),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 112/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L  +    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  366   KLTGNLPPNMCSGNNLQTIITLGNFLFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLS  425

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L NN LTG  P    K  SL  + L  N  +G +PP  G F   + L + GN
Sbjct  426   LPRLSQVELQNNILTGTFPDISSKSNSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGN  485

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP+EIG L +L ++   + N FSG + PE+     L   D +   L+GE+P EI 
Sbjct  486   KFSGRIPAEIGKLQQLSKIDFSH-NNFSGPMAPEISQCKLLTYVDLSRNQLSGEIPSEIT  544

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L S+D S N FSG +P
Sbjct  545   GMRILNYLNLSRNHLVGSIPSPISSMQSLTSVDFSYNNFSGLVP  588


 Score = 97.4 bits (241),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 79/247 (32%), Positives = 120/247 (49%), Gaps = 26/247 (11%)
 Frame = +2

Query  383   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL-----------------NLS  511
             G + P+ G+ P L  L+++ N L G +PPEI  I+TL+ L                 NLS
Sbjct  176   GRIPPEYGRFPSLEYLAVSGNALVGEIPPEIGNITTLQQLYVGYYNTFTGGIPPAIGNLS  235

Query  512   --------NNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYF  667
                     N       P ++ +L NL  L L  N+L+G L  E+  + SL+ L L  N F
Sbjct  236   QLLRFDAANCGLSGEIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMF  295

Query  668   SGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNL  847
             SG IPP +    N+  + +  N L G IP  I +L +L+ L + + N F+G IP  +G  
Sbjct  296   SGEIPPTFAELKNITLVNLFRNKLYGSIPEFIEDLPELEVLQL-WENNFTGSIPQGLGTK  354

Query  848   SQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnA  1027
             S+L   D ++  LTG LP  +    NL T+    N L G +   +G  ++L  + +  N 
Sbjct  355   SKLKNVDLSSNKLTGNLPPNMCSGNNLQTIITLGNFLFGPIPESLGRCESLNRIRMGENY  414

Query  1028  FSGEIPE  1048
              +G IP+
Sbjct  415   LNGSIPK  421



>dbj|BAK52390.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
peruvianum]
Length=1015

 Score =   376 bits (966),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 206/292 (71%), Positives = 237/292 (81%), Gaps = 0/292 (0%)
 Frame = +2

Query  179   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsl  358
             H     AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SL
Sbjct  11    HFTDFSAGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSL  70

Query  359   dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  538
             D+SG NL+G L P+VG L FL NLS+A NQ +GPVP EIS I  L +LNLSNNIFG  FP
Sbjct  71    DISGFNLTGTLPPEVGNLRFLQNLSVAVNQFTGPVPVEISFIPNLSYLNLSNNIFGMEFP  130

Query  539   HQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL  718
              QL +L NLQVLDLYNNN+TG+LPVEVY+MT LRHLHLGGN+FSGRIPPEYGRF +LEYL
Sbjct  131   SQLTRLRNLQVLDLYNNNMTGELPVEVYQMTKLRHLHLGGNFFSGRIPPEYGRFSSLEYL  190

Query  719   AVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGEL  898
             AVSGN L G IP EIGN+  L++LY+GY+N F+GGIPP +GNLSQL+RFDAANCGL+G++
Sbjct  191   AVSGNALVGEIPPEIGNIATLQQLYVGYYNTFTGGIPPAIGNLSQLLRFDAANCGLSGKI  250

Query  899   PVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             P EIGKL+NLDTLFLQVN LSGSL PEIGYLK+LKSLDLSNN FSGEIP +F
Sbjct  251   PREIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTF  302


 Score =   107 bits (268),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 111/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             +LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  
Sbjct  269   SLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIED  328

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L+VL L+ NN TG +P  +   + L+ L L  N  +G +PP      NL+ +   GN
Sbjct  329   LPELEVLQLWENNFTGSIPQGLGTKSKLKTLDLSSNKLTGNLPPNMCSGNNLQTIITLGN  388

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  +G    L  + +G  N  +G IP  + +L  L + +  N  LTG  P    
Sbjct  389   FLFGPIPESLGRCESLNRIRMGE-NYLNGSIPKGLLSLPHLSQVELQNNILTGTFPDISS  447

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             K  +L  + L  N L+G L P IG     + L L  N FSG IP
Sbjct  448   KSNSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIP  491


 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 112/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L  +    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  365   KLTGNLPPNMCSGNNLQTIITLGNFLFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLS  424

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L +L  ++L NN LTG  P    K  SL  + L  N  +G +PP  G F   + L + GN
Sbjct  425   LPHLSQVELQNNILTGTFPDISSKSNSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGN  484

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP+EIG L +L ++   + N  SG I PE+     L   D +   L+GE+P EI 
Sbjct  485   KFSGRIPAEIGKLQQLSKIDFSH-NNLSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEIT  543

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L S+D S N FSG +P
Sbjct  544   GMRILNYLNLSRNHLVGSIPAPISSMQSLTSVDFSYNNFSGLVP  587


 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 72/225 (32%), Positives = 114/225 (51%), Gaps = 2/225 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             L G + P++G +  L  L +   N  +G +PP I  +S L   + +N       P ++ +
Sbjct  197   LVGEIPPEIGNIATLQQLYVGYYNTFTGGIPPAIGNLSQLLRFDAANCGLSGKIPREIGK  256

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL  L L  N+L+G L  E+  + SL+ L L  N FSG IPP +    N+  + +  N
Sbjct  257   LQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRN  316

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  I +L +L+ L + + N F+G IP  +G  S+L   D ++  LTG LP  + 
Sbjct  317   KLYGSIPEFIEDLPELEVLQL-WENNFTGSIPQGLGTKSKLKTLDLSSNKLTGNLPPNMC  375

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPE  1048
                NL T+    N L G +   +G  ++L  + +  N  +G IP+
Sbjct  376   SGNNLQTIITLGNFLFGPIPESLGRCESLNRIRMGENYLNGSIPK  420



>ref|XP_009613990.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1019

 Score =   371 bits (952),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 200/285 (70%), Positives = 237/285 (83%), Gaps = 0/285 (0%)
 Frame = +2

Query  191   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg  370
             + A KP  + E  ALLS+K A T D QS+L SWNISTSHCTW+ VTCD   HV SL++S 
Sbjct  19    SAAAKPHFLPEYRALLSLKTAITDDPQSALISWNISTSHCTWKGVTCDKYRHVTSLNISN  78

Query  371   lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  550
             LNL+G L P++GQL +LVNLS+A NQ SGP+P E+S IS LR+LNLSNNIF  +FP QL 
Sbjct  79    LNLTGTLPPEIGQLRYLVNLSVAVNQFSGPIPVELSLISNLRYLNLSNNIFNLSFPQQLT  138

Query  551   QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
             QL NL+VLD+YNNNLTG+L V V+ +T+L HLHLGGN+F+GRIPPE+G+FP L+YLAVSG
Sbjct  139   QLINLEVLDIYNNNLTGELAVGVHNLTNLYHLHLGGNFFTGRIPPEFGKFPFLKYLAVSG  198

Query  731   NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
             N L+G IP EIGN+T LKELY+GY+N FSGGIPPE+GNLS+L+RFDAANCGL+G +P EI
Sbjct  199   NELAGDIPPEIGNITTLKELYVGYYNTFSGGIPPEIGNLSELVRFDAANCGLSGNIPSEI  258

Query  911   GKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             GKLK LDTLFLQVN LSGSL PEIGYLK+LKSLDLSNN  SGEIP
Sbjct  259   GKLKKLDTLFLQVNSLSGSLIPEIGYLKSLKSLDLSNNLLSGEIP  303


 Score =   107 bits (268),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 78/224 (35%), Positives = 116/224 (52%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             +LSG L P++G L  L +L ++ N LSG +P  +S +  L  LNL  N    + P  + +
Sbjct  273   SLSGSLIPEIGYLKSLKSLDLSNNLLSGEIPLTLSELKNLTLLNLFRNKLYGSIPEFIQE  332

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L+VL L+ NN TG +P+ + + + L+ L +  N  +G +PP   R  NLE L   GN
Sbjct  333   LPKLEVLQLWENNFTGSIPMGLGQNSKLKTLDISTNKLTGNLPPNMCRGNNLETLITLGN  392

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  +G    L  + +G  N  +G IP  + +L +L + +  +  LTG  PV   
Sbjct  393   FLFGPIPESLGQCESLSRIRMGE-NYLNGSIPKGLLSLPKLTQVELQDNLLTGTFPVTGS  451

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
                +L  + L  N L+G L   IG    ++ L L  N FSG IP
Sbjct  452   VSASLGQISLSNNRLTGRLPSSIGSFSGVQKLLLDGNKFSGRIP  495


 Score =   107 bits (267),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 78/224 (35%), Positives = 115/224 (51%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++ +   L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  369   KLTGNLPPNMCRGNNLETLITLGNFLFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLS  428

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N LTG  PV      SL  + L  N  +GR+P   G F  ++ L + GN
Sbjct  429   LPKLTQVELQDNLLTGTFPVTGSVSASLGQISLSNNRLTGRLPSSIGSFSGVQKLLLDGN  488

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP+EIG L +L ++     NGFSG IPPE+ N   L   D +   L+GE+P EI 
Sbjct  489   KFSGRIPAEIGKLQQLSKMDFSG-NGFSGPIPPEISNCKALTFIDLSRNKLSGEIPTEIT  547

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L +  N L GS+   I  +++L S+D S N  SG +P
Sbjct  548   GMRILNYLNVSRNHLVGSIPASISAMQSLTSVDFSYNNLSGLVP  591


 Score =   105 bits (262),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 125/248 (50%), Gaps = 24/248 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              +G + P+ G+ PFL  L+++ N+L+G +PPEI  I+TL+ L +   N F    P ++  
Sbjct  177   FTGRIPPEFGKFPFLKYLAVSGNELAGDIPPEIGNITTLKELYVGYYNTFSGGIPPEIGN  236

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L+ L   D  N  L+G++P E+ K+  L  L L  N  SG + PE G   +L+ L +S N
Sbjct  237   LSELVRFDAANCGLSGNIPSEIGKLKKLDTLFLQVNSLSGSLIPEIGYLKSLKSLDLSNN  296

Query  734   GLSGVIP---SEIGNLTKLK--------------------ELYIGYFNGFSGGIPPEMGN  844
              LSG IP   SE+ NLT L                     E+   + N F+G IP  +G 
Sbjct  297   LLSGEIPLTLSELKNLTLLNLFRNKLYGSIPEFIQELPKLEVLQLWENNFTGSIPMGLGQ  356

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
              S+L   D +   LTG LP  + +  NL+TL    N L G +   +G  ++L  + +  N
Sbjct  357   NSKLKTLDISTNKLTGNLPPNMCRGNNLETLITLGNFLFGPIPESLGQCESLSRIRMGEN  416

Query  1025  AFSGEIPE  1048
               +G IP+
Sbjct  417   YLNGSIPK  424


 Score =   101 bits (251),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 103/203 (51%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L +N+   TFP   +  
Sbjct  394  LFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLSLPKLTQVELQDNLLTGTFPVTGSVS  453

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
            A+L  + L NN LTG LP  +   + ++ L L GN FSGRIP E G+   L  +  SGNG
Sbjct  454  ASLGQISLSNNRLTGRLPSSIGSFSGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSGNG  513

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             SG IP EI N   L  + +   N  SG IP E+  +  L   + +   L G +P  I  
Sbjct  514  FSGPIPPEISNCKALTFIDLSR-NKLSGEIPTEITGMRILNYLNVSRNHLVGSIPASISA  572

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            +++L ++    N+LSG L P  G
Sbjct  573  MQSLTSVDFSYNNLSG-LVPGTG  594



>ref|XP_011073654.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1015

 Score =   370 bits (951),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 206/294 (70%), Positives = 238/294 (81%), Gaps = 4/294 (1%)
 Frame = +2

Query  176   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvv  352
             R+S GA  G+   + E  ALLSIKAA T D QS+L SWN STSHCTW  VTCD    HV 
Sbjct  16    RYSTGARPGR---MPEYRALLSIKAAITEDPQSTLASWNASTSHCTWEGVTCDVSGRHVT  72

Query  353   sldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  532
             +LD+S L+L+G LSPDVG L FLVNLS+AAN LSGPVPP+IS I  LR+LNLSNN+F  +
Sbjct  73    ALDISNLSLTGTLSPDVGHLRFLVNLSVAANSLSGPVPPQISDIPNLRYLNLSNNVFNLS  132

Query  533   FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE  712
             FP QL +L NLQVLDLYNNN+TGD P + Y +TSLRHLHLGGN+FSG IP E+G FPNLE
Sbjct  133   FPPQLYRLKNLQVLDLYNNNMTGDFPSQAYLLTSLRHLHLGGNFFSGEIPAEFGSFPNLE  192

Query  713   YLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTG  892
             YLAVSGN L+G IP EIGNLT+LKELYIGY+N FSGGIP E+GNLS L+RFDAANCGL+G
Sbjct  193   YLAVSGNELTGAIPREIGNLTQLKELYIGYYNTFSGGIPKEIGNLSNLVRFDAANCGLSG  252

Query  893   ELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             E+P EIG L+NLDTLFLQVN L+G L PE+G LK+LKS+DLSNN  SGE+P SF
Sbjct  253   EIPAEIGNLQNLDTLFLQVNGLTGGLTPELGNLKSLKSMDLSNNMLSGELPPSF  306


 Score = 98.6 bits (244),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 112/223 (50%), Gaps = 1/223 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G L P++     L  L    N L GP+P  +    +L  + +  N    + P  L  L
Sbjct  370   LTGNLPPNLCNGKQLHTLITLGNFLFGPIPESLGQCESLSRVRMGENYLNGSIPKGLLSL  429

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L  ++L +N L+G  P      T+L  + L  N+ SG +PP  G F  ++ L + GN 
Sbjct  430   PKLTQVELQDNLLSGAFPETDRPSTTLGQISLSNNHLSGPLPPSIGNFVGVQKLLLDGNK  489

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
              SG IP+EIG L +L ++   + N  SG I PE+     L   D +   L+G +P EI  
Sbjct  490   FSGRIPAEIGKLQQLSKMDFSH-NNLSGPIAPEISRCKLLTFVDLSRNQLSGSVPTEITG  548

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             ++ L+ L L  N L GS+   I  +++L S+D S N FSG +P
Sbjct  549   MRILNYLNLSRNHLVGSIPSSIASMQSLTSVDFSYNNFSGLVP  591


 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 81/271 (30%), Positives = 119/271 (44%), Gaps = 49/271 (18%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G L+P++G L  L ++ ++ N LSG +PP  + +  +  LNL  N    + P  + +L
Sbjct  274   LTGGLTPELGNLKSLKSMDLSNNMLSGELPPSFAELKNMTLLNLFRNKLTGSIPDFIGEL  333

Query  557   ANLQVLDLYNNNLTGDLP-------------VEVYKMT----------------------  631
               LQVL L+ NN TG +P             V   K+T                      
Sbjct  334   PELQVLQLWENNFTGSIPQNLGTNGNLHEVDVSSNKLTGNLPPNLCNGKQLHTLITLGNF  393

Query  632   -------------SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNL  772
                          SL  + +G NY +G IP      P L  + +  N LSG  P      
Sbjct  394   LFGPIPESLGQCESLSRVRMGENYLNGSIPKGLLSLPKLTQVELQDNLLSGAFPETDRPS  453

Query  773   TKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVN  952
             T L ++ +   N  SG +PP +GN   + +        +G +P EIGKL+ L  +    N
Sbjct  454   TTLGQISLSN-NHLSGPLPPSIGNFVGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSHN  512

Query  953   DLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             +LSG +APEI   K L  +DLS N  SG +P
Sbjct  513   NLSGPIAPEISRCKLLTFVDLSRNQLSGSVP  543


 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 74/225 (33%), Positives = 110/225 (49%), Gaps = 2/225 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             L+G +  ++G L  L  L I   N  SG +P EI  +S L   + +N       P ++  
Sbjct  201   LTGAIPREIGNLTQLKELYIGYYNTFSGGIPKEIGNLSNLVRFDAANCGLSGEIPAEIGN  260

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL  L L  N LTG L  E+  + SL+ + L  N  SG +PP +    N+  L +  N
Sbjct  261   LQNLDTLFLQVNGLTGGLTPELGNLKSLKSMDLSNNMLSGELPPSFAELKNMTLLNLFRN  320

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L+G IP  IG L +L+ L + + N F+G IP  +G    L   D ++  LTG LP  + 
Sbjct  321   KLTGSIPDFIGELPELQVLQL-WENNFTGSIPQNLGTNGNLHEVDVSSNKLTGNLPPNLC  379

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPE  1048
               K L TL    N L G +   +G  ++L  + +  N  +G IP+
Sbjct  380   NGKQLHTLITLGNFLFGPIPESLGQCESLSRVRMGENYLNGSIPK  424


 Score = 95.9 bits (237),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 69/201 (34%), Positives = 103/201 (51%), Gaps = 2/201 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG +  ++G L  L  L +  N L+G + PE+  + +L+ ++LSNN+     P   A+L
Sbjct  250  LSGEIPAEIGNLQNLDTLFLQVNGLTGGLTPELGNLKSLKSMDLSNNMLSGELPPSFAEL  309

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             N+ +L+L+ N LTG +P  + ++  L+ L L  N F+G IP   G   NL  + VS N 
Sbjct  310  KNMTLLNLFRNKLTGSIPDFIGELPELQVLQLWENNFTGSIPQNLGTNGNLHEVDVSSNK  369

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P  + N  +L  L I   N   G IP  +G    L R       L G +P  +  
Sbjct  370  LTGNLPPNLCNGKQLHTL-ITLGNFLFGPIPESLGQCESLSRVRMGENYLNGSIPKGLLS  428

Query  917  LKNLDTLFLQVNDLSGSLAPE  979
            L  L  + LQ N LSG+  PE
Sbjct  429  LPKLTQVELQDNLLSGAF-PE  448


 Score = 58.2 bits (139),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            NLSG ++P++ +   L  + ++ NQLSG VP EI+ +  L +LNLS N    + P  +A 
Sbjct  513  NLSGPIAPEISRCKLLTFVDLSRNQLSGSVPTEITGMRILNYLNLSRNHLVGSIPSSIAS  572

Query  554  LANLQVLDLYNNNLTGDLP  610
            + +L  +D   NN +G +P
Sbjct  573  MQSLTSVDFSYNNFSGLVP  591



>emb|CDP02660.1| unnamed protein product [Coffea canephora]
Length=1017

 Score =   370 bits (949),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 200/279 (72%), Positives = 230/279 (82%), Gaps = 1/279 (0%)
 Frame = +2

Query  221   EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSP  397
             E  ALLSIK+A TAD QSSL SWN ST+HC+W  VTCDS    V+      LNL+G LSP
Sbjct  26    EYKALLSIKSAITADPQSSLASWNDSTTHCSWSGVTCDSYGRHVTALDISGLNLTGSLSP  85

Query  398   DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  577
             DV  L  L+NLS+AANQ  GPVPPEIS+ISTLR+LNLSNNIF  TFP QL +L NL+VLD
Sbjct  86    DVSHLRLLLNLSVAANQFCGPVPPEISSISTLRYLNLSNNIFNLTFPRQLIRLKNLEVLD  145

Query  578   LYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPS  757
              YNNN++G LPV+VY++T+LRHLHLGGNYFSG IP EYG FPNLEYLAVSGN L+G IP 
Sbjct  146   FYNNNMSGPLPVDVYQLTNLRHLHLGGNYFSGGIPAEYGSFPNLEYLAVSGNELAGRIPP  205

Query  758   EIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTL  937
             EI NLTKL+ LYIGYFN FSGGIPP++GNLSQL+RFDAANCGL+GE+P E+G L+NLDTL
Sbjct  206   EIANLTKLQHLYIGYFNTFSGGIPPQIGNLSQLLRFDAANCGLSGEVPPELGMLQNLDTL  265

Query  938   FLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             FLQVN LSG L  E+GYLK+LKS+DLSNN F+GEIP SF
Sbjct  266   FLQVNALSGPLTSELGYLKSLKSMDLSNNMFTGEIPSSF  304


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 102/201 (51%), Gaps = 2/201 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P++G L  L  L +  N LSGP+  E+  + +L+ ++LSNN+F    P   AQL
Sbjct  248  LSGEVPPELGMLQNLDTLFLQVNALSGPLTSELGYLKSLKSMDLSNNMFTGEIPSSFAQL  307

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  308  KNLTLLNLFRNQLHGSIPDFIGDLPELEVLQLWDNNFTGSIPQGLGTNGKLQNLDLSSNK  367

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P  I    KL+ L I   N   G IP  +G    L R       L G +P  +  
Sbjct  368  LTGNLPPNICTGNKLQTL-ITLGNFLFGTIPESLGQCESLSRLRMGENYLNGSIPKGLLS  426

Query  917  LKNLDTLFLQVNDLSGSLAPE  979
            L  L  + LQ N L+GS  PE
Sbjct  427  LPQLTQVELQDNLLTGSF-PE  446


 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 76/225 (34%), Positives = 114/225 (51%), Gaps = 2/225 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             L+G + P++  L  L +L I   N  SG +PP+I  +S L   + +N       P +L  
Sbjct  199   LAGRIPPEIANLTKLQHLYIGYFNTFSGGIPPQIGNLSQLLRFDAANCGLSGEVPPELGM  258

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL  L L  N L+G L  E+  + SL+ + L  N F+G IP  + +  NL  L +  N
Sbjct  259   LQNLDTLFLQVNALSGPLTSELGYLKSLKSMDLSNNMFTGEIPSSFAQLKNLTLLNLFRN  318

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  IG+L +L+ L + + N F+G IP  +G   +L   D ++  LTG LP  I 
Sbjct  319   QLHGSIPDFIGDLPELEVLQL-WDNNFTGSIPQGLGTNGKLQNLDLSSNKLTGNLPPNIC  377

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPE  1048
                 L TL    N L G++   +G  ++L  L +  N  +G IP+
Sbjct  378   TGNKLQTLITLGNFLFGTIPESLGQCESLSRLRMGENYLNGSIPK  422


 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 109/224 (49%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L  L    N L G +P  +    +L  L +  N    + P  L  
Sbjct  367   KLTGNLPPNICTGNKLQTLITLGNFLFGTIPESLGQCESLSRLRMGENYLNGSIPKGLLS  426

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N LTG  P      T+L  + L  N  SG +PP  G F  ++   + GN
Sbjct  427   LPQLTQVELQDNLLTGSFPETDKTSTALGQISLSNNRLSGPLPPSIGNFVGVQKFLLDGN  486

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               +G IP+EIG L +L ++   + N FSG I PE+     L   D +   L GE+P EI 
Sbjct  487   KFTGPIPAEIGKLQQLSKIDFSH-NSFSGPIAPEISECKLLTFVDLSRNQLAGEIPTEIT  545

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L S+D S N  SG +P
Sbjct  546   GMRILNYLNLSRNHLVGSIPSPIASMQSLTSVDFSYNNLSGMVP  589


 Score = 88.6 bits (218),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 103/204 (50%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G    L NL +++N+L+G +PP I   + L+  + L N +FG T P  L 
Sbjct  343  NFTGSIPQGLGTNGKLQNLDLSSNKLTGNLPPNICTGNKLQTLITLGNFLFG-TIPESLG  401

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            Q  +L  L +  N L G +P  +  +  L  + L  N  +G  P        L  +++S 
Sbjct  402  QCESLSRLRMGENYLNGSIPKGLLSLPQLTQVELQDNLLTGSFPETDKTSTALGQISLSN  461

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +P  IGN   +++  +   N F+G IP E+G L QL + D ++   +G +  EI
Sbjct  462  NRLSGPLPPSIGNFVGVQKFLLDG-NKFTGPIPAEIGKLQQLSKIDFSHNSFSGPIAPEI  520

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  + L  N L+G +  EI
Sbjct  521  SECKLLTFVDLSRNQLAGEIPTEI  544



>ref|XP_011099433.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1008

 Score =   369 bits (948),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 202/289 (70%), Positives = 241/289 (83%), Gaps = 1/289 (0%)
 Frame = +2

Query  191   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCd-sllhvvsldls  367
             + A +P  ++E  ALLSIKAA T D QS+L SWN++T+HCTW+ +TCD S  HV SLD+S
Sbjct  16    SAAARPPRMSEYRALLSIKAAITDDPQSALASWNLTTNHCTWKGITCDPSRRHVTSLDIS  75

Query  368   glNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  547
              L+L+G LSPDVGQL FLVNLS+AAN +SGPVPP+IS I  LR+LNLSNN+F  +FP +L
Sbjct  76    NLSLTGTLSPDVGQLRFLVNLSVAANFISGPVPPQISDIPNLRYLNLSNNVFNLSFPPEL  135

Query  548   AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  727
              +L NLQVLDLYNNN+TGD P + Y + +LRHLHLGGN+FSG IPPE+G FP LEYLAVS
Sbjct  136   YRLRNLQVLDLYNNNMTGDFPSKAYLLANLRHLHLGGNFFSGEIPPEFGSFPYLEYLAVS  195

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
             GN L+G IP EIGNLT+LKELYIGY+N F+GG+P E+GNLSQL+R DAANCGLTGE+P E
Sbjct  196   GNELTGAIPPEIGNLTQLKELYIGYYNAFTGGMPKEIGNLSQLVRLDAANCGLTGEIPPE  255

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             IG L+NLDTLFLQVN LSGSL PE+G LK+LKS+DLSNN FSGEIP SF
Sbjct  256   IGNLQNLDTLFLQVNGLSGSLTPELGNLKSLKSMDLSNNMFSGEIPPSF  304


 Score =   104 bits (259),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 117/226 (52%), Gaps = 1/226 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G + P++G L  L  L +  N LSG + PE+  + +L+ ++LSNN+F    P   A+L
Sbjct  248   LTGEIPPEIGNLQNLDTLFLQVNGLSGSLTPELGNLKSLKSMDLSNNMFSGEIPPSFAEL  307

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              N+ +L+L+ N LTG +P  + ++  L  L L  N F+G IP   G   NL+ + VS N 
Sbjct  308   KNMTLLNLFRNKLTGSIPDFIGELPELEVLQLWENNFTGIIPQSLGTNGNLQEVDVSSNK  367

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L+G +P  + N  +L+ L I   N   G IP  +G    L R       L G +P  +  
Sbjct  368   LTGNLPPNLCNGNQLRTL-ITLGNFLFGPIPESLGQCKSLTRIRMGENYLNGSIPKGLLS  426

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             L  L  + LQ N LSG+     G   +L  + LS+N  +G +P S 
Sbjct  427   LPKLTQVELQDNLLSGTFPETDGLSTSLGQISLSDNHLTGPLPPSI  472


 Score =   101 bits (251),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 77/249 (31%), Positives = 119/249 (48%), Gaps = 26/249 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              SG + P+ G  P+L  L+++ N+L+G +PPEI  ++ L+ L +   N F    P ++  
Sbjct  175   FSGEIPPEFGSFPYLEYLAVSGNELTGAIPPEIGNLTQLKELYIGYYNAFTGGMPKEIGN  234

Query  554   LANLQVLDLYNNNLTGDLPVEVYKM------------------------TSLRHLHLGGN  661
             L+ L  LD  N  LTG++P E+  +                         SL+ + L  N
Sbjct  235   LSQLVRLDAANCGLTGEIPPEIGNLQNLDTLFLQVNGLSGSLTPELGNLKSLKSMDLSNN  294

Query  662   YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
              FSG IPP +    N+  L +  N L+G IP  IG L +L+ L + + N F+G IP  +G
Sbjct  295   MFSGEIPPSFAELKNMTLLNLFRNKLTGSIPDFIGELPELEVLQL-WENNFTGIIPQSLG  353

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
                 L   D ++  LTG LP  +     L TL    N L G +   +G  K+L  + +  
Sbjct  354   TNGNLQEVDVSSNKLTGNLPPNLCNGNQLRTLITLGNFLFGPIPESLGQCKSLTRIRMGE  413

Query  1022  nAFSGEIPE  1048
             N  +G IP+
Sbjct  414   NYLNGSIPK  422


 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 72/224 (32%), Positives = 112/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  367   KLTGNLPPNLCNGNQLRTLITLGNFLFGPIPESLGQCKSLTRIRMGENYLNGSIPKGLLS  426

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N L+G  P      TSL  + L  N+ +G +PP  G F  ++ L + GN
Sbjct  427   LPKLTQVELQDNLLSGTFPETDGLSTSLGQISLSDNHLTGPLPPSIGNFVGVQKLLLDGN  486

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP+EIG L +L ++   + N  +G I PE+     L   D +   L+G++P EI 
Sbjct  487   KFSGRIPAEIGKLQQLSKMDFSH-NELTGLIAPEISQCKLLTFVDLSRNQLSGDIPTEIT  545

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L S+D S N  SG +P
Sbjct  546   GMRILNYLNLSRNHLVGSIPSSIASMQSLTSVDFSYNNLSGLVP  589


 Score = 88.6 bits (218),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 99/203 (49%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L +N+   TFP      
Sbjct  392  LFGPIPESLGQCKSLTRIRMGENYLNGSIPKGLLSLPKLTQVELQDNLLSGTFPETDGLS  451

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             +L  + L +N+LTG LP  +     ++ L L GN FSGRIP E G+   L  +  S N 
Sbjct  452  TSLGQISLSDNHLTGPLPPSIGNFVGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSHNE  511

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G+I  EI     L  + +   N  SG IP E+  +  L   + +   L G +P  I  
Sbjct  512  LTGLIAPEISQCKLLTFVDLSR-NQLSGDIPTEITGMRILNYLNLSRNHLVGSIPSSIAS  570

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            +++L ++    N+LSG L P  G
Sbjct  571  MQSLTSVDFSYNNLSG-LVPGTG  592



>ref|XP_009786199.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1015

 Score =   367 bits (943),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 200/287 (70%), Positives = 237/287 (83%), Gaps = 2/287 (1%)
 Frame = +2

Query  191   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldl  364
             + A KP  + E  ALLS+K A + D QS+L SWN ST  SHCTW+ VTCD   HV SL++
Sbjct  15    SAAAKPHFLPEYRALLSLKTAISDDPQSALISWNSSTTTSHCTWKGVTCDKYRHVTSLNI  74

Query  365   sglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  544
             S LNL+G L P++GQL +LVNLS+A NQ SGP+P E+S IS LR+LNLSNNIF  +FP Q
Sbjct  75    SNLNLTGTLPPEIGQLRYLVNLSVAVNQFSGPIPVELSVISNLRYLNLSNNIFNLSFPQQ  134

Query  545   LAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  724
             L QL NL+VLD+YNNNLTG LPV V+ +T+L HLHLGGN+F+GRIPPE+G+FP L+YLAV
Sbjct  135   LTQLINLEVLDIYNNNLTGQLPVGVHNLTNLYHLHLGGNFFTGRIPPEFGKFPFLKYLAV  194

Query  725   SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPV  904
             SGN L+G IP EIGN+T LKELY+GY+N FSGGIPPE+GNLS+L+RFDAANCGL+GE+P 
Sbjct  195   SGNELAGDIPPEIGNITTLKELYVGYYNTFSGGIPPEIGNLSELVRFDAANCGLSGEIPA  254

Query  905   EIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             EIGKLK LDTLFLQVN LSGSL PEIGYLK+LKSLDLSNN  SGEIP
Sbjct  255   EIGKLKKLDTLFLQVNSLSGSLIPEIGYLKSLKSLDLSNNLLSGEIP  301


 Score =   110 bits (275),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 117/224 (52%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             +LSG L P++G L  L +L ++ N LSG +P  +S +  L  LNL  N    + P  + +
Sbjct  271   SLSGSLIPEIGYLKSLKSLDLSNNLLSGEIPLTLSELKNLTLLNLFRNKLYGSIPEFIEE  330

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L+VL L+ NN TG +P+ + + + L+ L +  N  +G +PP   R  NLE L   GN
Sbjct  331   LPKLEVLQLWENNFTGSIPMGLGQNSKLKTLDISTNKLTGNLPPNMCRGNNLETLITLGN  390

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  +G    L  + +G  N  +G IP  + +L +L + +  +  LTG  PV   
Sbjct  391   FLFGPIPESLGQCESLSRIRMGE-NYLNGSIPKGLLSLPKLTQVELQDNLLTGTFPVTGS  449

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
                +L  + L  N L+G L P IG    ++ L L  N FSG IP
Sbjct  450   VSASLGQISLSNNRLTGRLPPSIGNFSGVQKLLLDGNKFSGRIP  493


 Score =   108 bits (269),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 78/224 (35%), Positives = 116/224 (52%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++ +   L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  367   KLTGNLPPNMCRGNNLETLITLGNFLFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLS  426

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N LTG  PV      SL  + L  N  +GR+PP  G F  ++ L + GN
Sbjct  427   LPKLTQVELQDNLLTGTFPVTGSVSASLGQISLSNNRLTGRLPPSIGNFSGVQKLLLDGN  486

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP+EIG L +L ++     NGFSG IPPE+ +   L   D +   L+GE+P EI 
Sbjct  487   KFSGRIPAEIGKLQQLSKMDFSG-NGFSGPIPPEISHCKALTFVDLSRNKLSGEIPTEIT  545

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L +  N L GS+   I  +++L S+D S N  SG +P
Sbjct  546   GMRILNYLNVSRNHLVGSIPASISAMQSLTSVDFSYNNLSGLVP  589


 Score =   106 bits (264),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 125/248 (50%), Gaps = 24/248 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              +G + P+ G+ PFL  L+++ N+L+G +PPEI  I+TL+ L +   N F    P ++  
Sbjct  175   FTGRIPPEFGKFPFLKYLAVSGNELAGDIPPEIGNITTLKELYVGYYNTFSGGIPPEIGN  234

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L+ L   D  N  L+G++P E+ K+  L  L L  N  SG + PE G   +L+ L +S N
Sbjct  235   LSELVRFDAANCGLSGEIPAEIGKLKKLDTLFLQVNSLSGSLIPEIGYLKSLKSLDLSNN  294

Query  734   GLSGVIP---SEIGNLTKLK--------------------ELYIGYFNGFSGGIPPEMGN  844
              LSG IP   SE+ NLT L                     E+   + N F+G IP  +G 
Sbjct  295   LLSGEIPLTLSELKNLTLLNLFRNKLYGSIPEFIEELPKLEVLQLWENNFTGSIPMGLGQ  354

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
              S+L   D +   LTG LP  + +  NL+TL    N L G +   +G  ++L  + +  N
Sbjct  355   NSKLKTLDISTNKLTGNLPPNMCRGNNLETLITLGNFLFGPIPESLGQCESLSRIRMGEN  414

Query  1025  AFSGEIPE  1048
               +G IP+
Sbjct  415   YLNGSIPK  422


 Score = 98.6 bits (244),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 103/203 (51%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L +N+   TFP   +  
Sbjct  392  LFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLSLPKLTQVELQDNLLTGTFPVTGSVS  451

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
            A+L  + L NN LTG LP  +   + ++ L L GN FSGRIP E G+   L  +  SGNG
Sbjct  452  ASLGQISLSNNRLTGRLPPSIGNFSGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSGNG  511

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             SG IP EI +   L  + +   N  SG IP E+  +  L   + +   L G +P  I  
Sbjct  512  FSGPIPPEISHCKALTFVDLSR-NKLSGEIPTEITGMRILNYLNVSRNHLVGSIPASISA  570

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            +++L ++    N+LSG L P  G
Sbjct  571  MQSLTSVDFSYNNLSG-LVPGTG  592



>ref|XP_009771232.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1019

 Score =   367 bits (941),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 202/292 (69%), Positives = 233/292 (80%), Gaps = 0/292 (0%)
 Frame = +2

Query  179   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsl  358
             H     AGK   + E  ALL++K A T D Q +L SWNISTSHCTW+ VTCD   HV SL
Sbjct  14    HFTHFTAGKQPRIPEYQALLALKTAITDDPQLALASWNISTSHCTWKGVTCDRYRHVTSL  73

Query  359   dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  538
             D+SG N++G L P+VG L FL NLS+  NQ SGP+P EIS I  L +LNLSNNIF   FP
Sbjct  74    DISGFNVTGTLPPEVGNLRFLQNLSVDLNQFSGPIPVEISFIPNLHYLNLSNNIFSLGFP  133

Query  539   HQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL  718
              QL +L NL+VLDLYNNN+TGDLPV+VY+MT+LRHLHLGGN+F GRIPPEYGRF  LEYL
Sbjct  134   PQLTRLRNLKVLDLYNNNMTGDLPVDVYQMTNLRHLHLGGNFFGGRIPPEYGRFQFLEYL  193

Query  719   AVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGEL  898
             AVSGN L G IP EIGN+T L ELY+GY+N FSGGIPPE+GNLSQL+RFDAANCGL+GE+
Sbjct  194   AVSGNELVGEIPPEIGNITTLHELYVGYYNTFSGGIPPEIGNLSQLVRFDAANCGLSGEI  253

Query  899   PVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             P E+GKL+NLDTLFLQVN LSGSL PEIG LK+LKSLDLSNN  SGE+P +F
Sbjct  254   PAELGKLQNLDTLFLQVNSLSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTF  305


 Score =   110 bits (276),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 114/224 (51%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             +LSG L+P++G L  L +L ++ N LSG VPP  + +  L  LNL  N    + P  +  
Sbjct  272   SLSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADLKNLTLLNLFRNKLHGSIPEFIGD  331

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L+VL L+ NN TG +P  +   + L++L L  N  +G +PP      NL+ +   GN
Sbjct  332   LPELEVLQLWENNFTGSIPQGLGTNSKLKNLDLSSNKLTGNLPPNMCAGKNLQTIITLGN  391

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  +G    L  + +G  N  +G IP  + +L QL + +  N  LTG  P    
Sbjct  392   FLFGPIPESLGQCESLSRIRMGE-NYLNGSIPKRLLSLPQLSQVELQNNLLTGTFPETKS  450

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
                +L  + L  N L+GSL   IG    ++ L L  N FSG IP
Sbjct  451   ISTSLGQISLSNNHLTGSLPTSIGNFAGVQKLLLDGNKFSGRIP  494


 Score =   104 bits (260),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 116/225 (52%), Gaps = 2/225 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             L G + P++G +  L  L +   N  SG +PPEI  +S L   + +N       P +L +
Sbjct  200   LVGEIPPEIGNITTLHELYVGYYNTFSGGIPPEIGNLSQLVRFDAANCGLSGEIPAELGK  259

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL  L L  N+L+G L  E+  + SL+ L L  N  SG +PP +    NL  L +  N
Sbjct  260   LQNLDTLFLQVNSLSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADLKNLTLLNLFRN  319

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  IG+L +L+ L + + N F+G IP  +G  S+L   D ++  LTG LP  + 
Sbjct  320   KLHGSIPEFIGDLPELEVLQL-WENNFTGSIPQGLGTNSKLKNLDLSSNKLTGNLPPNMC  378

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPE  1048
               KNL T+    N L G +   +G  ++L  + +  N  +G IP+
Sbjct  379   AGKNLQTIITLGNFLFGPIPESLGQCESLSRIRMGENYLNGSIPK  423


 Score =   104 bits (259),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 114/224 (51%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L  +    N L GP+P  +    +L  + +  N    + P +L  
Sbjct  368   KLTGNLPPNMCAGKNLQTIITLGNFLFGPIPESLGQCESLSRIRMGENYLNGSIPKRLLS  427

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L NN LTG  P      TSL  + L  N+ +G +P   G F  ++ L + GN
Sbjct  428   LPQLSQVELQNNLLTGTFPETKSISTSLGQISLSNNHLTGSLPTSIGNFAGVQKLLLDGN  487

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP+EIG L +L ++   + N FSG I PE+     L   D +   L+GE+P EI 
Sbjct  488   KFSGRIPAEIGKLQQLSKIDFSH-NDFSGPIAPEISKCKLLTYVDLSRNQLSGEIPTEIT  546

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L S+D S N FSG +P
Sbjct  547   GMRILNYLNLSRNHLVGSIPAPISSMQSLTSVDFSYNNFSGLVP  590


 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/203 (32%), Positives = 97/203 (48%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L NN+   TFP   +  
Sbjct  393  LFGPIPESLGQCESLSRIRMGENYLNGSIPKRLLSLPQLSQVELQNNLLTGTFPETKSIS  452

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             +L  + L NN+LTG LP  +     ++ L L GN FSGRIP E G+   L  +  S N 
Sbjct  453  TSLGQISLSNNHLTGSLPTSIGNFAGVQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHND  512

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             SG I  EI     L  + +   N  SG IP E+  +  L   + +   L G +P  I  
Sbjct  513  FSGPIAPEISKCKLLTYVDLSR-NQLSGEIPTEITGMRILNYLNLSRNHLVGSIPAPISS  571

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            +++L ++    N+ SG L P  G
Sbjct  572  MQSLTSVDFSYNNFSG-LVPGTG  593



>ref|XP_009605676.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1017

 Score =   362 bits (930),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 201/292 (69%), Positives = 231/292 (79%), Gaps = 0/292 (0%)
 Frame = +2

Query  179   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsl  358
             H     AGK   + E  ALL++K A   D Q +L SWN STSHCTW+ VTCD   HV SL
Sbjct  13    HFTHFTAGKHPRIPEYQALLALKTAIIDDPQLALASWNNSTSHCTWKGVTCDRYRHVTSL  72

Query  359   dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  538
             D+SG N++G L P+VG   FL NLS+A NQ SGP+P EIS I  L +LNLSNNIF   FP
Sbjct  73    DISGFNVTGTLPPEVGNFRFLQNLSVALNQFSGPIPVEISFIPNLHYLNLSNNIFSLGFP  132

Query  539   HQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL  718
              QL +L NL+VLDLYNNN+TGDLPV+VY+MT+LRHLHLGGN+F GRIPPEYGRF  LEYL
Sbjct  133   PQLTRLRNLKVLDLYNNNMTGDLPVDVYQMTNLRHLHLGGNFFGGRIPPEYGRFQFLEYL  192

Query  719   AVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGEL  898
             AVSGN L GVIP EIGN+T L ELY+GY+N FSGGIPPE+GNLSQL+RFDAANCGL+GE+
Sbjct  193   AVSGNELVGVIPPEIGNITTLHELYVGYYNTFSGGIPPEIGNLSQLVRFDAANCGLSGEI  252

Query  899   PVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             P EI KL+NLDTLFLQVN LSGSL PEIG LK+LKSLDLSNN  SGE+P +F
Sbjct  253   PAEIEKLQNLDTLFLQVNSLSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTF  304


 Score =   110 bits (275),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 122/271 (45%), Gaps = 47/271 (17%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             +LSG L+P++G L  L +L ++ N LSG VPP  + +  L  LNL  N    + P  +  
Sbjct  271   SLSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADLKNLTLLNLFRNKLHGSIPEFIGD  330

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L+VL L+ NN TG +P  +   + L++L L  N  +G +PP      NL+ +   GN
Sbjct  331   LPELEVLQLWENNFTGSIPHGLGTNSKLKNLDLSSNKLTGSLPPNMCAGKNLQTIITLGN  390

Query  734   GLSGVIPSEIGNLTKLKELYIG--YFNG--------------------------------  811
              L G IP  +G    L  + +G  Y NG                                
Sbjct  391   FLFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLSLPQLSQVELQNNLLTGTFPETKSI  450

Query  812   -------------FSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVN  952
                           +G +P  +GN + + +        +G +PVEIGKL+ L  +    N
Sbjct  451   STSLGQISLSNNHLTGPLPTSIGNFAGVQKLLLDGNKFSGRIPVEIGKLQQLSKIDFSHN  510

Query  953   DLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             D SG +APEI   K L  +DLS N  SGEIP
Sbjct  511   DFSGPIAPEISKCKLLTYVDLSRNQLSGEIP  541


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 117/225 (52%), Gaps = 2/225 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             L GV+ P++G +  L  L +   N  SG +PPEI  +S L   + +N       P ++ +
Sbjct  199   LVGVIPPEIGNITTLHELYVGYYNTFSGGIPPEIGNLSQLVRFDAANCGLSGEIPAEIEK  258

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL  L L  N+L+G L  E+  + SL+ L L  N  SG +PP +    NL  L +  N
Sbjct  259   LQNLDTLFLQVNSLSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADLKNLTLLNLFRN  318

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  IG+L +L+ L + + N F+G IP  +G  S+L   D ++  LTG LP  + 
Sbjct  319   KLHGSIPEFIGDLPELEVLQL-WENNFTGSIPHGLGTNSKLKNLDLSSNKLTGSLPPNMC  377

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPE  1048
               KNL T+    N L G +   +G  ++L  + +  N  +G IP+
Sbjct  378   AGKNLQTIITLGNFLFGPIPESLGQCESLSRIRMGENYLNGSIPK  422


 Score =   101 bits (252),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 112/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L  +    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  367   KLTGSLPPNMCAGKNLQTIITLGNFLFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLS  426

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L NN LTG  P      TSL  + L  N+ +G +P   G F  ++ L + GN
Sbjct  427   LPQLSQVELQNNLLTGTFPETKSISTSLGQISLSNNHLTGPLPTSIGNFAGVQKLLLDGN  486

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP EIG L +L ++   + N FSG I PE+     L   D +   L+GE+P EI 
Sbjct  487   KFSGRIPVEIGKLQQLSKIDFSH-NDFSGPIAPEISKCKLLTYVDLSRNQLSGEIPTEIT  545

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L S+D S N FSG +P
Sbjct  546   GMRILNYLNLSRNHLVGSIPTPISSMQSLTSVDFSYNNFSGLVP  589


 Score = 89.0 bits (219),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 64/203 (32%), Positives = 97/203 (48%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L NN+   TFP   +  
Sbjct  392  LFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLSLPQLSQVELQNNLLTGTFPETKSIS  451

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             +L  + L NN+LTG LP  +     ++ L L GN FSGRIP E G+   L  +  S N 
Sbjct  452  TSLGQISLSNNHLTGPLPTSIGNFAGVQKLLLDGNKFSGRIPVEIGKLQQLSKIDFSHND  511

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             SG I  EI     L  + +   N  SG IP E+  +  L   + +   L G +P  I  
Sbjct  512  FSGPIAPEISKCKLLTYVDLSR-NQLSGEIPTEITGMRILNYLNLSRNHLVGSIPTPISS  570

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            +++L ++    N+ SG L P  G
Sbjct  571  MQSLTSVDFSYNNFSG-LVPGTG  592



>ref|XP_008344369.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Malus domestica]
Length=1015

 Score =   360 bits (924),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 191/283 (67%), Positives = 229/283 (81%), Gaps = 1/283 (0%)
 Frame = +2

Query  209   LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSG  385
             + ++   ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS    V+      L+L+G
Sbjct  20    IAMSNYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTG  79

Query  386   VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  565
              LSPD+  L FL NL++A NQ SGP+PPEISA+S LR LNLSNN+F +TFP +L+ L  L
Sbjct  80    TLSPDLAHLRFLANLTLADNQFSGPIPPEISALSGLRLLNLSNNVFNTTFPXKLSNLTRL  139

Query  566   QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  745
              VLDLYNNNLTGDLPV V  MTSLRHLHLGGN+FSG+IPPE+GRFP LEYLAVSGN L G
Sbjct  140   TVLDLYNNNLTGDLPVSVTHMTSLRHLHLGGNFFSGQIPPEFGRFPFLEYLAVSGNELGG  199

Query  746   VIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKN  925
              IP EIGNLT LKELYIGYFN + GGIPPE+GNLS L+RFDAANC LTGE+P E+G+L+N
Sbjct  200   PIPPEIGNLTTLKELYIGYFNSYEGGIPPEIGNLSNLVRFDAANCNLTGEVPPELGRLQN  259

Query  926   LDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             +DTLFLQVN LSGSL PE+GYLK+LKS+DLSNN F+GEIP SF
Sbjct  260   VDTLFLQVNALSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSF  302


 Score =   101 bits (252),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 82/271 (30%), Positives = 118/271 (44%), Gaps = 47/271 (17%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG L+P++G L  L ++ ++ N  +G +P   S +  L  LNL  N      P  +  L
Sbjct  270   LSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSELKNLTLLNLFRNRLHGAIPDFIGDL  329

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               LQVL L+ NN TG +P  + K   L+ L L  N  +G +PP+     NL+ L    N 
Sbjct  330   PELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSNKLTGTLPPDMCFGNNLQTLITLSNF  389

Query  737   LSGVIPSEIGNLTKLKELYIG--YFNG---------------------------------  811
             L G IP  +G    L  + +G  Y NG                                 
Sbjct  390   LFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLSLPKLTQVELQDNLLDGSFPETDSIS  449

Query  812   ------------FSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVND  955
                          SG +PP +GN S + +        +G +P EIG+L+ L  +  + N 
Sbjct  450   GNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFKHNK  509

Query  956   LSGSLAPEIGYlknlksldlsnnAFSGEIPE  1048
               GS+ PEI + K L  +DLS N  SGEIP+
Sbjct  510   FMGSITPEISHCKLLTFVDLSRNELSGEIPK  540


 Score = 99.8 bits (247),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 80/248 (32%), Positives = 118/248 (48%), Gaps = 25/248 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN+F    P   ++
Sbjct  245   NLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSE  304

Query  554   LAN------------------------LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  661
             L N                        LQVL L+ NN TG +P  + K   L+ L L  N
Sbjct  305   LKNLTLLNLFRNRLHGAIPDFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSN  364

Query  662   YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
               +G +PP+     NL+ L    N L G IP  +G    L  + +G  N  +G IP  + 
Sbjct  365   KLTGTLPPDMCFGNNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGD-NYLNGSIPKGLL  423

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
             +L +L + +  +  L G  P       NL  + L  N LSGSL P IG    ++ L L  
Sbjct  424   SLPKLTQVELQDNLLDGSFPETDSISGNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDG  483

Query  1022  nAFSGEIP  1045
             N FSG IP
Sbjct  484   NKFSGRIP  491


 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 73/224 (33%), Positives = 110/224 (49%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L PD+     L  L   +N L GP+P  +    +L  + + +N    + P  L  
Sbjct  365   KLTGTLPPDMCFGNNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLS  424

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  425   LPKLTQVELQDNLLDGSFPETDSISGNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGN  484

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP EIG L +L ++   + N F G I PE+ +   L   D +   L+GE+P E  
Sbjct  485   KFSGRIPPEIGRLQQLSKIDFKH-NKFMGSITPEISHCKLLTFVDLSRNELSGEIPKEXT  543

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L S+D S N  SG +P
Sbjct  544   GMRILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNNLSGLVP  587



>ref|XP_006364007.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1022

 Score =   360 bits (924),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 199/286 (70%), Positives = 232/286 (81%), Gaps = 0/286 (0%)
 Frame = +2

Query  197   AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  376
               KP  V E  ALLS+K + T D QS+L SWNISTSHCTWR VTCD   HV SLD+SG N
Sbjct  22    TAKPPYVPEYRALLSLKTSITDDPQSALLSWNISTSHCTWRGVTCDRYRHVTSLDISGFN  81

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G L+P+VG L FL+NLS+A NQ SGP+P E+S I  L +LNLSNNIF  +FP QL  L
Sbjct  82    LTGTLTPEVGHLRFLLNLSVAVNQFSGPIPIELSFIPNLSYLNLSNNIFNLSFPPQLTHL  141

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L+VLD+YNNN+TGDLPV VY +T+LRHLHLGGN+FSG IPPEYGRFP LEYLAVSGN 
Sbjct  142   RYLKVLDIYNNNMTGDLPVGVYNLTNLRHLHLGGNFFSGSIPPEYGRFPFLEYLAVSGNA  201

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L G+IP EIGN+T L+ELYIGY+N FSGG+P E+GNLS+LIR DAANCGL+GE+P EIGK
Sbjct  202   LVGMIPPEIGNITTLRELYIGYYNTFSGGLPAEIGNLSELIRLDAANCGLSGEIPPEIGK  261

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             L+ LDTLFLQVN LSGS+ PE+G LK+LKSLDLSNN  SGEIP +F
Sbjct  262   LQKLDTLFLQVNGLSGSVTPELGNLKSLKSLDLSNNMLSGEIPFTF  307


 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 113/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  370   KLTGNLPPNMCSGNKLQTLITLGNFLFGPIPESLGECQSLNRIRMGENFLNGSIPKGLFS  429

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N LTG  PV     +SL  + L  N F+G +P   G F  ++ L + GN
Sbjct  430   LPKLSQVELQDNLLTGTFPVTGSVSSSLGQICLSNNRFTGPLPSSIGNFTGVQKLLLDGN  489

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP+E+G L +L ++     N FSG IPPE+     L   D +   L+GE+P EI 
Sbjct  490   KFSGQIPAELGKLQQLSKMDFSG-NSFSGLIPPEISRCKALTYVDLSRNKLSGEVPTEIT  548

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L +  N L GS+   I  +++L S+D S N  SG +P
Sbjct  549   GMRILNYLNVSRNQLVGSIPAPIAAMQSLTSVDFSYNNLSGLVP  592


 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 76/226 (34%), Positives = 113/226 (50%), Gaps = 1/226 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG + P++G+L  L  L +  N LSG V PE+  + +L+ L+LSNN+     P    +L
Sbjct  251   LSGEIPPEIGKLQKLDTLFLQVNGLSGSVTPELGNLKSLKSLDLSNNMLSGEIPFTFTEL  310

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G+   L  + +S N 
Sbjct  311   KNLTLLNLFRNKLYGSIPEFIEDLPKLEVLQLWENNFTGSIPQGLGKNSKLTNVDISTNK  370

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L+G +P  + +  KL+ L I   N   G IP  +G    L R       L G +P  +  
Sbjct  371   LTGNLPPNMCSGNKLQTL-ITLGNFLFGPIPESLGECQSLNRIRMGENFLNGSIPKGLFS  429

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             L  L  + LQ N L+G+         +L  + LSNN F+G +P S 
Sbjct  430   LPKLSQVELQDNLLTGTFPVTGSVSSSLGQICLSNNRFTGPLPSSI  475


 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 106/204 (52%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   L N+ I+ N+L+G +PP + + + L+  + L N +FG   P  L 
Sbjct  346  NFTGSIPQGLGKNSKLTNVDISTNKLTGNLPPNMCSGNKLQTLITLGNFLFGP-IPESLG  404

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ +  L  + L  N  +G  P       +L  + +S 
Sbjct  405  ECQSLNRIRMGENFLNGSIPKGLFSLPKLSQVELQDNLLTGTFPVTGSVSSSLGQICLSN  464

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N  +G +PS IGN T +++L +   N FSG IP E+G L QL + D +    +G +P EI
Sbjct  465  NRFTGPLPSSIGNFTGVQKLLLDG-NKFSGQIPAELGKLQQLSKMDFSGNSFSGLIPPEI  523

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  + L  N LSG +  EI
Sbjct  524  SRCKALTYVDLSRNKLSGEVPTEI  547


 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 101/203 (50%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   TFP   +  
Sbjct  395  LFGPIPESLGECQSLNRIRMGENFLNGSIPKGLFSLPKLSQVELQDNLLTGTFPVTGSVS  454

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
            ++L  + L NN  TG LP  +   T ++ L L GN FSG+IP E G+   L  +  SGN 
Sbjct  455  SSLGQICLSNNRFTGPLPSSIGNFTGVQKLLLDGNKFSGQIPAELGKLQQLSKMDFSGNS  514

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             SG+IP EI     L  + +   N  SG +P E+  +  L   + +   L G +P  I  
Sbjct  515  FSGLIPPEISRCKALTYVDLSR-NKLSGEVPTEITGMRILNYLNVSRNQLVGSIPAPIAA  573

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            +++L ++    N+LSG L P  G
Sbjct  574  MQSLTSVDFSYNNLSG-LVPGTG  595


 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 100/198 (51%), Gaps = 1/198 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             SG L  ++G L  L+ L  A   LSG +PPEI  +  L  L L  N    +   +L  L
Sbjct  227  FSGGLPAEIGNLSELIRLDAANCGLSGEIPPEIGKLQKLDTLFLQVNGLSGSVTPELGNL  286

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             +L+ LDL NN L+G++P    ++ +L  L+L  N   G IP      P LE L +  N 
Sbjct  287  KSLKSLDLSNNMLSGEIPFTFTELKNLTLLNLFRNKLYGSIPEFIEDLPKLEVLQLWENN  346

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             +G IP  +G  +KL  + I   N  +G +PP M + ++L         L G +P  +G+
Sbjct  347  FTGSIPQGLGKNSKLTNVDIST-NKLTGNLPPNMCSGNKLQTLITLGNFLFGPIPESLGE  405

Query  917  LKNLDTLFLQVNDLSGSL  970
             ++L+ + +  N L+GS+
Sbjct  406  CQSLNRIRMGENFLNGSI  423



>ref|XP_009375880.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1015

 Score =   359 bits (922),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 192/283 (68%), Positives = 228/283 (81%), Gaps = 1/283 (0%)
 Frame = +2

Query  209   LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSG  385
             + ++   ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS    V+      L+L+G
Sbjct  20    IAMSNYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTG  79

Query  386   VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  565
              LSPDV  L FL NL++A NQ SGP+PPEISA+S LR LNLSNN+F +TFP QL+ L  L
Sbjct  80    TLSPDVAHLRFLANLTLAENQFSGPIPPEISALSGLRLLNLSNNVFNTTFPPQLSNLTRL  139

Query  566   QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  745
              VLDLYNNNLTGDLPV V  MTSLRHLHLGGN+FSG+IPPE+GRFP LEYLAVSGN L G
Sbjct  140   TVLDLYNNNLTGDLPVSVTHMTSLRHLHLGGNFFSGQIPPEFGRFPFLEYLAVSGNELGG  199

Query  746   VIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKN  925
              IP EIGNLT LKELYIGYFN + GGIPPE+GNLS L+RFDAANC LTGE+P E+G+L+N
Sbjct  200   PIPPEIGNLTTLKELYIGYFNSYEGGIPPEIGNLSNLVRFDAANCNLTGEIPPEVGRLQN  259

Query  926   LDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             +DTLFLQVN LSGSL  E+GYLK+LKS+DLSNN F+GEIP SF
Sbjct  260   VDTLFLQVNALSGSLTLELGYLKSLKSMDLSNNVFTGEIPGSF  302


 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 80/248 (32%), Positives = 117/248 (47%), Gaps = 25/248 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             NL+G + P+VG+L  +  L +  N LSG +  E+  + +L+ ++LSNN+F    P   ++
Sbjct  245   NLTGEIPPEVGRLQNVDTLFLQVNALSGSLTLELGYLKSLKSMDLSNNVFTGEIPGSFSE  304

Query  554   LAN------------------------LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  661
             L N                        LQVL L+ NN TG +P  + K   L+ L L  N
Sbjct  305   LKNLTLLNLFRNRLHGAIPDFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSN  364

Query  662   YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
               +G +PP+     NL+ L    N L G IP  +G    L  + +G  N  +G IP  + 
Sbjct  365   KLTGTLPPDMCFGNNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGD-NYLNGSIPKGLL  423

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
             +L +L + +  +  L G  P       NL  + L  N LSGSL P IG    ++ L L  
Sbjct  424   SLPKLTQVELQDNLLDGSFPETDSISGNLGQISLSNNRLSGSLPPSIGNFSGVQKLLLDG  483

Query  1022  nAFSGEIP  1045
             N FSG IP
Sbjct  484   NKFSGRIP  491


 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 73/224 (33%), Positives = 111/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L PD+     L  L   +N L GP+P  +    +L  + + +N    + P  L  
Sbjct  365   KLTGTLPPDMCFGNNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLS  424

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  425   LPKLTQVELQDNLLDGSFPETDSISGNLGQISLSNNRLSGSLPPSIGNFSGVQKLLLDGN  484

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP EIG L ++ ++   + N F G I PE+ +   L   D +   L+GE+P EI 
Sbjct  485   KFSGRIPPEIGRLQQVSKMDFKH-NKFMGPITPEISHCKLLTFVDLSRNELSGEIPKEIT  543

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L S+D S N  SG +P
Sbjct  544   GMRILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNNLSGLVP  587



>ref|XP_009354585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1014

 Score =   359 bits (921),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 190/282 (67%), Positives = 229/282 (81%), Gaps = 1/282 (0%)
 Frame = +2

Query  212   GVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGV  388
              +++  ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS    V+      L+L+G 
Sbjct  20    AMSDYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTGT  79

Query  389   LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  568
             LSPD+  L FL NL++A NQ SGP+PP+ISA+S LR LNLSNN+F +TFP QL+ L  L 
Sbjct  80    LSPDLAHLRFLSNLTLAENQFSGPIPPDISALSGLRLLNLSNNVFNTTFPPQLSNLTRLT  139

Query  569   VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  748
             VLDLYNNNLTGDLPV V  MTSLRHLHLGGN+FSG+IPPE+GRFP LEYLAVSGN L G 
Sbjct  140   VLDLYNNNLTGDLPVSVTHMTSLRHLHLGGNFFSGQIPPEFGRFPFLEYLAVSGNELGGS  199

Query  749   IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNL  928
             IP EIGNLT LKELYIGYFN + GG+PPE+GNLS L+RFDAANC LTGE+P E+G+L+N+
Sbjct  200   IPPEIGNLTTLKELYIGYFNSYEGGMPPEIGNLSNLVRFDAANCNLTGEVPPELGRLQNV  259

Query  929   DTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             DTLFLQVN LSGSL PE+GYLK+LKS+DLSNN F+GEIP SF
Sbjct  260   DTLFLQVNALSGSLTPELGYLKSLKSMDLSNNMFTGEIPGSF  301


 Score = 99.0 bits (245),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 78/248 (31%), Positives = 120/248 (48%), Gaps = 25/248 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN+F    P   ++
Sbjct  244   NLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNNMFTGEIPGSFSE  303

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   G+   L+ L +S N
Sbjct  304   LKNLTLLNLFRNRLHGAIPEFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSN  363

Query  734   GLSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
              L+G                         IP  +G    L  + +G  N  +G IP  + 
Sbjct  364   KLTGTLPPDMCFGNSLQTLITLSNFLFGPIPESLGRCDSLSRIRMGD-NFLNGSIPKGLF  422

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
             +L +L + +  +  L G  P       NL  + L  N LSGSL P IG    ++ L L  
Sbjct  423   SLPKLTQVELQDNLLDGSFPETDTISGNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDG  482

Query  1022  nAFSGEIP  1045
             N FSG IP
Sbjct  483   NKFSGRIP  490


 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 110/224 (49%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L PD+     L  L   +N L GP+P  +    +L  + + +N    + P  L  
Sbjct  364   KLTGTLPPDMCFGNSLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNFLNGSIPKGLFS  423

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  424   LPKLTQVELQDNLLDGSFPETDTISGNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGN  483

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP EIG L +L ++   + N F G I PE+     L   D +   L+GE+P EI 
Sbjct  484   KFSGRIPPEIGRLQQLSKMDFKH-NKFMGSITPEISQCKLLTFVDLSRNELSGEIPNEIT  542

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L S+D S N  SG +P
Sbjct  543   GMRILNYLNLSRNHLFGSIPSSISTMQSLTSVDFSYNNLSGLVP  586



>ref|XP_008354741.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1015

 Score =   356 bits (914),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 190/283 (67%), Positives = 228/283 (81%), Gaps = 1/283 (0%)
 Frame = +2

Query  209   LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSG  385
             + ++   ALLS+K++ T+   S+L++W  +TSHCTW  VTCDS    V+      L+L+G
Sbjct  20    IAMSNYRALLSLKSSITSXPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTG  79

Query  386   VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  565
              LSPD+  L FL NL++A NQ SGP+PPEISA+S LR LNLSNN+F +TFP +L+ L  L
Sbjct  80    TLSPDLAHLRFLANLTLADNQFSGPIPPEISALSGLRLLNLSNNVFNTTFPPKLSNLTRL  139

Query  566   QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  745
              VLDLYNNNLTGDLPV V  MTSLRHLHLGGN+FSG+IPPE+GRFP LEYLAVSGN L G
Sbjct  140   TVLDLYNNNLTGDLPVSVTHMTSLRHLHLGGNFFSGQIPPEFGRFPFLEYLAVSGNELGG  199

Query  746   VIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKN  925
              IP EIGNLT LKELYIGYFN + GGIPPE+GNLS L+RFDAANC LTGE+P E+G+L+N
Sbjct  200   PIPPEIGNLTTLKELYIGYFNSYEGGIPPEIGNLSNLVRFDAANCNLTGEVPPELGRLQN  259

Query  926   LDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             +DTLFLQVN LSGSL PE+GYLK+LKS+DLSNN F+GEIP SF
Sbjct  260   VDTLFLQVNALSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSF  302


 Score =   101 bits (252),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 82/271 (30%), Positives = 118/271 (44%), Gaps = 47/271 (17%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG L+P++G L  L ++ ++ N  +G +P   S +  L  LNL  N      P  +  L
Sbjct  270   LSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSELKNLTLLNLFRNRLHGAIPDFIGDL  329

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               LQVL L+ NN TG +P  + K   L+ L L  N  +G +PP+     NL+ L    N 
Sbjct  330   PELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSNKLTGTLPPDMCFGNNLQTLITLSNF  389

Query  737   LSGVIPSEIGNLTKLKELYIG--YFNG---------------------------------  811
             L G IP  +G    L  + +G  Y NG                                 
Sbjct  390   LFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLSLPKLTQVELQDNLLDGSFPETDSIS  449

Query  812   ------------FSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVND  955
                          SG +PP +GN S + +        +G +P EIG+L+ L  +  + N 
Sbjct  450   GNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFKHNK  509

Query  956   LSGSLAPEIGYlknlksldlsnnAFSGEIPE  1048
               GS+ PEI + K L  +DLS N  SGEIP+
Sbjct  510   FMGSITPEISHCKLLTFVDLSRNELSGEIPK  540


 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 80/248 (32%), Positives = 118/248 (48%), Gaps = 25/248 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN+F    P   ++
Sbjct  245   NLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSE  304

Query  554   LAN------------------------LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  661
             L N                        LQVL L+ NN TG +P  + K   L+ L L  N
Sbjct  305   LKNLTLLNLFRNRLHGAIPDFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSN  364

Query  662   YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
               +G +PP+     NL+ L    N L G IP  +G    L  + +G  N  +G IP  + 
Sbjct  365   KLTGTLPPDMCFGNNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGD-NYLNGSIPKGLL  423

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
             +L +L + +  +  L G  P       NL  + L  N LSGSL P IG    ++ L L  
Sbjct  424   SLPKLTQVELQDNLLDGSFPETDSISGNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDG  483

Query  1022  nAFSGEIP  1045
             N FSG IP
Sbjct  484   NKFSGRIP  491


 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 73/224 (33%), Positives = 110/224 (49%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L PD+     L  L   +N L GP+P  +    +L  + + +N    + P  L  
Sbjct  365   KLTGTLPPDMCFGNNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLS  424

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  425   LPKLTQVELQDNLLDGSFPETDSISGNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGN  484

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP EIG L +L ++   + N F G I PE+ +   L   D +   L+GE+P E  
Sbjct  485   KFSGRIPPEIGRLQQLSKIDFKH-NKFMGSITPEISHCKLLTFVDLSRNELSGEIPKEXT  543

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L S+D S N  SG +P
Sbjct  544   GMRILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNNLSGLVP  587



>ref|XP_004234641.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Solanum lycopersicum]
Length=1022

 Score =   356 bits (913),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 198/286 (69%), Positives = 229/286 (80%), Gaps = 0/286 (0%)
 Frame = +2

Query  197   AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  376
               KP  V E  ALLS+K A T D QS+L SWNISTSHCTWR VTCD   HV SLD+SG N
Sbjct  22    TAKPPYVPEYRALLSLKTAITDDPQSALLSWNISTSHCTWRGVTCDRYRHVTSLDISGFN  81

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G L+P+VG L FL+NLS+A NQ SGP+P E+S I  LR+LNLSNNIF  +FP QL  L
Sbjct  82    LTGTLTPEVGHLRFLLNLSVAVNQFSGPIPVELSFIPNLRYLNLSNNIFNLSFPPQLTHL  141

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L VLD+YNNN+TG+LPV  Y +T+LRHLHLGGN+FSG IPPEYGRFP LEYLAVSGN 
Sbjct  142   RYLNVLDIYNNNMTGELPVGFYNLTNLRHLHLGGNFFSGSIPPEYGRFPFLEYLAVSGNA  201

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L G IP EIGN+T L+ELYIGY+N FSGG+P E+G LS+LIR DAANCGL+GE+P EIGK
Sbjct  202   LVGRIPPEIGNITTLRELYIGYYNTFSGGLPAEIGYLSELIRLDAANCGLSGEIPPEIGK  261

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             L+ LDTLFLQVN LSGS+ PE+G LK+LKSLDLSNN  SGEIP +F
Sbjct  262   LQKLDTLFLQVNGLSGSVTPELGNLKSLKSLDLSNNMLSGEIPLTF  307


 Score = 99.4 bits (246),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 111/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  370   KLTGNLPPNMCSGNKLQTLITLGNFLFGPIPESLGECQSLNRIRMGENFLNGSIPKGLLS  429

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N LTG  PV      SL  + L  N F+G +P   G F  ++ L + GN
Sbjct  430   LPKLSQVELQDNLLTGTFPVTDSVSASLGQICLSNNRFTGPLPSSIGNFTAVQKLLLDGN  489

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP E+G L +L ++     N FSG IPPE+     L   D +   L+GE+P EI 
Sbjct  490   KFSGQIPGELGKLQQLSKMDFS-GNSFSGLIPPEISRCKALTYVDLSRNKLSGEVPTEIT  548

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L +  N L GS+   I  +++L S+D S N  SG +P
Sbjct  549   GMRILNYLNVSRNQLVGSIPAPIAAMQSLTSVDFSYNNLSGLVP  592


 Score = 98.6 bits (244),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 113/226 (50%), Gaps = 1/226 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG + P++G+L  L  L +  N LSG V PE+  + +L+ L+LSNN+     P    +L
Sbjct  251   LSGEIPPEIGKLQKLDTLFLQVNGLSGSVTPELGNLKSLKSLDLSNNMLSGEIPLTFTEL  310

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  +  M  L  L L  N F+G IP   G+   L  + +S N 
Sbjct  311   KNLTLLNLFRNKLYGSMPEFIEDMPKLEVLQLWENNFTGSIPQGLGKNSKLTNVDISTNK  370

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L+G +P  + +  KL+ L I   N   G IP  +G    L R       L G +P  +  
Sbjct  371   LTGNLPPNMCSGNKLQTL-ITLGNFLFGPIPESLGECQSLNRIRMGENFLNGSIPKGLLS  429

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             L  L  + LQ N L+G+         +L  + LSNN F+G +P S 
Sbjct  430   LPKLSQVELQDNLLTGTFPVTDSVSASLGQICLSNNRFTGPLPSSI  475


 Score = 92.8 bits (229),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 105/204 (51%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   L N+ I+ N+L+G +PP + + + L+  + L N +FG   P  L 
Sbjct  346  NFTGSIPQGLGKNSKLTNVDISTNKLTGNLPPNMCSGNKLQTLITLGNFLFGP-IPESLG  404

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  +  +  L  + L  N  +G  P       +L  + +S 
Sbjct  405  ECQSLNRIRMGENFLNGSIPKGLLSLPKLSQVELQDNLLTGTFPVTDSVSASLGQICLSN  464

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N  +G +PS IGN T +++L +   N FSG IP E+G L QL + D +    +G +P EI
Sbjct  465  NRFTGPLPSSIGNFTAVQKLLLD-GNKFSGQIPGELGKLQQLSKMDFSGNSFSGLIPPEI  523

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  + L  N LSG +  EI
Sbjct  524  SRCKALTYVDLSRNKLSGEVPTEI  547


 Score = 92.0 bits (227),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 64/203 (32%), Positives = 102/203 (50%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   TFP   +  
Sbjct  395  LFGPIPESLGECQSLNRIRMGENFLNGSIPKGLLSLPKLSQVELQDNLLTGTFPVTDSVS  454

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
            A+L  + L NN  TG LP  +   T+++ L L GN FSG+IP E G+   L  +  SGN 
Sbjct  455  ASLGQICLSNNRFTGPLPSSIGNFTAVQKLLLDGNKFSGQIPGELGKLQQLSKMDFSGNS  514

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             SG+IP EI     L  + +   N  SG +P E+  +  L   + +   L G +P  I  
Sbjct  515  FSGLIPPEISRCKALTYVDLSR-NKLSGEVPTEITGMRILNYLNVSRNQLVGSIPAPIAA  573

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            +++L ++    N+LSG L P  G
Sbjct  574  MQSLTSVDFSYNNLSG-LVPGTG  595


 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 101/198 (51%), Gaps = 1/198 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             SG L  ++G L  L+ L  A   LSG +PPEI  +  L  L L  N    +   +L  L
Sbjct  227  FSGGLPAEIGYLSELIRLDAANCGLSGEIPPEIGKLQKLDTLFLQVNGLSGSVTPELGNL  286

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             +L+ LDL NN L+G++P+   ++ +L  L+L  N   G +P      P LE L +  N 
Sbjct  287  KSLKSLDLSNNMLSGEIPLTFTELKNLTLLNLFRNKLYGSMPEFIEDMPKLEVLQLWENN  346

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             +G IP  +G  +KL  + I   N  +G +PP M + ++L         L G +P  +G+
Sbjct  347  FTGSIPQGLGKNSKLTNVDIST-NKLTGNLPPNMCSGNKLQTLITLGNFLFGPIPESLGE  405

Query  917  LKNLDTLFLQVNDLSGSL  970
             ++L+ + +  N L+GS+
Sbjct  406  CQSLNRIRMGENFLNGSI  423



>gb|EYU41357.1| hypothetical protein MIMGU_mgv1a000718mg [Erythranthe guttata]
Length=1006

 Score =   355 bits (911),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 232/291 (80%), Gaps = 1/291 (0%)
 Frame = +2

Query  185   AGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsld  361
              G+ A  P  + E  ALLSIKAA T D QS+L SWN +T HCTWR VTCD+    V SLD
Sbjct  16    GGSAAATPPHMPEYRALLSIKAAITDDPQSALASWNATTHHCTWRGVTCDASGRRVASLD  75

Query  362   lsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  541
             +S L+L+GVLSPDVG+L FLVN S AAN LSGP+PP+IS I  LR LNLSNN+F  +FP 
Sbjct  76    ISNLSLAGVLSPDVGRLRFLVNFSAAANFLSGPIPPQISDIPNLRHLNLSNNVFNLSFPA  135

Query  542   QLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLA  721
             +L  L NL+VLD+YNNN+TGD P + Y +T+LRHLHLGGN+F+G  PPE+G FP+LEYLA
Sbjct  136   ELYHLKNLEVLDVYNNNMTGDFPSQAYLLTNLRHLHLGGNFFTGVFPPEFGSFPHLEYLA  195

Query  722   VSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELP  901
             VSGN L+G IP +IGNLT LKELYIGYFN F+GGIP E+GNLS LIRFDAANCGL+G++P
Sbjct  196   VSGNELTGAIPPQIGNLTHLKELYIGYFNTFTGGIPKEIGNLSNLIRFDAANCGLSGQIP  255

Query  902   VEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
              EIG L+NLDTLFLQVN +SG L PE+G LK+LKS+DLSNN  SGEIP SF
Sbjct  256   AEIGNLQNLDTLFLQVNGISGGLPPELGNLKSLKSMDLSNNILSGEIPPSF  306


 Score =   105 bits (262),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 107/203 (53%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
             +GV  P+ G  P L  L+++ N+L+G +PP+I  ++ L+ L +   N F    P ++  
Sbjct  177  FTGVFPPEFGSFPHLEYLAVSGNELTGAIPPQIGNLTHLKELYIGYFNTFTGGIPKEIGN  236

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L+NL   D  N  L+G +P E+  + +L  L L  N  SG +PPE G   +L+ + +S N
Sbjct  237  LSNLIRFDAANCGLSGQIPAEIGNLQNLDTLFLQVNGISGGLPPELGNLKSLKSMDLSNN  296

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
             LSG IP     L  +  L + + N F+G IP  +G+L +L          TG +P  +G
Sbjct  297  ILSGEIPPSFSQLQNITLLNL-FRNKFTGSIPDFIGDLPELQVLQLWENNFTGIIPQNLG  355

Query  914  KLKNLDTLFLQVNDLSGSLAPEI  982
               NL+ + L  N L+G+L P +
Sbjct  356  DNGNLEEVDLSSNKLTGNLPPNL  378


 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 82/271 (30%), Positives = 118/271 (44%), Gaps = 48/271 (18%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             +SG L P++G L  L ++ ++ N LSG +PP  S +  +  LNL  N F  + P  +  L
Sbjct  274   ISGGLPPELGNLKSLKSMDLSNNILSGEIPPSFSQLQNITLLNLFRNKFTGSIPDFIGDL  333

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               LQVL L+ NN TG +P  +    +L  + L  N  +G +PP       L  L   GN 
Sbjct  334   PELQVLQLWENNFTGIIPQNLGDNGNLEEVDLSSNKLTGNLPPNLCNGNQLNTLITLGNF  393

Query  737   LSGVIPSEIGNLTKLKELYIG--YFNG---------------------------------  811
             L G IP  +G    L  + +G  Y NG                                 
Sbjct  394   LFGPIPDSLGRCGSLGRIRMGENYLNGSIPKGLLSLPKLTQVELQDNLLSGEFPNTDGIL  453

Query  812   -------------FSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVN  952
                           +G +PP +GN + + +        +GE+P EIGKL+ L  +    N
Sbjct  454   STTLGQISLSNNHLAGRLPPSIGNFAAVQKLLLDGNKFSGEIPAEIGKLQQLSKIDFSRN  513

Query  953   DLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             D SG ++PEI   K L  +DLS+N  SG IP
Sbjct  514   DFSGQISPEISRCKLLTFVDLSHNRLSGPIP  544


 Score = 99.8 bits (247),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 81/247 (33%), Positives = 122/247 (49%), Gaps = 24/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG +  ++G L  L  L +  N +SG +PPE+  + +L+ ++LSNNI     P   +QL
Sbjct  250   LSGQIPAEIGNLQNLDTLFLQVNGISGGLPPELGNLKSLKSMDLSNNILSGEIPPSFSQL  309

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              N+ +L+L+ N  TG +P  +  +  L+ L L  N F+G IP   G   NLE + +S N 
Sbjct  310   QNITLLNLFRNKFTGSIPDFIGDLPELQVLQLWENNFTGIIPQNLGDNGNLEEVDLSSNK  369

Query  737   LSGVIPSEIGNLTKLKELY-IGYF----------------------NGFSGGIPPEMGNL  847
             L+G +P  + N  +L  L  +G F                      N  +G IP  + +L
Sbjct  370   LTGNLPPNLCNGNQLNTLITLGNFLFGPIPDSLGRCGSLGRIRMGENYLNGSIPKGLLSL  429

Query  848   SQLIRFDAANCGLTGELPVEIGKLK-NLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
              +L + +  +  L+GE P   G L   L  + L  N L+G L P IG    ++ L L  N
Sbjct  430   PKLTQVELQDNLLSGEFPNTDGILSTTLGQISLSNNHLAGRLPPSIGNFAAVQKLLLDGN  489

Query  1025  AFSGEIP  1045
              FSGEIP
Sbjct  490   KFSGEIP  496


 Score = 98.6 bits (244),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 75/226 (33%), Positives = 118/226 (52%), Gaps = 2/226 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G L P++     L  L    N L GP+P  +    +L  + +  N    + P  L  L
Sbjct  370   LTGNLPPNLCNGNQLNTLITLGNFLFGPIPDSLGRCGSLGRIRMGENYLNGSIPKGLLSL  429

Query  557   ANLQVLDLYNNNLTGDLP-VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
               L  ++L +N L+G+ P  +    T+L  + L  N+ +GR+PP  G F  ++ L + GN
Sbjct  430   PKLTQVELQDNLLSGEFPNTDGILSTTLGQISLSNNHLAGRLPPSIGNFAAVQKLLLDGN  489

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP+EIG L +L ++     N FSG I PE+     L   D ++  L+G +P EI 
Sbjct  490   KFSGEIPAEIGKLQQLSKIDFSR-NDFSGQISPEISRCKLLTFVDLSHNRLSGPIPTEIT  548

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
              +K L+ L L  N+L G++   I  +++L S+D S N FSG +P +
Sbjct  549   SMKILNYLNLSRNNLMGNIPSSISGMQSLTSVDFSYNNFSGLVPAT  594


 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 68/225 (30%), Positives = 114/225 (51%), Gaps = 1/225 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
              +G +  ++G L  L+    A   LSG +P EI  +  L  L L  N      P +L  L
Sbjct  226   FTGGIPKEIGNLSNLIRFDAANCGLSGQIPAEIGNLQNLDTLFLQVNGISGGLPPELGNL  285

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              +L+ +DL NN L+G++P    ++ ++  L+L  N F+G IP   G  P L+ L +  N 
Sbjct  286   KSLKSMDLSNNILSGEIPPSFSQLQNITLLNLFRNKFTGSIPDFIGDLPELQVLQLWENN  345

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
              +G+IP  +G+   L+E+ +   N  +G +PP + N +QL         L G +P  +G+
Sbjct  346   FTGIIPQNLGDNGNLEEVDLSS-NKLTGNLPPNLCNGNQLNTLITLGNFLFGPIPDSLGR  404

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
               +L  + +  N L+GS+   +  L  L  ++L +N  SGE P +
Sbjct  405   CGSLGRIRMGENYLNGSIPKGLLSLPKLTQVELQDNLLSGEFPNT  449


 Score = 76.6 bits (187),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 94/198 (47%), Gaps = 4/198 (2%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQ  553
            L+G +   +  LP L  + +  N LSG  P     +ST L  ++LSNN      P  +  
Sbjct  418  LNGSIPKGLLSLPKLTQVELQDNLLSGEFPNTDGILSTTLGQISLSNNHLAGRLPPSIGN  477

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             A +Q L L  N  +G++P E+ K+  L  +    N FSG+I PE  R   L ++ +S N
Sbjct  478  FAAVQKLLLDGNKFSGEIPAEIGKLQQLSKIDFSRNDFSGQISPEISRCKLLTFVDLSHN  537

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
             LSG IP+EI ++  L  L +   N   G IP  +  +  L   D +    +G +P   G
Sbjct  538  RLSGPIPTEITSMKILNYLNLSR-NNLMGNIPSSISGMQSLTSVDFSYNNFSGLVPA-TG  595

Query  914  KLKNLD-TLFLQVNDLSG  964
            +    + T FL   DL G
Sbjct  596  QFSYFNRTSFLGNPDLCG  613


 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            + SG +SP++ +   L  + ++ N+LSGP+P EI+++  L +LNLS N      P  ++ 
Sbjct  514  DFSGQISPEISRCKLLTFVDLSHNRLSGPIPTEITSMKILNYLNLSRNNLMGNIPSSISG  573

Query  554  LANLQVLDLYNNNLTGDLP  610
            + +L  +D   NN +G +P
Sbjct  574  MQSLTSVDFSYNNFSGLVP  592



>ref|XP_008393812.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1014

 Score =   354 bits (909),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 188/282 (67%), Positives = 227/282 (80%), Gaps = 1/282 (0%)
 Frame = +2

Query  212   GVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGV  388
              +++  ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS    V+      L+L+G 
Sbjct  20    AMSDYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTGT  79

Query  389   LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  568
             LSPD+  L FL NL++A NQ SGP+PP+ISA+S LR LNLSNN+F +TFP QL+ L  L 
Sbjct  80    LSPDLAHLRFLSNLTLAENQFSGPIPPDISALSGLRLLNLSNNVFNTTFPRQLSNLTRLT  139

Query  569   VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  748
             VLDLYNNNLTG LPV V  MTSLRHLHLGGN+FSG+IPPE+GRFP LEYLAVSGN L G 
Sbjct  140   VLDLYNNNLTGKLPVSVTHMTSLRHLHLGGNFFSGQIPPEFGRFPFLEYLAVSGNELGGS  199

Query  749   IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNL  928
             IP EIGNLT LKELYIGYFN + GGIPPE+GNLS L+RFDAANC LTGE+P E+G+L+N+
Sbjct  200   IPPEIGNLTTLKELYIGYFNSYEGGIPPEIGNLSNLVRFDAANCNLTGEVPPELGRLQNV  259

Query  929   DTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             DTLFLQVN LSG L PE+GYLK+LKS+DLSNN ++GEIP SF
Sbjct  260   DTLFLQVNALSGWLTPELGYLKSLKSMDLSNNMYTGEIPGSF  301


 Score = 98.6 bits (244),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 82/271 (30%), Positives = 121/271 (45%), Gaps = 47/271 (17%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG L+P++G L  L ++ ++ N  +G +P   S +  L  LNL  N      P  +  L
Sbjct  269   LSGWLTPELGYLKSLKSMDLSNNMYTGEIPGSFSELKNLTLLNLFRNRLHGAIPEFIGDL  328

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEY---------------  691
               LQVL L+ NN TG +P  + K   L+ L L  N  +G +PP+                
Sbjct  329   PELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSNKLTGTLPPDMCFGNSLQTLITLSNF  388

Query  692   ---------GRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYI------GYF-------  805
                      GR  +L  + +  N L+G IP  +  L KL ++ +      G F       
Sbjct  389   LFGPIPESLGRCDSLSRIRMGDNFLNGSIPKGLFXLPKLTQVELQDNLLDGSFPETDTIS  448

Query  806   ----------NGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVND  955
                       N  SG +PP +GN S + +        +G +P EIG+L+ L  +  + N 
Sbjct  449   GNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKMDFKHNK  508

Query  956   LSGSLAPEIGYlknlksldlsnnAFSGEIPE  1048
               GS+ PEI   K L  +DLS N  SGEIP+
Sbjct  509   FMGSITPEISLCKLLTFVDLSRNELSGEIPK  539


 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 77/248 (31%), Positives = 119/248 (48%), Gaps = 25/248 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN++    P   ++
Sbjct  244   NLTGEVPPELGRLQNVDTLFLQVNALSGWLTPELGYLKSLKSMDLSNNMYTGEIPGSFSE  303

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   G+   L+ L +S N
Sbjct  304   LKNLTLLNLFRNRLHGAIPEFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSN  363

Query  734   GLSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
              L+G                         IP  +G    L  + +G  N  +G IP  + 
Sbjct  364   KLTGTLPPDMCFGNSLQTLITLSNFLFGPIPESLGRCDSLSRIRMGD-NFLNGSIPKGLF  422

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
              L +L + +  +  L G  P       NL  + L  N LSGSL P IG    ++ L L  
Sbjct  423   XLPKLTQVELQDNLLDGSFPETDTISGNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDG  482

Query  1022  nAFSGEIP  1045
             N FSG IP
Sbjct  483   NKFSGRIP  490


 Score = 95.9 bits (237),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 110/224 (49%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L PD+     L  L   +N L GP+P  +    +L  + + +N    + P  L  
Sbjct  364   KLTGTLPPDMCFGNSLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNFLNGSIPKGLFX  423

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  424   LPKLTQVELQDNLLDGSFPETDTISGNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGN  483

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP EIG L +L ++   + N F G I PE+     L   D +   L+GE+P EI 
Sbjct  484   KFSGRIPPEIGRLQQLSKMDFKH-NKFMGSITPEISLCKLLTFVDLSRNELSGEIPKEIT  542

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L S+D S N  SG +P
Sbjct  543   GMRILNYLNLSRNHLXGSIPSSISTMQSLTSVDFSYNNLSGLVP  586



>gb|AIT56194.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Dimocarpus longan]
Length=1015

 Score =   352 bits (902),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 193/280 (69%), Positives = 231/280 (83%), Gaps = 0/280 (0%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  394
             V+E  ALLSIK+A +ADSQ++L+SWN +TSHCTW  VTCDS  HV SLDL  LNLSG LS
Sbjct  21    VSEYRALLSIKSALSADSQAALSSWNATTSHCTWTGVTCDSRHHVTSLDLRDLNLSGTLS  80

Query  395   PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  574
              DV  L FL NL++AANQ SGP+PPEIS +S LRFLNLSNN+F  +FP QLA+LANL+V+
Sbjct  81    SDVAHLQFLRNLTVAANQFSGPIPPEISQLSALRFLNLSNNVFNGSFPSQLARLANLEVM  140

Query  575   DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  754
             DLYNNN+T +LPV V ++ +L HLHLGGN+FSG IP EYG +  LEYLAVSGN L G IP
Sbjct  141   DLYNNNMTDELPVGVTQLRNLHHLHLGGNFFSGEIPAEYGGWEFLEYLAVSGNELVGKIP  200

Query  755   SEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDT  934
              EIGNLT L+ELYIGY+N ++GG+PPE+GNLS L+R DAANC L+GE+P EIGKL+ LDT
Sbjct  201   PEIGNLTTLRELYIGYYNTYTGGLPPEIGNLSSLVRLDAANCALSGEIPGEIGKLQKLDT  260

Query  935   LFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             LFLQVN LSG+LA E+G LK+LKS+DLSNN F+GEIP SF
Sbjct  261   LFLQVNGLSGTLARELGNLKSLKSMDLSNNMFTGEIPASF  300


 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 110/224 (49%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  363   KLTGTLPPDMCSGNRLETLITLGNFLFGPIPESLGKCQSLSRIRMGENFLNGSIPKGLFG  422

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N LTG+ PV      SL  + L  N  SG +P   G F  ++ L + GN
Sbjct  423   LPKLTQVELQDNYLTGEFPVTDSISVSLGQITLSNNQLSGSLPASIGNFSGVQKLLLDGN  482

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP E+G+L +L ++     N FSG I PE+     L   D +   L+G +P EI 
Sbjct  483   KFSGQIPPEVGSLKQLSKMGFSD-NRFSGQIAPEISKCKLLTFVDLSRNELSGVVPNEIT  541

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              +K L+ L L  N L GS+   I  +++L S+D S N  SG +P
Sbjct  542   GMKILNYLNLSRNHLVGSIPAAIASMQSLTSVDFSYNNLSGLVP  585


 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 116/247 (47%), Gaps = 25/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+F    P   A+L
Sbjct  244   LSGEIPGEIGKLQKLDTLFLQVNGLSGTLARELGNLKSLKSMDLSNNMFTGEIPASFAEL  303

Query  557   AN------------------------LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  664
              N                        L+VL L+ NN TG +P  +     L+ L L  N 
Sbjct  304   KNMTLLNLFRNKLHGAIPEFIGELPKLEVLQLWENNFTGSIPQRLGSNGMLQLLDLSSNK  363

Query  665   FSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
              +G +PP+      LE L   GN L G IP  +G    L  + +G  N  +G IP  +  
Sbjct  364   LTGTLPPDMCSGNRLETLITLGNFLFGPIPESLGKCQSLSRIRMGE-NFLNGSIPKGLFG  422

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L +L + +  +  LTGE PV      +L  + L  N LSGSL   IG    ++ L L  N
Sbjct  423   LPKLTQVELQDNYLTGEFPVTDSISVSLGQITLSNNQLSGSLPASIGNFSGVQKLLLDGN  482

Query  1025  AFSGEIP  1045
              FSG+IP
Sbjct  483   KFSGQIP  489


 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 112/227 (49%), Gaps = 25/227 (11%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             L G +   +G+LP L  L +  N  +G +P  + +   L+ L+LS+N    T P  +  
Sbjct  315  KLHGAIPEFIGELPKLEVLQLWENNFTGSIPQRLGSNGMLQLLDLSSNKLTGTLPPDMCS  374

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP------PEY--------  691
               L+ L    N L G +P  + K  SL  + +G N+ +G IP      P+         
Sbjct  375  GNRLETLITLGNFLFGPIPESLGKCQSLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDN  434

Query  692  ---GRFPNLEYLAVS-------GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
               G FP  + ++VS        N LSG +P+ IGN + +++L +   N FSG IPPE+G
Sbjct  435  YLTGEFPVTDSISVSLGQITLSNNQLSGSLPASIGNFSGVQKLLLDG-NKFSGQIPPEVG  493

Query  842  NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEI  982
            +L QL +   ++   +G++  EI K K L  + L  N+LSG +  EI
Sbjct  494  SLKQLSKMGFSDNRFSGQIAPEISKCKLLTFVDLSRNELSGVVPNEI  540


 Score = 92.0 bits (227),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 100/197 (51%), Gaps = 1/197 (1%)
 Frame = +2

Query  380  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  559
            +G L P++G L  LV L  A   LSG +P EI  +  L  L L  N    T   +L  L 
Sbjct  221  TGGLPPEIGNLSSLVRLDAANCALSGEIPGEIGKLQKLDTLFLQVNGLSGTLARELGNLK  280

Query  560  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  739
            +L+ +DL NN  TG++P    ++ ++  L+L  N   G IP   G  P LE L +  N  
Sbjct  281  SLKSMDLSNNMFTGEIPASFAELKNMTLLNLFRNKLHGAIPEFIGELPKLEVLQLWENNF  340

Query  740  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKL  919
            +G IP  +G+   L+ L +   N  +G +PP+M + ++L         L G +P  +GK 
Sbjct  341  TGSIPQRLGSNGMLQLLDLSS-NKLTGTLPPDMCSGNRLETLITLGNFLFGPIPESLGKC  399

Query  920  KNLDTLFLQVNDLSGSL  970
            ++L  + +  N L+GS+
Sbjct  400  QSLSRIRMGENFLNGSI  416



>ref|XP_010271550.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1032

 Score =   351 bits (900),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 191/286 (67%), Positives = 232/286 (81%), Gaps = 0/286 (0%)
 Frame = +2

Query  197   AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  376
             AGKP+ ++E  ALLS+K A + D Q  L +WN STSHCTW  V+CDSL  VVSLDLS +N
Sbjct  23    AGKPVRISENRALLSLKTAISDDPQGFLQNWNFSTSHCTWTGVSCDSLNRVVSLDLSNMN  82

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             +SG+LSPDVGQL  LVNL++AAN + GP+PP IS IS LR LNLSNN+F  TFP QL++L
Sbjct  83    ISGILSPDVGQLRNLVNLTVAANLIYGPIPPGISYISGLRLLNLSNNVFNGTFPSQLSRL  142

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L+VLDLYNNN+TGDLPVEV  M +LRHLH GGN+FSGRIPPEYGR+  LEY+A+SGN 
Sbjct  143   KYLEVLDLYNNNMTGDLPVEVSDMPNLRHLHFGGNFFSGRIPPEYGRWEFLEYMALSGNE  202

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L+G IP  IGNLTKL++LY+GY+N +  GIP EMGNL++L+R D ANCGL+GE+P E+GK
Sbjct  203   LTGPIPPTIGNLTKLQQLYLGYYNTYESGIPAEMGNLTELVRLDMANCGLSGEIPHELGK  262

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             L+ LDTLFLQVN LSG L PE+G LK+LKS+DLSNN  SGE PE+F
Sbjct  263   LQKLDTLFLQVNGLSGELTPELGQLKSLKSMDLSNNMLSGEFPETF  308


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 77/223 (35%), Positives = 108/223 (48%), Gaps = 1/223 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG L+P++GQL  L ++ ++ N LSG  P   S +  L  LNL  N      P  +  L
Sbjct  276   LSGELTPELGQLKSLKSMDLSNNMLSGEFPETFSELKNLTLLNLFRNKLHGAIPDFIGDL  335

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L+VL L+ NN TG +P  + K   L+ L L  N  +G +PP+      L+ L   GN 
Sbjct  336   PELEVLQLWENNFTGSIPQGLGKNGRLQFLDLSSNKLTGNLPPDLCFGNRLQTLIALGNF  395

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L G IP  +G    L  + +G  N  +G IP  +  L  L++ +  +  L G  P     
Sbjct  396   LFGPIPESLGRCESLSRIRMGE-NFLNGTIPKGLFGLPMLVQVELQDNYLVGGFPETDSV  454

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              +NL  + L  N L GSL   IG    ++ L L  N FSG IP
Sbjct  455   AENLGQISLSNNQLMGSLPRSIGNFSGVQKLLLDGNFFSGSIP  497


 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 73/249 (29%), Positives = 120/249 (48%), Gaps = 26/249 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR--------------------  496
              SG + P+ G+  FL  ++++ N+L+GP+PP I  ++ L+                    
Sbjct  179   FSGRIPPEYGRWEFLEYMALSGNELTGPIPPTIGNLTKLQQLYLGYYNTYESGIPAEMGN  238

Query  497   -----FLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  661
                   L+++N       PH+L +L  L  L L  N L+G+L  E+ ++ SL+ + L  N
Sbjct  239   LTELVRLDMANCGLSGEIPHELGKLQKLDTLFLQVNGLSGELTPELGQLKSLKSMDLSNN  298

Query  662   YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
               SG  P  +    NL  L +  N L G IP  IG+L +L+ L + + N F+G IP  +G
Sbjct  299   MLSGEFPETFSELKNLTLLNLFRNKLHGAIPDFIGDLPELEVLQL-WENNFTGSIPQGLG  357

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
                +L   D ++  LTG LP ++     L TL    N L G +   +G  ++L  + +  
Sbjct  358   KNGRLQFLDLSSNKLTGNLPPDLCFGNRLQTLIALGNFLFGPIPESLGRCESLSRIRMGE  417

Query  1022  nAFSGEIPE  1048
             N  +G IP+
Sbjct  418   NFLNGTIPK  426


 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 108/204 (53%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   L  L +++N+L+G +PP++   + L+  + L N +FG   P  L 
Sbjct  347  NFTGSIPQGLGKNGRLQFLDLSSNKLTGNLPPDLCFGNRLQTLIALGNFLFGP-IPESLG  405

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ +  L  + L  NY  G  P       NL  +++S 
Sbjct  406  RCESLSRIRMGENFLNGTIPKGLFGLPMLVQVELQDNYLVGGFPETDSVAENLGQISLSN  465

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N L G +P  IGN + +++L +   N FSG IP E+G L QL + D +N   +G +  EI
Sbjct  466  NQLMGSLPRSIGNFSGVQKLLLDG-NFFSGSIPAEIGRLQQLSKMDFSNNRFSGSIAPEI  524

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  + L  N+LSG + PEI
Sbjct  525  SQCKLLTFVDLSRNELSGEIPPEI  548


 Score = 89.4 bits (220),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 107/223 (48%), Gaps = 1/223 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    T P  L  L
Sbjct  372   LTGNLPPDLCFGNRLQTLIALGNFLFGPIPESLGRCESLSRIRMGENFLNGTIPKGLFGL  431

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L  ++L +N L G  P       +L  + L  N   G +P   G F  ++ L + GN 
Sbjct  432   PMLVQVELQDNYLVGGFPETDSVAENLGQISLSNNQLMGSLPRSIGNFSGVQKLLLDGNF  491

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
              SG IP+EIG L +L ++     N FSG I PE+     L   D +   L+GE+P EI  
Sbjct  492   FSGSIPAEIGRLQQLSKMDFSN-NRFSGSIAPEISQCKLLTFVDLSRNELSGEIPPEITG  550

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             ++ L+ L L  N L GS+   I  +++L S+D S N  SG +P
Sbjct  551   MRILNYLNLSRNHLVGSIPASISTMQSLTSVDFSYNNLSGLVP  593



>ref|XP_007208421.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
 gb|EMJ09620.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
Length=1017

 Score =   350 bits (899),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 194/280 (69%), Positives = 226/280 (81%), Gaps = 0/280 (0%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  394
             +++  ALLS K++ ++D  S L+SW  +TSHCTW  VTCDS  HV SLDLS  +L G LS
Sbjct  22    MSDYRALLSFKSSISSDPNSVLSSWTPTTSHCTWTGVTCDSRRHVTSLDLSSSDLVGTLS  81

Query  395   PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  574
              D+  L FL NL++A NQ SGP+P EISA+S LR LNLSNNIF +TFP QL+ L  L VL
Sbjct  82    SDIAHLRFLSNLTLADNQFSGPIPSEISALSGLRLLNLSNNIFNTTFPPQLSNLTRLAVL  141

Query  575   DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  754
             DLYNNNLTGDLPV V  MTSLRHLHLGGN+FSGRIPPE+GRFP LEYLA+SGN L G IP
Sbjct  142   DLYNNNLTGDLPVSVTHMTSLRHLHLGGNFFSGRIPPEFGRFPLLEYLAISGNELGGSIP  201

Query  755   SEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDT  934
              EIGNLT LKELYIGY+N + GGIPPE+GNLSQL+R DAANC LTGE+P E+G+L+N+DT
Sbjct  202   PEIGNLTSLKELYIGYYNIYEGGIPPEIGNLSQLVRLDAANCNLTGEVPRELGRLQNVDT  261

Query  935   LFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             LFLQVN LSGSL  E+G LK+LKS+DLSNN FSGEIP SF
Sbjct  262   LFLQVNALSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSF  301


 Score =   108 bits (269),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 78/227 (34%), Positives = 120/227 (53%), Gaps = 2/227 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              SG + P+ G+ P L  L+I+ N+L G +PPEI  +++L+ L +   NI+    P ++  
Sbjct  172   FSGRIPPEFGRFPLLEYLAISGNELGGSIPPEIGNLTSLKELYIGYYNIYEGGIPPEIGN  231

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L+ L  LD  N NLTG++P E+ ++ ++  L L  N  SG +  E G   +L+ + +S N
Sbjct  232   LSQLVRLDAANCNLTGEVPRELGRLQNVDTLFLQVNALSGSLTAELGSLKSLKSMDLSNN  291

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP     L  L  L + + N   G IP  +G+L +L          TG +P  +G
Sbjct  292   MFSGEIPGSFSELKNLTLLNL-FRNKLHGAIPEFIGDLPELQVLQLWENNFTGSIPQGLG  350

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             K   L TL L  N L+G+L P++ +  NL++L    N   G IPES 
Sbjct  351   KNGKLITLDLSSNKLTGTLPPDMCFGNNLQTLITLGNFLFGPIPESL  397


 Score =   100 bits (249),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 78/223 (35%), Positives = 107/223 (48%), Gaps = 1/223 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG L+ ++G L  L ++ ++ N  SG +P   S +  L  LNL  N      P  +  L
Sbjct  269   LSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSELKNLTLLNLFRNKLHGAIPEFIGDL  328

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               LQVL L+ NN TG +P  + K   L  L L  N  +G +PP+     NL+ L   GN 
Sbjct  329   PELQVLQLWENNFTGSIPQGLGKNGKLITLDLSSNKLTGTLPPDMCFGNNLQTLITLGNF  388

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L G IP  +G    L  + +G  N  +G IP  +  L +L + +  +  L G  P     
Sbjct  389   LFGPIPESLGRCGSLSRIRMGE-NFLNGSIPKGLFGLPKLSQVELQDNLLAGSFPETDTI  447

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
               NL  + L  N LSGSL P IG    ++ L L  N FSG IP
Sbjct  448   SVNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIP  490


 Score = 93.6 bits (231),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 107/224 (48%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  364   KLTGTLPPDMCFGNNLQTLITLGNFLFGPIPESLGRCGSLSRIRMGENFLNGSIPKGLFG  423

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  424   LPKLSQVELQDNLLAGSFPETDTISVNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGN  483

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP EIG L +L ++   + N F G I PE+     L   D +   L GE+P EI 
Sbjct  484   KFSGRIPPEIGRLQQLSKIDFSH-NKFLGPIAPEISQCKLLTFVDLSRNELAGEIPKEIT  542

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L S+D S N  SG +P
Sbjct  543   GMRILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNNLSGLVP  586


 Score = 92.4 bits (228),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 63/204 (31%), Positives = 109/204 (53%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   L+ L +++N+L+G +PP++   + L+  + L N +FG   P  L 
Sbjct  340  NFTGSIPQGLGKNGKLITLDLSSNKLTGTLPPDMCFGNNLQTLITLGNFLFGP-IPESLG  398

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ +  L  + L  N  +G  P       NL  +++S 
Sbjct  399  RCGSLSRIRMGENFLNGSIPKGLFGLPKLSQVELQDNLLAGSFPETDTISVNLGQISLSN  458

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +P  IGN + +++L +   N FSG IPPE+G L QL + D ++    G +  EI
Sbjct  459  NRLSGSLPPTIGNFSGVQKLLLDG-NKFSGRIPPEIGRLQQLSKIDFSHNKFLGPIAPEI  517

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  + L  N+L+G +  EI
Sbjct  518  SQCKLLTFVDLSRNELAGEIPKEI  541



>ref|XP_010268646.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1034

 Score =   348 bits (894),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 190/286 (66%), Positives = 232/286 (81%), Gaps = 0/286 (0%)
 Frame = +2

Query  197   AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  376
             AG+PL + E  ALLSIK A + D Q+SL +WN+STSHCTW  V+CDS   VVSLDLS +N
Sbjct  20    AGRPLRIPEYRALLSIKTAISDDPQASLPNWNLSTSHCTWTGVSCDSFNRVVSLDLSNMN  79

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG+LSPDVGQL  L+NL+ AAN  SGP+P EIS IS LR LNLSNN+F  +FP + ++L
Sbjct  80    LSGILSPDVGQLRNLINLTAAANFFSGPIPSEISHISGLRLLNLSNNVFNGSFPSEFSRL  139

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L+VLDLYNNN+TGDLPV+V +M +LRHLHLGGN+FSGRIP EYGR+  LEYLA+SGN 
Sbjct  140   KLLEVLDLYNNNMTGDLPVDVSEMPNLRHLHLGGNFFSGRIPSEYGRWEFLEYLALSGNE  199

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L G IP EIGNLTKL++LY+GY+N + GGIPPE+GNL++L+R D ANCGL+GE+P E  K
Sbjct  200   LGGTIPPEIGNLTKLQQLYLGYYNSYEGGIPPELGNLTELVRLDMANCGLSGEIPPEFSK  259

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             L+ LDTLFLQVN LSG L PE+G LK+LKS+DLSNN  +GEIP +F
Sbjct  260   LQKLDTLFLQVNGLSGGLTPELGQLKSLKSMDLSNNMLAGEIPATF  305


 Score = 95.5 bits (236),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 83/245 (34%), Positives = 112/245 (46%), Gaps = 23/245 (9%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG L+P++GQL  L ++ ++ N L+G +P   S +  L  LNL  N      P  +  L
Sbjct  273   LSGGLTPELGQLKSLKSMDLSNNMLAGEIPATFSELKNLTLLNLFRNKLHGAIPDFIGDL  332

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L+VL L+ NN TG +P  + K   L+ L L  N  +G +PP+      L  L   GN 
Sbjct  333   PALEVLQLWENNFTGSIPQGLGKNGRLQLLDLSSNKLTGNLPPDLCFGNRLHTLIALGNF  392

Query  737   LSGVIPSEIGNLTKLKELYIG--YFNG------FS---------------GGIPPEMGNL  847
             L G IP  +G    L  + +G  + NG      FS               GG P      
Sbjct  393   LFGPIPESLGRCKSLSRIRMGENFLNGTIPKGLFSLPNLAQVELQDNYLVGGFPQTDSIA  452

Query  848   SQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnA  1027
               L +   +N  LTG LP  IG    +  L L  N   GS+  EIG L+ L  +D SNN 
Sbjct  453   EDLGQISLSNNQLTGSLPRSIGNFSGVQKLLLDGNFFFGSIPAEIGRLQQLSKMDFSNNR  512

Query  1028  FSGEI  1042
             FSG I
Sbjct  513   FSGPI  517


 Score = 91.7 bits (226),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 68/209 (33%), Positives = 105/209 (50%), Gaps = 7/209 (3%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P+  +L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   ++L
Sbjct  249  LSGEIPPEFSKLQKLDTLFLQVNGLSGGLTPELGQLKSLKSMDLSNNMLAGEIPATFSEL  308

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL +L+L+ N L G +P  +  + +L  L L  N F+G IP   G+   L+ L +S N 
Sbjct  309  KNLTLLNLFRNKLHGAIPDFIGDLPALEVLQLWENNFTGSIPQGLGKNGRLQLLDLSSNK  368

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P ++    +L  L I   N   G IP  +G    L R       L G +P  +  
Sbjct  369  LTGNLPPDLCFGNRLHTL-IALGNFLFGPIPESLGRCKSLSRIRMGENFLNGTIPKGLFS  427

Query  917  LKNLDTLFLQVNDLSG------SLAPEIG  985
            L NL  + LQ N L G      S+A ++G
Sbjct  428  LPNLAQVELQDNYLVGGFPQTDSIAEDLG  456


 Score = 89.7 bits (221),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 64/196 (33%), Positives = 101/196 (52%), Gaps = 1/196 (1%)
 Frame = +2

Query  383  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  562
            G + P++G L  LV L +A   LSG +PPE S +  L  L L  N        +L QL +
Sbjct  227  GGIPPELGNLTELVRLDMANCGLSGEIPPEFSKLQKLDTLFLQVNGLSGGLTPELGQLKS  286

Query  563  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  742
            L+ +DL NN L G++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +
Sbjct  287  LKSMDLSNNMLAGEIPATFSELKNLTLLNLFRNKLHGAIPDFIGDLPALEVLQLWENNFT  346

Query  743  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLK  922
            G IP  +G   +L+ L +   N  +G +PP++   ++L    A    L G +P  +G+ K
Sbjct  347  GSIPQGLGKNGRLQLLDLSS-NKLTGNLPPDLCFGNRLHTLIALGNFLFGPIPESLGRCK  405

Query  923  NLDTLFLQVNDLSGSL  970
            +L  + +  N L+G++
Sbjct  406  SLSRIRMGENFLNGTI  421


 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 71/228 (31%), Positives = 121/228 (53%), Gaps = 3/228 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
             N +G +   +G+   L  L +++N+L+G +PP++   + L   + L N +FG   P  L 
Sbjct  344   NFTGSIPQGLGKNGRLQLLDLSSNKLTGNLPPDLCFGNRLHTLIALGNFLFG-PIPESLG  402

Query  551   QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
             +  +L  + +  N L G +P  ++ + +L  + L  NY  G  P       +L  +++S 
Sbjct  403   RCKSLSRIRMGENFLNGTIPKGLFSLPNLAQVELQDNYLVGGFPQTDSIAEDLGQISLSN  462

Query  731   NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
             N L+G +P  IGN + +++L +   N F G IP E+G L QL + D +N   +G +  EI
Sbjct  463   NQLTGSLPRSIGNFSGVQKLLLDG-NFFFGSIPAEIGRLQQLSKMDFSNNRFSGPIASEI  521

Query  911   GKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
              + K L  + L  N+LSG + PE+  ++ L  L+LS N  +G IP S 
Sbjct  522   SQCKLLTFVDLSRNELSGVIPPEMTGMRILNYLNLSRNHLTGSIPASI  569


 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 71/223 (32%), Positives = 106/223 (48%), Gaps = 1/223 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    T P  L  L
Sbjct  369   LTGNLPPDLCFGNRLHTLIALGNFLFGPIPESLGRCKSLSRIRMGENFLNGTIPKGLFSL  428

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL  ++L +N L G  P        L  + L  N  +G +P   G F  ++ L + GN 
Sbjct  429   PNLAQVELQDNYLVGGFPQTDSIAEDLGQISLSNNQLTGSLPRSIGNFSGVQKLLLDGNF  488

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
               G IP+EIG L +L ++     N FSG I  E+     L   D +   L+G +P E+  
Sbjct  489   FFGSIPAEIGRLQQLSKMDFSN-NRFSGPIASEISQCKLLTFVDLSRNELSGVIPPEMTG  547

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             ++ L+ L L  N L+GS+   I  +++L S+D S N  SG +P
Sbjct  548   MRILNYLNLSRNHLTGSIPASIATMQSLTSVDFSYNNLSGLVP  590



>gb|KDO78771.1| hypothetical protein CISIN_1g001816mg [Citrus sinensis]
Length=1010

 Score =   348 bits (892),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 202/280 (72%), Positives = 239/280 (85%), Gaps = 0/280 (0%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  394
             V E  ALLSIK++ T D QSSL +WN +TSHCTW  VTCDS  HV SLDLSGLNLSG LS
Sbjct  20    VPEYKALLSIKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALS  79

Query  395   PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  574
             PDV  L FL NLS+AANQLSGP+PPEISA+S+LR LNLSNN+F  +FP QL+QLA+LQVL
Sbjct  80    PDVAHLRFLQNLSVAANQLSGPIPPEISALSSLRLLNLSNNVFNGSFPPQLSQLASLQVL  139

Query  575   DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  754
             DLYNNN+TGDLP+ V ++ +LRHLHLGGN+FSG+IPPEYG +  LEYLAVSGN L G IP
Sbjct  140   DLYNNNMTGDLPLAVTQLRNLRHLHLGGNFFSGQIPPEYGIWEFLEYLAVSGNELGGKIP  199

Query  755   SEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDT  934
              EIGNLTKL++LYIGY+N ++GG+PPE+GNLS L+RFDAANCGL+GE+P +IG+L+NLDT
Sbjct  200   GEIGNLTKLQQLYIGYYNSYTGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGRLQNLDT  259

Query  935   LFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             LFLQVN LSG L  E+GYLK+LKS+DLSNN F+GEIP SF
Sbjct  260   LFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASF  299


 Score =   105 bits (261),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 83/247 (34%), Positives = 116/247 (47%), Gaps = 25/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG +  D+G+L  L  L +  N LSGP+  E+  + +L+ ++LSNNIF    P   A+L
Sbjct  243   LSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASFAEL  302

Query  557   AN------------------------LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  664
              N                        L+VL L+ NN TG +P  +     LR L L  N 
Sbjct  303   KNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWENNFTGSIPQRLGSNGKLRILDLSSNK  362

Query  665   FSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
              +G +PP+      L+ L   GN L G IP  +G    L  + +G  N  +G IP  +  
Sbjct  363   LTGTLPPDMCAGNCLQTLITLGNFLFGPIPESLGKCDSLSRMRMGE-NFLNGSIPKGLFG  421

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L  L + +  +  LTG+ PV      NL  + L  N LSGSL   IG    ++ L L  N
Sbjct  422   LPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGN  481

Query  1025  AFSGEIP  1045
              FSG+IP
Sbjct  482   KFSGQIP  488


 Score =   102 bits (253),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 113/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  362   KLTGTLPPDMCAGNCLQTLITLGNFLFGPIPESLGKCDSLSRMRMGENFLNGSIPKGLFG  421

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L +L  ++L +N LTG  PV      +L  + L  N  SG +P   G+F  ++ L + GN
Sbjct  422   LPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGN  481

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP+EIG L +L ++   + N FSG I PE+     L   D +   L+GE+P ++ 
Sbjct  482   KFSGQIPAEIGKLQQLSKMDFSH-NKFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLT  540

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L S+D S N  SG +P
Sbjct  541   GMRILNYLNLSRNHLVGSIPASIASMQSLTSVDFSYNNLSGLVP  584


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 108/200 (54%), Gaps = 3/200 (2%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G    L  L +++N+L+G +PP++ A + L+  + L N +FG   P  L 
Sbjct  338  NFTGSIPQRLGSNGKLRILDLSSNKLTGTLPPDMCAGNCLQTLITLGNFLFG-PIPESLG  396

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ + SL  + L  NY +G+ P       NL  + +S 
Sbjct  397  KCDSLSRMRMGENFLNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSN  456

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +P+ IG  + +++L +   N FSG IP E+G L QL + D ++   +G +  EI
Sbjct  457  NQLSGSLPASIGKFSGVQKLLLDG-NKFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEI  515

Query  911  GKLKNLDTLFLQVNDLSGSL  970
             + K L  + L  N+LSG +
Sbjct  516  SQCKLLTFVDLSRNELSGEI  535


 Score = 85.9 bits (211),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 63/197 (32%), Positives = 96/197 (49%), Gaps = 1/197 (1%)
 Frame = +2

Query  380  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  559
            +G L P++G L  LV    A   LSG +P +I  +  L  L L  N        +L  L 
Sbjct  220  TGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLK  279

Query  560  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  739
            +L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  280  SLKSMDLSNNIFTGEIPASFAELKNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWENNF  339

Query  740  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKL  919
            +G IP  +G+  KL+ L +   N  +G +PP+M   + L         L G +P  +GK 
Sbjct  340  TGSIPQRLGSNGKLRILDLSS-NKLTGTLPPDMCAGNCLQTLITLGNFLFGPIPESLGKC  398

Query  920  KNLDTLFLQVNDLSGSL  970
             +L  + +  N L+GS+
Sbjct  399  DSLSRMRMGENFLNGSI  415



>ref|XP_006426178.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
 gb|ESR39418.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
Length=1012

 Score =   348 bits (892),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 202/280 (72%), Positives = 239/280 (85%), Gaps = 0/280 (0%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  394
             V E  ALLSIK++ T D QSSL +WN +TSHCTW  VTCDS  HV SLDLSGLNLSG LS
Sbjct  22    VPEYKALLSIKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALS  81

Query  395   PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  574
             PDV  L FL NLS+AANQLSGP+PPEISA+S+LR LNLSNN+F  +FP QL+QLA+LQVL
Sbjct  82    PDVAHLRFLQNLSVAANQLSGPIPPEISALSSLRLLNLSNNVFNGSFPPQLSQLASLQVL  141

Query  575   DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  754
             DLYNNN+TGDLP+ V ++ +LRHLHLGGN+FSG+IPPEYG +  LEYLAVSGN L G IP
Sbjct  142   DLYNNNMTGDLPLAVTQLRNLRHLHLGGNFFSGQIPPEYGIWEFLEYLAVSGNELGGKIP  201

Query  755   SEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDT  934
              EIGNLTKL++LYIGY+N ++GG+PPE+GNLS L+RFDAANCGL+GE+P +IG+L+NLDT
Sbjct  202   GEIGNLTKLQQLYIGYYNSYTGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGRLQNLDT  261

Query  935   LFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             LFLQVN LSG L  E+GYLK+LKS+DLSNN F+GEIP SF
Sbjct  262   LFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASF  301


 Score =   105 bits (261),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 83/247 (34%), Positives = 116/247 (47%), Gaps = 25/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG +  D+G+L  L  L +  N LSGP+  E+  + +L+ ++LSNNIF    P   A+L
Sbjct  245   LSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASFAEL  304

Query  557   AN------------------------LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  664
              N                        L+VL L+ NN TG +P  +     LR L L  N 
Sbjct  305   KNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWENNFTGSIPQRLGSNGKLRILDLSSNK  364

Query  665   FSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
              +G +PP+      L+ L   GN L G IP  +G    L  + +G  N  +G IP  +  
Sbjct  365   LTGTLPPDMCAGNCLQTLITLGNFLFGPIPESLGKCDSLSRMRMGE-NFLNGSIPKGLFG  423

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L  L + +  +  LTG+ PV      NL  + L  N LSGSL   IG    ++ L L  N
Sbjct  424   LPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGN  483

Query  1025  AFSGEIP  1045
              FSG+IP
Sbjct  484   KFSGQIP  490


 Score =   102 bits (253),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 113/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  364   KLTGTLPPDMCAGNCLQTLITLGNFLFGPIPESLGKCDSLSRMRMGENFLNGSIPKGLFG  423

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L +L  ++L +N LTG  PV      +L  + L  N  SG +P   G+F  ++ L + GN
Sbjct  424   LPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGN  483

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP+EIG L +L ++   + N FSG I PE+     L   D +   L+GE+P ++ 
Sbjct  484   KFSGQIPAEIGKLQQLSKMDFSH-NKFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLT  542

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L S+D S N  SG +P
Sbjct  543   GMRILNYLNLSRNHLVGSIPASIASMQSLTSVDFSYNNLSGLVP  586


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 108/200 (54%), Gaps = 3/200 (2%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G    L  L +++N+L+G +PP++ A + L+  + L N +FG   P  L 
Sbjct  340  NFTGSIPQRLGSNGKLRILDLSSNKLTGTLPPDMCAGNCLQTLITLGNFLFG-PIPESLG  398

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ + SL  + L  NY +G+ P       NL  + +S 
Sbjct  399  KCDSLSRMRMGENFLNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSN  458

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +P+ IG  + +++L +   N FSG IP E+G L QL + D ++   +G +  EI
Sbjct  459  NQLSGSLPASIGKFSGVQKLLLDG-NKFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEI  517

Query  911  GKLKNLDTLFLQVNDLSGSL  970
             + K L  + L  N+LSG +
Sbjct  518  SQCKLLTFVDLSRNELSGEI  537


 Score = 85.9 bits (211),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 63/197 (32%), Positives = 96/197 (49%), Gaps = 1/197 (1%)
 Frame = +2

Query  380  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  559
            +G L P++G L  LV    A   LSG +P +I  +  L  L L  N        +L  L 
Sbjct  222  TGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLK  281

Query  560  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  739
            +L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  282  SLKSMDLSNNIFTGEIPASFAELKNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWENNF  341

Query  740  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKL  919
            +G IP  +G+  KL+ L +   N  +G +PP+M   + L         L G +P  +GK 
Sbjct  342  TGSIPQRLGSNGKLRILDLSS-NKLTGTLPPDMCAGNCLQTLITLGNFLFGPIPESLGKC  400

Query  920  KNLDTLFLQVNDLSGSL  970
             +L  + +  N L+GS+
Sbjct  401  DSLSRMRMGENFLNGSI  417



>ref|XP_006466390.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Citrus sinensis]
Length=1010

 Score =   347 bits (891),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 202/280 (72%), Positives = 239/280 (85%), Gaps = 0/280 (0%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  394
             V E  ALLSIK++ T D QSSL +WN +TSHCTW  VTCDS  HV SLDLSGLNLSG LS
Sbjct  20    VPEYKALLSIKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALS  79

Query  395   PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  574
             PDV  L FL NLS+AANQLSGP+PPEISA+S+LR LNLSNN+F  +FP QL+QLA+LQVL
Sbjct  80    PDVAHLRFLQNLSVAANQLSGPIPPEISALSSLRLLNLSNNVFNGSFPPQLSQLASLQVL  139

Query  575   DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  754
             DLYNNN+TGDLP+ V ++ +LRHLHLGGN+FSG+IPPEYG +  LEYLAVSGN L G IP
Sbjct  140   DLYNNNMTGDLPLAVTQLRNLRHLHLGGNFFSGQIPPEYGIWEFLEYLAVSGNELGGKIP  199

Query  755   SEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDT  934
              EIGNLTKL++LYIGY+N ++GG+PPE+GNLS L+RFDAANCGL+GE+P +IG+L+NLDT
Sbjct  200   GEIGNLTKLQQLYIGYYNSYTGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGRLQNLDT  259

Query  935   LFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             LFLQVN LSG L  E+GYLK+LKS+DLSNN F+GEIP SF
Sbjct  260   LFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASF  299


 Score =   104 bits (260),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 83/247 (34%), Positives = 116/247 (47%), Gaps = 25/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG +  D+G+L  L  L +  N LSGP+  E+  + +L+ ++LSNNIF    P   A+L
Sbjct  243   LSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASFAEL  302

Query  557   AN------------------------LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  664
              N                        L+VL L+ NN TG +P  +     LR L L  N 
Sbjct  303   KNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWENNFTGSIPQRLGSNGKLRILDLSSNK  362

Query  665   FSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
              +G +PP+      L+ L   GN L G IP  +G    L  + +G  N  +G IP  +  
Sbjct  363   LTGTLPPDMCAGNCLQTLITLGNFLFGPIPESLGKCDSLSRMRMGE-NFLNGSIPKGLFG  421

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L  L + +  +  LTG+ PV      NL  + L  N LSGSL   IG    ++ L L  N
Sbjct  422   LPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGN  481

Query  1025  AFSGEIP  1045
              FSG+IP
Sbjct  482   KFSGQIP  488


 Score =   101 bits (252),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 113/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  362   KLTGTLPPDMCAGNCLQTLITLGNFLFGPIPESLGKCDSLSRMRMGENFLNGSIPKGLFG  421

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L +L  ++L +N LTG  PV      +L  + L  N  SG +P   G+F  ++ L + GN
Sbjct  422   LPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGN  481

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP+EIG L +L ++   + N FSG I PE+     L   D +   L+GE+P ++ 
Sbjct  482   KFSGQIPAEIGKLQQLSKMDFSH-NKFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLT  540

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L S+D S N  SG +P
Sbjct  541   GMRILNYLNLSRNHLVGSIPASIASMQSLTSVDFSYNNLSGLVP  584


 Score = 92.8 bits (229),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 108/200 (54%), Gaps = 3/200 (2%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G    L  L +++N+L+G +PP++ A + L+  + L N +FG   P  L 
Sbjct  338  NFTGSIPQRLGSNGKLRILDLSSNKLTGTLPPDMCAGNCLQTLITLGNFLFG-PIPESLG  396

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ + SL  + L  NY +G+ P       NL  + +S 
Sbjct  397  KCDSLSRMRMGENFLNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSN  456

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +P+ IG  + +++L +   N FSG IP E+G L QL + D ++   +G +  EI
Sbjct  457  NQLSGSLPASIGKFSGVQKLLLDG-NKFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEI  515

Query  911  GKLKNLDTLFLQVNDLSGSL  970
             + K L  + L  N+LSG +
Sbjct  516  SQCKLLTFVDLSRNELSGEI  535


 Score = 85.9 bits (211),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 63/197 (32%), Positives = 96/197 (49%), Gaps = 1/197 (1%)
 Frame = +2

Query  380  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  559
            +G L P++G L  LV    A   LSG +P +I  +  L  L L  N        +L  L 
Sbjct  220  TGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLK  279

Query  560  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  739
            +L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  280  SLKSMDLSNNIFTGEIPASFAELKNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWENNF  339

Query  740  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKL  919
            +G IP  +G+  KL+ L +   N  +G +PP+M   + L         L G +P  +GK 
Sbjct  340  TGSIPQRLGSNGKLRILDLSS-NKLTGTLPPDMCAGNCLQTLITLGNFLFGPIPESLGKC  398

Query  920  KNLDTLFLQVNDLSGSL  970
             +L  + +  N L+GS+
Sbjct  399  DSLSRMRMGENFLNGSI  415



>ref|XP_010105101.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
 gb|EXC03886.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
Length=1021

 Score =   347 bits (889),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 195/280 (70%), Positives = 226/280 (81%), Gaps = 0/280 (0%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  394
             V E  ALLS KAA T D QSSL +WN ST HCTW  +TCDS  HV SLDLSGLNLSG LS
Sbjct  26    VPEYKALLSFKAALTDDPQSSLATWNASTLHCTWFGITCDSRRHVTSLDLSGLNLSGSLS  85

Query  395   PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  574
             P++  L FL N+S+A NQ SGP+P EISAIS LR LNLSNN+F  TFP +L+QL NLQ+L
Sbjct  86    PELAYLRFLSNVSLADNQFSGPIPAEISAISGLRLLNLSNNVFNGTFPPELSQLKNLQIL  145

Query  575   DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  754
             DLYNNN+TGDLP++V  + +LRHLHLGGNYFSG IP EYGR+  LEYLAVSGN LSG IP
Sbjct  146   DLYNNNMTGDLPLDVVDLPNLRHLHLGGNYFSGAIPKEYGRWEFLEYLAVSGNELSGKIP  205

Query  755   SEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDT  934
              EIG+LT L+ELYIGY+N + GG+P E+GNLS+L+RFD ANC L+GE+P EIGKL+ LDT
Sbjct  206   PEIGSLTNLRELYIGYYNTYEGGLPAEIGNLSELVRFDGANCALSGEIPPEIGKLQKLDT  265

Query  935   LFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             LFLQVN LSGSL PE+G L +LKS+DLSNN  SGEIP SF
Sbjct  266   LFLQVNALSGSLTPELGSLNSLKSMDLSNNMLSGEIPPSF  305


 Score =   104 bits (260),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 81/248 (33%), Positives = 122/248 (49%), Gaps = 26/248 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG + P++G+L  L  L +  N LSG + PE+ ++++L+ ++LSNN+     P   A+L
Sbjct  249   LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGSLNSLKSMDLSNNMLSGEIPPSFAEL  308

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  + ++  L  L L  N F+G IP   GR   L+ L +S N 
Sbjct  309   KNLTLLNLFRNKLHGAIPEFIGELPELEVLQLWENNFTGSIPQGLGRNGKLQLLDLSSNK  368

Query  737   LSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+G                         IP  +G    L  + +G  N  +G IP  +  
Sbjct  369   LTGTLPPDMCSGHRLHTLITLGNFLFGPIPESLGKCQSLSRIRMGE-NFLNGSIPKGLFG  427

Query  845   LSQLIRFDAANCGLTGELPVEIGKL-KNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
             L +L + +  +  L+G+ P   G    NL  + L  N LSGSL P IG    ++ L L  
Sbjct  428   LPKLTQVELQDNLLSGDFPESDGTFAANLGQISLSNNQLSGSLPPSIGNFSGVQKLLLDG  487

Query  1022  nAFSGEIP  1045
             N FSG IP
Sbjct  488   NKFSGRIP  495


 Score =   101 bits (251),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 80/271 (30%), Positives = 117/271 (43%), Gaps = 48/271 (18%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG L+P++G L  L ++ ++ N LSG +PP  + +  L  LNL  N      P  + +L
Sbjct  273   LSGSLTPELGSLNSLKSMDLSNNMLSGEIPPSFAELKNLTLLNLFRNKLHGAIPEFIGEL  332

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L+VL L+ NN TG +P  + +   L+ L L  N  +G +PP+      L  L   GN 
Sbjct  333   PELEVLQLWENNFTGSIPQGLGRNGKLQLLDLSSNKLTGTLPPDMCSGHRLHTLITLGNF  392

Query  737   LSGVIPSEIGNLTKLKELYIG--YFNG---------------------------------  811
             L G IP  +G    L  + +G  + NG                                 
Sbjct  393   LFGPIPESLGKCQSLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDNLLSGDFPESDGTF  452

Query  812   -------------FSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVN  952
                           SG +PP +GN S + +        +G +P EIG+L+ +  +    N
Sbjct  453   AANLGQISLSNNQLSGSLPPSIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQVSKIDFSHN  512

Query  953   DLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
               SG + PEI   K L  +DLS N  SGEIP
Sbjct  513   KFSGLITPEISQCKVLTFVDLSRNELSGEIP  543


 Score = 95.1 bits (235),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 74/225 (33%), Positives = 111/225 (49%), Gaps = 2/225 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  368   KLTGTLPPDMCSGHRLHTLITLGNFLFGPIPESLGKCQSLSRIRMGENFLNGSIPKGLFG  427

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTS-LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
             L  L  ++L +N L+GD P       + L  + L  N  SG +PP  G F  ++ L + G
Sbjct  428   LPKLTQVELQDNLLSGDFPESDGTFAANLGQISLSNNQLSGSLPPSIGNFSGVQKLLLDG  487

Query  731   NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
             N  SG IP EIG L ++ ++   + N FSG I PE+     L   D +   L+GE+P EI
Sbjct  488   NKFSGRIPPEIGRLQQVSKIDFSH-NKFSGLITPEISQCKVLTFVDLSRNELSGEIPNEI  546

Query  911   GKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
               ++ L+ L L  N L G++   I  +++L S+D S N  SG +P
Sbjct  547   TGMRILNYLNLSRNHLVGNIPSSIASMQSLTSVDFSYNNLSGLVP  591


 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 78/251 (31%), Positives = 116/251 (46%), Gaps = 50/251 (20%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P   +L  L  L++  N+L G +P  I  +  L  L L  N F  + P  L + 
Sbjct  297  LSGEIPPSFAELKNLTLLNLFRNKLHGAIPEFIGELPELEVLQLWENNFTGSIPQGLGRN  356

Query  557  ANLQVLDLYNNNLTGDLPVEVY------------------------KMTSLRHLHLGGNY  664
              LQ+LDL +N LTG LP ++                         K  SL  + +G N+
Sbjct  357  GKLQLLDLSSNKLTGTLPPDMCSGHRLHTLITLGNFLFGPIPESLGKCQSLSRIRMGENF  416

Query  665  FSGRIP------PEY-----------GRFP--------NLEYLAVSGNGLSGVIPSEIGN  769
             +G IP      P+            G FP        NL  +++S N LSG +P  IGN
Sbjct  417  LNGSIPKGLFGLPKLTQVELQDNLLSGDFPESDGTFAANLGQISLSNNQLSGSLPPSIGN  476

Query  770  LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQV  949
             + +++L +   N FSG IPPE+G L Q+ + D ++   +G +  EI + K L  + L  
Sbjct  477  FSGVQKLLLDG-NKFSGRIPPEIGRLQQVSKIDFSHNKFSGLITPEISQCKVLTFVDLSR  535

Query  950  NDLSGSLAPEI  982
            N+LSG +  EI
Sbjct  536  NELSGEIPNEI  546


 Score = 89.0 bits (219),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 73/223 (33%), Positives = 112/223 (50%), Gaps = 1/223 (0%)
 Frame = +2

Query  383   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  562
             G L  ++G L  LV    A   LSG +PPEI  +  L  L L  N    +   +L  L +
Sbjct  227   GGLPAEIGNLSELVRFDGANCALSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGSLNS  286

Query  563   LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  742
             L+ +DL NN L+G++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +
Sbjct  287   LKSMDLSNNMLSGEIPPSFAELKNLTLLNLFRNKLHGAIPEFIGELPELEVLQLWENNFT  346

Query  743   GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLK  922
             G IP  +G   KL+ L +   N  +G +PP+M +  +L         L G +P  +GK +
Sbjct  347   GSIPQGLGRNGKLQLLDLSS-NKLTGTLPPDMCSGHRLHTLITLGNFLFGPIPESLGKCQ  405

Query  923   NLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
             +L  + +  N L+GS+   +  L  L  ++L +N  SG+ PES
Sbjct  406   SLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDNLLSGDFPES  448



>ref|XP_002875982.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52241.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
Length=1001

 Score =   344 bits (883),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 185/282 (66%), Positives = 222/282 (79%), Gaps = 2/282 (1%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  391
             +TE  ALLS+K++FT D  S LTSWN+ST+ C+W  VTCD  L  V+      LNLSG L
Sbjct  25    ITELNALLSLKSSFTIDEHSPLTSWNLSTTFCSWTGVTCDVSLRHVTSLDLSGLNLSGTL  84

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQ  568
             S DV  LP L NLS+AANQ+SGP+PPEIS +  LR LNLSNN+F  ++P +L+  L NL+
Sbjct  85    SSDVSHLPLLQNLSLAANQISGPIPPEISNLYELRHLNLSNNVFNGSYPDELSSGLVNLR  144

Query  569   VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  748
             VLDLYNNNLTGDLPV +  +T LRHLHLGGNYFSG+IP  YG +P LEYLAVSGN L G 
Sbjct  145   VLDLYNNNLTGDLPVSITNLTQLRHLHLGGNYFSGKIPATYGTWPVLEYLAVSGNELIGK  204

Query  749   IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNL  928
             IP EIGNLT L+ELYIGY+N F  G+PPE+GNLS+L+RFDAANCGLTGE+P EIGKL+ L
Sbjct  205   IPPEIGNLTTLRELYIGYYNAFEDGLPPEIGNLSELVRFDAANCGLTGEIPPEIGKLQKL  264

Query  929   DTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             DTLFLQVN  SG+L  E+G++ +LKS+DLSNN F+GEIP SF
Sbjct  265   DTLFLQVNAFSGTLTSELGFISSLKSMDLSNNMFTGEIPASF  306


 Score = 99.4 bits (246),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 77/249 (31%), Positives = 121/249 (49%), Gaps = 26/249 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              SG +    G  P L  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  177   FSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  236

Query  554   LANLQVLDLYNNNLTGDLPVEVYKM------------------------TSLRHLHLGGN  661
             L+ L   D  N  LTG++P E+ K+                        +SL+ + L  N
Sbjct  237   LSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNAFSGTLTSELGFISSLKSMDLSNN  296

Query  662   YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
              F+G IP  + +  NL  L +  N L G IP  IG + +L+ L + + N F+GGIP ++G
Sbjct  297   MFTGEIPASFSQLKNLTLLNLFRNKLYGAIPEFIGEMPELEVLQL-WENNFTGGIPHKLG  355

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
                +L+  D ++  LTG LP  +     L TL    N L GS+   +G  ++L  + +  
Sbjct  356   ENGRLVILDLSSNKLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGE  415

Query  1022  nAFSGEIPE  1048
             N  +G IP+
Sbjct  416   NFLNGSIPK  424


 Score = 98.6 bits (244),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 68/198 (34%), Positives = 101/198 (51%), Gaps = 1/198 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L+G + P++G+L  L  L +  N  SG +  E+  IS+L+ ++LSNN+F    P   +QL
Sbjct  250  LTGEIPPEIGKLQKLDTLFLQVNAFSGTLTSELGFISSLKSMDLSNNMFTGEIPASFSQL  309

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL +L+L+ N L G +P  + +M  L  L L  N F+G IP + G    L  L +S N 
Sbjct  310  KNLTLLNLFRNKLYGAIPEFIGEMPELEVLQLWENNFTGGIPHKLGENGRLVILDLSSNK  369

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P  + +  +L  L I   N   G IP  +G    L R       L G +P  +  
Sbjct  370  LTGTLPPNMCSGNRLMTL-ITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFG  428

Query  917  LKNLDTLFLQVNDLSGSL  970
            L  L  + LQ N L+G L
Sbjct  429  LPKLSQVELQDNYLTGEL  446


 Score = 95.1 bits (235),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 66/205 (32%), Positives = 113/205 (55%), Gaps = 4/205 (2%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI-SAISTLRFLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   LV L +++N+L+G +PP + S    +  + L N +FGS  P  L 
Sbjct  345  NFTGGIPHKLGENGRLVILDLSSNKLTGTLPPNMCSGNRLMTLITLGNFLFGS-IPDSLG  403

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFP-NLEYLAVS  727
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P   G    +L  +++S
Sbjct  404  KCESLTRIRMGENFLNGSIPKGLFGLPKLSQVELQDNYLTGELPISGGGVSGDLGQISLS  463

Query  728  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
             N LSG +P+ IGN + +++L +   N F+G IPPE+G L QL + D ++   +G +  E
Sbjct  464  NNQLSGPLPAAIGNFSGVQKLLLDG-NKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPE  522

Query  908  IGKLKNLDTLFLQVNDLSGSLAPEI  982
            I + K L  + L  N+LSG +  EI
Sbjct  523  ISRCKLLTFVDLSRNELSGDIPKEI  547


 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 73/227 (32%), Positives = 114/227 (50%), Gaps = 2/227 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L+ L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  369   KLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFG  428

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMT-SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
             L  L  ++L +N LTG+LP+    ++  L  + L  N  SG +P   G F  ++ L + G
Sbjct  429   LPKLSQVELQDNYLTGELPISGGGVSGDLGQISLSNNQLSGPLPAAIGNFSGVQKLLLDG  488

Query  731   NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
             N  +G IP EIG L +L +L   + N FSG I PE+     L   D +   L+G++P EI
Sbjct  489   NKFAGPIPPEIGRLQQLSKLDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGDIPKEI  547

Query  911   GKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
               ++ L+ L L  N L GS+   I  +++L S+D S N  SG +P +
Sbjct  548   TGMRILNYLNLSRNHLVGSIPVTIASMQSLTSVDFSYNNLSGLVPST  594



>ref|XP_004288299.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Fragaria vesca subsp. vesca]
Length=1023

 Score =   342 bits (877),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 193/275 (70%), Positives = 226/275 (82%), Gaps = 1/275 (0%)
 Frame = +2

Query  230   ALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQ  409
             ALLS+K++   D  S L+SW  +TSHCTW  VTCDS  HV SLDLSGLNLSG LSPD+  
Sbjct  38    ALLSLKSSLD-DPDSRLSSWTPNTSHCTWAGVTCDSHNHVTSLDLSGLNLSGYLSPDIAF  96

Query  410   LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  589
             L +L NL++A N LSGP+PPEISA+  LR LNLSNN+F  TFP +L+ L NL+VLDLYNN
Sbjct  97    LVYLSNLTLAENNLSGPIPPEISALPALRLLNLSNNVFNRTFPPELSNLTNLRVLDLYNN  156

Query  590   NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  769
             NLTG LPV V  MT+LRHLHLGGN+F G IPPEYG+FP LEYLAVSGN ++G IP EIGN
Sbjct  157   NLTGVLPVSVTHMTNLRHLHLGGNFFEGSIPPEYGQFPFLEYLAVSGNSITGKIPKEIGN  216

Query  770   LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQV  949
             LT+LKELYIGYFN + GGIP E+GNL+QLIRFDAANC L+GE+P E+G+L+N+DTLFLQV
Sbjct  217   LTRLKELYIGYFNSYDGGIPAEIGNLTQLIRFDAANCNLSGEIPPELGRLQNVDTLFLQV  276

Query  950   NDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             N LSGSL  E+G LK+LKS+DLSNN FSGEIP SF
Sbjct  277   NALSGSLTSELGSLKSLKSMDLSNNLFSGEIPTSF  311


 Score =   100 bits (249),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 79/248 (32%), Positives = 117/248 (47%), Gaps = 25/248 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             NLSG + P++G+L  +  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   A+
Sbjct  254   NLSGEIPPELGRLQNVDTLFLQVNALSGSLTSELGSLKSLKSMDLSNNLFSGEIPTSFAE  313

Query  554   LAN------------------------LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  661
             L N                        LQVL L+ NN TG +P  + +   L+ + L  N
Sbjct  314   LKNLTLLNLFRNQLHGAIPDFIGDLPELQVLQLWENNFTGSIPQSLGRNGKLQLVDLSSN  373

Query  662   YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
               +G +PP+     NL+ L   GN L G IP  +G    L  + +G  N  +G IP  + 
Sbjct  374   KLTGALPPDMCSGNNLQTLITLGNFLFGPIPESLGECKSLSRIRMGE-NFLNGSIPKGLF  432

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
              L +L + +  +  L G  PV       L  + L  N LSG L P IG    ++ L L  
Sbjct  433   GLPKLTQVELQDNFLNGPFPVSDSVSAGLGQISLSNNRLSGPLPPAIGNFTGVQKLLLDG  492

Query  1022  nAFSGEIP  1045
             N FSG IP
Sbjct  493   NKFSGRIP  500


 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 75/223 (34%), Positives = 110/223 (49%), Gaps = 1/223 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  L
Sbjct  375   LTGALPPDMCSGNNLQTLITLGNFLFGPIPESLGECKSLSRIRMGENFLNGSIPKGLFGL  434

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L  ++L +N L G  PV       L  + L  N  SG +PP  G F  ++ L + GN 
Sbjct  435   PKLTQVELQDNFLNGPFPVSDSVSAGLGQISLSNNRLSGPLPPAIGNFTGVQKLLLDGNK  494

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
              SG IP EIG+L +L ++   + N FSG I PE+     L   D +   L+GE+P EI  
Sbjct  495   FSGRIPPEIGHLEQLSKIDFSH-NLFSGPIAPEISRCKVLAYVDLSRNELSGEIPKEITG  553

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             ++ L+ L L  N L G++   I  +++L S+D S N  SG +P
Sbjct  554   MRILNYLNLSRNHLVGNIPAPISAMQSLTSVDFSYNNLSGLVP  596



>emb|CBI35733.3| unnamed protein product [Vitis vinifera]
Length=948

 Score =   340 bits (872),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 187/286 (65%), Positives = 229/286 (80%), Gaps = 0/286 (0%)
 Frame = +2

Query  197   AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  376
             A  P  + E  ALLS++ A + D +S L +WNISTSHCTW  VTCD+  HVV+L+LSGLN
Sbjct  39    AATPPRIPEYRALLSLRTAISYDPESPLAAWNISTSHCTWTGVTCDARRHVVALNLSGLN  98

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG LS D+  L FLVNL++AANQ  GP+PPE+S +S LR LNLSNN+F  TFP QLA+L
Sbjct  99    LSGSLSSDIAHLRFLVNLTLAANQFVGPIPPELSLVSGLRQLNLSNNVFNETFPSQLARL  158

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L+VLDLYNNN+TGDLP+ V +M +LRHLHLGGN+F+G IPP YG++  LEYLAVSGN 
Sbjct  159   KRLEVLDLYNNNMTGDLPLAVTEMPNLRHLHLGGNFFTGIIPPAYGQWEFLEYLAVSGNE  218

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L G IP EIGNLT L++LY+GY+N + GGIPPE+GNL+ L+R D ANC L+GE+P EIGK
Sbjct  219   LHGPIPPEIGNLTSLQQLYVGYYNTYDGGIPPEIGNLTSLVRLDMANCLLSGEIPPEIGK  278

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             L+NLDTLFLQVN LSG L PE+G LK+LKS+DLSNN  +GEIPE+F
Sbjct  279   LQNLDTLFLQVNTLSGPLTPELGNLKSLKSMDLSNNVLAGEIPEAF  324


 Score =   107 bits (267),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 81/246 (33%), Positives = 124/246 (50%), Gaps = 23/246 (9%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG + P++G+L  L  L +  N LSGP+ PE+  + +L+ ++LSNN+     P   A+L
Sbjct  268   LSGEIPPEIGKLQNLDTLFLQVNTLSGPLTPELGNLKSLKSMDLSNNVLAGEIPEAFAEL  327

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G+   L+ L VS N 
Sbjct  328   KNLTLLNLFRNKLHGAIPEFIGDLPELEVLQLWENNFTGSIPQGLGKNGKLQLLDVSSNK  387

Query  737   LSGVIPSEIGNLTKLKELY-IGYF----------------------NGFSGGIPPEMGNL  847
             L+G +P ++ +  +L+ L  +G F                      N  +G IP  + +L
Sbjct  388   LTGNLPPDMCSGNRLQTLITLGNFLFGPIPESLGRCESLSRIRMGENFLNGSIPKGLFDL  447

Query  848   SQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnA  1027
              +L + +  +  LTGE P       +L  + L  N L+GSL P +G    L+ L L  N 
Sbjct  448   PKLTQVELQDNYLTGEFPEIDSTPDSLGQISLSNNQLTGSLPPSVGNFSGLQKLLLDGNK  507

Query  1028  FSGEIP  1045
             FSG IP
Sbjct  508   FSGRIP  513


 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 109/224 (49%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  387   KLTGNLPPDMCSGNRLQTLITLGNFLFGPIPESLGRCESLSRIRMGENFLNGSIPKGLFD  446

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N LTG+ P       SL  + L  N  +G +PP  G F  L+ L + GN
Sbjct  447   LPKLTQVELQDNYLTGEFPEIDSTPDSLGQISLSNNQLTGSLPPSVGNFSGLQKLLLDGN  506

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP EIG L +L ++     N FSG I PE+     L   D +   L G++P EI 
Sbjct  507   KFSGRIPPEIGMLQQLSKMDFSN-NKFSGEITPEISQCKVLTFVDLSRNELFGDIPTEIT  565

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   +  +++L S+D S N  SG +P
Sbjct  566   GMRILNYLNLSRNHLIGSIPASLASMQSLTSVDFSYNNLSGLVP  609


 Score = 95.5 bits (236),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 111/204 (54%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   L  L +++N+L+G +PP++ + + L+  + L N +FG   P  L 
Sbjct  363  NFTGSIPQGLGKNGKLQLLDVSSNKLTGNLPPDMCSGNRLQTLITLGNFLFGP-IPESLG  421

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G  P       +L  +++S 
Sbjct  422  RCESLSRIRMGENFLNGSIPKGLFDLPKLTQVELQDNYLTGEFPEIDSTPDSLGQISLSN  481

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N L+G +P  +GN + L++L +   N FSG IPPE+G L QL + D +N   +GE+  EI
Sbjct  482  NQLTGSLPPSVGNFSGLQKLLLDG-NKFSGRIPPEIGMLQQLSKMDFSNNKFSGEITPEI  540

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  + L  N+L G +  EI
Sbjct  541  SQCKVLTFVDLSRNELFGDIPTEI  564



>ref|XP_003635561.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Vitis vinifera]
Length=1017

 Score =   340 bits (872),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 187/286 (65%), Positives = 229/286 (80%), Gaps = 0/286 (0%)
 Frame = +2

Query  197   AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  376
             A  P  + E  ALLS++ A + D +S L +WNISTSHCTW  VTCD+  HVV+L+LSGLN
Sbjct  20    AATPPRIPEYRALLSLRTAISYDPESPLAAWNISTSHCTWTGVTCDARRHVVALNLSGLN  79

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG LS D+  L FLVNL++AANQ  GP+PPE+S +S LR LNLSNN+F  TFP QLA+L
Sbjct  80    LSGSLSSDIAHLRFLVNLTLAANQFVGPIPPELSLVSGLRQLNLSNNVFNETFPSQLARL  139

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L+VLDLYNNN+TGDLP+ V +M +LRHLHLGGN+F+G IPP YG++  LEYLAVSGN 
Sbjct  140   KRLEVLDLYNNNMTGDLPLAVTEMPNLRHLHLGGNFFTGIIPPAYGQWEFLEYLAVSGNE  199

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L G IP EIGNLT L++LY+GY+N + GGIPPE+GNL+ L+R D ANC L+GE+P EIGK
Sbjct  200   LHGPIPPEIGNLTSLQQLYVGYYNTYDGGIPPEIGNLTSLVRLDMANCLLSGEIPPEIGK  259

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             L+NLDTLFLQVN LSG L PE+G LK+LKS+DLSNN  +GEIPE+F
Sbjct  260   LQNLDTLFLQVNTLSGPLTPELGNLKSLKSMDLSNNVLAGEIPEAF  305


 Score =   107 bits (267),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 81/246 (33%), Positives = 124/246 (50%), Gaps = 23/246 (9%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG + P++G+L  L  L +  N LSGP+ PE+  + +L+ ++LSNN+     P   A+L
Sbjct  249   LSGEIPPEIGKLQNLDTLFLQVNTLSGPLTPELGNLKSLKSMDLSNNVLAGEIPEAFAEL  308

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G+   L+ L VS N 
Sbjct  309   KNLTLLNLFRNKLHGAIPEFIGDLPELEVLQLWENNFTGSIPQGLGKNGKLQLLDVSSNK  368

Query  737   LSGVIPSEIGNLTKLKELY-IGYF----------------------NGFSGGIPPEMGNL  847
             L+G +P ++ +  +L+ L  +G F                      N  +G IP  + +L
Sbjct  369   LTGNLPPDMCSGNRLQTLITLGNFLFGPIPESLGRCESLSRIRMGENFLNGSIPKGLFDL  428

Query  848   SQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnA  1027
              +L + +  +  LTGE P       +L  + L  N L+GSL P +G    L+ L L  N 
Sbjct  429   PKLTQVELQDNYLTGEFPEIDSTPDSLGQISLSNNQLTGSLPPSVGNFSGLQKLLLDGNK  488

Query  1028  FSGEIP  1045
             FSG IP
Sbjct  489   FSGRIP  494


 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 109/224 (49%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  368   KLTGNLPPDMCSGNRLQTLITLGNFLFGPIPESLGRCESLSRIRMGENFLNGSIPKGLFD  427

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N LTG+ P       SL  + L  N  +G +PP  G F  L+ L + GN
Sbjct  428   LPKLTQVELQDNYLTGEFPEIDSTPDSLGQISLSNNQLTGSLPPSVGNFSGLQKLLLDGN  487

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP EIG L +L ++     N FSG I PE+     L   D +   L G++P EI 
Sbjct  488   KFSGRIPPEIGMLQQLSKMDFSN-NKFSGEITPEISQCKVLTFVDLSRNELFGDIPTEIT  546

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   +  +++L S+D S N  SG +P
Sbjct  547   GMRILNYLNLSRNHLIGSIPASLASMQSLTSVDFSYNNLSGLVP  590


 Score = 95.5 bits (236),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 111/204 (54%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   L  L +++N+L+G +PP++ + + L+  + L N +FG   P  L 
Sbjct  344  NFTGSIPQGLGKNGKLQLLDVSSNKLTGNLPPDMCSGNRLQTLITLGNFLFGP-IPESLG  402

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G  P       +L  +++S 
Sbjct  403  RCESLSRIRMGENFLNGSIPKGLFDLPKLTQVELQDNYLTGEFPEIDSTPDSLGQISLSN  462

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N L+G +P  +GN + L++L +   N FSG IPPE+G L QL + D +N   +GE+  EI
Sbjct  463  NQLTGSLPPSVGNFSGLQKLLLDG-NKFSGRIPPEIGMLQQLSKMDFSNNKFSGEITPEI  521

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  + L  N+L G +  EI
Sbjct  522  SQCKVLTFVDLSRNELFGDIPTEI  545



>gb|KHG04200.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1014

 Score =   338 bits (868),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 185/281 (66%), Positives = 227/281 (81%), Gaps = 1/281 (0%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVL  391
             VTE  AL+++K++ T D QS L++WN +T  C++  VTCD    HV S+DL+   LSG L
Sbjct  27    VTELRALIAVKSSITDDPQSYLSNWNATTPLCSFAGVTCDLTGRHVTSIDLTNFTLSGTL  86

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  571
             SP +  L FL NLS+A N L+GP+P E++ +S LR+LNLSNN+F  +FP QL+QL NLQV
Sbjct  87    SPSLAHLRFLQNLSVADNNLTGPIPTELAVLSNLRYLNLSNNVFNGSFPTQLSQLKNLQV  146

Query  572   LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  751
             LDLYNNN+TG+LPV V ++ +LRHLHLGGNYFSG+IP  YGR+ +LEYLAVSGN LSG I
Sbjct  147   LDLYNNNMTGELPVSVTELPNLRHLHLGGNYFSGQIPSSYGRWEHLEYLAVSGNELSGKI  206

Query  752   PSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLD  931
             P EIGNLTKLKELYIGYFN F GG+PPE+GNLS+L+RFDAANC L+GE+P EIGKL+ LD
Sbjct  207   PPEIGNLTKLKELYIGYFNNFEGGLPPEIGNLSELVRFDAANCMLSGEIPPEIGKLQKLD  266

Query  932   TLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             TLFLQVN LSGSL PE+G L +LKS+DLSNN F+GEIP SF
Sbjct  267   TLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASF  307


 Score =   110 bits (274),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 84/248 (34%), Positives = 122/248 (49%), Gaps = 26/248 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG + P++G+L  L  L +  N LSG + PE+  +++L+ ++LSNN+F    P   AQL
Sbjct  251   LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASFAQL  310

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L+ L +S N 
Sbjct  311   KNLTLLNLFRNKLHGQIPDFIGELPELEVLQLWENNFTGSIPQKLGSNKKLQVLDLSSNK  370

Query  737   LSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+G                         IP  +G    L  + +G  N  +G IP  +  
Sbjct  371   LTGTLPPDMCSGNTLQTLITLGNFLFGSIPESLGKCESLSRIRMGE-NYLNGSIPKGLLG  429

Query  845   LSQLIRFDAANCGLTGELPVEIGKLK-NLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
             L QL + +  N  LTGE PV    +  NL  + L  N LSG+L   IG    ++ L L  
Sbjct  430   LPQLTQVELQNNYLTGEFPVTDSSISVNLGQISLSNNQLSGALPASIGNFSGVQKLLLDG  489

Query  1022  nAFSGEIP  1045
             N FSG IP
Sbjct  490   NKFSGPIP  497


 Score = 80.9 bits (198),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 95/197 (48%), Gaps = 2/197 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L NN     FP   + +
Sbjct  395  LFGSIPESLGKCESLSRIRMGENYLNGSIPKGLLGLPQLTQVELQNNYLTGEFPVTDSSI  454

Query  557  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            + NL  + L NN L+G LP  +   + ++ L L GN FSG IP E G    L  +  S N
Sbjct  455  SVNLGQISLSNNQLSGALPASIGNFSGVQKLLLDGNKFSGPIPAEIGTLQQLSKIDFSHN  514

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              SG+IP EI     L  + +   N  SG IP E+ ++  L   + +   L G +P  I 
Sbjct  515  KFSGLIPPEICKCELLTFVDLSR-NELSGRIPTEITSMRILNFLNLSRNHLLGSIPSSIS  573

Query  914  KLKNLDTLFLQVNDLSG  964
             +++L ++    N+LSG
Sbjct  574  TMQSLTSVDFSYNNLSG  590


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG L   +G    +  L +  N+ SGP+P EI  +  L  ++ S+N F    P ++ + 
Sbjct  468  LSGALPASIGNFSGVQKLLLDGNKFSGPIPAEIGTLQQLSKIDFSHNKFSGLIPPEICKC  527

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              L  +DL  N L+G +P E+  M  L  L+L  N+  G IP       +L  +  S N 
Sbjct  528  ELLTFVDLSRNELSGRIPTEITSMRILNFLNLSRNHLLGSIPSSISTMQSLTSVDFSYNN  587

Query  737  LSGVIP  754
            LSG++P
Sbjct  588  LSGLVP  593


 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 67/137 (49%), Gaps = 1/137 (1%)
 Frame = +2

Query  419  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  598
            L  +S++ NQLSG +P  I   S ++ L L  N F    P ++  L  L  +D  +N  +
Sbjct  458  LGQISLSNNQLSGALPASIGNFSGVQKLLLDGNKFSGPIPAEIGTLQQLSKIDFSHNKFS  517

Query  599  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  778
            G +P E+ K   L  + L  N  SGRIP E      L +L +S N L G IPS I  +  
Sbjct  518  GLIPPEICKCELLTFVDLSRNELSGRIPTEITSMRILNFLNLSRNHLLGSIPSSISTMQS  577

Query  779  LKELYIGYFNGFSGGIP  829
            L  +   Y N  SG +P
Sbjct  578  LTSVDFSY-NNLSGLVP  593



>gb|KJB18115.1| hypothetical protein B456_003G034500 [Gossypium raimondii]
Length=1014

 Score =   338 bits (868),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 184/281 (65%), Positives = 228/281 (81%), Gaps = 1/281 (0%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVL  391
             VTE  AL+++K++ T D QS L++WN ST  C++  VTCD    HV S+DL+ + L+G L
Sbjct  27    VTELRALIAVKSSITDDPQSYLSNWNASTPLCSFAGVTCDLTGRHVTSIDLTNVTLAGTL  86

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  571
             SP +  L FL NLS+A N LSGP+P E++ +S LR+LNLSNN+F  +FP QL+QL NLQ+
Sbjct  87    SPSLAHLRFLQNLSVAGNDLSGPIPTELAVLSNLRYLNLSNNVFNGSFPTQLSQLKNLQI  146

Query  572   LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  751
             LDLYNNN+TG+LPV V ++ +LRHLHLGGNYFSG+IP  YGR+ +LEYLAVSGN LSG I
Sbjct  147   LDLYNNNMTGELPVSVTELPNLRHLHLGGNYFSGQIPSSYGRWEHLEYLAVSGNELSGKI  206

Query  752   PSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLD  931
             P EIGNLTKLK+LYIGYFN F GG+PPE+GNLS+L+RFDAANC L+GE+P EIGKL+ LD
Sbjct  207   PPEIGNLTKLKQLYIGYFNSFEGGLPPEIGNLSELVRFDAANCMLSGEIPPEIGKLQKLD  266

Query  932   TLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             TLFLQVN LSGSL PE+G L +LKS+DLSNN F+GEIP SF
Sbjct  267   TLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASF  307


 Score =   107 bits (267),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 122/248 (49%), Gaps = 26/248 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG + P++G+L  L  L +  N LSG + PE+  +++L+ ++LSNN+F    P   AQL
Sbjct  251   LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASFAQL  310

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L+ L +S N 
Sbjct  311   KNLTLLNLFRNKLHGRIPDFIGELPELEVLQLWENNFTGSIPQKLGSNKKLQVLDLSSNK  370

Query  737   LSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+G                         IP  +G    L  + +G  N  +G IP  +  
Sbjct  371   LTGTLPPDMCSGNTLQTLITLGNFLLGPIPESLGKCESLSRIRMGE-NYLNGSIPKGLLG  429

Query  845   LSQLIRFDAANCGLTGELPVEIGKLK-NLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
             L QL + +  +  LTGE PV    +  NL  + L  N LSG+L   +G    ++ L L  
Sbjct  430   LPQLTQVELQDNYLTGEFPVTDSSISANLGQISLSNNQLSGALPASVGNFSGVQKLLLDG  489

Query  1022  nAFSGEIP  1045
             N FSG IP
Sbjct  490   NKFSGPIP  497


 Score =   101 bits (252),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 84/246 (34%), Positives = 125/246 (51%), Gaps = 27/246 (11%)
 Frame = +2

Query  395   PD-VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  571
             PD +G+LP L  L +  N  +G +P ++ +   L+ L+LS+N    T P  +     LQ 
Sbjct  328   PDFIGELPELEVLQLWENNFTGSIPQKLGSNKKLQVLDLSSNKLTGTLPPDMCSGNTLQT  387

Query  572   LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP------PEY-----------GRF  700
             L    N L G +P  + K  SL  + +G NY +G IP      P+            G F
Sbjct  388   LITLGNFLLGPIPESLGKCESLSRIRMGENYLNGSIPKGLLGLPQLTQVELQDNYLTGEF  447

Query  701   P--------NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  856
             P        NL  +++S N LSG +P+ +GN + +++L +   N FSG IP E+G L QL
Sbjct  448   PVTDSSISANLGQISLSNNQLSGALPASVGNFSGVQKLLLD-GNKFSGPIPAEIGKLQQL  506

Query  857   IRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSG  1036
              + D ++  L+G +P EI K K L  + L  N+LSG +  EI  ++ L  L+LS N   G
Sbjct  507   SKIDFSHNKLSGLIPPEICKCKLLTFVDLSGNELSGRIPTEITSMRILNYLNLSRNHLLG  566

Query  1037  EIPESF  1054
              IP S 
Sbjct  567   SIPSSI  572


 Score = 99.0 bits (245),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 76/227 (33%), Positives = 114/227 (50%), Gaps = 2/227 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  370   KLTGTLPPDMCSGNTLQTLITLGNFLLGPIPESLGKCESLSRIRMGENYLNGSIPKGLLG  429

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTS-LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
             L  L  ++L +N LTG+ PV    +++ L  + L  N  SG +P   G F  ++ L + G
Sbjct  430   LPQLTQVELQDNYLTGEFPVTDSSISANLGQISLSNNQLSGALPASVGNFSGVQKLLLDG  489

Query  731   NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
             N  SG IP+EIG L +L ++   + N  SG IPPE+     L   D +   L+G +P EI
Sbjct  490   NKFSGPIPAEIGKLQQLSKIDFSH-NKLSGLIPPEICKCKLLTFVDLSGNELSGRIPTEI  548

Query  911   GKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
               ++ L+ L L  N L GS+   I  +++L S+D S N  SG +P S
Sbjct  549   TSMRILNYLNLSRNHLLGSIPSSISTMQSLTSVDFSYNNLSGLVPGS  595


 Score = 98.6 bits (244),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 102/199 (51%), Gaps = 1/199 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            +  G L P++G L  LV    A   LSG +PPEI  +  L  L L  N    +   +L  
Sbjct  226  SFEGGLPPEIGNLSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGT  285

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L +L+ +DL NN  TG++P    ++ +L  L+L  N   GRIP   G  P LE L +  N
Sbjct  286  LNSLKSMDLSNNMFTGEIPASFAQLKNLTLLNLFRNKLHGRIPDFIGELPELEVLQLWEN  345

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              +G IP ++G+  KL+ L +   N  +G +PP+M + + L         L G +P  +G
Sbjct  346  NFTGSIPQKLGSNKKLQVLDLSS-NKLTGTLPPDMCSGNTLQTLITLGNFLLGPIPESLG  404

Query  914  KLKNLDTLFLQVNDLSGSL  970
            K ++L  + +  N L+GS+
Sbjct  405  KCESLSRIRMGENYLNGSI  423



>ref|NP_190536.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 sp|Q9M2Z1.1|BAME2_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2; AltName: Full=Protein BARELY ANY MERISTEM 
2; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB66905.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAO64138.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|AAP04098.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 dbj|BAF00510.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59331.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE78574.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1002

 Score =   338 bits (867),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 183/283 (65%), Positives = 222/283 (78%), Gaps = 3/283 (1%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSL-TSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGV  388
             +TE  ALLS+K++FT D  S L TSWN+ST+ C+W  VTCD  L  V+      LNLSG 
Sbjct  25    ITELHALLSLKSSFTIDEHSPLLTSWNLSTTFCSWTGVTCDVSLRHVTSLDLSGLNLSGT  84

Query  389   LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANL  565
             LS DV  LP L NLS+AANQ+SGP+PP+IS +  LR LNLSNN+F  +FP +L+  L NL
Sbjct  85    LSSDVAHLPLLQNLSLAANQISGPIPPQISNLYELRHLNLSNNVFNGSFPDELSSGLVNL  144

Query  566   QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  745
             +VLDLYNNNLTGDLPV +  +T LRHLHLGGNYFSG+IP  YG +P LEYLAVSGN L+G
Sbjct  145   RVLDLYNNNLTGDLPVSLTNLTQLRHLHLGGNYFSGKIPATYGTWPVLEYLAVSGNELTG  204

Query  746   VIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKN  925
              IP EIGNLT L+ELYIGY+N F  G+PPE+GNLS+L+RFDAANCGLTGE+P EIGKL+ 
Sbjct  205   KIPPEIGNLTTLRELYIGYYNAFENGLPPEIGNLSELVRFDAANCGLTGEIPPEIGKLQK  264

Query  926   LDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             LDTLFLQVN  +G++  E+G + +LKS+DLSNN F+GEIP SF
Sbjct  265   LDTLFLQVNAFTGTITQELGLISSLKSMDLSNNMFTGEIPTSF  307


 Score =   105 bits (261),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 123/248 (50%), Gaps = 26/248 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G + P++G+L  L  L +  N  +G +  E+  IS+L+ ++LSNN+F    P   +QL
Sbjct  251   LTGEIPPEIGKLQKLDTLFLQVNAFTGTITQELGLISSLKSMDLSNNMFTGEIPTSFSQL  310

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  + +M  L  L L  N F+G IP + G    L  L +S N 
Sbjct  311   KNLTLLNLFRNKLYGAIPEFIGEMPELEVLQLWENNFTGSIPQKLGENGRLVILDLSSNK  370

Query  737   LSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+G                         IP  +G    L  + +G  N  +G IP E+  
Sbjct  371   LTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGE-NFLNGSIPKELFG  429

Query  845   LSQLIRFDAANCGLTGELPVEIGKLK-NLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
             L +L + +  +  LTGELP+  G +  +L  + L  N LSGSL   IG L  ++ L L  
Sbjct  430   LPKLSQVELQDNYLTGELPISGGGVSGDLGQISLSNNQLSGSLPAAIGNLSGVQKLLLDG  489

Query  1022  nAFSGEIP  1045
             N FSG IP
Sbjct  490   NKFSGSIP  497


 Score =   101 bits (251),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 115/205 (56%), Gaps = 4/205 (2%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI-SAISTLRFLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   LV L +++N+L+G +PP + S    +  + L N +FGS  P  L 
Sbjct  346  NFTGSIPQKLGENGRLVILDLSSNKLTGTLPPNMCSGNRLMTLITLGNFLFGS-IPDSLG  404

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFP-NLEYLAVS  727
            +  +L  + +  N L G +P E++ +  L  + L  NY +G +P   G    +L  +++S
Sbjct  405  KCESLTRIRMGENFLNGSIPKELFGLPKLSQVELQDNYLTGELPISGGGVSGDLGQISLS  464

Query  728  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
             N LSG +P+ IGNL+ +++L +   N FSG IPPE+G L QL + D ++   +G +  E
Sbjct  465  NNQLSGSLPAAIGNLSGVQKLLLDG-NKFSGSIPPEIGRLQQLSKLDFSHNLFSGRIAPE  523

Query  908  IGKLKNLDTLFLQVNDLSGSLAPEI  982
            I + K L  + L  N+LSG +  E+
Sbjct  524  ISRCKLLTFVDLSRNELSGDIPNEL  548


 Score = 98.6 bits (244),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 122/251 (49%), Gaps = 26/251 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              SG +    G  P L  L+++ N+L+G +PPEI  ++TLR L +   N F +  P ++  
Sbjct  178   FSGKIPATYGTWPVLEYLAVSGNELTGKIPPEIGNLTTLRELYIGYYNAFENGLPPEIGN  237

Query  554   LANLQVLDLYNNNLTGDLPVEVYKM------------------------TSLRHLHLGGN  661
             L+ L   D  N  LTG++P E+ K+                        +SL+ + L  N
Sbjct  238   LSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNAFTGTITQELGLISSLKSMDLSNN  297

Query  662   YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
              F+G IP  + +  NL  L +  N L G IP  IG + +L+ L + + N F+G IP ++G
Sbjct  298   MFTGEIPTSFSQLKNLTLLNLFRNKLYGAIPEFIGEMPELEVLQL-WENNFTGSIPQKLG  356

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
                +L+  D ++  LTG LP  +     L TL    N L GS+   +G  ++L  + +  
Sbjct  357   ENGRLVILDLSSNKLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGE  416

Query  1022  nAFSGEIPESF  1054
             N  +G IP+  
Sbjct  417   NFLNGSIPKEL  427


 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 73/226 (32%), Positives = 114/226 (50%), Gaps = 2/226 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G L P++     L+ L    N L G +P  +    +L  + +  N    + P +L  L
Sbjct  371   LTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKELFGL  430

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMT-SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
               L  ++L +N LTG+LP+    ++  L  + L  N  SG +P   G    ++ L + GN
Sbjct  431   PKLSQVELQDNYLTGELPISGGGVSGDLGQISLSNNQLSGSLPAAIGNLSGVQKLLLDGN  490

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP EIG L +L +L   + N FSG I PE+     L   D +   L+G++P E+ 
Sbjct  491   KFSGSIPPEIGRLQQLSKLDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGDIPNELT  549

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
              +K L+ L L  N L GS+   I  +++L S+D S N  SG +P +
Sbjct  550   GMKILNYLNLSRNHLVGSIPVTIASMQSLTSVDFSYNNLSGLVPST  595



>ref|XP_004509039.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1005

 Score =   338 bits (867),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 183/282 (65%), Positives = 225/282 (80%), Gaps = 2/282 (1%)
 Frame = +2

Query  215   VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCds-llhvvsldlsglNLSGV  388
             ++E   LLS K++  T D   SL SWN ST+HC+W  +TC     HV S+DLS L L+  
Sbjct  22    ISEHKTLLSFKSSSITDDPTHSLISWNSSTTHCSWHGITCTGPHRHVTSIDLSSLTLTAT  81

Query  389   LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  568
             LS  +  LPFL NLS+A N+ SGP+PP  S++ +LRFLNLSNN+F  TFP QL++L+NL 
Sbjct  82    LSDHLSNLPFLSNLSLADNKFSGPIPPSFSSLYSLRFLNLSNNVFNGTFPSQLSRLSNLH  141

Query  569   VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  748
             VLDLYNNN+TG LP+ V +M +LRHLHLGGN+F+G+IPPEYG +P+LEYLAVSGN LSG 
Sbjct  142   VLDLYNNNMTGTLPLSVTRMQNLRHLHLGGNFFTGKIPPEYGTWPHLEYLAVSGNELSGP  201

Query  749   IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNL  928
             IP EIGNLT L+ELYIGY+N + GGIPPE+GNLS ++RFDAA CGLTGE+P E+GKL+NL
Sbjct  202   IPPEIGNLTSLRELYIGYYNTYDGGIPPEIGNLSAMVRFDAAYCGLTGEIPPELGKLQNL  261

Query  929   DTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             DTLFLQVN LSGSL PE+G LK+LKS+DLSNNAF GE+P SF
Sbjct  262   DTLFLQVNALSGSLTPELGNLKSLKSMDLSNNAFDGEVPASF  303


 Score =   101 bits (251),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 81/247 (33%), Positives = 121/247 (49%), Gaps = 25/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN F    P   A+L
Sbjct  247   LTGEIPPELGKLQNLDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNAFDGEVPASFAEL  306

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP------------------  682
              NL +L+L+ N L G +P  + +M +L  L +  N F+G IP                  
Sbjct  307   KNLTLLNLFRNKLHGAIPEFIGEMPALEVLQIWENNFTGSIPQSLGKNGKLTLVDVSSNK  366

Query  683   -----PEYGRFPN-LEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
                  P Y  F N L+ L   GN L G IP  +G    L  + +G  N  +G IP  +  
Sbjct  367   LTGSLPPYMCFGNKLQTLITLGNFLFGPIPDSLGKCESLSRIRMGE-NFLNGSIPKGLFG  425

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L QL + +  +  L+GE P  +    NL  + L  N LSG L   IG   +++ L L  N
Sbjct  426   LPQLTQVELQDNLLSGEFPQPVSMSPNLGQVTLSNNKLSGPLPSSIGNFTSVQKLLLDGN  485

Query  1025  AFSGEIP  1045
              F+G+IP
Sbjct  486   QFTGKIP  492


 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 107/204 (52%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   L  + +++N+L+G +PP +   + L+  + L N +FG   P  L 
Sbjct  342  NFTGSIPQSLGKNGKLTLVDVSSNKLTGSLPPYMCFGNKLQTLITLGNFLFGP-IPDSLG  400

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ +  L  + L  N  SG  P      PNL  + +S 
Sbjct  401  KCESLSRIRMGENFLNGSIPKGLFGLPQLTQVELQDNLLSGEFPQPVSMSPNLGQVTLSN  460

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +PS IGN T +++L +   N F+G IP E+G L QL + D ++   +G +  EI
Sbjct  461  NKLSGPLPSSIGNFTSVQKLLLDG-NQFTGKIPSEIGKLQQLSKIDFSHNKFSGPIAPEI  519

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
               K L  + L  N+LSG +  EI
Sbjct  520  SHCKLLTFVDLSRNELSGEIPNEI  543


 Score = 84.0 bits (206),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 99/203 (49%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP  ++  
Sbjct  391  LFGPIPDSLGKCESLSRIRMGENFLNGSIPKGLFGLPQLTQVELQDNLLSGEFPQPVSMS  450

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL  + L NN L+G LP  +   TS++ L L GN F+G+IP E G+   L  +  S N 
Sbjct  451  PNLGQVTLSNNKLSGPLPSSIGNFTSVQKLLLDGNQFTGKIPSEIGKLQQLSKIDFSHNK  510

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             SG I  EI +   L  + +   N  SG IP E+  +  L   + +   L G +P  I  
Sbjct  511  FSGPIAPEISHCKLLTFVDLSR-NELSGEIPNEITGMRILNYLNLSRNHLVGTIPGSIAS  569

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            +++L ++    N+L+G L P  G
Sbjct  570  MQSLTSVDFSYNNLTG-LVPGTG  591



>ref|XP_006404116.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
 gb|ESQ45569.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
Length=1009

 Score =   338 bits (866),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 188/291 (65%), Positives = 220/291 (76%), Gaps = 7/291 (2%)
 Frame = +2

Query  197   AGKPLGVTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls  367
             AG+P  ++E  ALLS+K++ T    D  S LTSW +STS C W  VTCD     V+    
Sbjct  31    AGRP--ISEYHALLSLKSSLTGGENDQHSPLTSWKLSTSFCLWTGVTCDVSRRHVTSLDL  88

Query  368   g-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  544
               LNLSG LS DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNNIF  ++P +
Sbjct  89    SGLNLSGTLSSDVAHLPLLQNLSVAANQISGPIPPEISNLSELRHLNLSNNIFNGSYPDE  148

Query  545   L-AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLA  721
             L A L NLQVLDLYNNNLTGDLPV +  +T LRHLHLGGNYF+G IP  YG +P LEYLA
Sbjct  149   LSAGLVNLQVLDLYNNNLTGDLPVSITNLTQLRHLHLGGNYFAGNIPAVYGTWPVLEYLA  208

Query  722   VSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELP  901
             VSGN L G IP EIGNLT L+ELYIGY+N F  G+PPE+GNLS+L+RFDAANCGLTGE+P
Sbjct  209   VSGNELVGKIPPEIGNLTSLRELYIGYYNAFEDGLPPEIGNLSELVRFDAANCGLTGEIP  268

Query  902   VEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
              EI KL+ LDTLFLQVN  SG L PE+G + +LKS+DLSNN F+GEIP SF
Sbjct  269   PEIWKLQKLDTLFLQVNAFSGPLTPELGMISSLKSMDLSNNMFTGEIPASF  319


 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 84/247 (34%), Positives = 120/247 (49%), Gaps = 25/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G + P++ +L  L  L +  N  SGP+ PE+  IS+L+ ++LSNN+F    P    QL
Sbjct  263   LTGEIPPEIWKLQKLDTLFLQVNAFSGPLTPELGMISSLKSMDLSNNMFTGEIPASFEQL  322

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  +  +  L  L L  N F+G IP + G    L  L +S N 
Sbjct  323   KNLTLLNLFRNKLYGAIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGKLVILDLSSNK  382

Query  737   LSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+G                         IP  +G    L  + +G  N  +G IP  +  
Sbjct  383   LTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGECESLTRIRMGE-NFLNGSIPKGLLG  441

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L +L + +  +  LTGELPV  G   NL  + L  N LSG L P IG    ++ L L  N
Sbjct  442   LPKLSQVELQDNYLTGELPVSGGVSVNLGQISLSNNQLSGPLPPAIGNFSGVQKLLLDGN  501

Query  1025  AFSGEIP  1045
              FSG+IP
Sbjct  502   KFSGQIP  508


 Score =   101 bits (252),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 116/226 (51%), Gaps = 1/226 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L+ L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  382   KLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGECESLTRIRMGENFLNGSIPKGLLG  441

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N LTG+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  442   LPKLSQVELQDNYLTGELPVSGGVSVNLGQISLSNNQLSGPLPPAIGNFSGVQKLLLDGN  501

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IPSEIG L +L +L   + N FSG I PE+ +   L   D +   L+GE+P EI 
Sbjct  502   KFSGQIPSEIGRLQQLSKLDFSH-NLFSGRITPEISHCKLLTFVDLSRNELSGEIPNEIT  560

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
              ++ L+ L +  N L GS+   I  +++L S+D S N  SG +P +
Sbjct  561   SMRILNYLNISRNHLVGSIPVTIASMQSLTSVDFSYNNLSGLVPST  606


 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 72/218 (33%), Positives = 110/218 (50%), Gaps = 2/218 (1%)
 Frame = +2

Query  404   GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQLANLQVLDL  580
             G  P L  L+++ N+L G +PPEI  +++LR L +   N F    P ++  L+ L   D 
Sbjct  199   GTWPVLEYLAVSGNELVGKIPPEIGNLTSLRELYIGYYNAFEDGLPPEIGNLSELVRFDA  258

Query  581   YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSE  760
              N  LTG++P E++K+  L  L L  N FSG + PE G   +L+ + +S N  +G IP+ 
Sbjct  259   ANCGLTGEIPPEIWKLQKLDTLFLQVNAFSGPLTPELGMISSLKSMDLSNNMFTGEIPAS  318

Query  761   IGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLF  940
                L  L  L + + N   G IP  +G+L +L          TG +P ++G+   L  L 
Sbjct  319   FEQLKNLTLLNL-FRNKLYGAIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGKLVILD  377

Query  941   LQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             L  N L+G+L P +     L +L    N   G IP+S 
Sbjct  378   LSSNKLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSL  415


 Score = 94.7 bits (234),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 67/204 (33%), Positives = 109/204 (53%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI-SAISTLRFLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   LV L +++N+L+G +PP + S    +  + L N +FGS  P  L 
Sbjct  358  NFTGSIPQKLGENGKLVILDLSSNKLTGTLPPNMCSGNRLMTLITLGNFLFGS-IPDSLG  416

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  +  +  L  + L  NY +G +P   G   NL  +++S 
Sbjct  417  ECESLTRIRMGENFLNGSIPKGLLGLPKLSQVELQDNYLTGELPVSGGVSVNLGQISLSN  476

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +P  IGN + +++L +   N FSG IP E+G L QL + D ++   +G +  EI
Sbjct  477  NQLSGPLPPAIGNFSGVQKLLLD-GNKFSGQIPSEIGRLQQLSKLDFSHNLFSGRITPEI  535

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
               K L  + L  N+LSG +  EI
Sbjct  536  SHCKLLTFVDLSRNELSGEIPNEI  559



>ref|XP_002310320.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
 gb|EEE90770.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
Length=1020

 Score =   338 bits (866),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 182/281 (65%), Positives = 223/281 (79%), Gaps = 1/281 (0%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  391
             V+E  ALLSIK++ T D QS L++WN +T  C+W  +TCD     V+      LNLSG L
Sbjct  28    VSEYEALLSIKSSITDDPQSFLSAWNSTTPLCSWTGITCDHTGRRVTSLDLSGLNLSGTL  87

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  571
             S DV  L +L NLS+A NQ SGP+P  +SA+++LR LNLSNNIF STFP QL+ L NLQV
Sbjct  88    SSDVAHLRYLQNLSLAVNQFSGPIPASLSAVTSLRSLNLSNNIFNSTFPPQLSSLKNLQV  147

Query  572   LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  751
             LDLYNNN+TG LP+ V +M +LRHLHLGGNY+SG+IP EYG++  LEYLA+SGN L G I
Sbjct  148   LDLYNNNMTGGLPLTVVEMPNLRHLHLGGNYYSGKIPSEYGKWGFLEYLAISGNELEGSI  207

Query  752   PSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLD  931
             P E+GNLTKL+ELYIGYFN + GG+PPE+GNLS L+RFDAANCGL+G++P EIG+L+ LD
Sbjct  208   PVELGNLTKLRELYIGYFNTYEGGLPPEIGNLSSLVRFDAANCGLSGQIPPEIGRLQKLD  267

Query  932   TLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             TLFLQVN LSGSL PE+G LK+LKS+DLSNN F+GEIP SF
Sbjct  268   TLFLQVNGLSGSLTPELGSLKSLKSMDLSNNMFTGEIPTSF  308


 Score =   106 bits (264),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 123/248 (50%), Gaps = 27/248 (11%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG + P++G+L  L  L +  N LSG + PE+ ++ +L+ ++LSNN+F    P   A+L
Sbjct  252   LSGQIPPEIGRLQKLDTLFLQVNGLSGSLTPELGSLKSLKSMDLSNNMFTGEIPTSFAEL  311

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  + ++  L+ L L  N F+  IP   G+   LE L +S N 
Sbjct  312   KNLTLLNLFRNKLYGAIPEFIAELPELQVLQLWENNFTSTIPQALGQNGKLEILDLSSNK  371

Query  737   LSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+G                         IP  +G    L  + +G  N  +G IP  + +
Sbjct  372   LTGTLPPNMCLGNNLQTLITLSNFLFGPIPESLGQCQSLSRIRMGE-NFLNGSIPKGLFD  430

Query  845   LSQLIRFDAANCGLTGELPVEIGKLK-NLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
             L  L + +  +  L GE PV IG L  NL  L L  N L+GSL P +G    ++   L  
Sbjct  431   LPNLSQVELQDNLLAGEFPV-IGTLAVNLGQLSLSNNRLTGSLPPSVGNFSGVQKFLLDG  489

Query  1022  nAFSGEIP  1045
             N FSG IP
Sbjct  490   NKFSGSIP  497


 Score =   100 bits (250),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 112/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L  L   +N L GP+P  +    +L  + +  N    + P  L  
Sbjct  371   KLTGTLPPNMCLGNNLQTLITLSNFLFGPIPESLGQCQSLSRIRMGENFLNGSIPKGLFD  430

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL  ++L +N L G+ PV      +L  L L  N  +G +PP  G F  ++   + GN
Sbjct  431   LPNLSQVELQDNLLAGEFPVIGTLAVNLGQLSLSNNRLTGSLPPSVGNFSGVQKFLLDGN  490

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP EIG L +L ++   + N FSG I PE+     L   D +   L+GE+P EI 
Sbjct  491   KFSGSIPPEIGRLQQLTKMDFSH-NKFSGPIAPEISQCKLLTFVDLSRNELSGEIPTEIT  549

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L S+D S N  SG +P
Sbjct  550   GMRILNYLNLSRNHLVGSIPAPIATMQSLTSVDFSYNNLSGLVP  593


 Score = 85.9 bits (211),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 71/225 (32%), Positives = 108/225 (48%), Gaps = 2/225 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             L G +  ++G L  L  L I   N   G +PPEI  +S+L   + +N       P ++ +
Sbjct  203   LEGSIPVELGNLTKLRELYIGYFNTYEGGLPPEIGNLSSLVRFDAANCGLSGQIPPEIGR  262

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  L L  N L+G L  E+  + SL+ + L  N F+G IP  +    NL  L +  N
Sbjct  263   LQKLDTLFLQVNGLSGSLTPELGSLKSLKSMDLSNNMFTGEIPTSFAELKNLTLLNLFRN  322

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  I  L +L+ L + + N F+  IP  +G   +L   D ++  LTG LP  + 
Sbjct  323   KLYGAIPEFIAELPELQVLQL-WENNFTSTIPQALGQNGKLEILDLSSNKLTGTLPPNMC  381

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPE  1048
                NL TL    N L G +   +G  ++L  + +  N  +G IP+
Sbjct  382   LGNNLQTLITLSNFLFGPIPESLGQCQSLSRIRMGENFLNGSIPK  426



>ref|NP_001235080.1| receptor-like protein kinase 3 precursor [Glycine max]
 gb|AAF91324.1|AF244890_1 receptor-like protein kinase 3 [Glycine max]
Length=1012

 Score =   337 bits (863),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 184/280 (66%), Positives = 229/280 (82%), Gaps = 0/280 (0%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  394
             ++E  ALLS+++A T  +   LTSWN ST +C+W  VTCD+  HV SLDL+GL+LSG LS
Sbjct  25    ISEYRALLSLRSAITDATPPLLTSWNSSTPYCSWLGVTCDNRRHVTSLDLTGLDLSGPLS  84

Query  395   PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  574
              DV  LPFL NLS+A+N+ SGP+PP +SA+S LRFLNLSNN+F  TFP +L++L NL+VL
Sbjct  85    ADVAHLPFLSNLSLASNKFSGPIPPSLSALSGLRFLNLSNNVFNETFPSELSRLQNLEVL  144

Query  575   DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  754
             DLYNNN+TG LP+ V +M +LRHLHLGGN+FSG+IPPEYGR+  L+YLAVSGN L G IP
Sbjct  145   DLYNNNMTGVLPLAVAQMQNLRHLHLGGNFFSGQIPPEYGRWQRLQYLAVSGNELEGTIP  204

Query  755   SEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDT  934
              EIGNL+ L+ELYIGY+N ++GGIPPE+GNLS+L+R DAA CGL+GE+P  +GKL+ LDT
Sbjct  205   PEIGNLSSLRELYIGYYNTYTGGIPPEIGNLSELVRLDAAYCGLSGEIPAALGKLQKLDT  264

Query  935   LFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             LFLQVN LSGSL PE+G LK+LKS+DLSNN  SGEIP  F
Sbjct  265   LFLQVNALSGSLTPELGNLKSLKSMDLSNNMLSGEIPARF  304


 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 113/224 (50%), Gaps = 3/224 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG L+P++G L  L ++ ++ N LSG +P     +  +  LNL  N      P  + +L
Sbjct  272   LSGSLTPELGNLKSLKSMDLSNNMLSGEIPARFGELKNITLLNLFRNKLHGAIPEFIGEL  331

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L+V+ L+ NN TG +P  + K   L  + L  N  +G +P        L+ L   GN 
Sbjct  332   PALEVVQLWENNFTGSIPEGLGKNGRLNLVDLSSNKLTGTLPTYLCSGNTLQTLITLGNF  391

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L G IP  +G+   L  + +G  N  +G IP  +  L +L + +  +  L+GE P E+G 
Sbjct  392   LFGPIPESLGSCESLTRIRMGE-NFLNGSIPRGLFGLPKLTQVELQDNYLSGEFP-EVGS  449

Query  917   LK-NLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             +  NL  + L  N LSG L P IG   +++ L L  N F+G IP
Sbjct  450   VAVNLGQITLSNNQLSGVLPPSIGNFSSVQKLILDGNMFTGRIP  493


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 73/227 (32%), Positives = 112/227 (49%), Gaps = 2/227 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              SG + P+ G+   L  L+++ N+L G +PPEI  +S+LR L +   N +    P ++  
Sbjct  175   FSGQIPPEYGRWQRLQYLAVSGNELEGTIPPEIGNLSSLRELYIGYYNTYTGGIPPEIGN  234

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L+ L  LD     L+G++P  + K+  L  L L  N  SG + PE G   +L+ + +S N
Sbjct  235   LSELVRLDAAYCGLSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNLKSLKSMDLSNN  294

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              LSG IP+  G L  +  L + + N   G IP  +G L  L          TG +P  +G
Sbjct  295   MLSGEIPARFGELKNITLLNL-FRNKLHGAIPEFIGELPALEVVQLWENNFTGSIPEGLG  353

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             K   L+ + L  N L+G+L   +     L++L    N   G IPES 
Sbjct  354   KNGRLNLVDLSSNKLTGTLPTYLCSGNTLQTLITLGNFLFGPIPESL  400


 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 107/227 (47%), Gaps = 25/227 (11%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             L G +   +G+LP L  + +  N  +G +P  +     L  ++LS+N    T P  L  
Sbjct  319  KLHGAIPEFIGELPALEVVQLWENNFTGSIPEGLGKNGRLNLVDLSSNKLTGTLPTYLCS  378

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP------PEY--------  691
               LQ L    N L G +P  +    SL  + +G N+ +G IP      P+         
Sbjct  379  GNTLQTLITLGNFLFGPIPESLGSCESLTRIRMGENFLNGSIPRGLFGLPKLTQVELQDN  438

Query  692  ---GRFP-------NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
               G FP       NL  + +S N LSGV+P  IGN + +++L +   N F+G IPP++G
Sbjct  439  YLSGEFPEVGSVAVNLGQITLSNNQLSGVLPPSIGNFSSVQKLILD-GNMFTGRIPPQIG  497

Query  842  NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEI  982
             L QL + D +    +G +  EI + K L  L L  N+LSG +  EI
Sbjct  498  RLQQLSKIDFSGNKFSGPIVPEISQCKLLTFLDLSRNELSGDIPNEI  544


 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 97/203 (48%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G +   +G    L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  392  LFGPIPESLGSCESLTRIRMGENFLNGSIPRGLFGLPKLTQVELQDNYLSGEFPEVGSVA  451

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL  + L NN L+G LP  +   +S++ L L GN F+GRIPP+ GR   L  +  SGN 
Sbjct  452  VNLGQITLSNNQLSGVLPPSIGNFSSVQKLILDGNMFTGRIPPQIGRLQQLSKIDFSGNK  511

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             SG I  EI     L  L +   N  SG IP E+  +  L   + +   L G +P  I  
Sbjct  512  FSGPIVPEISQCKLLTFLDLSR-NELSGDIPNEITGMRILNYLNLSRNHLVGGIPSSISS  570

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            +++L ++    N+LSG L P  G
Sbjct  571  MQSLTSVDFSYNNLSG-LVPGTG  592


 Score = 85.9 bits (211),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 104/209 (50%), Gaps = 1/209 (0%)
 Frame = +2

Query  419   LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  598
             L  L    N L GP+P  + +  +L  + +  N    + P  L  L  L  ++L +N L+
Sbjct  382   LQTLITLGNFLFGPIPESLGSCESLTRIRMGENFLNGSIPRGLFGLPKLTQVELQDNYLS  441

Query  599   GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  778
             G+ P       +L  + L  N  SG +PP  G F +++ L + GN  +G IP +IG L +
Sbjct  442   GEFPEVGSVAVNLGQITLSNNQLSGVLPPSIGNFSSVQKLILDGNMFTGRIPPQIGRLQQ  501

Query  779   LKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDL  958
             L ++     N FSG I PE+     L   D +   L+G++P EI  ++ L+ L L  N L
Sbjct  502   LSKIDFS-GNKFSGPIVPEISQCKLLTFLDLSRNELSGDIPNEITGMRILNYLNLSRNHL  560

Query  959   SGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              G +   I  +++L S+D S N  SG +P
Sbjct  561   VGGIPSSISSMQSLTSVDFSYNNLSGLVP  589


 Score = 76.6 bits (187),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 97/225 (43%), Gaps = 24/225 (11%)
 Frame = +2

Query  380  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  559
            +G + P++G L  LV L  A   LSG +P  +  +  L  L L  N    +   +L  L 
Sbjct  225  TGGIPPEIGNLSELVRLDAAYCGLSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNLK  284

Query  560  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  739
            +L+ +DL NN L+G++P    ++ ++  L+L  N   G IP   G  P LE + +  N  
Sbjct  285  SLKSMDLSNNMLSGEIPARFGELKNITLLNLFRNKLHGAIPEFIGELPALEVVQLWENNF  344

Query  740  SGVIPSEIG-----NLTKLK------------------ELYIGYFNGFSGGIPPEMGNLS  850
            +G IP  +G     NL  L                   +  I   N   G IP  +G+  
Sbjct  345  TGSIPEGLGKNGRLNLVDLSSNKLTGTLPTYLCSGNTLQTLITLGNFLFGPIPESLGSCE  404

Query  851  QLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIG  985
             L R       L G +P  +  L  L  + LQ N LSG   PE+G
Sbjct  405  SLTRIRMGENFLNGSIPRGLFGLPKLTQVELQDNYLSGEF-PEVG  448



>ref|XP_010028033.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Eucalyptus grandis]
 gb|KCW54695.1| hypothetical protein EUGRSUZ_I00635 [Eucalyptus grandis]
Length=1023

 Score =   336 bits (861),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 195/301 (65%), Positives = 236/301 (78%), Gaps = 9/301 (3%)
 Frame = +2

Query  176   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTS-------HCTWRRVTCd  334
             R  A A A  P  +TE  ALLSI+AA T D QS+L+SW  + +       HC+W+ VTCD
Sbjct  17    RRGAAASAA-PTRLTEPLALLSIRAAVTGDPQSALSSWTSAAAAAANGSSHCSWQGVTCD  75

Query  335   -sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS  511
                 HV +LDLS L L+G LSPDV  L FL++LS+AANQLSGP+PP+ISA++ LR+LNLS
Sbjct  76    PRRRHVTALDLSSLELAGALSPDVAHLRFLISLSVAANQLSGPIPPQISALAALRYLNLS  135

Query  512   NNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEY  691
             NN+F  TFP +L  L NL+VLDLYNNN+TGDLPV V +M  LRHLHLGGNYF GRIPPEY
Sbjct  136   NNVFNGTFPPRLGLLRNLRVLDLYNNNMTGDLPVAVAEMPQLRHLHLGGNYFGGRIPPEY  195

Query  692   GRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDA  871
             GR+  +EYLAVSG+ L+G IP EIGNLT L+ELY+GY+N + G +PPE+GNLSQL+R DA
Sbjct  196   GRWEFIEYLAVSGDELTGAIPPEIGNLTTLRELYLGYYNSYDGSLPPEIGNLSQLVRLDA  255

Query  872   ANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
             A+CGL+GE+P EI KL+NLDTLFLQVN  +GSL  EIGYL +LKSLDLSNN F+GEIPES
Sbjct  256   ASCGLSGEIPPEIAKLQNLDTLFLQVNGFAGSLPAEIGYLNSLKSLDLSNNMFAGEIPES  315

Query  1052  F  1054
             F
Sbjct  316   F  316


 Score = 99.4 bits (246),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 78/248 (31%), Positives = 121/248 (49%), Gaps = 26/248 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG + P++ +L  L  L +  N  +G +P EI  +++L+ L+LSNN+F    P   +QL
Sbjct  260   LSGEIPPEIAKLQNLDTLFLQVNGFAGSLPAEIGYLNSLKSLDLSNNMFAGEIPESFSQL  319

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L L+ N L G++P  +  +  L+ L L  N F+G IP   G+  +L+ + +S N 
Sbjct  320   KNLTLLHLFRNKLNGEIPEFIADLPELQVLQLWENNFTGSIPQGLGKNGHLQIVDLSSNK  379

Query  737   LSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+G                         IP  +G    L+ + +G  N  +G IP  +  
Sbjct  380   LTGTLPPDLCYGNQLQILIALSNYLLGPIPESLGKCRSLERIRMG-GNYLNGSIPRGLFG  438

Query  845   LSQLIRFDAANCGLTGELPVEIGKLK-NLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
             L +L + +  +  L GE PV    +   L  + L  N L GSL P IG    ++ L L  
Sbjct  439   LPELNQVEFQDNLLVGEFPVSDDSIALKLGQITLSNNKLGGSLPPTIGNFSGVQKLLLDG  498

Query  1022  nAFSGEIP  1045
             N FSG+IP
Sbjct  499   NNFSGQIP  506


 Score = 98.6 bits (244),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 83/252 (33%), Positives = 124/252 (49%), Gaps = 26/252 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G +   +  LP L  L +  N  +G +P  +     L+ ++LS+N    T P  L  
Sbjct  331   KLNGEIPEFIADLPELQVLQLWENNFTGSIPQGLGKNGHLQIVDLSSNKLTGTLPPDLCY  390

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP------PE---------  688
                LQ+L   +N L G +P  + K  SL  + +GGNY +G IP      PE         
Sbjct  391   GNQLQILIALSNYLLGPIPESLGKCRSLERIRMGGNYLNGSIPRGLFGLPELNQVEFQDN  450

Query  689   --YGRFP--------NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  838
                G FP         L  + +S N L G +P  IGN + +++L +   N FSG IPPE+
Sbjct  451   LLVGEFPVSDDSIALKLGQITLSNNKLGGSLPPTIGNFSGVQKLLLD-GNNFSGQIPPEI  509

Query  839   GNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldls  1018
             G L QL + D ++   +G +P +I + K L  + L  N+LSG +  EI  ++ L  L+LS
Sbjct  510   GRLQQLAKIDFSSNRYSGPIPAQISQCKLLTFVDLSGNELSGEIPNEITGMRILNYLNLS  569

Query  1019  nnAFSGEIPESF  1054
             +N  SG IP S 
Sbjct  570   SNNLSGSIPPSI  581


 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 77/228 (34%), Positives = 115/228 (50%), Gaps = 8/228 (4%)
 Frame = +2

Query  374   NLSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  544
              L+G L PD+    QL  L+ LS   N L GP+P  +    +L  + +  N    + P  
Sbjct  379   KLTGTLPPDLCYGNQLQILIALS---NYLLGPIPESLGKCRSLERIRMGGNYLNGSIPRG  435

Query  545   LAQLANLQVLDLYNNNLTGDLPVEVYKMT-SLRHLHLGGNYFSGRIPPEYGRFPNLEYLA  721
             L  L  L  ++  +N L G+ PV    +   L  + L  N   G +PP  G F  ++ L 
Sbjct  436   LFGLPELNQVEFQDNLLVGEFPVSDDSIALKLGQITLSNNKLGGSLPPTIGNFSGVQKLL  495

Query  722   VSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELP  901
             + GN  SG IP EIG L +L ++     N +SG IP ++     L   D +   L+GE+P
Sbjct  496   LDGNNFSGQIPPEIGRLQQLAKIDFSS-NRYSGPIPAQISQCKLLTFVDLSGNELSGEIP  554

Query  902   VEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              EI  ++ L+ L L  N+LSGS+ P I  +++L S+D S N  SG +P
Sbjct  555   NEITGMRILNYLNLSSNNLSGSIPPSISTMQSLTSVDFSYNNLSGLVP  602


 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/197 (33%), Positives = 104/197 (53%), Gaps = 1/197 (1%)
 Frame = +2

Query  380  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  559
             G L P++G L  LV L  A+  LSG +PPEI+ +  L  L L  N F  + P ++  L 
Sbjct  237  DGSLPPEIGNLSQLVRLDAASCGLSGEIPPEIAKLQNLDTLFLQVNGFAGSLPAEIGYLN  296

Query  560  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  739
            +L+ LDL NN   G++P    ++ +L  LHL  N  +G IP      P L+ L +  N  
Sbjct  297  SLKSLDLSNNMFAGEIPESFSQLKNLTLLHLFRNKLNGEIPEFIADLPELQVLQLWENNF  356

Query  740  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKL  919
            +G IP  +G    L+ + +   N  +G +PP++   +QL    A +  L G +P  +GK 
Sbjct  357  TGSIPQGLGKNGHLQIVDLSS-NKLTGTLPPDLCYGNQLQILIALSNYLLGPIPESLGKC  415

Query  920  KNLDTLFLQVNDLSGSL  970
            ++L+ + +  N L+GS+
Sbjct  416  RSLERIRMGGNYLNGSI  432


 Score = 95.9 bits (237),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 73/225 (32%), Positives = 113/225 (50%), Gaps = 2/225 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             L+G + P++G L  L  L +   N   G +PPEI  +S L  L+ ++       P ++A+
Sbjct  211   LTGAIPPEIGNLTTLRELYLGYYNSYDGSLPPEIGNLSQLVRLDAASCGLSGEIPPEIAK  270

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL  L L  N   G LP E+  + SL+ L L  N F+G IP  + +  NL  L +  N
Sbjct  271   LQNLDTLFLQVNGFAGSLPAEIGYLNSLKSLDLSNNMFAGEIPESFSQLKNLTLLHLFRN  330

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L+G IP  I +L +L+ L + + N F+G IP  +G    L   D ++  LTG LP ++ 
Sbjct  331   KLNGEIPEFIADLPELQVLQL-WENNFTGSIPQGLGKNGHLQIVDLSSNKLTGTLPPDLC  389

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPE  1048
                 L  L    N L G +   +G  ++L+ + +  N  +G IP 
Sbjct  390   YGNQLQILIALSNYLLGPIPESLGKCRSLERIRMGGNYLNGSIPR  434


 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 77/144 (53%), Gaps = 4/144 (3%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            N SG + P++G+L  L  +  ++N+ SGP+P +IS    L F++LS N      P+++  
Sbjct  500  NFSGQIPPEIGRLQQLAKIDFSSNRYSGPIPAQISQCKLLTFVDLSGNELSGEIPNEITG  559

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            +  L  L+L +NNL+G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  560  MRILNYLNLSSNNLSGSIPPSISTMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  618

Query  734  -GLSG--VIPSEIGNLTKLKELYI  796
              L G  + P + G +T + + ++
Sbjct  619  PELCGPYLGPCKDGEMTGIHQAHV  642



>ref|XP_010683073.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=1009

 Score =   335 bits (860),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 184/284 (65%), Positives = 215/284 (76%), Gaps = 6/284 (2%)
 Frame = +2

Query  221   EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl------NLS  382
             EQ ALL IK+A T D QSSL+SWN ST HCTW  + C S   +              NL+
Sbjct  24    EQKALLGIKSAITDDPQSSLSSWNTSTHHCTWDFIKCSSSSSLNHHQSVVSLNISGLNLT  83

Query  383   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  562
             G+LSPD+G L  L NLS+A N  SGP+P  +S +S L  LNLSNNIF STFP  L+ L N
Sbjct  84    GILSPDIGFLTNLQNLSVAGNSFSGPIPSSLSLLSNLYHLNLSNNIFNSTFPSSLSPLQN  143

Query  563   LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  742
             LQ+LD+YNNNLTG LP+ V  M+ LRHLHLGGNYFSG IP EYG++  +EYLAVSGN L 
Sbjct  144   LQILDVYNNNLTGPLPLSVVNMSELRHLHLGGNYFSGEIPAEYGQWRKIEYLAVSGNELE  203

Query  743   GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLK  922
             G IP+EIGNL+ LKELYIGY+NG+SGGIPPE+GNLS+L+RFD ANCGL+GE+P E+GKLK
Sbjct  204   GNIPAEIGNLSSLKELYIGYYNGYSGGIPPEIGNLSELVRFDGANCGLSGEIPAELGKLK  263

Query  923   NLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
              LDTLFLQVN LSG L  E GYL +LKS+DLSNN FSGEIPESF
Sbjct  264   KLDTLFLQVNTLSGYLPSEFGYLSSLKSMDLSNNLFSGEIPESF  307


 Score =   101 bits (251),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 86/271 (32%), Positives = 125/271 (46%), Gaps = 48/271 (18%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ----  544
             LSG +  ++G+L  L  L +  N LSG +P E   +S+L+ ++LSNN+F    P      
Sbjct  251   LSGEIPAELGKLKKLDTLFLQVNTLSGYLPSEFGYLSSLKSMDLSNNLFSGEIPESFSLL  310

Query  545   --------------------LAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  664
                                 +  L  L+VL L+ NN TG +P ++     L+ L L  N 
Sbjct  311   KNLTLLNLFRNKLHGGIPEFIGDLPQLEVLQLWENNFTGSIPEKLGFNGRLQLLDLSSNK  370

Query  665   FSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIG--YFNG---------  811
              +G +PP   +   LE L   GN L G IP  +G+   L  + +G  + NG         
Sbjct  371   LTGTLPPSLCKGERLETLITLGNFLLGPIPESLGSCKSLSRVRMGENFLNGSIPKGLFGL  430

Query  812   ------------FSGGIPPEMGNLS-QLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVN  952
                          +GG P  + +++  L +   +N  LTGELP  IG    +  L L  N
Sbjct  431   PKLTQVELQDNLLTGGFPVTVDSIAVNLGQISLSNNQLTGELPSSIGNFSGVQKLLLDGN  490

Query  953   DLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
               SGS+ PEIG L+ L  +D S+N FSGEIP
Sbjct  491   KFSGSIPPEIGRLQQLSKIDFSSNKFSGEIP  521


 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 74/227 (33%), Positives = 114/227 (50%), Gaps = 2/227 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              SG +  + GQ   +  L+++ N+L G +P EI  +S+L+ L +   N +    P ++  
Sbjct  178   FSGEIPAEYGQWRKIEYLAVSGNELEGNIPAEIGNLSSLKELYIGYYNGYSGGIPPEIGN  237

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L+ L   D  N  L+G++P E+ K+  L  L L  N  SG +P E+G   +L+ + +S N
Sbjct  238   LSELVRFDGANCGLSGEIPAELGKLKKLDTLFLQVNTLSGYLPSEFGYLSSLKSMDLSNN  297

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP E  +L K   L   + N   GGIP  +G+L QL          TG +P ++G
Sbjct  298   LFSGEIP-ESFSLLKNLTLLNLFRNKLHGGIPEFIGDLPQLEVLQLWENNFTGSIPEKLG  356

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
                 L  L L  N L+G+L P +   + L++L    N   G IPES 
Sbjct  357   FNGRLQLLDLSSNKLTGTLPPSLCKGERLETLITLGNFLLGPIPESL  403


 Score = 84.0 bits (206),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 102/204 (50%), Gaps = 3/204 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G +   +G    L  + +  N L+G +P  +  +  L  + L +N+    FP  +  +
Sbjct  395  LLGPIPESLGSCKSLSRVRMGENFLNGSIPKGLFGLPKLTQVELQDNLLTGGFPVTVDSI  454

Query  557  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            A NL  + L NN LTG+LP  +   + ++ L L GN FSG IPPE GR   L  +  S N
Sbjct  455  AVNLGQISLSNNQLTGELPSSIGNFSGVQKLLLDGNKFSGSIPPEIGRLQQLSKIDFSSN  514

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              SG IPSEI     L  + +   N FSG IP E+  +  L   + +   L+G +P  I 
Sbjct  515  KFSGEIPSEISKCKLLTFVDLSR-NQFSGEIPKEITGMRILNYLNISRNHLSGSIPGSIS  573

Query  914  KLKNLDTLFLQVNDLSGSLAPEIG  985
             +++L ++    N+ SG L PE G
Sbjct  574  SMQSLTSVDFSYNNFSG-LIPESG  596


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 75/144 (52%), Gaps = 2/144 (1%)
 Frame = +2

Query  419  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  598
            L  +S++ NQL+G +P  I   S ++ L L  N F  + P ++ +L  L  +D  +N  +
Sbjct  458  LGQISLSNNQLTGELPSSIGNFSGVQKLLLDGNKFSGSIPPEIGRLQQLSKIDFSSNKFS  517

Query  599  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  778
            G++P E+ K   L  + L  N FSG IP E      L YL +S N LSG IP  I ++  
Sbjct  518  GEIPSEISKCKLLTFVDLSRNQFSGEIPKEITGMRILNYLNISRNHLSGSIPGSISSMQS  577

Query  779  LKELYIGYFNGFSGGIPPEMGNLS  850
            L  +   Y N FSG I PE G  S
Sbjct  578  LTSVDFSY-NNFSGLI-PESGQFS  599


 Score = 64.3 bits (155),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 64/120 (53%), Gaps = 1/120 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              SG + P++G+L  L  +  ++N+ SG +P EIS    L F++LS N F    P ++  
Sbjct  491  KFSGSIPPEIGRLQQLSKIDFSSNKFSGEIPSEISKCKLLTFVDLSRNQFSGEIPKEITG  550

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            +  L  L++  N+L+G +P  +  M SL  +    N FSG I PE G+F    Y +  GN
Sbjct  551  MRILNYLNISRNHLSGSIPGSISSMQSLTSVDFSYNNFSGLI-PESGQFSYFNYTSFLGN  609



>gb|KFK34238.1| hypothetical protein AALP_AA5G119100 [Arabis alpina]
Length=998

 Score =   335 bits (859),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 196/289 (68%), Positives = 227/289 (79%), Gaps = 5/289 (2%)
 Frame = +2

Query  197   AGKPLGVTEQAALLSIKAAFTADSQSS-LTSWNISTSHCTWRRVTCdsl-lhvvsldlsg  370
             A +P   TE  ALLS+K + T+  QSS LTSWN+S S C W  VTCD    HV SLDLS 
Sbjct  17    AARP--TTELHALLSLKTSLTSGEQSSSLTSWNLSKSFCLWAGVTCDVSLRHVTSLDLSS  74

Query  371   lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-  547
             LNLSG LS DV  LP L NLS+AANQ+SGP+PPEI+ +S LR LNLSNN+F  ++P+QL 
Sbjct  75    LNLSGTLSSDVAHLPLLQNLSVAANQISGPIPPEIANLSELRHLNLSNNVFNGSYPNQLS  134

Query  548   AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  727
             A+LANLQVLDLYNNNLTGDLPV +  +T LRHLHLGGNYF+GRIP  YG +P LEYLAVS
Sbjct  135   ARLANLQVLDLYNNNLTGDLPVSITNLTQLRHLHLGGNYFTGRIPAVYGSWPVLEYLAVS  194

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
             GN L G IP EIGNLT LKELYIGY+N F  G+PPE+G LS+L+RFDAANCGLTGE+P E
Sbjct  195   GNELVGKIPPEIGNLTTLKELYIGYYNAFENGLPPEIGKLSELVRFDAANCGLTGEIPPE  254

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             IGKL+ LDTLFLQVN  SG L  E+G + +LKS+DLSNN F+GEIP SF
Sbjct  255   IGKLQKLDTLFLQVNAFSGPLTSELGVISSLKSMDLSNNMFTGEIPASF  303


 Score =   102 bits (254),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 119/248 (48%), Gaps = 26/248 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G + P++G+L  L  L +  N  SGP+  E+  IS+L+ ++LSNN+F    P    QL
Sbjct  247   LTGEIPPEIGKLQKLDTLFLQVNAFSGPLTSELGVISSLKSMDLSNNMFTGEIPASFEQL  306

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  +  +  L  L L  N F+G IP + G    L  L +S N 
Sbjct  307   KNLTLLNLFRNKLYGAIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGRLVILDLSSNK  366

Query  737   LSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+G                         IP  +G    L  + +G  N  +G IP  +  
Sbjct  367   LTGTLPVNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGE-NFLNGSIPKGLFG  425

Query  845   LSQLIRFDAANCGLTGELPVEIGKLK-NLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
             L +L + +  +  LTGELP+  G +  NL  + L  N LSG L P IG    ++ L L  
Sbjct  426   LPKLSQVELQDNYLTGELPIGGGVVSVNLGQISLSNNHLSGPLPPAIGNFSGVQKLLLDG  485

Query  1022  nAFSGEIP  1045
             N F G IP
Sbjct  486   NKFGGPIP  493


 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 121/240 (50%), Gaps = 26/240 (11%)
 Frame = +2

Query  404   GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQLANLQVLDL  580
             G  P L  L+++ N+L G +PPEI  ++TL+ L +   N F +  P ++ +L+ L   D 
Sbjct  183   GSWPVLEYLAVSGNELVGKIPPEIGNLTTLKELYIGYYNAFENGLPPEIGKLSELVRFDA  242

Query  581   YNNNLTGDLPVEVYKM------------------------TSLRHLHLGGNYFSGRIPPE  688
              N  LTG++P E+ K+                        +SL+ + L  N F+G IP  
Sbjct  243   ANCGLTGEIPPEIGKLQKLDTLFLQVNAFSGPLTSELGVISSLKSMDLSNNMFTGEIPAS  302

Query  689   YGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFD  868
             + +  NL  L +  N L G IP  IG+L +L+ L + + N F+G IP ++G   +L+  D
Sbjct  303   FEQLKNLTLLNLFRNKLYGAIPEFIGDLPELEVLQL-WENNFTGSIPQKLGENGRLVILD  361

Query  869   AANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPE  1048
              ++  LTG LPV +     L TL    N L GS+   +G  ++L  + +  N  +G IP+
Sbjct  362   LSSNKLTGTLPVNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPK  421


 Score = 89.4 bits (220),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 66/205 (32%), Positives = 109/205 (53%), Gaps = 4/205 (2%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI-SAISTLRFLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   LV L +++N+L+G +P  + S    +  + L N +FGS  P  L 
Sbjct  342  NFTGSIPQKLGENGRLVILDLSSNKLTGTLPVNMCSGNRLMTLITLGNFLFGS-IPDSLG  400

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFP-NLEYLAVS  727
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P   G    NL  +++S
Sbjct  401  KCESLTRIRMGENFLNGSIPKGLFGLPKLSQVELQDNYLTGELPIGGGVVSVNLGQISLS  460

Query  728  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
             N LSG +P  IGN + +++L +   N F G IPPE+G L QL + D ++    G +  E
Sbjct  461  NNHLSGPLPPAIGNFSGVQKLLLDG-NKFGGPIPPEIGRLQQLSKLDFSHNLFPGRIAPE  519

Query  908  IGKLKNLDTLFLQVNDLSGSLAPEI  982
            I + K L  + L  N+LSG +  EI
Sbjct  520  ISQCKLLTFVDLSRNELSGEIPNEI  544


 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 72/227 (32%), Positives = 114/227 (50%), Gaps = 2/227 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L  ++     L+ L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  366   KLTGTLPVNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFG  425

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMT-SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
             L  L  ++L +N LTG+LP+    ++ +L  + L  N+ SG +PP  G F  ++ L + G
Sbjct  426   LPKLSQVELQDNYLTGELPIGGGVVSVNLGQISLSNNHLSGPLPPAIGNFSGVQKLLLDG  485

Query  731   NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
             N   G IP EIG L +L +L   + N F G I PE+     L   D +   L+GE+P EI
Sbjct  486   NKFGGPIPPEIGRLQQLSKLDFSH-NLFPGRIAPEISQCKLLTFVDLSRNELSGEIPNEI  544

Query  911   GKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
               ++ L+ L L  N L GS+   +  +++L S+D S N  SG +P +
Sbjct  545   TGMRILNYLNLSRNHLLGSIPVTMASMQSLTSVDFSYNNLSGLVPST  591



>ref|XP_006290548.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
 gb|EOA23446.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
Length=997

 Score =   335 bits (859),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 178/282 (63%), Positives = 218/282 (77%), Gaps = 2/282 (1%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  391
             +TE  ALLS+K++ T D  S L SWN+ST+ C+W  VTCD     V+      L+LSG L
Sbjct  22    ITELQALLSLKSSLTGDEHSPLNSWNLSTTFCSWTGVTCDVSRRHVTSLDLSGLDLSGTL  81

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQ  568
             S DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNN+F  ++P +L+  L NL+
Sbjct  82    SSDVSHLPLLQNLSLAANQISGPIPPEISNLSELRHLNLSNNVFNGSYPDELSSGLVNLR  141

Query  569   VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  748
             VLDLYNNNLTG LP+ +  +T LRHLHLGGNYFSG+IP  YG +P LEYLAVSGN L G 
Sbjct  142   VLDLYNNNLTGVLPLSITNLTELRHLHLGGNYFSGKIPATYGTWPVLEYLAVSGNELIGK  201

Query  749   IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNL  928
             IP EIGNLT L+ELYIGY+N F  G+PPE+GNLS+L+RFDAANCGLTG +P EIGKL+NL
Sbjct  202   IPPEIGNLTSLRELYIGYYNAFEDGLPPEIGNLSELVRFDAANCGLTGAIPPEIGKLQNL  261

Query  929   DTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             DTLFLQVN  +G+L  E+G++ +LKS+D SNN F+GEIP SF
Sbjct  262   DTLFLQVNAFAGTLTQELGWISSLKSMDFSNNMFTGEIPASF  303


 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 114/204 (56%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTL-RFLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   LV L +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  342  NFTGGIPQKLGENGRLVILDLSSNKLTGTLPPNMCSGNRLVTLITLGNFLFGS-IPDSLG  400

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P   G   +L  +++S 
Sbjct  401  KCESLTRIRMGENFLNGSIPKGLFGLPKLSQVELQDNYLTGGLPISGGVSGDLGQISLSN  460

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +P+ IGN + +++L +   N F+G IPPE+G L QL + D ++   +G +  EI
Sbjct  461  NQLSGPLPAAIGNFSGVQKLLLDG-NKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEI  519

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  + L  N+LSG +  EI
Sbjct  520  SRCKLLTFVDLSRNELSGDIPNEI  543


 Score = 95.9 bits (237),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 76/249 (31%), Positives = 118/249 (47%), Gaps = 26/249 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              SG +    G  P L  L+++ N+L G +PPEI  +++LR L +   N F    P ++  
Sbjct  174   FSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTSLRELYIGYYNAFEDGLPPEIGN  233

Query  554   LANLQVLDLYNNNLTGDLPVEVYKM------------------------TSLRHLHLGGN  661
             L+ L   D  N  LTG +P E+ K+                        +SL+ +    N
Sbjct  234   LSELVRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFAGTLTQELGWISSLKSMDFSNN  293

Query  662   YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
              F+G IP  +    NL  L +  N L G IP  IG L +L+ L + + N F+GGIP ++G
Sbjct  294   MFTGEIPASFAELKNLTLLNLFRNKLYGAIPEFIGELPELEVLQL-WENNFTGGIPQKLG  352

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
                +L+  D ++  LTG LP  +     L TL    N L GS+   +G  ++L  + +  
Sbjct  353   ENGRLVILDLSSNKLTGTLPPNMCSGNRLVTLITLGNFLFGSIPDSLGKCESLTRIRMGE  412

Query  1022  nAFSGEIPE  1048
             N  +G IP+
Sbjct  413   NFLNGSIPK  421


 Score = 94.7 bits (234),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 65/198 (33%), Positives = 100/198 (51%), Gaps = 1/198 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L+G + P++G+L  L  L +  N  +G +  E+  IS+L+ ++ SNN+F    P   A+L
Sbjct  247  LTGAIPPEIGKLQNLDTLFLQVNAFAGTLTQELGWISSLKSMDFSNNMFTGEIPASFAEL  306

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L  L +S N 
Sbjct  307  KNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGGIPQKLGENGRLVILDLSSNK  366

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P  + +  +L  L I   N   G IP  +G    L R       L G +P  +  
Sbjct  367  LTGTLPPNMCSGNRLVTL-ITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFG  425

Query  917  LKNLDTLFLQVNDLSGSL  970
            L  L  + LQ N L+G L
Sbjct  426  LPKLSQVELQDNYLTGGL  443


 Score = 93.6 bits (231),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 75/226 (33%), Positives = 111/226 (49%), Gaps = 1/226 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     LV L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  366   KLTGTLPPNMCSGNRLVTLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFG  425

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N LTG LP+       L  + L  N  SG +P   G F  ++ L + GN
Sbjct  426   LPKLSQVELQDNYLTGGLPISGGVSGDLGQISLSNNQLSGPLPAAIGNFSGVQKLLLDGN  485

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               +G IP EIG L +L +L   + N FSG I PE+     L   D +   L+G++P EI 
Sbjct  486   KFAGPIPPEIGRLQQLSKLDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGDIPNEIT  544

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
              +K L+ L L  N L GS+   I  +++L S+D S N  SG +P +
Sbjct  545   GMKILNYLNLSRNHLVGSIPVTIASMQSLTSVDFSYNNLSGLVPST  590



>gb|KJB48795.1| hypothetical protein B456_008G087500 [Gossypium raimondii]
Length=1013

 Score =   334 bits (856),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 183/281 (65%), Positives = 226/281 (80%), Gaps = 1/281 (0%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVL  391
             V+E  ALL++K++ T D QS L++WN +T  C++  VTCD    HV SL+LS  NLSG L
Sbjct  24    VSEFQALLAVKSSITDDPQSYLSNWNATTPLCSFTGVTCDYTGRHVTSLNLSYFNLSGTL  83

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  571
             SP    L FL N S+AANQL GP+P E++A+S LR+LNLSNN+F  +FP QL+QL NLQV
Sbjct  84    SPSFSHLQFLQNFSLAANQLYGPIPTELAALSALRYLNLSNNVFNGSFPTQLSQLKNLQV  143

Query  572   LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  751
             LDLYNNN+TG+LP+ V  + +LRHLHLGGN+F+G+IP  YGR+ +LEYLAVSGN L G I
Sbjct  144   LDLYNNNMTGELPISVTDLPNLRHLHLGGNFFTGQIPASYGRWEHLEYLAVSGNELGGRI  203

Query  752   PSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLD  931
             P EIGNL KLKELYIGY+N F GG+PPE+GNLS+L+RFDAANC L+GE+P EIGKL+ LD
Sbjct  204   PPEIGNLKKLKELYIGYYNSFEGGLPPEIGNLSELVRFDAANCMLSGEIPPEIGKLQKLD  263

Query  932   TLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             TLFLQVN LSGSL PE+G L++LKS+DLSNN  +GEIPESF
Sbjct  264   TLFLQVNALSGSLTPELGTLESLKSMDLSNNMLAGEIPESF  304


 Score =   101 bits (252),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 79/248 (32%), Positives = 118/248 (48%), Gaps = 26/248 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A L
Sbjct  248   LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLESLKSMDLSNNMLAGEIPESFADL  307

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  + ++  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  308   KNLTLLNLFRNKLHGQIPEFIGELPELEVLQLWENNFTGNIPQTLGSNRKLQLLDLSSNK  367

Query  737   LSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+G+                        IP  +G    L  + +G  N  +G IP  +  
Sbjct  368   LTGILPPDMCSGNTLHTLITLGNFLFGSIPESLGKCESLSRIRMGE-NFLNGSIPKGLFG  426

Query  845   LSQLIRFDAANCGLTGELPVEIGKLK-NLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
             L +L + +  +  LTGE PV    +  NL  + L  N LSG L   +G    ++ L L  
Sbjct  427   LPKLTQVELQDNYLTGEFPVTDSSISLNLGQISLSNNRLSGPLPATVGNFSGVQKLLLDG  486

Query  1022  nAFSGEIP  1045
             N FSG IP
Sbjct  487   NKFSGPIP  494


 Score = 92.4 bits (228),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 65/199 (33%), Positives = 100/199 (50%), Gaps = 1/199 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            +  G L P++G L  LV    A   LSG +PPEI  +  L  L L  N    +   +L  
Sbjct  223  SFEGGLPPEIGNLSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGT  282

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L +L+ +DL NN L G++P     + +L  L+L  N   G+IP   G  P LE L +  N
Sbjct  283  LESLKSMDLSNNMLAGEIPESFADLKNLTLLNLFRNKLHGQIPEFIGELPELEVLQLWEN  342

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              +G IP  +G+  KL+ L +   N  +G +PP+M + + L         L G +P  +G
Sbjct  343  NFTGNIPQTLGSNRKLQLLDLSS-NKLTGILPPDMCSGNTLHTLITLGNFLFGSIPESLG  401

Query  914  KLKNLDTLFLQVNDLSGSL  970
            K ++L  + +  N L+GS+
Sbjct  402  KCESLSRIRMGENFLNGSI  420


 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 78/271 (29%), Positives = 114/271 (42%), Gaps = 48/271 (18%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG L+P++G L  L ++ ++ N L+G +P   + +  L  LNL  N      P  + +L
Sbjct  272   LSGSLTPELGTLESLKSMDLSNNMLAGEIPESFADLKNLTLLNLFRNKLHGQIPEFIGEL  331

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L+VL L+ NN TG++P  +     L+ L L  N  +G +PP+      L  L   GN 
Sbjct  332   PELEVLQLWENNFTGNIPQTLGSNRKLQLLDLSSNKLTGILPPDMCSGNTLHTLITLGNF  391

Query  737   LSGVIPSEIGNLTKLKELYIG--YFNG---------------------------------  811
             L G IP  +G    L  + +G  + NG                                 
Sbjct  392   LFGSIPESLGKCESLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGEFPVTDSSI  451

Query  812   -------------FSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVN  952
                           SG +P  +GN S + +        +G +P EIG L+ L  +    N
Sbjct  452   SLNLGQISLSNNRLSGPLPATVGNFSGVQKLLLDGNKFSGPIPAEIGNLQQLSKMDFSHN  511

Query  953   DLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
               SG +AP I   K L  +DLS N  SGEIP
Sbjct  512   KFSGPVAPGISKCKLLTFVDLSRNELSGEIP  542


 Score = 73.6 bits (179),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 94/204 (46%), Gaps = 3/204 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP   + +
Sbjct  392  LFGSIPESLGKCESLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGEFPVTDSSI  451

Query  557  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            + NL  + L NN L+G LP  V   + ++ L L GN FSG IP E G    L  +  S N
Sbjct  452  SLNLGQISLSNNRLSGPLPATVGNFSGVQKLLLDGNKFSGPIPAEIGNLQQLSKMDFSHN  511

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              SG +   I     L  + +   N  SG IP E+  +  L   + +   L G +P  I 
Sbjct  512  KFSGPVAPGISKCKLLTFVDLSR-NELSGEIPTEITGMRILNYLNLSRNHLIGSIPSSIS  570

Query  914  KLKNLDTLFLQVNDLSGSLAPEIG  985
             +++L ++    N+LSG L P  G
Sbjct  571  TMQSLTSVDFSYNNLSG-LVPSTG  593



>gb|EPS74129.1| hypothetical protein M569_00625, partial [Genlisea aurea]
Length=970

 Score =   333 bits (854),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 192/293 (66%), Positives = 233/293 (80%), Gaps = 1/293 (0%)
 Frame = +2

Query  179   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvs-  355
             H     A +P  ++E  AL+SIKAA + +++ +L SWN   SHC+WR VTCDSL   V+ 
Sbjct  15    HLQRCAAVRPPRMSEYHALVSIKAAISEEARPALASWNSGASHCSWRGVTCDSLGRHVTG  74

Query  356   ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  535
             LD+S L+LSG LSPDVGQL FLVNLS AAN LSGPVP EI+ I  LR+LNLSNN+F  +F
Sbjct  75    LDISNLSLSGSLSPDVGQLLFLVNLSAAANLLSGPVPAEIADIPNLRYLNLSNNVFNLSF  134

Query  536   PHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEY  715
             P +L +L NLQVLDLYNNN+TGD P   Y + +LRHLHLGGN+F+G +PPE+G FP+LEY
Sbjct  135   PTELYRLKNLQVLDLYNNNMTGDFPSRAYLLANLRHLHLGGNFFTGTMPPEFGSFPHLEY  194

Query  716   LAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGE  895
             LAVSGN LSG IP E+GNLT+LKELY+GY+N FSGG+P E+GNLS L+R DAA+CGL+G+
Sbjct  195   LAVSGNELSGTIPPELGNLTQLKELYVGYYNTFSGGLPKEIGNLSNLLRLDAASCGLSGD  254

Query  896   LPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             +P EIG L+NLDTLFLQVN  SG L PE+G LKNLKS+DLSNNA SGEIP SF
Sbjct  255   IPSEIGMLQNLDTLFLQVNGFSGGLTPELGNLKNLKSMDLSNNALSGEIPSSF  307


 Score =   116 bits (290),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 79/227 (35%), Positives = 120/227 (53%), Gaps = 2/227 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              +G + P+ G  P L  L+++ N+LSG +PPE+  ++ L+ L +   N F    P ++  
Sbjct  178   FTGTMPPEFGSFPHLEYLAVSGNELSGTIPPELGNLTQLKELYVGYYNTFSGGLPKEIGN  237

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L+NL  LD  +  L+GD+P E+  + +L  L L  N FSG + PE G   NL+ + +S N
Sbjct  238   LSNLLRLDAASCGLSGDIPSEIGMLQNLDTLFLQVNGFSGGLTPELGNLKNLKSMDLSNN  297

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              LSG IPS    L  L  L + + N  +G IP  +G L QL          TG +P  +G
Sbjct  298   ALSGEIPSSFAELKNLTLLNL-FRNKLNGSIPNFIGELPQLQVLQLWENNFTGSIPENLG  356

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
                NL  + L  N L+GSL+P++ +   L +L    N  +G IP+S 
Sbjct  357   SNGNLQEVDLSSNKLTGSLSPKLCHGNQLHTLITLGNFLTGPIPDSM  403


 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 76/225 (34%), Positives = 112/225 (50%), Gaps = 1/225 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G LSP +     L  L    N L+GP+P  +    +L  + +  N      P  L  L
Sbjct  371   LTGSLSPKLCHGNQLHTLITLGNFLTGPIPDSMGHCESLSRVRMGENYLNGHIPKGLLSL  430

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L  L+L +N ++G  P       +L  + L  N+ SG +PP  G F  ++   + GN 
Sbjct  431   PMLTQLELQDNLISGPFPETDVLSQNLGQISLSNNHLSGPLPPSIGNFVAVQKFLLDGNS  490

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
              SG IP+EIG L +L ++     N FSG IPPE+    QL   D +   L G +P EI  
Sbjct  491   FSGSIPAEIGKLQQLSKMDFSS-NKFSGQIPPELSQCKQLAFVDLSRNQLNGRVPSEISA  549

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
             +K L+ L L  N L G++   I  +++L S+D S N F+G +P S
Sbjct  550   MKILNYLNLSRNQLDGNIPSSISSMQSLTSVDFSYNNFTGLVPGS  594


 Score = 99.0 bits (245),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 71/223 (32%), Positives = 112/223 (50%), Gaps = 1/223 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
              SG L+P++G L  L ++ ++ N LSG +P   + +  L  LNL  N    + P+ + +L
Sbjct  275   FSGGLTPELGNLKNLKSMDLSNNALSGEIPSSFAELKNLTLLNLFRNKLNGSIPNFIGEL  334

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               LQVL L+ NN TG +P  +    +L+ + L  N  +G + P+      L  L   GN 
Sbjct  335   PQLQVLQLWENNFTGSIPENLGSNGNLQEVDLSSNKLTGSLSPKLCHGNQLHTLITLGNF  394

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L+G IP  +G+   L  + +G  N  +G IP  + +L  L + +  +  ++G  P     
Sbjct  395   LTGPIPDSMGHCESLSRVRMGE-NYLNGHIPKGLLSLPMLTQLELQDNLISGPFPETDVL  453

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              +NL  + L  N LSG L P IG    ++   L  N+FSG IP
Sbjct  454   SQNLGQISLSNNHLSGPLPPSIGNFVAVQKFLLDGNSFSGSIP  496


 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 84/274 (31%), Positives = 122/274 (45%), Gaps = 49/274 (18%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG +     +L  L  L++  N+L+G +P  I  +  L+ L L  N F  + P  L   
Sbjct  299   LSGEIPSSFAELKNLTLLNLFRNKLNGSIPNFIGELPQLQVLQLWENNFTGSIPENLGSN  358

Query  557   ANLQVLDLYNNNLTGDL------------------------PVEVYKMTSLRHLHLGGNY  664
              NLQ +DL +N LTG L                        P  +    SL  + +G NY
Sbjct  359   GNLQEVDLSSNKLTGSLSPKLCHGNQLHTLITLGNFLTGPIPDSMGHCESLSRVRMGENY  418

Query  665   FSGRIPPEY-----------------GRFP-------NLEYLAVSGNGLSGVIPSEIGNL  772
              +G IP                    G FP       NL  +++S N LSG +P  IGN 
Sbjct  419   LNGHIPKGLLSLPMLTQLELQDNLISGPFPETDVLSQNLGQISLSNNHLSGPLPPSIGNF  478

Query  773   TKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVN  952
               +++  +   N FSG IP E+G L QL + D ++   +G++P E+ + K L  + L  N
Sbjct  479   VAVQKFLLDG-NSFSGSIPAEIGKLQQLSKMDFSSNKFSGQIPPELSQCKQLAFVDLSRN  537

Query  953   DLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
              L+G +  EI  +K L  L+LS N   G IP S 
Sbjct  538   QLNGRVPSEISAMKILNYLNLSRNQLDGNIPSSI  571



>gb|KHG03710.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
 gb|KHG03906.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1013

 Score =   332 bits (851),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 187/293 (64%), Positives = 228/293 (78%), Gaps = 6/293 (2%)
 Frame = +2

Query  179   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvs  355
             H +GA       V E  ALL++K++ T D QS L++WN +   C++  VTCD    HV S
Sbjct  17    HCSGART-----VLEFQALLAVKSSITGDPQSYLSNWNATIPLCSFTGVTCDYTGRHVTS  71

Query  356   ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  535
             LDLS  NLSG LSP    L FL N S+AANQL GP+P E++A+S LR+LNLSNN+F  +F
Sbjct  72    LDLSYFNLSGTLSPSFSHLRFLQNFSLAANQLYGPIPTELAALSALRYLNLSNNVFNGSF  131

Query  536   PHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEY  715
             P QL+QL NLQVLDLYNNN+TGDLP+ V  + +LRHLHLGGN+F+G+IP  YGR+ +LEY
Sbjct  132   PTQLSQLKNLQVLDLYNNNMTGDLPISVTDLPNLRHLHLGGNFFTGQIPASYGRWEHLEY  191

Query  716   LAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGE  895
             LAVSGN L G IP EIGNL KL+ELYIGY+N F GG+PPE+GNLS+L+RFDAANC L+GE
Sbjct  192   LAVSGNELGGRIPPEIGNLEKLQELYIGYYNSFEGGLPPEIGNLSELVRFDAANCMLSGE  251

Query  896   LPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             +P EIGKL+ LDTLFLQVN LSGSL PE+G LK+LKS+DLSNN  +GEIPESF
Sbjct  252   IPPEIGKLQKLDTLFLQVNALSGSLTPELGTLKSLKSMDLSNNMLAGEIPESF  304


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 100/198 (51%), Gaps = 1/198 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A L
Sbjct  248  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLKSLKSMDLSNNMLAGEIPESFADL  307

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  308  KNLTLLNLFRNKLHGQIPGFIGELPELEVLQLWENNFTGSIPQTLGSNRKLQLLDLSSNK  367

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P ++ +   L  L I   N   G IP  +G    L R       L G +P  + +
Sbjct  368  LTGTLPPDMCSGNTLHTL-ITLGNFLFGSIPESLGKCESLSRIRMGENFLNGSIPKGLFR  426

Query  917  LKNLDTLFLQVNDLSGSL  970
            L  L  + LQ N L+G  
Sbjct  427  LPKLTQVELQDNYLTGEF  444


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 65/199 (33%), Positives = 100/199 (50%), Gaps = 1/199 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            +  G L P++G L  LV    A   LSG +PPEI  +  L  L L  N    +   +L  
Sbjct  223  SFEGGLPPEIGNLSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGT  282

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L +L+ +DL NN L G++P     + +L  L+L  N   G+IP   G  P LE L +  N
Sbjct  283  LKSLKSMDLSNNMLAGEIPESFADLKNLTLLNLFRNKLHGQIPGFIGELPELEVLQLWEN  342

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              +G IP  +G+  KL+ L +   N  +G +PP+M + + L         L G +P  +G
Sbjct  343  NFTGSIPQTLGSNRKLQLLDLSS-NKLTGTLPPDMCSGNTLHTLITLGNFLFGSIPESLG  401

Query  914  KLKNLDTLFLQVNDLSGSL  970
            K ++L  + +  N L+GS+
Sbjct  402  KCESLSRIRMGENFLNGSI  420


 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 78/271 (29%), Positives = 113/271 (42%), Gaps = 48/271 (18%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG L+P++G L  L ++ ++ N L+G +P   + +  L  LNL  N      P  + +L
Sbjct  272   LSGSLTPELGTLKSLKSMDLSNNMLAGEIPESFADLKNLTLLNLFRNKLHGQIPGFIGEL  331

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L+VL L+ NN TG +P  +     L+ L L  N  +G +PP+      L  L   GN 
Sbjct  332   PELEVLQLWENNFTGSIPQTLGSNRKLQLLDLSSNKLTGTLPPDMCSGNTLHTLITLGNF  391

Query  737   LSGVIPSEIGNLTKLKELYIG--YFNG---------------------------------  811
             L G IP  +G    L  + +G  + NG                                 
Sbjct  392   LFGSIPESLGKCESLSRIRMGENFLNGSIPKGLFRLPKLTQVELQDNYLTGEFPVTDSSI  451

Query  812   -------------FSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVN  952
                           SG +P  +GN S + +        +G +P EIG L+ L  +    N
Sbjct  452   SLNLGQISLSNNRLSGPLPATVGNFSGVQKLLLDGNKFSGPIPAEIGNLQQLSKMDFSHN  511

Query  953   DLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
               SG +AP I   K L  +DLS N  SGEIP
Sbjct  512   KFSGPVAPGISKCKLLTFVDLSRNELSGEIP  542


 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 94/204 (46%), Gaps = 3/204 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP   + +
Sbjct  392  LFGSIPESLGKCESLSRIRMGENFLNGSIPKGLFRLPKLTQVELQDNYLTGEFPVTDSSI  451

Query  557  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            + NL  + L NN L+G LP  V   + ++ L L GN FSG IP E G    L  +  S N
Sbjct  452  SLNLGQISLSNNRLSGPLPATVGNFSGVQKLLLDGNKFSGPIPAEIGNLQQLSKMDFSHN  511

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              SG +   I     L  + +   N  SG IP E+  +  L   + +   L G +P  I 
Sbjct  512  KFSGPVAPGISKCKLLTFVDLSR-NELSGEIPTEITGMRILNYLNLSRNHLIGSIPSSIS  570

Query  914  KLKNLDTLFLQVNDLSGSLAPEIG  985
             +++L ++    N+LSG L P  G
Sbjct  571  TMQSLTSVDFSYNNLSG-LVPSTG  593



>gb|KJB18113.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
 gb|KJB18114.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
Length=1026

 Score =   332 bits (851),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 181/281 (64%), Positives = 226/281 (80%), Gaps = 1/281 (0%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVL  391
             VTE +AL+++K++ T D QS L++WN +T  C++  V CD    HV S+DL+   LSG L
Sbjct  27    VTELSALIAVKSSITDDPQSYLSNWNANTPLCSFAGVACDLTGRHVTSIDLTNFTLSGTL  86

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  571
             SP +  L FL NLS+AAN LSGP+P E++ +S LR+LNLSNN+F  +FP QL+QL NLQ+
Sbjct  87    SPSLAHLRFLQNLSVAANDLSGPIPTELAVLSNLRYLNLSNNVFNGSFPTQLSQLKNLQI  146

Query  572   LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  751
             LDLYNNN+TG+LPV V ++ +LRHLHLGGNYFSG+IP  YGR+ +LEYLAVSGN LSG I
Sbjct  147   LDLYNNNMTGELPVSVTELPNLRHLHLGGNYFSGQIPSSYGRWEHLEYLAVSGNELSGKI  206

Query  752   PSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLD  931
             P EIGNLTKLK+LYIGYFN F GG+PPE+GNLS+L+ FDAANC L+GE+P E+GKL+ L 
Sbjct  207   PPEIGNLTKLKQLYIGYFNSFEGGLPPEIGNLSELVLFDAANCMLSGEIPPEVGKLQRLH  266

Query  932   TLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             TLFLQVN LSGSL PE+G L +LKS+DLSNN F+GEIP SF
Sbjct  267   TLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASF  307


 Score =   108 bits (270),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 122/248 (49%), Gaps = 26/248 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG + P+VG+L  L  L +  N LSG + PE+  +++L+ ++LSNN+F    P   AQL
Sbjct  251   LSGEIPPEVGKLQRLHTLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASFAQL  310

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L+ L +S N 
Sbjct  311   KNLTLLNLFRNKLHGQIPDFIGELPELEVLQLWENNFTGSIPQKLGSNKKLQVLDLSSNK  370

Query  737   LSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+G                         IP  +G    L  + +G  N  +G IP  +  
Sbjct  371   LTGTLPPDMCSGNTLQTLITLGNFLLGPIPESLGKCESLSRIRMGE-NYLNGSIPKGLLG  429

Query  845   LSQLIRFDAANCGLTGELPVEIGKLK-NLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
             L QL + +  +  LTGE PV    +  NL  + L  N LSG+L   +G    ++ L L  
Sbjct  430   LPQLTQVELQDNYLTGEFPVTDSSISVNLGQISLSNNQLSGALPASVGNFSGVQKLLLDG  489

Query  1022  nAFSGEIP  1045
             N FSG IP
Sbjct  490   NKFSGPIP  497


 Score = 95.1 bits (235),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 102/199 (51%), Gaps = 1/199 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            +  G L P++G L  LV    A   LSG +PPE+  +  L  L L  N    +   +L  
Sbjct  226  SFEGGLPPEIGNLSELVLFDAANCMLSGEIPPEVGKLQRLHTLFLQVNALSGSLTPELGT  285

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L +L+ +DL NN  TG++P    ++ +L  L+L  N   G+IP   G  P LE L +  N
Sbjct  286  LNSLKSMDLSNNMFTGEIPASFAQLKNLTLLNLFRNKLHGQIPDFIGELPELEVLQLWEN  345

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              +G IP ++G+  KL+ L +   N  +G +PP+M + + L         L G +P  +G
Sbjct  346  NFTGSIPQKLGSNKKLQVLDLSS-NKLTGTLPPDMCSGNTLQTLITLGNFLLGPIPESLG  404

Query  914  KLKNLDTLFLQVNDLSGSL  970
            K ++L  + +  N L+GS+
Sbjct  405  KCESLSRIRMGENYLNGSI  423


 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 96/197 (49%), Gaps = 2/197 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP   + +
Sbjct  395  LLGPIPESLGKCESLSRIRMGENYLNGSIPKGLLGLPQLTQVELQDNYLTGEFPVTDSSI  454

Query  557  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            + NL  + L NN L+G LP  V   + ++ L L GN FSG IP E G+   L  +  S N
Sbjct  455  SVNLGQISLSNNQLSGALPASVGNFSGVQKLLLDGNKFSGPIPAEIGKLQQLSKIDFSHN  514

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              SG+IP EI     L  + +   N  SG IP E+ ++  L   + +   L G +P  I 
Sbjct  515  KFSGLIPPEICKCKLLTFVDLSR-NELSGQIPTEITSMRILNYLNLSRNHLLGSIPSSIS  573

Query  914  KLKNLDTLFLQVNDLSG  964
             +++L ++    N+LSG
Sbjct  574  TMQSLTSVDFSYNNLSG  590


 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG L   VG    +  L +  N+ SGP+P EI  +  L  ++ S+N F    P ++ + 
Sbjct  468  LSGALPASVGNFSGVQKLLLDGNKFSGPIPAEIGKLQQLSKIDFSHNKFSGLIPPEICKC  527

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              L  +DL  N L+G +P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  528  KLLTFVDLSRNELSGQIPTEITSMRILNYLNLSRNHLLGSIPSSISTMQSLTSVDFSYNN  587

Query  737  LSGVIP  754
            LSG++P
Sbjct  588  LSGLVP  593


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 68/137 (50%), Gaps = 1/137 (1%)
 Frame = +2

Query  419  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  598
            L  +S++ NQLSG +P  +   S ++ L L  N F    P ++ +L  L  +D  +N  +
Sbjct  458  LGQISLSNNQLSGALPASVGNFSGVQKLLLDGNKFSGPIPAEIGKLQQLSKIDFSHNKFS  517

Query  599  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  778
            G +P E+ K   L  + L  N  SG+IP E      L YL +S N L G IPS I  +  
Sbjct  518  GLIPPEICKCKLLTFVDLSRNELSGQIPTEITSMRILNYLNLSRNHLLGSIPSSISTMQS  577

Query  779  LKELYIGYFNGFSGGIP  829
            L  +   Y N  SG +P
Sbjct  578  LTSVDFSY-NNLSGLVP  593



>ref|XP_007047661.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOX91818.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=1018

 Score =   332 bits (850),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 183/289 (63%), Positives = 232/289 (80%), Gaps = 3/289 (1%)
 Frame = +2

Query  191   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsldls  367
             + A +P  V+E  ALL++K++FT D +S L++WN +T  C++  V CD    HV S+DLS
Sbjct  17    SSAARP--VSEFRALLAVKSSFTDDPESYLSNWNATTRFCSFTGVACDYTGRHVTSIDLS  74

Query  368   glNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  547
               NLSG LSP    L FL +LS+AANQ+SGP+P E++A+S+LR+ NLSNN+F  +FP QL
Sbjct  75    NFNLSGTLSPSFSHLRFLQSLSLAANQISGPIPTELAALSSLRYFNLSNNVFNGSFPSQL  134

Query  548   AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  727
             +QL NLQVLDLYNNN+TG+LP+ V ++ +L HLHLGGN+FSG+IP  YGR+  LEYLAVS
Sbjct  135   SQLKNLQVLDLYNNNMTGELPISVTELPNLLHLHLGGNFFSGQIPSSYGRWEFLEYLAVS  194

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
             GN L G IP EIGNLTKL++LYIGY+N F GG+PPE+GNLS+L+RFDAANC L+GE+P E
Sbjct  195   GNELDGKIPPEIGNLTKLQQLYIGYYNSFEGGLPPEIGNLSELVRFDAANCMLSGEIPPE  254

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             IGKL+ LDTLFLQVN LSGSL PE+G LK+LKS+DLSNN  +GEIPESF
Sbjct  255   IGKLQKLDTLFLQVNALSGSLTPELGTLKSLKSMDLSNNMLAGEIPESF  303


 Score = 99.4 bits (246),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 87/271 (32%), Positives = 122/271 (45%), Gaps = 48/271 (18%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVP-----------------------PE-ISAI  484
             LSG L+P++G L  L ++ ++ N L+G +P                       PE I  +
Sbjct  271   LSGSLTPELGTLKSLKSMDLSNNMLAGEIPESFANLKNLTLLNLFRNKLHGQIPEFIGEL  330

Query  485   STLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  664
               L  L L  N F  + P QL     LQ+LDL +N LTG LP+++    +L  L   GN+
Sbjct  331   PELEVLQLWENNFTGSIPQQLGSNKKLQLLDLSSNKLTGTLPLDMCSGNTLHTLITLGNF  390

Query  665   FSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLK--ELYIGYFNG---------  811
               G IP   G+  +L  + +  N L+G IP  +  L KL   EL   Y  G         
Sbjct  391   LFGPIPESLGKCESLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGEFPVTESSI  450

Query  812   -------------FSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVN  952
                           SG +P  +GN S + +        +G +P EIGKL+ L  +    N
Sbjct  451   SANLGQISLSNNKLSGTLPASVGNFSGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSHN  510

Query  953   DLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
               SG++APEI   K L  +DLS N  SGEIP
Sbjct  511   KFSGTIAPEISKCKLLTFVDLSRNELSGEIP  541


 Score = 98.6 bits (244),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 75/225 (33%), Positives = 113/225 (50%), Gaps = 2/225 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L  D+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  366   KLTGTLPLDMCSGNTLHTLITLGNFLFGPIPESLGKCESLSRIRMGENFLNGSIPKGLFG  425

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTS-LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
             L  L  ++L +N LTG+ PV    +++ L  + L  N  SG +P   G F  ++ L + G
Sbjct  426   LPKLTQVELQDNYLTGEFPVTESSISANLGQISLSNNKLSGTLPASVGNFSGVQKLLLDG  485

Query  731   NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
             N  SG IP+EIG L +L ++   + N FSG I PE+     L   D +   L+GE+P EI
Sbjct  486   NKFSGRIPAEIGKLQQLSKMDFSH-NKFSGTIAPEISKCKLLTFVDLSRNELSGEIPTEI  544

Query  911   GKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
               ++ L+ L L  N L GS+   I  +++L S+D S N  SG +P
Sbjct  545   TGMRILNYLNLSRNHLIGSIPSSIATMQSLTSVDFSYNNLSGLVP  589


 Score = 96.7 bits (239),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 71/228 (31%), Positives = 111/228 (49%), Gaps = 26/228 (11%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             L G +   +G+LP L  L +  N  +G +P ++ +   L+ L+LS+N    T P  +  
Sbjct  318  KLHGQIPEFIGELPELEVLQLWENNFTGSIPQQLGSNKKLQLLDLSSNKLTGTLPLDMCS  377

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP------PEY--------  691
               L  L    N L G +P  + K  SL  + +G N+ +G IP      P+         
Sbjct  378  GNTLHTLITLGNFLFGPIPESLGKCESLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDN  437

Query  692  ---GRFP--------NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  838
               G FP        NL  +++S N LSG +P+ +GN + +++L +   N FSG IP E+
Sbjct  438  YLTGEFPVTESSISANLGQISLSNNKLSGTLPASVGNFSGVQKLLLDG-NKFSGRIPAEI  496

Query  839  GNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEI  982
            G L QL + D ++   +G +  EI K K L  + L  N+LSG +  EI
Sbjct  497  GKLQQLSKMDFSHNKFSGTIAPEISKCKLLTFVDLSRNELSGEIPTEI  544


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 78/273 (29%), Positives = 113/273 (41%), Gaps = 50/273 (18%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI------------------------SA  481
             +  G L P++G L  LV    A   LSG +PPEI                          
Sbjct  222   SFEGGLPPEIGNLSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGT  281

Query  482   ISTLRFLNLSNNIFGSTFPHQLA------------------------QLANLQVLDLYNN  589
             + +L+ ++LSNN+     P   A                        +L  L+VL L+ N
Sbjct  282   LKSLKSMDLSNNMLAGEIPESFANLKNLTLLNLFRNKLHGQIPEFIGELPELEVLQLWEN  341

Query  590   NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  769
             N TG +P ++     L+ L L  N  +G +P +      L  L   GN L G IP  +G 
Sbjct  342   NFTGSIPQQLGSNKKLQLLDLSSNKLTGTLPLDMCSGNTLHTLITLGNFLFGPIPESLGK  401

Query  770   LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLK-NLDTLFLQ  946
                L  + +G  N  +G IP  +  L +L + +  +  LTGE PV    +  NL  + L 
Sbjct  402   CESLSRIRMGE-NFLNGSIPKGLFGLPKLTQVELQDNYLTGEFPVTESSISANLGQISLS  460

Query  947   VNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              N LSG+L   +G    ++ L L  N FSG IP
Sbjct  461   NNKLSGTLPASVGNFSGVQKLLLDGNKFSGRIP  493



>ref|XP_011021820.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Populus euphratica]
Length=1020

 Score =   332 bits (850),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 179/281 (64%), Positives = 221/281 (79%), Gaps = 1/281 (0%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  391
             V+E  ALLSIK++ T D QS L++WN +   C+W  +TCD     V+      LNLSG L
Sbjct  28    VSEYEALLSIKSSITDDPQSFLSAWNSTAPLCSWTGITCDHTGRRVTSLDLSGLNLSGTL  87

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  571
             S D+  L +L NLS+A NQ SGP+P  +SA+++LR LNLSNNIF STFP QL+ L NLQV
Sbjct  88    SSDIAHLRYLQNLSLAVNQFSGPIPASLSAVTSLRSLNLSNNIFNSTFPPQLSSLKNLQV  147

Query  572   LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  751
             LDLYNNN+TG LP+ V +M +LRHLHLGGNY+SG+IP EYG++  LEYLA+SGN L G I
Sbjct  148   LDLYNNNMTGGLPLTVVEMPNLRHLHLGGNYYSGKIPSEYGKWEFLEYLAISGNELEGSI  207

Query  752   PSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLD  931
             P E+GNLTKL+ELYIGYFN + GG+PPE+GNLS L+RFDAANCGL+G++P EIG+L+ LD
Sbjct  208   PVELGNLTKLRELYIGYFNTYEGGLPPEIGNLSNLVRFDAANCGLSGQIPPEIGRLQKLD  267

Query  932   TLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             TLFLQVN LSGSL  E+G LK+LKS+DLSNN F+GEIP SF
Sbjct  268   TLFLQVNGLSGSLTLELGSLKSLKSMDLSNNMFTGEIPTSF  308


 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 113/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L  L   +N L GP+P  +    +L  + +  N    + P  L  
Sbjct  371   KLTGTLPPNMCLGNNLQTLITLSNFLFGPIPESLGQCQSLSRIRMGENFLNGSIPKGLFD  430

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL  ++L +N L G+ PV      +L  L L  N  +G +PP  G F  ++ L + GN
Sbjct  431   LPNLSQVELQDNLLAGEFPVIGTLAVNLGQLSLSNNRLTGSLPPSVGNFSGVQKLLLDGN  490

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP EIG L +L ++   + N FSG I PE+     L   D +   L+GE+P EI 
Sbjct  491   KFSGSIPPEIGRLQQLTKMDFSH-NKFSGPIAPEISQCKLLTFVDLSRNELSGEIPTEIT  549

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L S+D S N  SG +P
Sbjct  550   GMRILNYLNLSRNHLVGSIPSPIATMQSLTSVDFSYNNLSGLVP  593


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 123/248 (50%), Gaps = 27/248 (11%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG + P++G+L  L  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   A+L
Sbjct  252   LSGQIPPEIGRLQKLDTLFLQVNGLSGSLTLELGSLKSLKSMDLSNNMFTGEIPTSFAEL  311

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  + ++  L+ L L  N F+  IP   G+   L+ L +S N 
Sbjct  312   KNLTLLNLFRNKLYGAIPEFIAELPELQVLQLWENNFTSTIPQALGQNGKLQILDLSSNK  371

Query  737   LSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+G                         IP  +G    L  + +G  N  +G IP  + +
Sbjct  372   LTGTLPPNMCLGNNLQTLITLSNFLFGPIPESLGQCQSLSRIRMGE-NFLNGSIPKGLFD  430

Query  845   LSQLIRFDAANCGLTGELPVEIGKLK-NLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
             L  L + +  +  L GE PV IG L  NL  L L  N L+GSL P +G    ++ L L  
Sbjct  431   LPNLSQVELQDNLLAGEFPV-IGTLAVNLGQLSLSNNRLTGSLPPSVGNFSGVQKLLLDG  489

Query  1022  nAFSGEIP  1045
             N FSG IP
Sbjct  490   NKFSGSIP  497


 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 71/225 (32%), Positives = 108/225 (48%), Gaps = 2/225 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             L G +  ++G L  L  L I   N   G +PPEI  +S L   + +N       P ++ +
Sbjct  203   LEGSIPVELGNLTKLRELYIGYFNTYEGGLPPEIGNLSNLVRFDAANCGLSGQIPPEIGR  262

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  L L  N L+G L +E+  + SL+ + L  N F+G IP  +    NL  L +  N
Sbjct  263   LQKLDTLFLQVNGLSGSLTLELGSLKSLKSMDLSNNMFTGEIPTSFAELKNLTLLNLFRN  322

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  I  L +L+ L + + N F+  IP  +G   +L   D ++  LTG LP  + 
Sbjct  323   KLYGAIPEFIAELPELQVLQL-WENNFTSTIPQALGQNGKLQILDLSSNKLTGTLPPNMC  381

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPE  1048
                NL TL    N L G +   +G  ++L  + +  N  +G IP+
Sbjct  382   LGNNLQTLITLSNFLFGPIPESLGQCQSLSRIRMGENFLNGSIPK  426



>ref|XP_010515326.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score =   330 bits (846),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 181/284 (64%), Positives = 220/284 (77%), Gaps = 4/284 (1%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSL-TSWNISTS-HCTWRRVTCdsllhvvsldlsg-lNLSG  385
             +TE  ALLS+K++ T D  S L +SWN+ST+  C+W  VTCD     V+      LNLSG
Sbjct  23    ITEFNALLSLKSSLTGDDHSPLLSSWNLSTTTFCSWTGVTCDVSRRHVTSLDLSGLNLSG  82

Query  386   VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LAN  562
              LS DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNN+F  ++P +L+  L N
Sbjct  83    TLSSDVSHLPLLQNLSLAANQISGPIPPEISNLSELRLLNLSNNVFNGSYPDELSSGLVN  142

Query  563   LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  742
             L+VLDLYNNNLTGDLP+ +  +T LRHLHLGGNYFSG+IP  YG +P LEYLAVSGN L+
Sbjct  143   LRVLDLYNNNLTGDLPLSITNLTELRHLHLGGNYFSGKIPATYGTWPVLEYLAVSGNELT  202

Query  743   GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLK  922
             G IP EIGNLT L+ELYIGY+N F  G+PPE+GNL++L+RFDAANCGLTG +P EIGKL+
Sbjct  203   GKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGNLTELLRFDAANCGLTGAIPPEIGKLQ  262

Query  923   NLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             NLDTLFLQVN  SG L  E+G + +LKS+DLSNN F+GEIP SF
Sbjct  263   NLDTLFLQVNAFSGPLTSELGLISSLKSMDLSNNMFTGEIPTSF  306


 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 121/247 (49%), Gaps = 25/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G + P++G+L  L  L +  N  SGP+  E+  IS+L+ ++LSNN+F    P   ++L
Sbjct  250   LTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLKSMDLSNNMFTGEIPTSFSEL  309

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L  L +S N 
Sbjct  310   KNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGGIPQKLGDNGRLVILDLSSNK  369

Query  737   LSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+G                         IP  +G    L  + +G  N  +G IP  +  
Sbjct  370   LTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGQ-NFLNGSIPKGLFG  428

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L +L + +  +  LTGELP+  G   +L  + L  N LSGSL   IG    ++ L L  N
Sbjct  429   LPKLSQVELQDNYLTGELPISGGVSSDLGQVSLSNNKLSGSLPAAIGNFSGVQKLLLDGN  488

Query  1025  AFSGEIP  1045
              F+G IP
Sbjct  489   KFTGPIP  495


 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 78/249 (31%), Positives = 120/249 (48%), Gaps = 26/249 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              SG +    G  P L  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  177   FSGKIPATYGTWPVLEYLAVSGNELTGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  236

Query  554   LANLQVLDLYNNNLTGDLPVEVYKM------------------------TSLRHLHLGGN  661
             L  L   D  N  LTG +P E+ K+                        +SL+ + L  N
Sbjct  237   LTELLRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLKSMDLSNN  296

Query  662   YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
              F+G IP  +    NL  L +  N L G IP  IG L +L+ L + + N F+GGIP ++G
Sbjct  297   MFTGEIPTSFSELKNLTLLNLFRNKLYGAIPEFIGELPELEVLQL-WENNFTGGIPQKLG  355

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
             +  +L+  D ++  LTG LP  +     L TL    N L GS+   +G  ++L  + +  
Sbjct  356   DNGRLVILDLSSNKLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGQ  415

Query  1022  nAFSGEIPE  1048
             N  +G IP+
Sbjct  416   NFLNGSIPK  424


 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 112/204 (55%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI-SAISTLRFLNLSNNIFGSTFPHQLA  550
            N +G +   +G    LV L +++N+L+G +PP + S    +  + L N +FGS  P  L 
Sbjct  345  NFTGGIPQKLGDNGRLVILDLSSNKLTGTLPPNMCSGNRLMTLITLGNFLFGS-IPDSLG  403

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P   G   +L  +++S 
Sbjct  404  KCESLTRIRMGQNFLNGSIPKGLFGLPKLSQVELQDNYLTGELPISGGVSSDLGQVSLSN  463

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +P+ IGN + +++L +   N F+G IPP++G L QL + D ++   +G +  EI
Sbjct  464  NKLSGSLPAAIGNFSGVQKLLLDG-NKFTGPIPPDIGRLQQLSKLDFSHNLFSGRIAPEI  522

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  + L  N+LSG +  EI
Sbjct  523  SRCKLLTFVDLSRNELSGDIPNEI  546


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 72/225 (32%), Positives = 113/225 (50%), Gaps = 1/225 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G L P++     L+ L    N L G +P  +    +L  + +  N    + P  L  L
Sbjct  370   LTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIPKGLFGL  429

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L  ++L +N LTG+LP+     + L  + L  N  SG +P   G F  ++ L + GN 
Sbjct  430   PKLSQVELQDNYLTGELPISGGVSSDLGQVSLSNNKLSGSLPAAIGNFSGVQKLLLDGNK  489

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
              +G IP +IG L +L +L   + N FSG I PE+     L   D +   L+G++P EI  
Sbjct  490   FTGPIPPDIGRLQQLSKLDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITG  548

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
             ++ L+ L L  N L GS+   I  +++L S+D S N  SG +P +
Sbjct  549   MRILNYLNLSRNHLVGSIPVSIASMQSLTSVDFSYNNLSGLVPST  593



>ref|NP_001237715.1| receptor-like protein kinase 2 precursor [Glycine max]
 gb|AAF91323.1|AF244889_1 receptor-like protein kinase 2 [Glycine max]
Length=1012

 Score =   330 bits (846),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 178/280 (64%), Positives = 225/280 (80%), Gaps = 0/280 (0%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  394
             ++E  ALLS+++  T  +   L+SWN S  +C+W  VTCD+  HV +L+L+GL+LSG LS
Sbjct  25    ISEYRALLSLRSVITDATPPVLSSWNASIPYCSWLGVTCDNRRHVTALNLTGLDLSGTLS  84

Query  395   PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  574
              DV  LPFL NLS+AAN+ SGP+PP +SA+S LR+LNLSNN+F  TFP +L +L +L+VL
Sbjct  85    ADVAHLPFLSNLSLAANKFSGPIPPSLSALSGLRYLNLSNNVFNETFPSELWRLQSLEVL  144

Query  575   DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  754
             DLYNNN+TG LP+ V +M +LRHLHLGGN+FSG+IPPEYGR+  L+YLAVSGN L G IP
Sbjct  145   DLYNNNMTGVLPLAVAQMQNLRHLHLGGNFFSGQIPPEYGRWQRLQYLAVSGNELDGTIP  204

Query  755   SEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDT  934
              EIGNLT L+ELYIGY+N ++GGIPPE+GNLS+L+R D A C L+GE+P  +GKL+ LDT
Sbjct  205   PEIGNLTSLRELYIGYYNTYTGGIPPEIGNLSELVRLDVAYCALSGEIPAALGKLQKLDT  264

Query  935   LFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             LFLQVN LSGSL PE+G LK+LKS+DLSNN  SGEIP SF
Sbjct  265   LFLQVNALSGSLTPELGNLKSLKSMDLSNNMLSGEIPASF  304


 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 116/224 (52%), Gaps = 3/224 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG L+P++G L  L ++ ++ N LSG +P     +  +  LNL  N      P  + +L
Sbjct  272   LSGSLTPELGNLKSLKSMDLSNNMLSGEIPASFGELKNITLLNLFRNKLHGAIPEFIGEL  331

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L+V+ L+ NNLTG +P  + K   L  + L  N  +G +PP       L+ L   GN 
Sbjct  332   PALEVVQLWENNLTGSIPEGLGKNGRLNLVDLSSNKLTGTLPPYLCSGNTLQTLITLGNF  391

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L G IP  +G    L  + +G  N  +G IP  +  L +L + +  +  L+GE P E+G 
Sbjct  392   LFGPIPESLGTCESLTRIRMGE-NFLNGSIPKGLFGLPKLTQVELQDNYLSGEFP-EVGS  449

Query  917   LK-NLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             +  NL  + L  N LSG+L+P IG   +++ L L  N F+G IP
Sbjct  450   VAVNLGQITLSNNQLSGALSPSIGNFSSVQKLLLDGNMFTGRIP  493


 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 74/227 (33%), Positives = 115/227 (51%), Gaps = 2/227 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              SG + P+ G+   L  L+++ N+L G +PPEI  +++LR L +   N +    P ++  
Sbjct  175   FSGQIPPEYGRWQRLQYLAVSGNELDGTIPPEIGNLTSLRELYIGYYNTYTGGIPPEIGN  234

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L+ L  LD+    L+G++P  + K+  L  L L  N  SG + PE G   +L+ + +S N
Sbjct  235   LSELVRLDVAYCALSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNLKSLKSMDLSNN  294

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              LSG IP+  G L  +  L + + N   G IP  +G L  L         LTG +P  +G
Sbjct  295   MLSGEIPASFGELKNITLLNL-FRNKLHGAIPEFIGELPALEVVQLWENNLTGSIPEGLG  353

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             K   L+ + L  N L+G+L P +     L++L    N   G IPES 
Sbjct  354   KNGRLNLVDLSSNKLTGTLPPYLCSGNTLQTLITLGNFLFGPIPESL  400


 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 110/224 (49%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P +     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  367   KLTGTLPPYLCSGNTLQTLITLGNFLFGPIPESLGTCESLTRIRMGENFLNGSIPKGLFG  426

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N L+G+ P       +L  + L  N  SG + P  G F +++ L + GN
Sbjct  427   LPKLTQVELQDNYLSGEFPEVGSVAVNLGQITLSNNQLSGALSPSIGNFSSVQKLLLDGN  486

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               +G IP++IG L +L ++     N FSG I PE+     L   D +   L+G++P EI 
Sbjct  487   MFTGRIPTQIGRLQQLSKIDFS-GNKFSGPIAPEISQCKLLTFLDLSRNELSGDIPNEIT  545

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L S+D S N  SG +P
Sbjct  546   GMRILNYLNLSKNHLVGSIPSSISSMQSLTSVDFSYNNLSGLVP  589


 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 107/204 (52%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            NL+G +   +G+   L  + +++N+L+G +PP + + +TL+  + L N +FG   P  L 
Sbjct  343  NLTGSIPEGLGKNGRLNLVDLSSNKLTGTLPPYLCSGNTLQTLITLGNFLFGP-IPESLG  401

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
               +L  + +  N L G +P  ++ +  L  + L  NY SG  P       NL  + +S 
Sbjct  402  TCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGEFPEVGSVAVNLGQITLSN  461

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +   IGN + +++L +   N F+G IP ++G L QL + D +    +G +  EI
Sbjct  462  NQLSGALSPSIGNFSSVQKLLLD-GNMFTGRIPTQIGRLQQLSKIDFSGNKFSGPIAPEI  520

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  L L  N+LSG +  EI
Sbjct  521  SQCKLLTFLDLSRNELSGDIPNEI  544


 Score = 83.6 bits (205),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 95/203 (47%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G +   +G    L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  392  LFGPIPESLGTCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGEFPEVGSVA  451

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL  + L NN L+G L   +   +S++ L L GN F+GRIP + GR   L  +  SGN 
Sbjct  452  VNLGQITLSNNQLSGALSPSIGNFSSVQKLLLDGNMFTGRIPTQIGRLQQLSKIDFSGNK  511

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             SG I  EI     L  L +   N  SG IP E+  +  L   + +   L G +P  I  
Sbjct  512  FSGPIAPEISQCKLLTFLDLSR-NELSGDIPNEITGMRILNYLNLSKNHLVGSIPSSISS  570

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            +++L ++    N+LSG L P  G
Sbjct  571  MQSLTSVDFSYNNLSG-LVPGTG  592



>ref|XP_010426489.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score =   328 bits (841),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 180/284 (63%), Positives = 218/284 (77%), Gaps = 4/284 (1%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSL-TSWNIS-TSHCTWRRVTCdsllhvvsldlsg-lNLSG  385
             +TE  ALLS+K++ T D  S L TSWN+S T+ C+W  V CD     V+      LNLSG
Sbjct  23    ITELNALLSLKSSLTGDDHSPLLTSWNLSSTTFCSWTGVKCDVSRRHVTSLDLSGLNLSG  82

Query  386   VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LAN  562
              LS DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNN+F  ++P +L+  L N
Sbjct  83    TLSSDVSHLPLLQNLSLAANQISGPIPPEISKLSELRLLNLSNNVFNGSYPDELSSGLVN  142

Query  563   LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  742
             L+VLDLYNNNLTGDLP+ +  +T LRHLHLGGNYFSG+IP  YG +P LEYLAVSGN L 
Sbjct  143   LRVLDLYNNNLTGDLPLSITNLTELRHLHLGGNYFSGKIPATYGTWPVLEYLAVSGNELI  202

Query  743   GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLK  922
             G IP EIGNLT L+ELYIGY+N F  G+PPE+GNL++L+RFDAANCGLTG +P EIGKL+
Sbjct  203   GKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGNLTELLRFDAANCGLTGAIPPEIGKLQ  262

Query  923   NLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             NLDTLFLQVN  +G L  E+G + +LKS+DLSNN F+GEIP SF
Sbjct  263   NLDTLFLQVNAFAGPLTSELGLISSLKSMDLSNNMFTGEIPTSF  306


 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 79/247 (32%), Positives = 121/247 (49%), Gaps = 25/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G + P++G+L  L  L +  N  +GP+  E+  IS+L+ ++LSNN+F    P   ++L
Sbjct  250   LTGAIPPEIGKLQNLDTLFLQVNAFAGPLTSELGLISSLKSMDLSNNMFTGEIPTSFSEL  309

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L  L +S N 
Sbjct  310   KNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGGIPQKLGDNGRLVILDLSSNK  369

Query  737   LSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+G                         IP  +G    L  + +G  N  +G IP  +  
Sbjct  370   LTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGQ-NFLNGSIPKGLFG  428

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L +L + +  +  LTGELP+  G   +L  + L  N LSGSL   IG    ++ L L  N
Sbjct  429   LPKLSQVELQDNYLTGELPISGGVSSDLGQVSLSNNQLSGSLPAAIGNFSGVQKLLLDGN  488

Query  1025  AFSGEIP  1045
              F+G IP
Sbjct  489   KFAGPIP  495


 Score = 98.6 bits (244),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 78/249 (31%), Positives = 119/249 (48%), Gaps = 26/249 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              SG +    G  P L  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  177   FSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  236

Query  554   LANLQVLDLYNNNLTGDLPVEVYKM------------------------TSLRHLHLGGN  661
             L  L   D  N  LTG +P E+ K+                        +SL+ + L  N
Sbjct  237   LTELLRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFAGPLTSELGLISSLKSMDLSNN  296

Query  662   YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
              F+G IP  +    NL  L +  N L G IP  IG L +L+ L + + N F+GGIP ++G
Sbjct  297   MFTGEIPTSFSELKNLTLLNLFRNKLYGAIPEFIGELPELEVLQL-WENNFTGGIPQKLG  355

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
             +  +L+  D ++  LTG LP  +     L TL    N L GS+   +G  ++L  + +  
Sbjct  356   DNGRLVILDLSSNKLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGQ  415

Query  1022  nAFSGEIPE  1048
             N  +G IP+
Sbjct  416   NFLNGSIPK  424


 Score = 98.6 bits (244),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 112/204 (55%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI-SAISTLRFLNLSNNIFGSTFPHQLA  550
            N +G +   +G    LV L +++N+L+G +PP + S    +  + L N +FGS  P  L 
Sbjct  345  NFTGGIPQKLGDNGRLVILDLSSNKLTGTLPPNMCSGNRLMTLITLGNFLFGS-IPDSLG  403

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P   G   +L  +++S 
Sbjct  404  KCESLTRIRMGQNFLNGSIPKGLFGLPKLSQVELQDNYLTGELPISGGVSSDLGQVSLSN  463

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +P+ IGN + +++L +   N F+G IPPE+G L QL + D ++   +G +  EI
Sbjct  464  NQLSGSLPAAIGNFSGVQKLLLDG-NKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEI  522

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  + L  N+LSG +  EI
Sbjct  523  SRCKLLTFVDLSRNELSGDIPNEI  546


 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 73/226 (32%), Positives = 113/226 (50%), Gaps = 1/226 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L+ L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  369   KLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIPKGLFG  428

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N LTG+LP+     + L  + L  N  SG +P   G F  ++ L + GN
Sbjct  429   LPKLSQVELQDNYLTGELPISGGVSSDLGQVSLSNNQLSGSLPAAIGNFSGVQKLLLDGN  488

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               +G IP EIG L +L +L   + N FSG I PE+     L   D +   L+G++P EI 
Sbjct  489   KFAGPIPPEIGRLQQLSKLDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGDIPNEIT  547

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
              ++ L+ L L  N L GS+   I  +++L S+D S N  SG +P +
Sbjct  548   GMRILNYLNLSRNHLVGSIPVSIASMQSLTSVDFSYNNLSGLVPST  593



>ref|XP_002864974.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41233.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
Length=1003

 Score =   328 bits (841),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 181/285 (64%), Positives = 218/285 (76%), Gaps = 5/285 (2%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLS  382
             ++E  ALLS+K++ T    D  S L+SW +STS CTW  VTCD     V+      LNLS
Sbjct  23    ISEFRALLSLKSSLTGAGDDINSPLSSWKVSTSFCTWTGVTCDVSRRHVTSLDLSGLNLS  82

Query  383   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LA  559
             G LSPDV  L  L NLS+A NQ+SGP+PPEIS++S LR LNLSNN+F  +FP +++  L 
Sbjct  83    GTLSPDVSHLRLLQNLSLADNQISGPIPPEISSLSGLRHLNLSNNVFNGSFPDEISSGLV  142

Query  560   NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  739
             NL+VLD+YNNNLTGDLPV V  +T LRHLHLGGNYF+ +IPP YG +P +EYLAVSGN L
Sbjct  143   NLRVLDVYNNNLTGDLPVSVTNLTQLRHLHLGGNYFAEKIPPSYGSWPVIEYLAVSGNEL  202

Query  740   SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKL  919
              G IP EIGNL  L+ELYIGY+N F  G+PPE+GNLS+L+RFDAANCGLTGE+P EIGKL
Sbjct  203   VGKIPPEIGNLKTLRELYIGYYNAFEDGLPPEIGNLSELVRFDAANCGLTGEIPPEIGKL  262

Query  920   KNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             + LDTLFLQVN  SGSL  E+G L +LKS+DLSNN F+GEIP SF
Sbjct  263   QKLDTLFLQVNVFSGSLTWELGTLSSLKSMDLSNNMFTGEIPASF  307


 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 83/247 (34%), Positives = 120/247 (49%), Gaps = 25/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G + P++G+L  L  L +  N  SG +  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  251   LTGEIPPEIGKLQKLDTLFLQVNVFSGSLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  310

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRF------------  700
              NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G              
Sbjct  311   KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGTIPQKLGENGKLNLVDLSSNK  370

Query  701   ------PN------LEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
                   PN      LE L   GN L G IP  +G    L  + +G  N  +G IP  +  
Sbjct  371   LTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGE-NFLNGSIPKGLFG  429

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L +L + +  +  L+GELPV  G   NL  + L  N LSG L P IG    ++ L L  N
Sbjct  430   LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  489

Query  1025  AFSGEIP  1045
              F G IP
Sbjct  490   KFEGPIP  496


 Score = 96.7 bits (239),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 75/245 (31%), Positives = 118/245 (48%), Gaps = 26/245 (11%)
 Frame = +2

Query  389   LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQLANL  565
             + P  G  P +  L+++ N+L G +PPEI  + TLR L +   N F    P ++  L+ L
Sbjct  182   IPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLKTLRELYIGYYNAFEDGLPPEIGNLSEL  241

Query  566   QVLDLYNNNLTGDLPVEVYK------------------------MTSLRHLHLGGNYFSG  673
                D  N  LTG++P E+ K                        ++SL+ + L  N F+G
Sbjct  242   VRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGSLTWELGTLSSLKSMDLSNNMFTG  301

Query  674   RIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQ  853
              IP  +    NL  L +  N L G IP  IG+L +L+ L + + N F+G IP ++G   +
Sbjct  302   EIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQL-WENNFTGTIPQKLGENGK  360

Query  854   LIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFS  1033
             L   D ++  LTG LP  +     L+TL    N L GS+   +G  ++L  + +  N  +
Sbjct  361   LNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGENFLN  420

Query  1034  GEIPE  1048
             G IP+
Sbjct  421   GSIPK  425


 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 113/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  370   KLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFG  429

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N L+G+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  430   LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  489

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
                G IPSE+G L +L ++   + N FSG I PE+     L   D +   L+GE+P EI 
Sbjct  490   KFEGPIPSEVGKLQQLSKIDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEIT  548

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              +K L+ L L  N+L GS+   I  +++L SLD S N  SG +P
Sbjct  549   GMKILNYLNLSRNNLVGSIPGSISSMQSLTSLDFSYNNLSGLVP  592


 Score = 94.7 bits (234),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 110/204 (54%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   L  + +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  346  NFTGTIPQKLGENGKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGS-IPDSLG  404

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ +  L  + L  NY SG +P   G   NL  +++S 
Sbjct  405  KCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSN  464

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +P  IGN T +++L +   N F G IP E+G L QL + D ++   +G +  EI
Sbjct  465  NQLSGPLPPAIGNFTGVQKLLLDG-NKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEI  523

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  + L  N+LSG +  EI
Sbjct  524  SRCKLLTFVDLSRNELSGEIPNEI  547



>ref|XP_010547579.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1015

 Score =   328 bits (841),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 182/291 (63%), Positives = 222/291 (76%), Gaps = 8/291 (3%)
 Frame = +2

Query  200   GKPLGVTEQAALLSIKAAFTAD----SQSSLTSWNISTSHCTWRRVTCdsllhvvsldls  367
             G+P  ++E  ALLSIK++ +      + S L +WN ST+ C W  VTCD+    V     
Sbjct  22    GRP--ISEFRALLSIKSSLSGAGDGPNSSPLATWNDSTTFCAWTGVTCDASGRHVISLDL  79

Query  368   g-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  544
               LNLSG LSPD+  L  L NLS+A+NQ+SGP+PPE+S++S LR+LNLSNN+F  +FP +
Sbjct  80    SGLNLSGTLSPDIAHLFLLQNLSVASNQISGPIPPEVSSLSGLRYLNLSNNVFNGSFPDE  139

Query  545   L-AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLA  721
             L A   NL+VLDLYNNNLTGDLPV V  +T LRHLHLGGNYF+GRIPP YG +P LEYLA
Sbjct  140   LSAGAVNLRVLDLYNNNLTGDLPVSVTNLTHLRHLHLGGNYFAGRIPPAYGSWPVLEYLA  199

Query  722   VSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELP  901
             VSGN L G IP EIGNLT L+ELYIGY+N F  G+PPE+GNLS+L+RFDAANCGLTG++P
Sbjct  200   VSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGNLSELVRFDAANCGLTGKIP  259

Query  902   VEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
              E+GKL+ LDTLFLQVN LSG L  E+G L +LKS+DLSNN F+GEIP SF
Sbjct  260   PEVGKLQKLDTLFLQVNALSGPLTTELGTLSSLKSMDLSNNMFTGEIPASF  310


 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 105/198 (53%), Gaps = 1/198 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L+G + P+VG+L  L  L +  N LSGP+  E+  +S+L+ ++LSNN+F    P   AQL
Sbjct  254  LTGKIPPEVGKLQKLDTLFLQVNALSGPLTTELGTLSSLKSMDLSNNMFTGEIPASFAQL  313

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP + G+   L++L +S N 
Sbjct  314  KNLTLLNLFRNKLHGAIPEFIGDLPQLEVLQLWENNFTGSIPQKLGQNGKLQFLDLSSNK  373

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P  + +  KL+ L I   N   G IP  +G    L R       L G +P  +  
Sbjct  374  LTGTLPPNLCSGNKLQTL-ITLSNFLFGSIPDSLGECESLTRIRMGENFLNGSIPKGLFG  432

Query  917  LKNLDTLFLQVNDLSGSL  970
            L  L  + LQ N LSG  
Sbjct  433  LPKLSQVELQDNYLSGEF  450


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 78/249 (31%), Positives = 120/249 (48%), Gaps = 26/249 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              +G + P  G  P L  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  181   FAGRIPPAYGSWPVLEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  240

Query  554   LANLQVLDLYNNNLTGDLPVEVYKM------------------------TSLRHLHLGGN  661
             L+ L   D  N  LTG +P EV K+                        +SL+ + L  N
Sbjct  241   LSELVRFDAANCGLTGKIPPEVGKLQKLDTLFLQVNALSGPLTTELGTLSSLKSMDLSNN  300

Query  662   YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
              F+G IP  + +  NL  L +  N L G IP  IG+L +L+ L + + N F+G IP ++G
Sbjct  301   MFTGEIPASFAQLKNLTLLNLFRNKLHGAIPEFIGDLPQLEVLQL-WENNFTGSIPQKLG  359

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
                +L   D ++  LTG LP  +     L TL    N L GS+   +G  ++L  + +  
Sbjct  360   QNGKLQFLDLSSNKLTGTLPPNLCSGNKLQTLITLSNFLFGSIPDSLGECESLTRIRMGE  419

Query  1022  nAFSGEIPE  1048
             N  +G IP+
Sbjct  420   NFLNGSIPK  428


 Score = 99.0 bits (245),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 112/204 (55%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +GQ   L  L +++N+L+G +PP + + + L+  + LSN +FGS  P  L 
Sbjct  349  NFTGSIPQKLGQNGKLQFLDLSSNKLTGTLPPNLCSGNKLQTLITLSNFLFGS-IPDSLG  407

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ +  L  + L  NY SG  P       NL  +++S 
Sbjct  408  ECESLTRIRMGENFLNGSIPKGLFGLPKLSQVELQDNYLSGEFPVSGRVAVNLGQISLSN  467

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +P  IGN   +++L +   N F+G IPP++G L QL + D ++  L+G +  EI
Sbjct  468  NQLSGPLPPAIGNFYGVQKLLLDG-NKFTGPIPPQVGKLQQLSKMDISHNQLSGRIAPEI  526

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  + L  N+LSG +  EI
Sbjct  527  SQCKLLTFVDLSRNELSGEIPNEI  550


 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/226 (31%), Positives = 112/226 (50%), Gaps = 1/226 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L  L   +N L G +P  +    +L  + +  N    + P  L  
Sbjct  373   KLTGTLPPNLCSGNKLQTLITLSNFLFGSIPDSLGECESLTRIRMGENFLNGSIPKGLFG  432

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N L+G+ PV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  433   LPKLSQVELQDNYLSGEFPVSGRVAVNLGQISLSNNQLSGPLPPAIGNFYGVQKLLLDGN  492

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               +G IP ++G L +L ++ I + N  SG I PE+     L   D +   L+GE+P EI 
Sbjct  493   KFTGPIPPQVGKLQQLSKMDISH-NQLSGRIAPEISQCKLLTFVDLSRNELSGEIPNEIT  551

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
              ++ L+ L L  N L G +   +  +++L S+D S N  SG +P S
Sbjct  552   GMRILNYLNLSRNHLVGPIPASVASMQSLTSVDFSYNNLSGLVPGS  597



>ref|NP_201371.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 ref|NP_001190624.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 sp|O49545.1|BAME1_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1; AltName: Full=Protein BARELY ANY MERISTEM 
1; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16688.1| receptor protein kinase - like protein [Arabidopsis thaliana]
 dbj|BAB10677.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAM20665.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAP68249.1| At5g65700 [Arabidopsis thaliana]
 dbj|BAE98627.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59407.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED98091.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 gb|AED98092.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1003

 Score =   327 bits (838),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 182/291 (63%), Positives = 219/291 (75%), Gaps = 7/291 (2%)
 Frame = +2

Query  197   AGKPLGVTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls  367
             A +P  ++E  ALLS+K + T    D  S L+SW +STS CTW  VTCD     V+    
Sbjct  19    ASRP--ISEFRALLSLKTSLTGAGDDKNSPLSSWKVSTSFCTWIGVTCDVSRRHVTSLDL  76

Query  368   g-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  544
               LNLSG LSPDV  L  L NLS+A N +SGP+PPEIS++S LR LNLSNN+F  +FP +
Sbjct  77    SGLNLSGTLSPDVSHLRLLQNLSLAENLISGPIPPEISSLSGLRHLNLSNNVFNGSFPDE  136

Query  545   LAQ-LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLA  721
             ++  L NL+VLD+YNNNLTGDLPV V  +T LRHLHLGGNYF+G+IPP YG +P +EYLA
Sbjct  137   ISSGLVNLRVLDVYNNNLTGDLPVSVTNLTQLRHLHLGGNYFAGKIPPSYGSWPVIEYLA  196

Query  722   VSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELP  901
             VSGN L G IP EIGNLT L+ELYIGY+N F  G+PPE+GNLS+L+RFD ANCGLTGE+P
Sbjct  197   VSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGNLSELVRFDGANCGLTGEIP  256

Query  902   VEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
              EIGKL+ LDTLFLQVN  SG L  E+G L +LKS+DLSNN F+GEIP SF
Sbjct  257   PEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASF  307


 Score =   106 bits (265),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 84/247 (34%), Positives = 121/247 (49%), Gaps = 25/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  251   LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  310

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRF------------  700
              NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G              
Sbjct  311   KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGKLNLVDLSSNK  370

Query  701   ------PN------LEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
                   PN      LE L   GN L G IP  +G    L  + +G  N  +G IP  +  
Sbjct  371   LTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGE-NFLNGSIPKGLFG  429

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L +L + +  +  L+GELPV  G   NL  + L  N LSG L P IG    ++ L L  N
Sbjct  430   LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  489

Query  1025  AFSGEIP  1045
              F G IP
Sbjct  490   KFQGPIP  496


 Score = 98.2 bits (243),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 76/249 (31%), Positives = 121/249 (49%), Gaps = 26/249 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  178   FAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  237

Query  554   LANLQVLDLYNNNLTGDLPVEVYK------------------------MTSLRHLHLGGN  661
             L+ L   D  N  LTG++P E+ K                        ++SL+ + L  N
Sbjct  238   LSELVRFDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNN  297

Query  662   YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
              F+G IP  +    NL  L +  N L G IP  IG+L +L+ L + + N F+G IP ++G
Sbjct  298   MFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQL-WENNFTGSIPQKLG  356

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
                +L   D ++  LTG LP  +     L+TL    N L GS+   +G  ++L  + +  
Sbjct  357   ENGKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGE  416

Query  1022  nAFSGEIPE  1048
             N  +G IP+
Sbjct  417   NFLNGSIPK  425


 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 112/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  370   KLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFG  429

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N L+G+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  430   LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  489

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
                G IPSE+G L +L ++   + N FSG I PE+     L   D +   L+GE+P EI 
Sbjct  490   KFQGPIPSEVGKLQQLSKIDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEIT  548

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              +K L+ L L  N L GS+   I  +++L SLD S N  SG +P
Sbjct  549   AMKILNYLNLSRNHLVGSIPGSISSMQSLTSLDFSYNNLSGLVP  592


 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 110/204 (54%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   L  + +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  346  NFTGSIPQKLGENGKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGS-IPDSLG  404

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ +  L  + L  NY SG +P   G   NL  +++S 
Sbjct  405  KCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSN  464

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +P  IGN T +++L +   N F G IP E+G L QL + D ++   +G +  EI
Sbjct  465  NQLSGPLPPAIGNFTGVQKLLLDG-NKFQGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEI  523

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  + L  N+LSG +  EI
Sbjct  524  SRCKLLTFVDLSRNELSGEIPNEI  547



>ref|XP_006393995.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
 gb|ESQ31281.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
Length=1007

 Score =   327 bits (837),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 182/291 (63%), Positives = 220/291 (76%), Gaps = 7/291 (2%)
 Frame = +2

Query  197   AGKPLGVTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls  367
             AG+P  ++E  AL+S+K++ T    D  S L SW  STS CTW  VTCD     V+    
Sbjct  19    AGRP--ISELHALISLKSSLTGAGEDPNSPLASWKSSTSFCTWTGVTCDISRRHVTSLDL  76

Query  368   g-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  544
               LNLSG LSPDV +LP L NLS+A NQ+SGP+PPEIS +  LR LNLSNN+F  +FP +
Sbjct  77    SGLNLSGTLSPDVSRLPLLQNLSVADNQISGPIPPEISNLYGLRHLNLSNNVFNGSFPDE  136

Query  545   LAQ-LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLA  721
             ++  L NL+VLD+YNNNLTGDLP+ V  +T LRHLHLGGNYF+G+IP  YG +P +EYLA
Sbjct  137   ISSGLVNLRVLDVYNNNLTGDLPLSVTNLTQLRHLHLGGNYFAGQIPSSYGSWPVIEYLA  196

Query  722   VSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELP  901
             VSGN L G IP EIGNLT L+ELYIGY+N F  G+PPE+GNLS+L+RFDAANCGLTGE+P
Sbjct  197   VSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGNLSELVRFDAANCGLTGEIP  256

Query  902   VEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
              EIGKL+ LDTLFLQVN  SG L  E+G L +LKS+DLSNN F+GEIP SF
Sbjct  257   PEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASF  307


 Score =   108 bits (271),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 84/247 (34%), Positives = 122/247 (49%), Gaps = 25/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  251   LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  310

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGR-------------  697
              NL +L+L+ N L G++P  + ++  L  L L  N F+G IP + G              
Sbjct  311   KNLTLLNLFRNKLHGEIPEFIGELPELEVLQLWENNFTGSIPQKLGENGKLNLVDLSSNK  370

Query  698   ----FP-------NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
                  P       NLE L   GN L G IP  +G    L  + +G  N  +G IP  +  
Sbjct  371   LTGALPPNMCSGNNLETLITLGNFLFGSIPDSLGKCESLSRIRMGQ-NFLNGSIPKGLFG  429

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L +L + +  +  LTG+LPV  G   NL  + L  N LSG L P IG    ++ L L  N
Sbjct  430   LPKLTQVELQDNYLTGQLPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  489

Query  1025  AFSGEIP  1045
              F G IP
Sbjct  490   KFEGPIP  496


 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 76/249 (31%), Positives = 120/249 (48%), Gaps = 26/249 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              +G +    G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  178   FAGQIPSSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  237

Query  554   LANLQVLDLYNNNLTGDLPVEVYK------------------------MTSLRHLHLGGN  661
             L+ L   D  N  LTG++P E+ K                        ++SL+ + L  N
Sbjct  238   LSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNN  297

Query  662   YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
              F+G IP  +    NL  L +  N L G IP  IG L +L+ L + + N F+G IP ++G
Sbjct  298   MFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGELPELEVLQL-WENNFTGSIPQKLG  356

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
                +L   D ++  LTG LP  +    NL+TL    N L GS+   +G  ++L  + +  
Sbjct  357   ENGKLNLVDLSSNKLTGALPPNMCSGNNLETLITLGNFLFGSIPDSLGKCESLSRIRMGQ  416

Query  1022  nAFSGEIPE  1048
             N  +G IP+
Sbjct  417   NFLNGSIPK  425


 Score = 93.6 bits (231),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 112/223 (50%), Gaps = 1/223 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  L
Sbjct  371   LTGALPPNMCSGNNLETLITLGNFLFGSIPDSLGKCESLSRIRMGQNFLNGSIPKGLFGL  430

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L  ++L +N LTG LPV      +L  + L  N  SG +PP  G F  ++ L + GN 
Sbjct  431   PKLTQVELQDNYLTGQLPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNK  490

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
               G IPSE+G L +L ++   + N FSG I PE+ +   L   D +   L+G++P EI  
Sbjct  491   FEGPIPSEVGKLQQLSKIDFSH-NLFSGRIAPEISHCKLLTFVDLSRNELSGDIPNEITG  549

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             ++ L+ L L  N L G++   I  +++L SLD S N  SG +P
Sbjct  550   MRILNYLNLSRNHLVGTIPGSISSMQSLTSLDFSYNNLSGLVP  592


 Score = 92.8 bits (229),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 110/204 (54%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   L  + +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  346  NFTGSIPQKLGENGKLNLVDLSSNKLTGALPPNMCSGNNLETLITLGNFLFGS-IPDSLG  404

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G++P   G   NL  +++S 
Sbjct  405  KCESLSRIRMGQNFLNGSIPKGLFGLPKLTQVELQDNYLTGQLPVAGGVSVNLGQISLSN  464

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +P  IGN T +++L +   N F G IP E+G L QL + D ++   +G +  EI
Sbjct  465  NQLSGPLPPAIGNFTGVQKLLLDG-NKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEI  523

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
               K L  + L  N+LSG +  EI
Sbjct  524  SHCKLLTFVDLSRNELSGDIPNEI  547



>ref|XP_004511796.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1009

 Score =   327 bits (837),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 177/280 (63%), Positives = 225/280 (80%), Gaps = 0/280 (0%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  394
             ++E  ALLS++ A T  +   L+SWN ST+HC W  VTCD+  HV +L+L+GLNLSG L+
Sbjct  23    ISEYRALLSLREAITDTNPPILSSWNPSTTHCIWLGVTCDTRRHVTALNLTGLNLSGTLA  82

Query  395   PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  574
              D+  LPFL NLS+A N+ SG +PP +SA+S LR LNLSNN+F  TFP +L+QL +L+VL
Sbjct  83    ADIAHLPFLSNLSLADNKFSGEIPPSLSAVSGLRLLNLSNNVFNGTFPSELSQLKSLEVL  142

Query  575   DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  754
             DLYNNN+TG LP+ V ++ +LRHLHLGGNYF+G+IPPEYG + +LEYLAVSGN L G IP
Sbjct  143   DLYNNNMTGTLPLAVTELPNLRHLHLGGNYFTGQIPPEYGLWQHLEYLAVSGNELDGTIP  202

Query  755   SEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDT  934
               IGNLT L+ELYIGY+N ++GGIPPE+GNL++L+R DAA CGL+GE+P E+GKL+ LDT
Sbjct  203   PGIGNLTSLRELYIGYYNTYAGGIPPEIGNLTELVRLDAAYCGLSGEIPAEMGKLQKLDT  262

Query  935   LFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             LFLQVN LSGSL  E+G LK+LKS+DLSNN  +GEIP SF
Sbjct  263   LFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSF  302


 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 109/223 (49%), Gaps = 1/223 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG L+ ++G L  L ++ ++ N L+G +P   S +  L  LNL  N      P  +  +
Sbjct  270   LSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFSQLKNLTLLNLFRNKLHGAIPEFIGDM  329

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L+V+ L+ NN TG++P+ +     L  L L  N  +G +PP       L+ L   GN 
Sbjct  330   PALEVVQLWENNFTGNIPMGLGSNGKLTLLDLSSNKLTGTLPPYLCSGNRLQTLITLGNF  389

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L G IP  +G+   L  + +G  N  +G IP  +  L +L + +  +  L+G  P     
Sbjct  390   LFGPIPESLGSCESLNRIRMGD-NFLNGSIPKGLFGLPKLTQVELQDNYLSGNFPETHSV  448

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
               NL  + L  N LSG L P IG   +++   L  N F+G+IP
Sbjct  449   SVNLGQITLSNNQLSGVLPPSIGNFTSMQKFLLDGNMFTGKIP  491


 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 107/204 (52%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G    L  L +++N+L+G +PP + + + L+  + L N +FG   P  L 
Sbjct  341  NFTGNIPMGLGSNGKLTLLDLSSNKLTGTLPPYLCSGNRLQTLITLGNFLFGP-IPESLG  399

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
               +L  + + +N L G +P  ++ +  L  + L  NY SG  P  +    NL  + +S 
Sbjct  400  SCESLNRIRMGDNFLNGSIPKGLFGLPKLTQVELQDNYLSGNFPETHSVSVNLGQITLSN  459

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSGV+P  IGN T +++  +   N F+G IP ++G L QL   D ++   +G +  EI
Sbjct  460  NQLSGVLPPSIGNFTSMQKFLLD-GNMFTGKIPSQIGRLQQLSNIDFSHNKFSGPIASEI  518

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  + L  N+LSG +  EI
Sbjct  519  SQCKLLTFVDLSRNELSGVIPNEI  542


 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 110/223 (49%), Gaps = 1/223 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G L P +     L  L    N L GP+P  + +  +L  + + +N    + P  L  L
Sbjct  366   LTGTLPPYLCSGNRLQTLITLGNFLFGPIPESLGSCESLNRIRMGDNFLNGSIPKGLFGL  425

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L  ++L +N L+G+ P       +L  + L  N  SG +PP  G F +++   + GN 
Sbjct  426   PKLTQVELQDNYLSGNFPETHSVSVNLGQITLSNNQLSGVLPPSIGNFTSMQKFLLDGNM  485

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
              +G IPS+IG L +L  +   + N FSG I  E+     L   D +   L+G +P EI  
Sbjct  486   FTGKIPSQIGRLQQLSNIDFSH-NKFSGPIASEISQCKLLTFVDLSRNELSGVIPNEITG  544

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             ++ L+ L L  N L GS+   I  +++L S+D S N  SG +P
Sbjct  545   MRILNYLNLSRNHLVGSIPISISSMQSLTSVDFSYNNLSGLVP  587


 Score = 82.8 bits (203),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 100/197 (51%), Gaps = 1/197 (1%)
 Frame = +2

Query  380  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  559
            +G + P++G L  LV L  A   LSG +P E+  +  L  L L  N    +   +L  L 
Sbjct  223  AGGIPPEIGNLTELVRLDAAYCGLSGEIPAEMGKLQKLDTLFLQVNALSGSLTWELGNLK  282

Query  560  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  739
            +L+ +DL NN LTG++P    ++ +L  L+L  N   G IP   G  P LE + +  N  
Sbjct  283  SLKSMDLSNNMLTGEIPTSFSQLKNLTLLNLFRNKLHGAIPEFIGDMPALEVVQLWENNF  342

Query  740  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKL  919
            +G IP  +G+  KL  L +   N  +G +PP + + ++L         L G +P  +G  
Sbjct  343  TGNIPMGLGSNGKLTLLDLSS-NKLTGTLPPYLCSGNRLQTLITLGNFLFGPIPESLGSC  401

Query  920  KNLDTLFLQVNDLSGSL  970
            ++L+ + +  N L+GS+
Sbjct  402  ESLNRIRMGDNFLNGSI  418



>ref|XP_007155783.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
 gb|ESW27777.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
Length=1018

 Score =   327 bits (837),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 180/281 (64%), Positives = 226/281 (80%), Gaps = 1/281 (0%)
 Frame = +2

Query  215   VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  391
             ++E  ALLS KA+  T D  ++L+SWN ST++C+W  +TCDS LHV +L+L+  +LSG L
Sbjct  26    ISEYRALLSFKASSITDDPTNALSSWNSSTTYCSWLGITCDSRLHVTTLNLTSSSLSGTL  85

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  571
                +  LPFL  LS+A NQ SGP+P   S++S LR LNLSNN F +TFP  L++LANLQV
Sbjct  86    YDHLSHLPFLSYLSLADNQFSGPIPASFSSLSALRHLNLSNNAFNATFPSNLSRLANLQV  145

Query  572   LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  751
             LDLYNNN+TG LP+ V  M  LRHLHLGGN+FSG+IPPEYG + +L+YLAVSGN LSG I
Sbjct  146   LDLYNNNMTGPLPLAVASMPLLRHLHLGGNFFSGQIPPEYGTWQHLQYLAVSGNELSGNI  205

Query  752   PSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLD  931
             P E+GNLT L+ELYIGY+N +SGGIPPE+GNLSQL+RFDAA CGL+GE+P ++G+L+N+D
Sbjct  206   PPELGNLTALRELYIGYYNAYSGGIPPEIGNLSQLVRFDAAYCGLSGEIPADLGRLQNMD  265

Query  932   TLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             TLFLQVN LSGSL PE+G LK+LKS+DLSNN  SGE+P SF
Sbjct  266   TLFLQVNALSGSLTPELGNLKSLKSMDLSNNILSGEVPASF  306


 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 120/247 (49%), Gaps = 25/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG +  D+G+L  +  L +  N LSG + PE+  + +L+ ++LSNNI     P    +L
Sbjct  250   LSGEIPADLGRLQNMDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNILSGEVPASFTEL  309

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  V ++ +L  L L  N F+G IP   GR   L  + +S N 
Sbjct  310   KNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNFTGSIPQSLGRNGKLTVVDLSSNK  369

Query  737   LSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+G+                        IP  IG    L  + +G  N  +G IP  +  
Sbjct  370   LTGMLPPDMCYGNRLQTLITLGNYLFGPIPDSIGKCESLNRIRMGE-NFLNGSIPIGLFG  428

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L +L + +  N  LTG+ P       NL  + L  N LSGSL P IG   +++ L L  N
Sbjct  429   LPKLTQVELQNNLLTGQFPEGGSIAVNLGQISLSNNKLSGSLPPTIGNFTSMQKLLLDGN  488

Query  1025  AFSGEIP  1045
              FSG+IP
Sbjct  489   KFSGQIP  495


 Score =   100 bits (249),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 77/224 (34%), Positives = 112/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G+L PD+     L  L    N L GP+P  I    +L  + +  N    + P  L  
Sbjct  369   KLTGMLPPDMCYGNRLQTLITLGNYLFGPIPDSIGKCESLNRIRMGENFLNGSIPIGLFG  428

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L NN LTG  P       +L  + L  N  SG +PP  G F +++ L + GN
Sbjct  429   LPKLTQVELQNNLLTGQFPEGGSIAVNLGQISLSNNKLSGSLPPTIGNFTSMQKLLLDGN  488

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IPS+IG L +L ++     N FSG I PE+     L   D +   L+GE+P +I 
Sbjct  489   KFSGQIPSQIGRLQQLSKIDFSR-NEFSGPIAPEISRCKLLTFIDLSRNELSGEIPNQIT  547

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L S+D S N  SG +P
Sbjct  548   AMRILNYLNLSRNHLVGSIPGSIASMQSLTSVDFSYNNLSGLVP  591


 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 77/274 (28%), Positives = 117/274 (43%), Gaps = 73/274 (27%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG L+P++G L  L ++ ++ N LSG VP   + +  L  LNL  N      P  + +L
Sbjct  274  LSGSLTPELGNLKSLKSMDLSNNILSGEVPASFTELKNLTLLNLFRNKLHGAIPEFVGEL  333

Query  557  ANLQVLDLYNNNLTGDLPVE----------------------------------------  616
              L+VL L+ NN TG +P                                          
Sbjct  334  PALEVLQLWENNFTGSIPQSLGRNGKLTVVDLSSNKLTGMLPPDMCYGNRLQTLITLGNY  393

Query  617  --------VYKMTSLRHLHLGGNYFSGRIP------PEY-----------GRFP------  703
                    + K  SL  + +G N+ +G IP      P+            G+FP      
Sbjct  394  LFGPIPDSIGKCESLNRIRMGENFLNGSIPIGLFGLPKLTQVELQNNLLTGQFPEGGSIA  453

Query  704  -NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANC  880
             NL  +++S N LSG +P  IGN T +++L +   N FSG IP ++G L QL + D +  
Sbjct  454  VNLGQISLSNNKLSGSLPPTIGNFTSMQKLLLDG-NKFSGQIPSQIGRLQQLSKIDFSRN  512

Query  881  GLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEI  982
              +G +  EI + K L  + L  N+LSG +  +I
Sbjct  513  EFSGPIAPEISRCKLLTFIDLSRNELSGEIPNQI  546


 Score = 85.5 bits (210),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 99/197 (50%), Gaps = 1/197 (1%)
 Frame = +2

Query  380  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  559
            SG + P++G L  LV    A   LSG +P ++  +  +  L L  N    +   +L  L 
Sbjct  227  SGGIPPEIGNLSQLVRFDAAYCGLSGEIPADLGRLQNMDTLFLQVNALSGSLTPELGNLK  286

Query  560  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  739
            +L+ +DL NN L+G++P    ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  287  SLKSMDLSNNILSGEVPASFTELKNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNF  346

Query  740  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKL  919
            +G IP  +G   KL  + +   N  +G +PP+M   ++L         L G +P  IGK 
Sbjct  347  TGSIPQSLGRNGKLTVVDLSS-NKLTGMLPPDMCYGNRLQTLITLGNYLFGPIPDSIGKC  405

Query  920  KNLDTLFLQVNDLSGSL  970
            ++L+ + +  N L+GS+
Sbjct  406  ESLNRIRMGENFLNGSI  422



>ref|XP_004143422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Cucumis sativus]
 gb|KGN48657.1| hypothetical protein Csa_6G497080 [Cucumis sativus]
Length=1019

 Score =   327 bits (837),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 191/280 (68%), Positives = 225/280 (80%), Gaps = 0/280 (0%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  394
             V+E  ALLS+K + T D +SSL SWN STSHCTW  VTCD   HV +LDL+ L LSG LS
Sbjct  26    VSEYRALLSLKTSITGDPKSSLASWNASTSHCTWFGVTCDLRRHVTALDLTALGLSGSLS  85

Query  395   PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  574
             PDV  L FL NLS+AAN+ SGP+PPE+S+IS+LR LNLSNN+F  +FP + +QL NL VL
Sbjct  86    PDVAFLRFLTNLSLAANEFSGPIPPELSSISSLRLLNLSNNVFDGSFPSRFSQLQNLHVL  145

Query  575   DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  754
             DLYNNN+TGD P+ V +M+ LRHLHLGGN+F+GRIPPE GR  +LEYLAVSGN LSG IP
Sbjct  146   DLYNNNMTGDFPIVVTQMSGLRHLHLGGNFFAGRIPPEVGRMQSLEYLAVSGNELSGSIP  205

Query  755   SEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDT  934
              E+GNLT L+ELYIGYFN + GG+P E+GNLSQL+R DAANCGL+G +P E+GKL+NLDT
Sbjct  206   PELGNLTNLRELYIGYFNAYDGGLPAEIGNLSQLVRLDAANCGLSGRIPPELGKLQNLDT  265

Query  935   LFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             LFLQVN LSG L PEIG L +LKSLDLSNN   GEIP SF
Sbjct  266   LFLQVNALSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSF  305


 Score =   105 bits (261),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 81/247 (33%), Positives = 122/247 (49%), Gaps = 25/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG + P++G+L  L  L +  N LSGP+ PEI  +++L+ L+LSNN+     P   AQL
Sbjct  249   LSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQL  308

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  +  +  L  L L  N F+  IP   G+   L+ L +S N 
Sbjct  309   KNLTLLNLFRNKLHGAIPSFIGDLPKLEVLQLWENNFTEAIPQNLGKNGMLQILDLSSNK  368

Query  737   LSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+G                         IP  +G    L  + +G  N  +G IP  + +
Sbjct  369   LTGTLPPDMCFGNRLQILIALSNFLFGPIPESLGKCVSLNRIRMGE-NFLNGSIPKGLLS  427

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L +L + +  +  L+GE P+      NL  + L  N L+GS+ P IG    ++ L L  N
Sbjct  428   LPKLSQVELQDNFLSGEFPITDSISLNLGQISLSNNRLTGSIPPTIGNFSGVQKLLLDGN  487

Query  1025  AFSGEIP  1045
              FSG+IP
Sbjct  488   KFSGQIP  494


 Score = 95.9 bits (237),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 113/227 (50%), Gaps = 7/227 (3%)
 Frame = +2

Query  374   NLSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  544
              L+G L PD+    +L  L+ LS   N L GP+P  +    +L  + +  N    + P  
Sbjct  368   KLTGTLPPDMCFGNRLQILIALS---NFLFGPIPESLGKCVSLNRIRMGENFLNGSIPKG  424

Query  545   LAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  724
             L  L  L  ++L +N L+G+ P+      +L  + L  N  +G IPP  G F  ++ L +
Sbjct  425   LLSLPKLSQVELQDNFLSGEFPITDSISLNLGQISLSNNRLTGSIPPTIGNFSGVQKLLL  484

Query  725   SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPV  904
              GN  SG IP EIG L +L ++     N  SG I PE+     L   D +   L+GE+P 
Sbjct  485   DGNKFSGQIPPEIGRLQQLSKIDFSS-NMLSGPIAPEISQCKLLTFVDLSRNQLSGEIPN  543

Query  905   EIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             EI  ++ L+ L L  N L G +   I  +++L S+D S N  SG +P
Sbjct  544   EITSMRILNYLNLSKNHLVGGIPATIASMQSLTSVDFSYNNLSGLVP  590


 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 99/196 (51%), Gaps = 1/196 (1%)
 Frame = +2

Query  383  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  562
            G L  ++G L  LV L  A   LSG +PPE+  +  L  L L  N        ++ QL +
Sbjct  227  GGLPAEIGNLSQLVRLDAANCGLSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLNS  286

Query  563  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  742
            L+ LDL NN L G++PV   ++ +L  L+L  N   G IP   G  P LE L +  N  +
Sbjct  287  LKSLDLSNNMLVGEIPVSFAQLKNLTLLNLFRNKLHGAIPSFIGDLPKLEVLQLWENNFT  346

Query  743  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLK  922
              IP  +G    L+ L +   N  +G +PP+M   ++L    A +  L G +P  +GK  
Sbjct  347  EAIPQNLGKNGMLQILDLSS-NKLTGTLPPDMCFGNRLQILIALSNFLFGPIPESLGKCV  405

Query  923  NLDTLFLQVNDLSGSL  970
            +L+ + +  N L+GS+
Sbjct  406  SLNRIRMGENFLNGSI  421


 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/203 (32%), Positives = 99/203 (49%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N     FP   +  
Sbjct  393  LFGPIPESLGKCVSLNRIRMGENFLNGSIPKGLLSLPKLSQVELQDNFLSGEFPITDSIS  452

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL  + L NN LTG +P  +   + ++ L L GN FSG+IPPE GR   L  +  S N 
Sbjct  453  LNLGQISLSNNRLTGSIPPTIGNFSGVQKLLLDGNKFSGQIPPEIGRLQQLSKIDFSSNM  512

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            LSG I  EI     L  + +   N  SG IP E+ ++  L   + +   L G +P  I  
Sbjct  513  LSGPIAPEISQCKLLTFVDLSR-NQLSGEIPNEITSMRILNYLNLSKNHLVGGIPATIAS  571

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            +++L ++    N+LSG L P  G
Sbjct  572  MQSLTSVDFSYNNLSG-LVPGTG  593



>ref|XP_010484412.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1005

 Score =   326 bits (836),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 180/286 (63%), Positives = 216/286 (76%), Gaps = 6/286 (2%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNL  379
             ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD     V+      LNL
Sbjct  23    ISEFRALLSLKSSLTGAGTDDQNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  380   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-L  556
             SG LSPDV  L  L NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +L+  L
Sbjct  83    SGTLSPDVSHLRLLQNLSLAENQISGPIPPEISILSGLRHLNLSNNVFNGSFPDELSSGL  142

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL+VLD+YNNNLTGDLP+ V  +T LRHLHLGGNYF+G+IPP YG +P +EYLAVSGN 
Sbjct  143   VNLRVLDVYNNNLTGDLPLSVTNLTQLRHLHLGGNYFAGKIPPSYGSWPVIEYLAVSGNE  202

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L G IP EIGNLT L+ELYIGY+N F  G+PPE+GNLS+L+R D ANCGLTGE+P EIGK
Sbjct  203   LVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGNLSELVRLDGANCGLTGEIPPEIGK  262

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             L+ LDTLFLQVN  SG L  E+G L +LKS+DLSNN F+GEIP SF
Sbjct  263   LQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASF  308


 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 85/247 (34%), Positives = 122/247 (49%), Gaps = 25/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  252   LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  311

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRF------------  700
              NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G              
Sbjct  312   KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGKLNLVDLSSNK  371

Query  701   ------PN------LEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
                   PN      LE L   GN L G IP  +G    L  + IG  N  +G IP  +  
Sbjct  372   LTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRIGQ-NFLNGSIPKGLFG  430

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L +L + +  +  L+GELPV  G   NL  + L  N LSG L P IG    ++ L L  N
Sbjct  431   LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490

Query  1025  AFSGEIP  1045
              F G+IP
Sbjct  491   KFEGQIP  497


 Score = 99.8 bits (247),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 77/249 (31%), Positives = 122/249 (49%), Gaps = 26/249 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  179   FAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  238

Query  554   LANLQVLDLYNNNLTGDLPVEVYK------------------------MTSLRHLHLGGN  661
             L+ L  LD  N  LTG++P E+ K                        ++SL+ + L  N
Sbjct  239   LSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNN  298

Query  662   YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
              F+G IP  +    NL  L +  N L G IP  IG+L +L+ L + + N F+G IP ++G
Sbjct  299   MFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQL-WENNFTGSIPQKLG  357

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
                +L   D ++  LTG LP  +     L+TL    N L GS+   +G  ++L  + +  
Sbjct  358   ENGKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRIGQ  417

Query  1022  nAFSGEIPE  1048
             N  +G IP+
Sbjct  418   NFLNGSIPK  426


 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 110/204 (54%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   L  + +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  347  NFTGSIPQKLGENGKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGS-IPDSLG  405

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ +  L  + L  NY SG +P   G   NL  +++S 
Sbjct  406  KCESLTRIRIGQNFLNGSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSN  465

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +P  IGN T +++L +   N F G IP E+G L QL + D ++   +G +  EI
Sbjct  466  NQLSGPLPPAIGNFTGVQKLLLDG-NKFEGQIPSEVGKLQQLSKIDFSHNLFSGRIAPEI  524

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  + L  N+LSG +  EI
Sbjct  525  SRCKLLTFVDLSRNELSGEIPNEI  548


 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 112/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  371   KLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRIGQNFLNGSIPKGLFG  430

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N L+G+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  431   LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
                G IPSE+G L +L ++   + N FSG I PE+     L   D +   L+GE+P EI 
Sbjct  491   KFEGQIPSEVGKLQQLSKIDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEIT  549

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L SLD S N  SG +P
Sbjct  550   GMRILNYLNLSRNHLLGSIPGSISSMQSLTSLDFSYNNLSGLVP  593



>ref|XP_010444585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score =   326 bits (835),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 180/286 (63%), Positives = 216/286 (76%), Gaps = 6/286 (2%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNL  379
             ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD     V+      LNL
Sbjct  23    ISEFRALLSLKSSLTGAGSDDQNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  380   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-L  556
             SG LSPDV  L  L NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +L+  L
Sbjct  83    SGTLSPDVSHLRLLQNLSLAENQISGPIPPEISILSGLRHLNLSNNVFNGSFPDELSSGL  142

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL+VLD+YNNNLTGDLP+ V  +T LRHLHLGGNYF+G+IPP YG +P +EYLAVSGN 
Sbjct  143   VNLRVLDVYNNNLTGDLPLSVTNLTQLRHLHLGGNYFAGKIPPSYGSWPVIEYLAVSGNE  202

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L G IP EIGNLT L+ELYIGY+N F  G+PPE+GNLS+L+R D ANCGLTGE+P EIGK
Sbjct  203   LVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGNLSELVRLDGANCGLTGEIPPEIGK  262

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             L+ LDTLFLQVN  SG L  E+G L +LKS+DLSNN F+GEIP SF
Sbjct  263   LQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASF  308


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 83/247 (34%), Positives = 121/247 (49%), Gaps = 25/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  252   LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  311

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRF------------  700
              NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G              
Sbjct  312   KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGKLNLVDLSSNK  371

Query  701   ------PN------LEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
                   PN      LE L   GN L G IP  +G    L  + +G  N  +  IP  +  
Sbjct  372   LTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGQ-NFLNASIPKGLFG  430

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L +L + +  +  L+GELPV  G   NL  + L  N LSG L P IG    ++ L L  N
Sbjct  431   LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490

Query  1025  AFSGEIP  1045
              F G+IP
Sbjct  491   KFEGQIP  497


 Score = 98.6 bits (244),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 73/227 (32%), Positives = 115/227 (51%), Gaps = 2/227 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  179   FAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  238

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L+ L  LD  N  LTG++P E+ K+  L  L L  N FSG +  E G   +L+ + +S N
Sbjct  239   LSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNN  298

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               +G IP+    L  L  L + + N   G IP  +G+L +L          TG +P ++G
Sbjct  299   MFTGEIPASFAELKNLTLLNL-FRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLG  357

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             +   L+ + L  N L+G+L P +     L++L    N   G IP+S 
Sbjct  358   ENGKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSL  404


 Score = 95.5 bits (236),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 113/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L  L    N L G +P  +    +L  + +  N   ++ P  L  
Sbjct  371   KLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNASIPKGLFG  430

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N L+G+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  431   LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
                G IPSE+G L +L ++   + N FSG I PE+     L   D +   L+GE+P EI 
Sbjct  491   KFEGQIPSEVGKLQQLSKIDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEIT  549

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L SLD S N  SG +P
Sbjct  550   GMRILNYLNLSRNHLLGSIPGSISSMQSLTSLDFSYNNLSGLVP  593


 Score = 92.8 bits (229),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 109/204 (53%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   L  + +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  347  NFTGSIPQKLGENGKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGS-IPDSLG  405

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L   +P  ++ +  L  + L  NY SG +P   G   NL  +++S 
Sbjct  406  KCESLTRIRMGQNFLNASIPKGLFGLPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSN  465

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +P  IGN T +++L +   N F G IP E+G L QL + D ++   +G +  EI
Sbjct  466  NQLSGPLPPAIGNFTGVQKLLLDG-NKFEGQIPSEVGKLQQLSKIDFSHNLFSGRIAPEI  524

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  + L  N+LSG +  EI
Sbjct  525  SRCKLLTFVDLSRNELSGEIPNEI  548



>ref|XP_012079496.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Jatropha curcas]
 gb|KDP32143.1| hypothetical protein JCGZ_12604 [Jatropha curcas]
Length=1013

 Score =   325 bits (834),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 189/281 (67%), Positives = 227/281 (81%), Gaps = 2/281 (1%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCd-sllhvvsldlsglNLSGVL  391
             ++E  ALLS+KAA   D QS+L SWN S S C+W  VTCD S  HV SLDLS LNLSG+L
Sbjct  23    MSEYQALLSVKAAID-DPQSALVSWNSSNSLCSWSGVTCDPSGRHVTSLDLSSLNLSGIL  81

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  571
             S D+  L +L NL++AANQLSGP+PP++SAI  LR LNLSNN+F  TFP QL+QL NLQV
Sbjct  82    SSDIAHLRYLQNLTLAANQLSGPIPPQLSAIPGLRSLNLSNNVFNGTFPSQLSQLKNLQV  141

Query  572   LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  751
             LDLYNNN+T  LP+ V  M +LRHLHLGGN+FSG+IPPEYG++  LEYLA+SGN L G I
Sbjct  142   LDLYNNNMTDVLPLAVTDMPNLRHLHLGGNFFSGKIPPEYGKWEFLEYLAISGNELVGPI  201

Query  752   PSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLD  931
             P EIGNLT+L++LYIGY+N + GG+PPE+GNLS L+RFDAANC L+GE+P EIGKL+ LD
Sbjct  202   PPEIGNLTRLQQLYIGYYNSYEGGLPPEIGNLSDLVRFDAANCMLSGEIPKEIGKLQKLD  261

Query  932   TLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             TLFLQVN LSGSL  E+G LK+LKS+DLSNN  +GEIP SF
Sbjct  262   TLFLQVNGLSGSLTEELGNLKSLKSMDLSNNMLTGEIPSSF  302


 Score =   101 bits (252),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 78/223 (35%), Positives = 109/223 (49%), Gaps = 1/223 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG L+ ++G L  L ++ ++ N L+G +P   S +  L  LNL  N      P  +  L
Sbjct  270   LSGSLTEELGNLKSLKSMDLSNNMLTGEIPSSFSELKNLTLLNLFRNKLYGAIPEFIGDL  329

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L+VL L+ NN TG +P  + K  +L  L L  N  +G +PP       L+ L    N 
Sbjct  330   PKLEVLQLWENNFTGSIPQGLGKNGNLVLLDLSSNKLTGNLPPNMCLGNRLQTLITLSNF  389

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L G IP  +G    L  + +G  N  +G IP  +  L +L + +  +  LTGE PV    
Sbjct  390   LFGPIPESLGKCESLSRIRMGE-NFLNGSIPKGLFGLPKLSQVELQDNLLTGEFPVTDTI  448

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
               NL  + L  N LSGSL P IG    ++ L L  N FSG IP
Sbjct  449   AMNLGQISLSNNRLSGSLPPSIGNFSGVQKLLLDGNKFSGAIP  491


 Score = 95.9 bits (237),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 73/223 (33%), Positives = 111/223 (50%), Gaps = 1/223 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G L P++     L  L   +N L GP+P  +    +L  + +  N    + P  L  L
Sbjct  366   LTGNLPPNMCLGNRLQTLITLSNFLFGPIPESLGKCESLSRIRMGENFLNGSIPKGLFGL  425

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L  ++L +N LTG+ PV      +L  + L  N  SG +PP  G F  ++ L + GN 
Sbjct  426   PKLSQVELQDNLLTGEFPVTDTIAMNLGQISLSNNRLSGSLPPSIGNFSGVQKLLLDGNK  485

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
              SG IP +IG L +L ++     N FSG I PE+     L   D +   L+G +P EI  
Sbjct  486   FSGAIPPQIGRLQQLSKMDFSS-NKFSGPITPEISQCKLLTFVDLSRNELSGAIPTEITG  544

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             ++ L+ L L  N L GS+   I  +++L S+D S N  +G +P
Sbjct  545   MRILNYLNLSRNHLIGSIPSSIATMQSLTSVDFSYNNLTGLVP  587


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 111/204 (54%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   LV L +++N+L+G +PP +   + L+  + LSN +FG   P  L 
Sbjct  341  NFTGSIPQGLGKNGNLVLLDLSSNKLTGNLPPNMCLGNRLQTLITLSNFLFGP-IPESLG  399

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ +  L  + L  N  +G  P       NL  +++S 
Sbjct  400  KCESLSRIRMGENFLNGSIPKGLFGLPKLSQVELQDNLLTGEFPVTDTIAMNLGQISLSN  459

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +P  IGN + +++L +   N FSG IPP++G L QL + D ++   +G +  EI
Sbjct  460  NRLSGSLPPSIGNFSGVQKLLLDG-NKFSGAIPPQIGRLQQLSKMDFSSNKFSGPITPEI  518

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  + L  N+LSG++  EI
Sbjct  519  SQCKLLTFVDLSRNELSGAIPTEI  542


 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/196 (33%), Positives = 96/196 (49%), Gaps = 1/196 (1%)
 Frame = +2

Query  383  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  562
            G L P++G L  LV    A   LSG +P EI  +  L  L L  N    +   +L  L +
Sbjct  224  GGLPPEIGNLSDLVRFDAANCMLSGEIPKEIGKLQKLDTLFLQVNGLSGSLTEELGNLKS  283

Query  563  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  742
            L+ +DL NN LTG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +
Sbjct  284  LKSMDLSNNMLTGEIPSSFSELKNLTLLNLFRNKLYGAIPEFIGDLPKLEVLQLWENNFT  343

Query  743  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLK  922
            G IP  +G    L  L +   N  +G +PP M   ++L      +  L G +P  +GK +
Sbjct  344  GSIPQGLGKNGNLVLLDLSS-NKLTGNLPPNMCLGNRLQTLITLSNFLFGPIPESLGKCE  402

Query  923  NLDTLFLQVNDLSGSL  970
            +L  + +  N L+GS+
Sbjct  403  SLSRIRMGENFLNGSI  418



>ref|XP_010463501.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score =   325 bits (832),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 180/286 (63%), Positives = 216/286 (76%), Gaps = 6/286 (2%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNL  379
             ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD     V+      LNL
Sbjct  23    ISEFRALLSLKSSLTGAGTDDKNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  380   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-L  556
             SG LSPDV  L  L NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +L+  L
Sbjct  83    SGTLSPDVSHLRLLQNLSLAENQISGPIPPEISNLSGLRHLNLSNNVFNGSFPDELSSGL  142

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL+VLD+YNNNLTGDLP+ V  +T LRHLHLGGNYF+G+IPP YG +P +EYLAVSGN 
Sbjct  143   VNLRVLDVYNNNLTGDLPLSVTNLTQLRHLHLGGNYFAGKIPPLYGSWPVIEYLAVSGNE  202

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L G IP EIGNLT L+ELYIGY+N F  G+PPE+GNLS+L+R D ANCGLTGE+P EIGK
Sbjct  203   LVGKIPPEIGNLTTLRELYIGYYNAFENGLPPEIGNLSELVRLDGANCGLTGEIPPEIGK  262

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             L+ LDTLFLQVN  SG L  E+G L +LKS+DLSNN F+GEIP SF
Sbjct  263   LQKLDTLFLQVNVFSGPLTWELGSLSSLKSMDLSNNMFTGEIPTSF  308


 Score =   107 bits (266),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 81/246 (33%), Positives = 125/246 (51%), Gaps = 23/246 (9%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G + P++G+L  L  L +  N  SGP+  E+ ++S+L+ ++LSNN+F    P   A+L
Sbjct  252   LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGSLSSLKSMDLSNNMFTGEIPTSFAEL  311

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G    L  + +S N 
Sbjct  312   KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPEKLGENGKLNLVDLSSNK  371

Query  737   LSGVIPSEIGNLTKLKELY-IGYF----------------------NGFSGGIPPEMGNL  847
             L+G +P  + +  KL+ L  +G F                      N  +G IP  +  L
Sbjct  372   LTGTLPPNMCSGNKLETLITLGNFVFGSIPESLGKCESLTRIRMGQNFLNGSIPKGLFGL  431

Query  848   SQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnA  1027
              +L + +  +  L+GELPV  G   NL  + L  N LSG L P IG    ++ L L  N 
Sbjct  432   PKLTQVEFQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNK  491

Query  1028  FSGEIP  1045
             F G+IP
Sbjct  492   FEGQIP  497


 Score = 98.6 bits (244),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 74/227 (33%), Positives = 116/227 (51%), Gaps = 2/227 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F +  P ++  
Sbjct  179   FAGKIPPLYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFENGLPPEIGN  238

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L+ L  LD  N  LTG++P E+ K+  L  L L  N FSG +  E G   +L+ + +S N
Sbjct  239   LSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGSLSSLKSMDLSNN  298

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               +G IP+    L  L  L + + N   G IP  +G+L +L          TG +P ++G
Sbjct  299   MFTGEIPTSFAELKNLTLLNL-FRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPEKLG  357

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             +   L+ + L  N L+G+L P +     L++L    N   G IPES 
Sbjct  358   ENGKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFVFGSIPESL  404


 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 109/204 (53%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   L  + +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  347  NFTGSIPEKLGENGKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFVFGS-IPESLG  405

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ +  L  +    NY SG +P   G   NL  +++S 
Sbjct  406  KCESLTRIRMGQNFLNGSIPKGLFGLPKLTQVEFQDNYLSGELPVAGGVSVNLGQISLSN  465

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +P  IGN T +++L +   N F G IP E+G L QL + D ++   +G +  EI
Sbjct  466  NQLSGPLPPAIGNFTGVQKLLLDG-NKFEGQIPSEVGKLQQLSKIDFSHNLFSGRIAPEI  524

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  + L  N+LSG +  EI
Sbjct  525  SRCKLLTFVDLSRNELSGEIPNEI  548


 Score = 92.4 bits (228),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 73/223 (33%), Positives = 111/223 (50%), Gaps = 1/223 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G L P++     L  L    N + G +P  +    +L  + +  N    + P  L  L
Sbjct  372   LTGTLPPNMCSGNKLETLITLGNFVFGSIPESLGKCESLTRIRMGQNFLNGSIPKGLFGL  431

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L  ++  +N L+G+LPV      +L  + L  N  SG +PP  G F  ++ L + GN 
Sbjct  432   PKLTQVEFQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNK  491

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
               G IPSE+G L +L ++   + N FSG I PE+     L   D +   L+GE+P EI  
Sbjct  492   FEGQIPSEVGKLQQLSKIDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITG  550

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             ++ L+ L L  N L GS+   I  +++L SLD S N  SG +P
Sbjct  551   MRILNYLNLSRNHLLGSIPGSISSMQSLTSLDFSYNNLSGLVP  593



>ref|XP_006279943.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
 gb|EOA12841.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
Length=1004

 Score =   324 bits (830),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 180/286 (63%), Positives = 215/286 (75%), Gaps = 6/286 (2%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNL  379
             ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD     V+      LNL
Sbjct  23    ISEFRALLSLKSSLTGAGSDDKNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  380   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-L  556
             SG LSPDV  L  L NLS+A NQ+SGP+P EIS +S LR LNLSNN+F  +FP +L+  L
Sbjct  83    SGTLSPDVSHLRLLQNLSLAENQISGPIPTEISNLSGLRHLNLSNNVFNGSFPDELSYGL  142

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL+VLD+YNNNLTGDLPV V  +T LRHLHLGGNYF+G+IPP YG +P +EYLAVSGN 
Sbjct  143   VNLRVLDVYNNNLTGDLPVSVTNLTQLRHLHLGGNYFAGKIPPSYGSWPVIEYLAVSGNE  202

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L G IP EIGNLT L+ELYIGY+N F  G+PPE+GNLS+L+R D ANCGLTGE+P EIGK
Sbjct  203   LVGKIPPEIGNLTTLRELYIGYYNAFENGLPPEIGNLSELVRLDGANCGLTGEIPPEIGK  262

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             L+ LDTLFLQVN  SG L  E+G L +LKS+DLSNN F+GEIP SF
Sbjct  263   LQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASF  308


 Score =   104 bits (260),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 83/247 (34%), Positives = 121/247 (49%), Gaps = 25/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  252   LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  311

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRF------------  700
              NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G              
Sbjct  312   KNLTLLNLFRNKLHGEIPEFIGVLPELEVLQLWENNFTGSIPQKLGENGKLNLVDLSSNK  371

Query  701   ------PN------LEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
                   PN      LE L   GN L G IP  +G    L  + +G  N  +G IP  +  
Sbjct  372   LTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGE-NFLNGSIPKGLFG  430

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L +L + +  +  L+G+LPV  G   NL  + L  N LSG L P IG    ++ L L  N
Sbjct  431   LPKLTQVELQDNYLSGQLPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490

Query  1025  AFSGEIP  1045
              F G IP
Sbjct  491   KFEGPIP  497


 Score = 98.2 bits (243),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 77/249 (31%), Positives = 122/249 (49%), Gaps = 26/249 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F +  P ++  
Sbjct  179   FAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFENGLPPEIGN  238

Query  554   LANLQVLDLYNNNLTGDLPVEVYK------------------------MTSLRHLHLGGN  661
             L+ L  LD  N  LTG++P E+ K                        ++SL+ + L  N
Sbjct  239   LSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNN  298

Query  662   YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
              F+G IP  +    NL  L +  N L G IP  IG L +L+ L + + N F+G IP ++G
Sbjct  299   MFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGVLPELEVLQL-WENNFTGSIPQKLG  357

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
                +L   D ++  LTG LP  +     L+TL    N L GS+   +G  ++L  + +  
Sbjct  358   ENGKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGE  417

Query  1022  nAFSGEIPE  1048
             N  +G IP+
Sbjct  418   NFLNGSIPK  426


 Score = 95.1 bits (235),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 111/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  371   KLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFG  430

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N L+G LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  431   LPKLTQVELQDNYLSGQLPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
                G IPSE+G L +L ++   + N FSG I PE+     L   D +   L+GE+P EI 
Sbjct  491   KFEGPIPSEVGKLQQLSKIDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEIT  549

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              +K L+ L L  N L GS+   I  +++L SLD S N  SG +P
Sbjct  550   GMKILNYLNLSRNHLVGSIPGSISSMQSLTSLDFSYNNLSGLVP  593


 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 111/204 (54%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   L  + +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  347  NFTGSIPQKLGENGKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGS-IPDSLG  405

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ +  L  + L  NY SG++P   G   NL  +++S 
Sbjct  406  KCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGQLPVAGGVSVNLGQISLSN  465

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +P  IGN T +++L +   N F G IP E+G L QL + D ++   +G +  EI
Sbjct  466  NQLSGPLPPAIGNFTGVQKLLLDG-NKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEI  524

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  + L  N+LSG +  EI
Sbjct  525  SRCKLLTFVDLSRNELSGEIPNEI  548



>ref|XP_009150662.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brassica rapa]
Length=997

 Score =   323 bits (828),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 177/283 (63%), Positives = 214/283 (76%), Gaps = 3/283 (1%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSS-LTSWNISTSHCTWRRVTCdsllhvvsldlsglNLS-GV  388
             ++E  ALLS+K++ T D+ +S L SW  +TS CTW  VTCD     V+          G 
Sbjct  23    ISEFRALLSLKSSLTGDAPNSPLASWKPTTSFCTWTGVTCDVSRRHVTSLDLSSLNLSGT  82

Query  389   LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANL  565
             LSPDV  LP L NLS+A NQ+SGP+PPEIS +S LR LNLSNNIF  +FP ++ A LANL
Sbjct  83    LSPDVSHLPLLQNLSLADNQISGPIPPEISNLSGLRHLNLSNNIFNGSFPGEISAGLANL  142

Query  566   QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  745
             +VLD+YNNN+TGDLP+ V  +T LRHLHLGGNYF+G IPP YG +P +EYLAVSGN L+G
Sbjct  143   RVLDVYNNNMTGDLPLSVTNLTQLRHLHLGGNYFAGEIPPSYGTWPEIEYLAVSGNELTG  202

Query  746   VIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKN  925
              IP EIGNLT L+ELYIGYFN F  G+PPE+GNLS+L+RFDAANC L GE+P EIG+L+ 
Sbjct  203   KIPPEIGNLTTLRELYIGYFNAFEDGLPPEIGNLSELVRFDAANCALNGEIPPEIGRLQK  262

Query  926   LDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             LDTLFLQVN  SG L  E+G L +LKS+DLSNN F+GEIP SF
Sbjct  263   LDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNNMFTGEIPASF  305


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 86/247 (35%), Positives = 121/247 (49%), Gaps = 25/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   + L
Sbjct  249   LNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNNMFTGEIPASFSDL  308

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP---EYGRF---------  700
              NL +L+L+ N L G++P  + ++  L  L L  N F+G IP    E GR          
Sbjct  309   KNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIPEKLGENGRLHLVDLSSNK  368

Query  701   ------PN------LEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
                   PN      LE L   GN L G IP  +G    L  + +G  N  +G IP  +  
Sbjct  369   LTGTLPPNMCAGNKLETLITLGNFLFGSIPESLGKCESLTRIRMGE-NFLNGSIPKGLFG  427

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L +L + +  +  LTGELPV      NL  L L  N LSG L P IG    ++ L L  N
Sbjct  428   LPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSNNQLSGQLPPAIGNFTGVQKLLLDGN  487

Query  1025  AFSGEIP  1045
              F G IP
Sbjct  488   KFEGPIP  494


 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 114/224 (51%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  368   KLTGTLPPNMCAGNKLETLITLGNFLFGSIPESLGKCESLTRIRMGENFLNGSIPKGLFG  427

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N LTG+LPV      +L  L L  N  SG++PP  G F  ++ L + GN
Sbjct  428   LPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSNNQLSGQLPPAIGNFTGVQKLLLDGN  487

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
                G IPSE+G L +L ++   + N FSGGI PE+     L   D +   L+GE+P EI 
Sbjct  488   KFEGPIPSEVGRLQQLSKIDFSH-NLFSGGIAPEISRCKLLTFVDLSRNELSGEIPKEIT  546

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              +K L+ L L  N L GS+   I  +++L SLD S N  SG +P
Sbjct  547   GMKILNYLNLSRNHLIGSIPGSISSMQSLTSLDFSYNNLSGLVP  590


 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 113/227 (50%), Gaps = 2/227 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              +G + P  G  P +  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  176   FAGEIPPSYGTWPEIEYLAVSGNELTGKIPPEIGNLTTLRELYIGYFNAFEDGLPPEIGN  235

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L+ L   D  N  L G++P E+ ++  L  L L  N FSG +  E G+  +L+ + +S N
Sbjct  236   LSELVRFDAANCALNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNN  295

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               +G IP+   +L  L  L + + N   G IP  +G L  L          TG +P ++G
Sbjct  296   MFTGEIPASFSDLKNLTLLNL-FRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIPEKLG  354

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             +   L  + L  N L+G+L P +     L++L    N   G IPES 
Sbjct  355   ENGRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNFLFGSIPESL  401


 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 109/204 (53%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   L  + +++N+L+G +PP + A + L   + L N +FGS  P  L 
Sbjct  344  NFTGSIPEKLGENGRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNFLFGS-IPESLG  402

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P       NL  L++S 
Sbjct  403  KCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSN  462

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +P  IGN T +++L +   N F G IP E+G L QL + D ++   +G +  EI
Sbjct  463  NQLSGQLPPAIGNFTGVQKLLLDG-NKFEGPIPSEVGRLQQLSKIDFSHNLFSGGIAPEI  521

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  + L  N+LSG +  EI
Sbjct  522  SRCKLLTFVDLSRNELSGEIPKEI  545



>ref|XP_010503631.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=999

 Score =   323 bits (827),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 179/284 (63%), Positives = 216/284 (76%), Gaps = 4/284 (1%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSL-TSWNISTS-HCTWRRVTCdsllhvvsldlsg-lNLSG  385
             +TE  ALLS+K++ T D  S L +SWN+ST+  C+W  VTCD     V+      LNLSG
Sbjct  22    ITELNALLSLKSSLTGDDHSPLLSSWNLSTTTFCSWTGVTCDVSRRHVTSLDLSGLNLSG  81

Query  386   VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LAN  562
              LS DV  LP L NLS+AANQ+SGP+PPE S +  LR LNLSNN+F  ++P +L+  L N
Sbjct  82    TLSSDVSHLPLLQNLSLAANQISGPIPPEFSNLYELRLLNLSNNVFNGSYPDELSSGLVN  141

Query  563   LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  742
             L+VLDLYNNNLTG LP+ +  +T LRHLHLGGNYFSG+IP  YG +P LEYLAVSGN L 
Sbjct  142   LRVLDLYNNNLTGHLPLSITNLTQLRHLHLGGNYFSGKIPATYGTWPVLEYLAVSGNELI  201

Query  743   GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLK  922
             G IP EIGNLT L+ELYIGY+N F  G+PPE+GNLS+L+RFDAANCGLTG +P EIGKL+
Sbjct  202   GKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGNLSELLRFDAANCGLTGAIPPEIGKLQ  261

Query  923   NLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             NLDTLFLQVN  SG L  E+G + +LKS+DLSNN F+GEIP SF
Sbjct  262   NLDTLFLQVNAFSGPLTSELGLISSLKSMDLSNNMFTGEIPTSF  305


 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 81/247 (33%), Positives = 121/247 (49%), Gaps = 25/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G + P++G+L  L  L +  N  SGP+  E+  IS+L+ ++LSNN+F    P   ++L
Sbjct  249   LTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLKSMDLSNNMFTGEIPTSFSEL  308

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L  L +S N 
Sbjct  309   KNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGGIPQKLGDNGRLVILDLSSNK  368

Query  737   LSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+G                         IP  +G    L  + +G  N  +G IP  +  
Sbjct  369   LTGTLPPNMCAGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGQ-NFLNGSIPKGLFG  427

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L +L + +  +  LTGELPV  G   +L  + L  N LSGSL   IG    ++ L L  N
Sbjct  428   LPKLSQVELQDNYLTGELPVSGGVSSDLGQVSLSNNQLSGSLPAAIGNFSGVQKLLLDGN  487

Query  1025  AFSGEIP  1045
              F+G IP
Sbjct  488   KFAGPIP  494


 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 67/204 (33%), Positives = 113/204 (55%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTL-RFLNLSNNIFGSTFPHQLA  550
            N +G +   +G    LV L +++N+L+G +PP + A + L   + L N +FGS  P  L 
Sbjct  344  NFTGGIPQKLGDNGRLVILDLSSNKLTGTLPPNMCAGNRLMTLITLGNFLFGS-IPDSLG  402

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P   G   +L  +++S 
Sbjct  403  KCESLTRIRMGQNFLNGSIPKGLFGLPKLSQVELQDNYLTGELPVSGGVSSDLGQVSLSN  462

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +P+ IGN + +++L +   N F+G IPPE+G L QL + D ++   +G +  EI
Sbjct  463  NQLSGSLPAAIGNFSGVQKLLLDG-NKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEI  521

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  + L  N+LSG +  EI
Sbjct  522  SRCKLLTFVDLSRNELSGDIPNEI  545


 Score = 98.6 bits (244),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 78/249 (31%), Positives = 120/249 (48%), Gaps = 26/249 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              SG +    G  P L  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  176   FSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  235

Query  554   LANLQVLDLYNNNLTGDLPVEVYKM------------------------TSLRHLHLGGN  661
             L+ L   D  N  LTG +P E+ K+                        +SL+ + L  N
Sbjct  236   LSELLRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLKSMDLSNN  295

Query  662   YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
              F+G IP  +    NL  L +  N L G IP  IG L +L+ L + + N F+GGIP ++G
Sbjct  296   MFTGEIPTSFSELKNLTLLNLFRNKLYGAIPEFIGELPELEVLQL-WENNFTGGIPQKLG  354

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
             +  +L+  D ++  LTG LP  +     L TL    N L GS+   +G  ++L  + +  
Sbjct  355   DNGRLVILDLSSNKLTGTLPPNMCAGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGQ  414

Query  1022  nAFSGEIPE  1048
             N  +G IP+
Sbjct  415   NFLNGSIPK  423


 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 74/225 (33%), Positives = 113/225 (50%), Gaps = 1/225 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G L P++     L+ L    N L G +P  +    +L  + +  N    + P  L  L
Sbjct  369   LTGTLPPNMCAGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIPKGLFGL  428

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L  ++L +N LTG+LPV     + L  + L  N  SG +P   G F  ++ L + GN 
Sbjct  429   PKLSQVELQDNYLTGELPVSGGVSSDLGQVSLSNNQLSGSLPAAIGNFSGVQKLLLDGNK  488

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
              +G IP EIG L +L +L   + N FSG I PE+     L   D +   L+G++P EI  
Sbjct  489   FAGPIPPEIGRLQQLSKLDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITG  547

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
             ++ L+ L L  N L GS+   I  +++L S+D S N  SG +P +
Sbjct  548   MRILNYLNLSRNHLVGSIPVSIASMQSLTSVDFSYNNLSGLVPST  592



>ref|NP_001235065.1| receptor-like protein kinase 1 precursor [Glycine max]
 gb|AAF91322.1|AF244888_1 receptor-like protein kinase 1 [Glycine max]
Length=1008

 Score =   322 bits (825),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 181/281 (64%), Positives = 226/281 (80%), Gaps = 1/281 (0%)
 Frame = +2

Query  215   VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  391
             ++E  ALLS KA+  T D   +L+SWN ST  C+W  +TCDS  HV SL+L+ L+LSG L
Sbjct  19    ISEYRALLSFKASSLTDDPTHALSSWNSSTPFCSWFGLTCDSRRHVTSLNLTSLSLSGTL  78

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  571
             S D+  LPFL +LS+A N+ SGP+P   SA+S LRFLNLSNN+F +TFP QL +LANL+V
Sbjct  79    SDDLSHLPFLSHLSLADNKFSGPIPASFSALSALRFLNLSNNVFNATFPSQLNRLANLEV  138

Query  572   LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  751
             LDLYNNN+TG+LP+ V  M  LRHLHLGGN+FSG+IPPEYG + +L+YLA+SGN L+G I
Sbjct  139   LDLYNNNMTGELPLSVAAMPLLRHLHLGGNFFSGQIPPEYGTWQHLQYLALSGNELAGTI  198

Query  752   PSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLD  931
               E+GNL+ L+ELYIGY+N +SGGIPPE+GNLS L+R DAA CGL+GE+P E+GKL+NLD
Sbjct  199   APELGNLSSLRELYIGYYNTYSGGIPPEIGNLSNLVRLDAAYCGLSGEIPAELGKLQNLD  258

Query  932   TLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             TLFLQVN LSGSL PE+G LK+LKS+DLSNN  SGE+P SF
Sbjct  259   TLFLQVNALSGSLTPELGSLKSLKSMDLSNNMLSGEVPASF  299


 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 111/223 (50%), Gaps = 1/223 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG L+P++G L  L ++ ++ N LSG VP   + +  L  LNL  N      P  + +L
Sbjct  267   LSGSLTPELGSLKSLKSMDLSNNMLSGEVPASFAELKNLTLLNLFRNKLHGAIPEFVGEL  326

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L+VL L+ NN TG +P  +     L  + L  N  +G +PP       L+ L   GN 
Sbjct  327   PALEVLQLWENNFTGSIPQNLGNNGRLTLVDLSSNKITGTLPPNMCYGNRLQTLITLGNY  386

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L G IP  +G    L  + +G  N  +G IP  +  L +L + +  +  LTG+ P +   
Sbjct  387   LFGPIPDSLGKCKSLNRIRMGE-NFLNGSIPKGLFGLPKLTQVELQDNLLTGQFPEDGSI  445

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
               +L  + L  N LSGSL   IG   +++ L L+ N F+G IP
Sbjct  446   ATDLGQISLSNNQLSGSLPSTIGNFTSMQKLLLNGNEFTGRIP  488


 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 113/223 (51%), Gaps = 1/223 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             ++G L P++     L  L    N L GP+P  +    +L  + +  N    + P  L  L
Sbjct  363   ITGTLPPNMCYGNRLQTLITLGNYLFGPIPDSLGKCKSLNRIRMGENFLNGSIPKGLFGL  422

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L  ++L +N LTG  P +    T L  + L  N  SG +P   G F +++ L ++GN 
Sbjct  423   PKLTQVELQDNLLTGQFPEDGSIATDLGQISLSNNQLSGSLPSTIGNFTSMQKLLLNGNE  482

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
              +G IP +IG L +L ++   + N FSG I PE+     L   D +   L+GE+P +I  
Sbjct  483   FTGRIPPQIGMLQQLSKIDFSH-NKFSGPIAPEISKCKLLTFIDLSGNELSGEIPNKITS  541

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             ++ L+ L L  N L GS+   I  +++L S+D S N FSG +P
Sbjct  542   MRILNYLNLSRNHLDGSIPGNIASMQSLTSVDFSYNNFSGLVP  584


 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 72/226 (32%), Positives = 111/226 (49%), Gaps = 25/226 (11%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G +   VG+LP L  L +  N  +G +P  +     L  ++LS+N    T P  +   
Sbjct  315  LHGAIPEFVGELPALEVLQLWENNFTGSIPQNLGNNGRLTLVDLSSNKITGTLPPNMCYG  374

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP------PEY---------  691
              LQ L    N L G +P  + K  SL  + +G N+ +G IP      P+          
Sbjct  375  NRLQTLITLGNYLFGPIPDSLGKCKSLNRIRMGENFLNGSIPKGLFGLPKLTQVELQDNL  434

Query  692  --GRFP-------NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
              G+FP       +L  +++S N LSG +PS IGN T +++L +   N F+G IPP++G 
Sbjct  435  LTGQFPEDGSIATDLGQISLSNNQLSGSLPSTIGNFTSMQKLLLNG-NEFTGRIPPQIGM  493

Query  845  LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEI  982
            L QL + D ++   +G +  EI K K L  + L  N+LSG +  +I
Sbjct  494  LQQLSKIDFSHNKFSGPIAPEISKCKLLTFIDLSGNELSGEIPNKI  539


 Score = 89.7 bits (221),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 100/197 (51%), Gaps = 1/197 (1%)
 Frame = +2

Query  380  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  559
            SG + P++G L  LV L  A   LSG +P E+  +  L  L L  N    +   +L  L 
Sbjct  220  SGGIPPEIGNLSNLVRLDAAYCGLSGEIPAELGKLQNLDTLFLQVNALSGSLTPELGSLK  279

Query  560  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  739
            +L+ +DL NN L+G++P    ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  280  SLKSMDLSNNMLSGEVPASFAELKNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNF  339

Query  740  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKL  919
            +G IP  +GN  +L  + +   N  +G +PP M   ++L         L G +P  +GK 
Sbjct  340  TGSIPQNLGNNGRLTLVDLSS-NKITGTLPPNMCYGNRLQTLITLGNYLFGPIPDSLGKC  398

Query  920  KNLDTLFLQVNDLSGSL  970
            K+L+ + +  N L+GS+
Sbjct  399  KSLNRIRMGENFLNGSI  415



>gb|KFK28239.1| hypothetical protein AALP_AA8G490400 [Arabis alpina]
Length=1002

 Score =   322 bits (825),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 178/292 (61%), Positives = 217/292 (74%), Gaps = 8/292 (3%)
 Frame = +2

Query  197   AGKPLGVTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldl  364
              GKP  ++E  ALLS+K++ T     D  S L+SW ++TS CTW  VTCD     V+   
Sbjct  19    TGKP--ISEPRALLSLKSSLTVTGDDDKNSPLSSWKLTTSFCTWTGVTCDVSRRHVTSLD  76

Query  365   sg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  541
                LNL G LSP++  L  L NLS+A NQ+SG +PP+IS +S LR+LNLSNN+F  TFP 
Sbjct  77    LSGLNLPGTLSPEISHLRLLQNLSLAENQISGQIPPQISNLSGLRYLNLSNNVFNGTFPD  136

Query  542   QLAQ-LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL  718
             +++  L NL++LD+YNNNLTGDLP+ V  +T LRHLHLGGNYFSG IP  YG +P +EYL
Sbjct  137   EISSGLVNLRILDVYNNNLTGDLPISVTNLTQLRHLHLGGNYFSGSIPSSYGSWPVIEYL  196

Query  719   AVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGEL  898
             AVSGN L G IP EIGNLT L+ELYIGY+N F  G+PPE+GNLS+L+RFD ANCGLTGE+
Sbjct  197   AVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGNLSELVRFDGANCGLTGEI  256

Query  899   PVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             P EIGKLK LDTLFLQVN  SG L  E+G L +LKS+DLSNN F+GEIP SF
Sbjct  257   PSEIGKLKKLDTLFLQVNVFSGPLTWELGSLSSLKSMDLSNNMFTGEIPTSF  308


 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 84/247 (34%), Positives = 121/247 (49%), Gaps = 25/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G +  ++G+L  L  L +  N  SGP+  E+ ++S+L+ ++LSNN+F    P   A+L
Sbjct  252   LTGEIPSEIGKLKKLDTLFLQVNVFSGPLTWELGSLSSLKSMDLSNNMFTGEIPTSFAEL  311

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGR-------------  697
              NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G              
Sbjct  312   KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGKLHLVDLSSNK  371

Query  698   ----FP-------NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
                  P       NLE L   GN L G IP  +G    L  + +G  N  +G IP  +  
Sbjct  372   LTGTLPPNMCSGNNLETLITLGNFLFGSIPDSLGKCESLTRIRMGE-NFLNGSIPKGLFG  430

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L +L + +  +  LTGELPV  G   NL  + L  N LSG L P IG    ++ L L  N
Sbjct  431   LPKLTQVELQDNYLTGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490

Query  1025  AFSGEIP  1045
              F G IP
Sbjct  491   KFEGPIP  497


 Score = 99.0 bits (245),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 77/249 (31%), Positives = 121/249 (49%), Gaps = 26/249 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              SG +    G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  179   FSGSIPSSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  238

Query  554   LANLQVLDLYNNNLTGDLPVEVYK------------------------MTSLRHLHLGGN  661
             L+ L   D  N  LTG++P E+ K                        ++SL+ + L  N
Sbjct  239   LSELVRFDGANCGLTGEIPSEIGKLKKLDTLFLQVNVFSGPLTWELGSLSSLKSMDLSNN  298

Query  662   YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
              F+G IP  +    NL  L +  N L G IP  IG+L +L+ L + + N F+G IP ++G
Sbjct  299   MFTGEIPTSFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQL-WENNFTGSIPQKLG  357

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
                +L   D ++  LTG LP  +    NL+TL    N L GS+   +G  ++L  + +  
Sbjct  358   ENGKLHLVDLSSNKLTGTLPPNMCSGNNLETLITLGNFLFGSIPDSLGKCESLTRIRMGE  417

Query  1022  nAFSGEIPE  1048
             N  +G IP+
Sbjct  418   NFLNGSIPK  426


 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 113/223 (51%), Gaps = 1/223 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  L
Sbjct  372   LTGTLPPNMCSGNNLETLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFGL  431

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L  ++L +N LTG+LPV      +L  + L  N  SG +PP  G F  ++ L + GN 
Sbjct  432   PKLTQVELQDNYLTGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNK  491

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
               G IPSE+G L +L ++   + N FSG I PE+ +   L   D +   L+G++P EI  
Sbjct  492   FEGPIPSEVGKLQQLSKIDFSH-NLFSGRIAPEISHCKLLTFVDLSRNELSGDIPNEITG  550

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             ++ L+ L L  N L G++   I  +++L SLD S N  SG +P
Sbjct  551   MRILNYLNLSRNHLVGAIPSSISSMQSLTSLDFSYNNLSGLVP  593


 Score = 92.4 bits (228),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 109/204 (53%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   L  + +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  347  NFTGSIPQKLGENGKLHLVDLSSNKLTGTLPPNMCSGNNLETLITLGNFLFGS-IPDSLG  405

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P   G   NL  +++S 
Sbjct  406  KCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGELPVAGGVSVNLGQISLSN  465

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +P  IGN T +++L +   N F G IP E+G L QL + D ++   +G +  EI
Sbjct  466  NQLSGPLPPAIGNFTGVQKLLLDG-NKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEI  524

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
               K L  + L  N+LSG +  EI
Sbjct  525  SHCKLLTFVDLSRNELSGDIPNEI  548



>ref|XP_002531999.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF30398.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=1021

 Score =   319 bits (818),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 187/283 (66%), Positives = 227/283 (80%), Gaps = 4/283 (1%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCd-sllhvvsldlsglNLSG  385
             ++E  ALLS+K+A   D Q +L SWN +  +  CTW  VTCD +  H+ SLDLS LNLSG
Sbjct  25    ISEYQALLSLKSAID-DPQGALASWNSTNKNNLCTWSFVTCDYNNRHITSLDLSSLNLSG  83

Query  386   VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  565
              LSPD+  L +L NL++AANQ+SGP+P ++SAIS LR LNLSNN+F  +FP QL+QL NL
Sbjct  84    TLSPDIAHLRYLQNLTLAANQISGPIPIQLSAISGLRCLNLSNNVFNGSFPTQLSQLKNL  143

Query  566   QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  745
             QVLDLYNNN+TGDLP+ V +M +LRHLHLGGN+FSG IP EYG++  LEYLAVSGN L G
Sbjct  144   QVLDLYNNNMTGDLPLAVTEMPNLRHLHLGGNFFSGAIPREYGKWEFLEYLAVSGNELEG  203

Query  746   VIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKN  925
              IP EIGNLTKL++LYIGY+N + GG+PPE+GNLS L+RFDAANC L+GE+P EIGKL+ 
Sbjct  204   PIPPEIGNLTKLQQLYIGYYNTYEGGLPPEIGNLSDLVRFDAANCMLSGEIPKEIGKLQK  263

Query  926   LDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             LDTLFLQVN LSGSL  E+G LK+LKS+DLSNN  SGEIP SF
Sbjct  264   LDTLFLQVNGLSGSLIEELGNLKSLKSMDLSNNMLSGEIPTSF  306


 Score =   102 bits (253),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 118/227 (52%), Gaps = 2/227 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              SG +  + G+  FL  L+++ N+L GP+PPEI  ++ L+ L +   N +    P ++  
Sbjct  177   FSGAIPREYGKWEFLEYLAVSGNELEGPIPPEIGNLTKLQQLYIGYYNTYEGGLPPEIGN  236

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L++L   D  N  L+G++P E+ K+  L  L L  N  SG +  E G   +L+ + +S N
Sbjct  237   LSDLVRFDAANCMLSGEIPKEIGKLQKLDTLFLQVNGLSGSLIEELGNLKSLKSMDLSNN  296

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              LSG IP+    L+ L  L + + N   G IP  +G+L QL          TG +P  +G
Sbjct  297   MLSGEIPTSFAQLSNLTLLNL-FRNKLHGAIPEFIGDLPQLEVLQLWENNFTGSIPQGLG  355

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             K  NL  + L  N L+G+L P++     L++L   +N   G IPES 
Sbjct  356   KNGNLVLVDLSSNKLTGNLPPDMCSGDRLQTLITLSNFLFGPIPESL  402


 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 115/224 (51%), Gaps = 2/224 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G L PD+     L  L   +N L GP+P  +    +L  + +  N    + P  L  L
Sbjct  370   LTGNLPPDMCSGDRLQTLITLSNFLFGPIPESLGKCQSLSRIRMGENFLNGSLPKGLFGL  429

Query  557   ANLQVLDLYNNNLTGDLPVEVYKM-TSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
               L  ++L +N LTG+ PV   K+  +L  + L  N+ +G +P   G+F  ++ L + GN
Sbjct  430   PKLTQVELQDNLLTGEFPVTDDKIAVNLGQISLSNNHLTGSLPSSIGKFSGVQKLLLDGN  489

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP EIG L +L ++   + N FSG I PE+     L   D +   L+G +P EI 
Sbjct  490   KFSGPIPPEIGKLQQLSKVDFSH-NKFSGPIAPEISQCKLLTFVDLSRNELSGAIPTEIT  548

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L S+D S N  +G +P
Sbjct  549   GMRILNYLNLSRNHLVGSIPASIATMQSLTSVDFSYNNLTGLVP  592


 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 79/248 (32%), Positives = 119/248 (48%), Gaps = 26/248 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P   AQL
Sbjct  250   LSGEIPKEIGKLQKLDTLFLQVNGLSGSLIEELGNLKSLKSMDLSNNMLSGEIPTSFAQL  309

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             +NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G+  NL  + +S N 
Sbjct  310   SNLTLLNLFRNKLHGAIPEFIGDLPQLEVLQLWENNFTGSIPQGLGKNGNLVLVDLSSNK  369

Query  737   LS------------------------GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+                        G IP  +G    L  + +G  N  +G +P  +  
Sbjct  370   LTGNLPPDMCSGDRLQTLITLSNFLFGPIPESLGKCQSLSRIRMGE-NFLNGSLPKGLFG  428

Query  845   LSQLIRFDAANCGLTGELPVEIGKLK-NLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
             L +L + +  +  LTGE PV   K+  NL  + L  N L+GSL   IG    ++ L L  
Sbjct  429   LPKLTQVELQDNLLTGEFPVTDDKIAVNLGQISLSNNHLTGSLPSSIGKFSGVQKLLLDG  488

Query  1022  nAFSGEIP  1045
             N FSG IP
Sbjct  489   NKFSGPIP  496


 Score = 93.6 bits (231),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 113/205 (55%), Gaps = 4/205 (2%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   LV + +++N+L+G +PP++ +   L+  + LSN +FG   P  L 
Sbjct  345  NFTGSIPQGLGKNGNLVLVDLSSNKLTGNLPPDMCSGDRLQTLITLSNFLFGP-IPESLG  403

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFP-NLEYLAVS  727
            +  +L  + +  N L G LP  ++ +  L  + L  N  +G  P    +   NL  +++S
Sbjct  404  KCQSLSRIRMGENFLNGSLPKGLFGLPKLTQVELQDNLLTGEFPVTDDKIAVNLGQISLS  463

Query  728  GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
             N L+G +PS IG  + +++L +   N FSG IPPE+G L QL + D ++   +G +  E
Sbjct  464  NNHLTGSLPSSIGKFSGVQKLLLDG-NKFSGPIPPEIGKLQQLSKVDFSHNKFSGPIAPE  522

Query  908  IGKLKNLDTLFLQVNDLSGSLAPEI  982
            I + K L  + L  N+LSG++  EI
Sbjct  523  ISQCKLLTFVDLSRNELSGAIPTEI  547


 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 98/196 (50%), Gaps = 1/196 (1%)
 Frame = +2

Query  383  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  562
            G L P++G L  LV    A   LSG +P EI  +  L  L L  N    +   +L  L +
Sbjct  228  GGLPPEIGNLSDLVRFDAANCMLSGEIPKEIGKLQKLDTLFLQVNGLSGSLIEELGNLKS  287

Query  563  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  742
            L+ +DL NN L+G++P    ++++L  L+L  N   G IP   G  P LE L +  N  +
Sbjct  288  LKSMDLSNNMLSGEIPTSFAQLSNLTLLNLFRNKLHGAIPEFIGDLPQLEVLQLWENNFT  347

Query  743  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLK  922
            G IP  +G    L  + +   N  +G +PP+M +  +L      +  L G +P  +GK +
Sbjct  348  GSIPQGLGKNGNLVLVDLSS-NKLTGNLPPDMCSGDRLQTLITLSNFLFGPIPESLGKCQ  406

Query  923  NLDTLFLQVNDLSGSL  970
            +L  + +  N L+GSL
Sbjct  407  SLSRIRMGENFLNGSL  422


 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 80/272 (29%), Positives = 114/272 (42%), Gaps = 50/272 (18%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG L  ++G L  L ++ ++ N LSG +P   + +S L  LNL  N      P  +  L
Sbjct  274   LSGSLIEELGNLKSLKSMDLSNNMLSGEIPTSFAQLSNLTLLNLFRNKLHGAIPEFIGDL  333

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L+VL L+ NN TG +P  + K  +L  + L  N  +G +PP+      L+ L    N 
Sbjct  334   PQLEVLQLWENNFTGSIPQGLGKNGNLVLVDLSSNKLTGNLPPDMCSGDRLQTLITLSNF  393

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPV----  904
             L G IP  +G    L  + +G  N  +G +P  +  L +L + +  +  LTGE PV    
Sbjct  394   LFGPIPESLGKCQSLSRIRMGE-NFLNGSLPKGLFGLPKLTQVELQDNLLTGEFPVTDDK  452

Query  905   ---------------------------------------------EIGKLKNLDTLFLQV  949
                                                          EIGKL+ L  +    
Sbjct  453   IAVNLGQISLSNNHLTGSLPSSIGKFSGVQKLLLDGNKFSGPIPPEIGKLQQLSKVDFSH  512

Query  950   NDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             N  SG +APEI   K L  +DLS N  SG IP
Sbjct  513   NKFSGPIAPEISQCKLLTFVDLSRNELSGAIP  544


 Score = 73.6 bits (179),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 93/198 (47%), Gaps = 4/198 (2%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQ  553
            L+G L   +  LP L  + +  N L+G  P     I+  L  ++LSNN    + P  + +
Sbjct  418  LNGSLPKGLFGLPKLTQVELQDNLLTGEFPVTDDKIAVNLGQISLSNNHLTGSLPSSIGK  477

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             + +Q L L  N  +G +P E+ K+  L  +    N FSG I PE  +   L ++ +S N
Sbjct  478  FSGVQKLLLDGNKFSGPIPPEIGKLQQLSKVDFSHNKFSGPIAPEISQCKLLTFVDLSRN  537

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
             LSG IP+EI  +  L  L +   N   G IP  +  +  L   D +   LTG +P   G
Sbjct  538  ELSGAIPTEITGMRILNYLNLSR-NHLVGSIPASIATMQSLTSVDFSYNNLTGLVP-GTG  595

Query  914  KLKNLD-TLFLQVNDLSG  964
            +    + T FL   DL G
Sbjct  596  QFSYFNYTSFLGNTDLCG  613


 Score = 73.6 bits (179),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 67/127 (53%), Gaps = 0/127 (0%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            +L+G L   +G+   +  L +  N+ SGP+PPEI  +  L  ++ S+N F      +++Q
Sbjct  466  HLTGSLPSSIGKFSGVQKLLLDGNKFSGPIPPEIGKLQQLSKVDFSHNKFSGPIAPEISQ  525

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
               L  +DL  N L+G +P E+  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  526  CKLLTFVDLSRNELSGAIPTEITGMRILNYLNLSRNHLVGSIPASIATMQSLTSVDFSYN  585

Query  734  GLSGVIP  754
             L+G++P
Sbjct  586  NLTGLVP  592



>ref|NP_001237688.1| receptor-like protein kinase precursor [Glycine max]
 gb|ACM89563.1| receptor-like protein kinase [Glycine max]
Length=1010

 Score =   317 bits (812),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 178/281 (63%), Positives = 219/281 (78%), Gaps = 1/281 (0%)
 Frame = +2

Query  215   VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  391
             ++E  ALLS KA+  T D   +L+SWN ST  C+W  VTCDS  HV  L+L+ L+LS  L
Sbjct  19    ISEYRALLSFKASSITNDPTHALSSWNSSTPFCSWFGVTCDSRRHVTGLNLTSLSLSATL  78

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  571
                +  LPFL +LS+A NQ SGP+P   SA+S LRFLNLSNN+F  TFP QLA+L+NL+V
Sbjct  79    YDHLSHLPFLSHLSLADNQFSGPIPVSFSALSALRFLNLSNNVFNQTFPSQLARLSNLEV  138

Query  572   LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  751
             LDLYNNN+TG LP+ V  M  LRHLHLGGN+FSG+IPPEYG + +L YLA+SGN L+G I
Sbjct  139   LDLYNNNMTGPLPLAVASMPLLRHLHLGGNFFSGQIPPEYGTWQHLRYLALSGNELAGYI  198

Query  752   PSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLD  931
               E+GNL+ L+ELYIGY+N +SGGIPPE+GNLS L+R DAA CGL+GE+P E+GKL+NLD
Sbjct  199   APELGNLSALRELYIGYYNTYSGGIPPEIGNLSNLVRLDAAYCGLSGEIPAELGKLQNLD  258

Query  932   TLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             TLFLQVN LSGSL  E+G LK+LKS+DLSNN  SGE+P SF
Sbjct  259   TLFLQVNSLSGSLTSELGNLKSLKSMDLSNNMLSGEVPASF  299


 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 81/250 (32%), Positives = 119/250 (48%), Gaps = 26/250 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             +LSG L+ ++G L  L ++ ++ N LSG VP   + +  L  LNL  N      P  + +
Sbjct  266   SLSGSLTSELGNLKSLKSMDLSNNMLSGEVPASFAELKNLTLLNLFRNKLHGAIPEFVGE  325

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L+VL L+ NN TG +P  + K   L  + L  N  +G +PP       L+ L   GN
Sbjct  326   LPALEVLQLWENNFTGSIPQSLGKNGRLTLVDLSSNKITGTLPPYMCYGNRLQTLITLGN  385

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP-----------------------PEMGN  844
              L G IP  +G    L  + +G  N  +G IP                       PE G+
Sbjct  386   YLFGPIPDSLGKCESLNRIRMGE-NFLNGSIPKGLFGLPKLTQVELQDNLLTGQFPEYGS  444

Query  845   L-SQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
             + + L +   +N  L+G LP  IG   ++  L L  N+ SG + P+IG L+ L  +D S+
Sbjct  445   IATDLGQISLSNNKLSGPLPSTIGNFTSMQKLLLDGNEFSGRIPPQIGRLQQLSKIDFSH  504

Query  1022  nAFSGEI-PE  1048
             N FSG I PE
Sbjct  505   NKFSGPIAPE  514


 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 73/224 (33%), Positives = 110/224 (49%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              ++G L P +     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  362   KITGTLPPYMCYGNRLQTLITLGNYLFGPIPDSLGKCESLNRIRMGENFLNGSIPKGLFG  421

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N LTG  P      T L  + L  N  SG +P   G F +++ L + GN
Sbjct  422   LPKLTQVELQDNLLTGQFPEYGSIATDLGQISLSNNKLSGPLPSTIGNFTSMQKLLLDGN  481

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP +IG L +L ++   + N FSG I PE+     L   D +   L+GE+P +I 
Sbjct  482   EFSGRIPPQIGRLQQLSKIDFSH-NKFSGPIAPEISRCKLLTFIDLSGNELSGEIPNQIT  540

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L S+D S N FSG +P
Sbjct  541   SMRILNYLNLSRNHLDGSIPGSIASMQSLTSVDFSYNNFSGLVP  584


 Score = 85.9 bits (211),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 99/197 (50%), Gaps = 1/197 (1%)
 Frame = +2

Query  380  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  559
            SG + P++G L  LV L  A   LSG +P E+  +  L  L L  N    +   +L  L 
Sbjct  220  SGGIPPEIGNLSNLVRLDAAYCGLSGEIPAELGKLQNLDTLFLQVNSLSGSLTSELGNLK  279

Query  560  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  739
            +L+ +DL NN L+G++P    ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  280  SLKSMDLSNNMLSGEVPASFAELKNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNF  339

Query  740  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKL  919
            +G IP  +G   +L  + +   N  +G +PP M   ++L         L G +P  +GK 
Sbjct  340  TGSIPQSLGKNGRLTLVDLSS-NKITGTLPPYMCYGNRLQTLITLGNYLFGPIPDSLGKC  398

Query  920  KNLDTLFLQVNDLSGSL  970
            ++L+ + +  N L+GS+
Sbjct  399  ESLNRIRMGENFLNGSI  415


 Score = 84.0 bits (206),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/203 (31%), Positives = 98/203 (48%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP   +  
Sbjct  387  LFGPIPDSLGKCESLNRIRMGENFLNGSIPKGLFGLPKLTQVELQDNLLTGQFPEYGSIA  446

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             +L  + L NN L+G LP  +   TS++ L L GN FSGRIPP+ GR   L  +  S N 
Sbjct  447  TDLGQISLSNNKLSGPLPSTIGNFTSMQKLLLDGNEFSGRIPPQIGRLQQLSKIDFSHNK  506

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             SG I  EI     L  + +   N  SG IP ++ ++  L   + +   L G +P  I  
Sbjct  507  FSGPIAPEISRCKLLTFIDLS-GNELSGEIPNQITSMRILNYLNLSRNHLDGSIPGSIAS  565

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            +++L ++    N+ SG L P  G
Sbjct  566  MQSLTSVDFSYNNFSG-LVPGTG  587



>ref|XP_010939309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1020

 Score =   316 bits (810),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 180/294 (61%), Positives = 223/294 (76%), Gaps = 7/294 (2%)
 Frame = +2

Query  191   AGAGKPLG---VTEQAALLSIKAAFTADSQSSLTSWNISTS--HCTWRRVTCdsllhvvs  355
             AGA  P G     +QA LLS+K+A + D  ++L  WN + +  HC W  V CD+ L  V 
Sbjct  25    AGAPPPDGEASADDQATLLSLKSALS-DPGAALAGWNATAAPDHCAWHGVACDATLRRVV  83

Query  356   ldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  532
                   LNLSG L   VG L  L+NLS A N LSGP+PPE+S +S LR LNLSNN+F  +
Sbjct  84    SLDLSGLNLSGSLPTAVGHLRHLLNLSAATNFLSGPIPPELSFLSDLRHLNLSNNLFNGS  143

Query  533   FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE  712
             FP  L +L NL+VLDLYNNNLTG LPVEV ++++LRHLHLGGN+FSG IPPEYGR+ ++E
Sbjct  144   FPSALRRLKNLEVLDLYNNNLTGLLPVEVAELSNLRHLHLGGNFFSGVIPPEYGRWDHIE  203

Query  713   YLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTG  892
             YLAVSGN L G IP EIGNL++L++LY+GYFN + GGIPPE+GNLS L+RFDAANCGL+G
Sbjct  204   YLAVSGNELVGAIPPEIGNLSRLRQLYVGYFNSYDGGIPPEIGNLSALVRFDAANCGLSG  263

Query  893   ELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
              +P E+G+L+NLDTLFLQVN L+G L PE+G L++LKSLDLSNNA +GEIP SF
Sbjct  264   SIPPELGRLENLDTLFLQVNGLAGELPPELGRLRSLKSLDLSNNALTGEIPPSF  317


 Score =   104 bits (260),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 115/224 (51%), Gaps = 2/224 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             L G + P++G L  L  L +   N   G +PPEI  +S L   + +N     + P +L +
Sbjct  212   LVGAIPPEIGNLSRLRQLYVGYFNSYDGGIPPEIGNLSALVRFDAANCGLSGSIPPELGR  271

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL  L L  N L G+LP E+ ++ SL+ L L  N  +G IPP +    NL  L +  N
Sbjct  272   LENLDTLFLQVNGLAGELPPELGRLRSLKSLDLSNNALTGEIPPSFADLWNLTLLNLFRN  331

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G +P  IG+L +L+ L + + N F+G IP  +G   +L   D ++  LTG+LP+++ 
Sbjct  332   KLDGTVPDFIGDLPELEVLQL-WDNNFTGIIPRGIGRSGKLQLLDLSSNKLTGDLPLDLC  390

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
                 L TL    N L G +   +G   +L  + L  N  +G IP
Sbjct  391   SGNKLHTLIALGNALFGPIPESLGRCFSLSRVRLGQNYLNGSIP  434


 Score =   101 bits (252),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 92/300 (31%), Positives = 135/300 (45%), Gaps = 75/300 (25%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G L P++G+L  L +L ++ N L+G +PP  + +  L  LNL  N    T P  +  L
Sbjct  285   LAGELPPELGRLRSLKSLDLSNNALTGEIPPSFADLWNLTLLNLFRNKLDGTVPDFIGDL  344

Query  557   ANLQVLDLYNNN------------------------LTGDLPVEVY--------------  622
               L+VL L++NN                        LTGDLP+++               
Sbjct  345   PELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNKLTGDLPLDLCSGNKLHTLIALGNA  404

Query  623   ----------KMTSLRHLHLGGNYFSGRIP-----------------------PEYGRFP  703
                       +  SL  + LG NY +G IP                       P+ G  P
Sbjct  405   LFGPIPESLGRCFSLSRVRLGQNYLNGSIPSGLFCLPNLAQVELQDNLLAGGFPDTGDAP  464

Query  704   ---NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAA  874
                +L  +++S N LSG +P  IGN + L++L +   N FSG IPPE+G L QL + D +
Sbjct  465   ISSSLGQISLSNNRLSGPLPLSIGNFSGLQKLLLSQ-NQFSGRIPPEIGRLQQLSKVDFS  523

Query  875   NCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
                 +GE+  EI K K L  + L  N+LSG +  EI  ++ L  L++S N   G IP S 
Sbjct  524   GNRFSGEIAPEISKCKLLTFVDLSRNNLSGEIPAEIAGIRILNYLNVSRNHLEGSIPPSI  583


 Score =   100 bits (249),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 91/275 (33%), Positives = 125/275 (45%), Gaps = 52/275 (19%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG + P++G+L  L  L +  N L+G +PPE+  + +L+ L+LSNN      P   A L
Sbjct  261   LSGSIPPELGRLENLDTLFLQVNGLAGELPPELGRLRSLKSLDLSNNALTGEIPPSFADL  320

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS---  727
              NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   GR   L+ L +S   
Sbjct  321   WNLTLLNLFRNKLDGTVPDFIGDLPELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNK  380

Query  728   ---------------------GNGLSGVIPSEIGNLTKLKELYIG--YFNG---------  811
                                  GN L G IP  +G    L  + +G  Y NG         
Sbjct  381   LTGDLPLDLCSGNKLHTLIALGNALFGPIPESLGRCFSLSRVRLGQNYLNGSIPSGLFCL  440

Query  812   ------------FSGGIPPEMGNL---SQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQ  946
                          +GG  P+ G+    S L +   +N  L+G LP+ IG    L  L L 
Sbjct  441   PNLAQVELQDNLLAGGF-PDTGDAPISSSLGQISLSNNRLSGPLPLSIGNFSGLQKLLLS  499

Query  947   VNDLSGSLAPEIGYlknlksldlsnnAFSGEI-PE  1048
              N  SG + PEIG L+ L  +D S N FSGEI PE
Sbjct  500   QNQFSGRIPPEIGRLQQLSKVDFSGNRFSGEIAPE  534


 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 78/232 (34%), Positives = 113/232 (49%), Gaps = 11/232 (5%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L  D+     L  L    N L GP+P  +    +L  + L  N    + P  L  
Sbjct  380   KLTGDLPLDLCSGNKLHTLIALGNALFGPIPESLGRCFSLSRVRLGQNYLNGSIPSGLFC  439

Query  554   LANLQVLDLYNNNL------TGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEY  715
             L NL  ++L +N L      TGD P+     +SL  + L  N  SG +P   G F  L+ 
Sbjct  440   LPNLAQVELQDNLLAGGFPDTGDAPIS----SSLGQISLSNNRLSGPLPLSIGNFSGLQK  495

Query  716   LAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGE  895
             L +S N  SG IP EIG L +L ++     N FSG I PE+     L   D +   L+GE
Sbjct  496   LLLSQNQFSGRIPPEIGRLQQLSKVDFSG-NRFSGEIAPEISKCKLLTFVDLSRNNLSGE  554

Query  896   LPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
             +P EI  ++ L+ L +  N L GS+ P I  +++L ++D S N  SG +P +
Sbjct  555   IPAEIAGIRILNYLNVSRNHLEGSIPPSIATMQSLTAVDFSYNNLSGLVPST  606



>ref|XP_009136515.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Brassica rapa]
Length=993

 Score =   314 bits (805),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 173/267 (65%), Positives = 206/267 (77%), Gaps = 3/267 (1%)
 Frame = +2

Query  263   DSQSS-LTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSI  436
             D Q S L SW++STS C W  VTCD+ L  V       LNLSG L   V  LP L NLS+
Sbjct  42    DQQHSPLASWDLSTSFCLWTGVTCDASLRHVISLDLSGLNLSGTLPSSVAHLPLLRNLSL  101

Query  437   AANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPV  613
             AANQ+SG +PPE++++S LR LNLSNN+F  +FP +L A L NL+VLDLYNNNLTGDLPV
Sbjct  102   AANQISGHIPPEMASLSELRRLNLSNNVFNGSFPDELSAGLVNLRVLDLYNNNLTGDLPV  161

Query  614   EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELY  793
              +  +T LRHLHLGGNYF+GRIPP YG +P LEYLAVSGN L+G IP EIGNLT L+ELY
Sbjct  162   SITNLTELRHLHLGGNYFAGRIPPAYGSWPALEYLAVSGNELAGKIPPEIGNLTTLRELY  221

Query  794   IGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLA  973
             IGYFN F GG+P E+GNLS+L+R DAANCGL GE+P EIG+L+ LDTLFLQVN  SG+L 
Sbjct  222   IGYFNAFDGGLPAEIGNLSELLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLP  281

Query  974   PEIGYlknlksldlsnnAFSGEIPESF  1054
             PE+G + +LKS+DLSNN F+GEIP  F
Sbjct  282   PELGTISSLKSMDLSNNMFTGEIPPRF  308


 Score =   107 bits (268),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 86/249 (35%), Positives = 121/249 (49%), Gaps = 27/249 (11%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L G + P++G+L  L  L +  N  SG +PPE+  IS+L+ ++LSNN+F    P +  QL
Sbjct  252   LRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPPRFEQL  311

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  +  M  L  L L  N F+G IP + G    L  L +S N 
Sbjct  312   RNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQLWENNFTGSIPRKLGENGRLVILDLSSNK  371

Query  737   LSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+G                         IP  +G    L  + +G  N  +G IP  +  
Sbjct  372   LTGTLPPNMCFGNRLVTLITLGNFLFGSIPDSLGKCESLTRIRMGQ-NFLNGSIPNGLFG  430

Query  845   LSQLIRFDAANCGLTGELPVEI--GKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldls  1018
             L +L + +  +  LTGELP+ I  G   NL  + L  N LSG L P IG    ++ L L 
Sbjct  431   LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGSFSGVQKLLLD  490

Query  1019  nnAFSGEIP  1045
              N FSG IP
Sbjct  491   GNKFSGAIP  499


 Score =   105 bits (261),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 119/228 (52%), Gaps = 3/228 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     LV L    N L G +P  +    +L  + +  N    + P+ L  
Sbjct  371   KLTGTLPPNMCFGNRLVTLITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIPNGLFG  430

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  727
             L  L  ++L +N LTG+LP+ +    S  L  + L  N  SG +PP  G F  ++ L + 
Sbjct  431   LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGSFSGVQKLLLD  490

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
             GN  SG IPSEIG L +L +L   + N FSGGIPPE+     L   D +   L+GE+P E
Sbjct  491   GNKFSGAIPSEIGRLQQLSKLDFSH-NLFSGGIPPEISRCKLLTYVDLSRNELSGEIPNE  549

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
             I  ++ L+ L +  N L GS+   I  +++L S+D S N  SG +P +
Sbjct  550   ITSMRILNYLNVSRNHLVGSIPVTISSMQSLTSIDFSYNNLSGLVPST  597


 Score = 98.6 bits (244),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 76/248 (31%), Positives = 122/248 (49%), Gaps = 26/248 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              +G + P  G  P L  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  179   FAGRIPPAYGSWPALEYLAVSGNELAGKIPPEIGNLTTLRELYIGYFNAFDGGLPAEIGN  238

Query  554   LANLQVLDLYNNNLTGDLPVEVYKM------------------------TSLRHLHLGGN  661
             L+ L  LD  N  L G++P E+ ++                        +SL+ + L  N
Sbjct  239   LSELLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNN  298

Query  662   YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
              F+G IPP + +  NL  L +  N L G IP  IG++  L+ L + + N F+G IP ++G
Sbjct  299   MFTGEIPPRFEQLRNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQL-WENNFTGSIPRKLG  357

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
                +L+  D ++  LTG LP  +     L TL    N L GS+   +G  ++L  + +  
Sbjct  358   ENGRLVILDLSSNKLTGTLPPNMCFGNRLVTLITLGNFLFGSIPDSLGKCESLTRIRMGQ  417

Query  1022  nAFSGEIP  1045
             N  +G IP
Sbjct  418   NFLNGSIP  425


 Score = 91.7 bits (226),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 67/206 (33%), Positives = 112/206 (54%), Gaps = 5/206 (2%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTL-RFLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   LV L +++N+L+G +PP +   + L   + L N +FGS  P  L 
Sbjct  347  NFTGSIPRKLGENGRLVILDLSSNKLTGTLPPNMCFGNRLVTLITLGNFLFGS-IPDSLG  405

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEY--GRFPNLEYLAV  724
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P     G   NL  +++
Sbjct  406  KCESLTRIRMGQNFLNGSIPNGLFGLPELSQVELQDNYLTGELPLPISGGVSVNLGQISL  465

Query  725  SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPV  904
            S N LSG +P  IG+ + +++L +   N FSG IP E+G L QL + D ++   +G +P 
Sbjct  466  SNNQLSGPLPPAIGSFSGVQKLLLDG-NKFSGAIPSEIGRLQQLSKLDFSHNLFSGGIPP  524

Query  905  EIGKLKNLDTLFLQVNDLSGSLAPEI  982
            EI + K L  + L  N+LSG +  EI
Sbjct  525  EISRCKLLTYVDLSRNELSGEIPNEI  550


 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 92/188 (49%), Gaps = 5/188 (3%)
 Frame = +2

Query  410  LPFLVNLSIAANQLSGPVPPEISAISTLRF--LNLSNNIFGSTFPHQLAQLANLQVLDLY  583
            LP L  + +  N L+G +P  IS   ++    ++LSNN      P  +   + +Q L L 
Sbjct  431  LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGSFSGVQKLLLD  490

Query  584  NNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEI  763
             N  +G +P E+ ++  L  L    N FSG IPPE  R   L Y+ +S N LSG IP+EI
Sbjct  491  GNKFSGAIPSEIGRLQQLSKLDFSHNLFSGGIPPEISRCKLLTYVDLSRNELSGEIPNEI  550

Query  764  GNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLD-TLF  940
             ++  L  L +   N   G IP  + ++  L   D +   L+G +P   G+    + T F
Sbjct  551  TSMRILNYLNVSR-NHLVGSIPVTISSMQSLTSIDFSYNNLSGLVP-STGQFGYFNHTSF  608

Query  941  LQVNDLSG  964
            L  +DL G
Sbjct  609  LGNSDLCG  616



>ref|XP_010518800.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1011

 Score =   314 bits (804),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 171/267 (64%), Positives = 203/267 (76%), Gaps = 2/267 (1%)
 Frame = +2

Query  260   ADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSI  436
             A   S+L +W  STS C W  VTCD+    V       LNLSG LS D+  L  L N S+
Sbjct  40    AGDDSALATWTDSTSFCGWAGVTCDASRRHVISLDLSGLNLSGTLSSDIAHLRLLQNFSV  99

Query  437   AANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPV  613
             +ANQ+SGP+PPEIS++  LR+LNLSNN+F  +FP +L A L NL+VLDLYNNNLTGDLPV
Sbjct  100   SANQISGPIPPEISSLFGLRYLNLSNNVFNGSFPDELSAGLVNLRVLDLYNNNLTGDLPV  159

Query  614   EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELY  793
              V  +T LRHLHLGGNYF+GRIP  YG +P +EYLAVSGN L G IP EIGNL+ L+ELY
Sbjct  160   SVTNLTQLRHLHLGGNYFAGRIPAAYGSWPVIEYLAVSGNELVGKIPPEIGNLSTLRELY  219

Query  794   IGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLA  973
             IGY+N F  G+PPE+GNLS+L+RFDAANCGLTG++P EIGKL+ LDTLFLQVN LSG L 
Sbjct  220   IGYYNAFEDGLPPEIGNLSELVRFDAANCGLTGQIPPEIGKLQKLDTLFLQVNGLSGPLT  279

Query  974   PEIGYlknlksldlsnnAFSGEIPESF  1054
             PE+G L  L+S+DLSNN F GEIP SF
Sbjct  280   PELGTLPILESMDLSNNMFVGEIPASF  306


 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 82/250 (33%), Positives = 119/250 (48%), Gaps = 25/250 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G + P++G+L  L  L +  N LSGP+ PE+  +  L  ++LSNN+F    P   AQL
Sbjct  250   LTGQIPPEIGKLQKLDTLFLQVNGLSGPLTPELGTLPILESMDLSNNMFVGEIPASFAQL  309

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  +  +  L  L L  N F+G IP + G    L+ L +S N 
Sbjct  310   KNLTLLNLFRNKLHGAIPEFIGDLPELEVLQLWENNFTGSIPRKLGENGKLQLLDLSSNK  369

Query  737   LSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+G                         IP  +G    L  + +G  N  +G IP  +  
Sbjct  370   LTGTLPPNMCSGNNLQTLITLSNFLFGPIPDSLGECESLTRIRMGE-NFLNGSIPKGLFG  428

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L +L + +  +  LTGE PV      NL  + L  N LSG L P IG    ++ L L  N
Sbjct  429   LPKLTQVELQDNYLTGEFPVTGRVAFNLGQISLSNNQLSGPLPPTIGNFSGVQKLLLDGN  488

Query  1025  AFSGEIPESF  1054
              F+G IP+  
Sbjct  489   KFTGLIPQQI  498


 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 73/224 (33%), Positives = 112/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L  L   +N L GP+P  +    +L  + +  N    + P  L  
Sbjct  369   KLTGTLPPNMCSGNNLQTLITLSNFLFGPIPDSLGECESLTRIRMGENFLNGSIPKGLFG  428

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N LTG+ PV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  429   LPKLTQVELQDNYLTGEFPVTGRVAFNLGQISLSNNQLSGPLPPTIGNFSGVQKLLLDGN  488

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               +G+IP +IG L +L ++   + N FSG I PE+     L   D +   L GE+P EI 
Sbjct  489   KFTGLIPQQIGKLQQLSKMDFSH-NRFSGRIAPEISQCKLLTFVDLSRNELAGEIPNEIT  547

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L G +   I  +++L S+D S N  SG +P
Sbjct  548   GMRILNYLNLSRNHLVGPIPASISSMQSLTSVDFSYNNLSGLVP  591



>ref|XP_008441113.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1, partial [Cucumis melo]
Length=977

 Score =   311 bits (796),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 183/262 (70%), Positives = 214/262 (82%), Gaps = 0/262 (0%)
 Frame = +2

Query  269   QSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQ  448
             +SSL SWN STSHCTW  VTCD   HV +LDL+ L LSG LSPDV  L FL NLS+AAN+
Sbjct  2     KSSLASWNASTSHCTWFGVTCDLRRHVTALDLTALGLSGSLSPDVAFLRFLTNLSLAANE  61

Query  449   LSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKM  628
              SGP+PPE+S+IS+LR LNLSNN+F  +FP + +QL NL VLDLYNNN+TGD P+ V +M
Sbjct  62    FSGPIPPELSSISSLRLLNLSNNVFDGSFPSRFSQLQNLHVLDLYNNNMTGDFPIVVTEM  121

Query  629   TSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFN  808
             +SLRHLHLGGN+F+GRIPPE GR  +LEYLAVSGN LSG IP E+GNLT L+ELYIGYFN
Sbjct  122   SSLRHLHLGGNFFAGRIPPEVGRMQSLEYLAVSGNELSGPIPPELGNLTNLRELYIGYFN  181

Query  809   GFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGY  988
              + GG+P E+GNLSQL+R DAANCGL+G +P E+GKL+NLDTLFLQVN LSG L PEIG 
Sbjct  182   AYDGGLPAEIGNLSQLVRLDAANCGLSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQ  241

Query  989   lknlksldlsnnAFSGEIPESF  1054
             L +LKSLDLSNN   GEIP SF
Sbjct  242   LNSLKSLDLSNNMLVGEIPVSF  263


 Score =   104 bits (260),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 81/247 (33%), Positives = 122/247 (49%), Gaps = 25/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG + P++G+L  L  L +  N LSGP+ PEI  +++L+ L+LSNN+     P   AQL
Sbjct  207   LSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQL  266

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  +  +  L  L L  N F+  IP   G+   L+ L +S N 
Sbjct  267   KNLTLLNLFRNKLHGAIPSFIGDLPKLEVLQLWENNFTEAIPQNLGKNGMLQILDLSSNK  326

Query  737   LSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+G                         IP  +G    L  + +G  N  +G IP  + +
Sbjct  327   LTGTLPPDMCFGNRLQILIALSNFLFGPIPESLGKCASLNRIRMGE-NFLNGSIPKGLLS  385

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L +L + +  +  L+GE P+      NL  + L  N L+GS+ P IG    ++ L L  N
Sbjct  386   LPKLSQVELQDNFLSGEFPITDSISLNLGQISLSNNRLTGSIPPTIGNFSGVQKLLLDGN  445

Query  1025  AFSGEIP  1045
              FSG+IP
Sbjct  446   KFSGQIP  452


 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 114/227 (50%), Gaps = 7/227 (3%)
 Frame = +2

Query  374   NLSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  544
              L+G L PD+    +L  L+ LS   N L GP+P  +   ++L  + +  N    + P  
Sbjct  326   KLTGTLPPDMCFGNRLQILIALS---NFLFGPIPESLGKCASLNRIRMGENFLNGSIPKG  382

Query  545   LAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  724
             L  L  L  ++L +N L+G+ P+      +L  + L  N  +G IPP  G F  ++ L +
Sbjct  383   LLSLPKLSQVELQDNFLSGEFPITDSISLNLGQISLSNNRLTGSIPPTIGNFSGVQKLLL  442

Query  725   SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPV  904
              GN  SG IP EIG L +L ++     N  SG I PE+     L   D +   L+GE+P 
Sbjct  443   DGNKFSGQIPPEIGRLQQLSKIDFSS-NMLSGPIAPEISQCKLLTFVDLSRNQLSGEIPN  501

Query  905   EIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             EI  ++ L+ L L  N L G +   I  +++L S+D S N  SG +P
Sbjct  502   EITSMRILNYLNLSKNHLVGGIPATIASMQSLTSVDFSYNNLSGLVP  548


 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 99/196 (51%), Gaps = 1/196 (1%)
 Frame = +2

Query  383  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  562
            G L  ++G L  LV L  A   LSG +PPE+  +  L  L L  N        ++ QL +
Sbjct  185  GGLPAEIGNLSQLVRLDAANCGLSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLNS  244

Query  563  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  742
            L+ LDL NN L G++PV   ++ +L  L+L  N   G IP   G  P LE L +  N  +
Sbjct  245  LKSLDLSNNMLVGEIPVSFAQLKNLTLLNLFRNKLHGAIPSFIGDLPKLEVLQLWENNFT  304

Query  743  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLK  922
              IP  +G    L+ L +   N  +G +PP+M   ++L    A +  L G +P  +GK  
Sbjct  305  EAIPQNLGKNGMLQILDLSS-NKLTGTLPPDMCFGNRLQILIALSNFLFGPIPESLGKCA  363

Query  923  NLDTLFLQVNDLSGSL  970
            +L+ + +  N L+GS+
Sbjct  364  SLNRIRMGENFLNGSI  379


 Score = 85.5 bits (210),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 64/203 (32%), Positives = 99/203 (49%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N     FP   +  
Sbjct  351  LFGPIPESLGKCASLNRIRMGENFLNGSIPKGLLSLPKLSQVELQDNFLSGEFPITDSIS  410

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL  + L NN LTG +P  +   + ++ L L GN FSG+IPPE GR   L  +  S N 
Sbjct  411  LNLGQISLSNNRLTGSIPPTIGNFSGVQKLLLDGNKFSGQIPPEIGRLQQLSKIDFSSNM  470

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            LSG I  EI     L  + +   N  SG IP E+ ++  L   + +   L G +P  I  
Sbjct  471  LSGPIAPEISQCKLLTFVDLSR-NQLSGEIPNEITSMRILNYLNLSKNHLVGGIPATIAS  529

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            +++L ++    N+LSG L P  G
Sbjct  530  MQSLTSVDFSYNNLSG-LVPGTG  551



>gb|AES94465.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1014

 Score =   310 bits (794),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 175/280 (63%), Positives = 226/280 (81%), Gaps = 0/280 (0%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  394
             ++E  ALLS + + T  +  SL+SWN +T+HCTW  VTC++  HV +++L+GL+LSG LS
Sbjct  25    ISEYRALLSFRQSITDSTPPSLSSWNTNTTHCTWFGVTCNTRRHVTAVNLTGLDLSGTLS  84

Query  395   PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  574
              ++  LPFL NLS+A N+ SG +PP +SA++ LR LNLSNN+F  TFP +L+ L NL+VL
Sbjct  85    DELSHLPFLTNLSLADNKFSGQIPPSLSAVTNLRLLNLSNNVFNGTFPSELSLLKNLEVL  144

Query  575   DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  754
             DLYNNN+TG LP+ V ++ +LRHLHLGGNY +G+IPPEYG + +L+YLAVSGN L G IP
Sbjct  145   DLYNNNMTGTLPLAVTELPNLRHLHLGGNYLTGQIPPEYGSWQHLQYLAVSGNELDGTIP  204

Query  755   SEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDT  934
              EIGNLT L+ELYIGYFN ++GGIPP++GNL++LIR DAA CGL+GE+P EIGKL+NLDT
Sbjct  205   PEIGNLTSLRELYIGYFNEYTGGIPPQIGNLTELIRLDAAYCGLSGEIPHEIGKLQNLDT  264

Query  935   LFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             LFLQVN LSGSL  E+G LK+LKS+DLSNN  +GEIP SF
Sbjct  265   LFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSF  304


 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/225 (32%), Positives = 114/225 (51%), Gaps = 2/225 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             L G + P++G L  L  L I   N+ +G +PP+I  ++ L  L+ +        PH++ +
Sbjct  199   LDGTIPPEIGNLTSLRELYIGYFNEYTGGIPPQIGNLTELIRLDAAYCGLSGEIPHEIGK  258

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL  L L  N L+G L  E+  + SL+ + L  N  +G IP  +G   NL  L +  N
Sbjct  259   LQNLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFRN  318

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  IG++  L+ + + + N F+G IP  +G   +L   D ++  LTG LP  + 
Sbjct  319   KLHGAIPEFIGDMPALEVIQL-WENNFTGNIPMSLGTNGKLSLLDISSNKLTGTLPPYLC  377

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPE  1048
                 L TL    N L G +   +G  ++L  + +  N F+G IP+
Sbjct  378   SGNMLQTLITLGNFLFGPIPESLGGCESLTRIRMGENFFNGSIPK  422


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 72/224 (32%), Positives = 109/224 (49%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P +     L  L    N L GP+P  +    +L  + +  N F  + P  L  
Sbjct  367   KLTGTLPPYLCSGNMLQTLITLGNFLFGPIPESLGGCESLTRIRMGENFFNGSIPKGLFG  426

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N L+G+ P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  427   LPKLSQVELQDNYLSGNFPETHSVSVNLGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGN  486

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
                G IPS+IG L +L ++   + N FSG I PE+     L   D +   L+G +P EI 
Sbjct  487   MFEGKIPSQIGRLQQLSKIDFSH-NRFSGPIAPEISKCKLLTFVDLSRNELSGIIPNEIT  545

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              +K L+   +  N L GS+   I  +++L S+D S N  SG +P
Sbjct  546   HMKILNYFNISRNHLVGSIPGSIASMQSLTSVDFSYNNLSGLVP  589


 Score = 89.4 bits (220),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 113/247 (46%), Gaps = 25/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P    +L
Sbjct  248   LSGEIPHEIGKLQNLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGEL  307

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  +  M +L  + L  N F+G IP   G    L  L +S N 
Sbjct  308   KNLTLLNLFRNKLHGAIPEFIGDMPALEVIQLWENNFTGNIPMSLGTNGKLSLLDISSNK  367

Query  737   LSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+G                         IP  +G    L  + +G  N F+G IP  +  
Sbjct  368   LTGTLPPYLCSGNMLQTLITLGNFLFGPIPESLGGCESLTRIRMGE-NFFNGSIPKGLFG  426

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L +L + +  +  L+G  P       NL  + L  N LSG L P IG    ++ L L  N
Sbjct  427   LPKLSQVELQDNYLSGNFPETHSVSVNLGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGN  486

Query  1025  AFSGEIP  1045
              F G+IP
Sbjct  487   MFEGKIP  493


 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 72/228 (32%), Positives = 117/228 (51%), Gaps = 3/228 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
             N +G +   +G    L  L I++N+L+G +PP + + + L+  + L N +FG   P  L 
Sbjct  343   NFTGNIPMSLGTNGKLSLLDISSNKLTGTLPPYLCSGNMLQTLITLGNFLFGP-IPESLG  401

Query  551   QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
                +L  + +  N   G +P  ++ +  L  + L  NY SG  P  +    NL  + +S 
Sbjct  402   GCESLTRIRMGENFFNGSIPKGLFGLPKLSQVELQDNYLSGNFPETHSVSVNLGQITLSN  461

Query  731   NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
             N LSG +P  IGN + +++L +   N F G IP ++G L QL + D ++   +G +  EI
Sbjct  462   NQLSGPLPPSIGNFSGVQKLLLD-GNMFEGKIPSQIGRLQQLSKIDFSHNRFSGPIAPEI  520

Query  911   GKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
              K K L  + L  N+LSG +  EI ++K L   ++S N   G IP S 
Sbjct  521   SKCKLLTFVDLSRNELSGIIPNEITHMKILNYFNISRNHLVGSIPGSI  568



>ref|XP_008237309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Prunus mume]
Length=968

 Score =   308 bits (790),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 166/227 (73%), Positives = 188/227 (83%), Gaps = 0/227 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             +L G LS D+  L FL N ++A NQ SGP+P EISA+S LR LNLSNNIF +TFP QL+ 
Sbjct  26    DLVGTLSSDIAHLRFLSNGTLADNQFSGPIPSEISALSGLRLLNLSNNIFNTTFPPQLSN  85

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L VLDLYNNNLTGDLPV V  MTSLRHLHLGGN+FSGRIPPE+GRFP LEYLAVSGN
Sbjct  86    LTRLAVLDLYNNNLTGDLPVAVTHMTSLRHLHLGGNFFSGRIPPEFGRFPLLEYLAVSGN  145

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP EIGNLT LKELYIGY+N + GGIPPE+GNLSQL+R DAANC LTGE+P E+G
Sbjct  146   ELGGSIPPEIGNLTSLKELYIGYYNVYEGGIPPEIGNLSQLVRLDAANCNLTGEVPRELG  205

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             +L+N+DTLFLQVN LSGSL  E+G LK+LKS+DLSNN FSGEIP SF
Sbjct  206   RLQNVDTLFLQVNALSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSF  252


 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/227 (33%), Positives = 120/227 (53%), Gaps = 2/227 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              SG + P+ G+ P L  L+++ N+L G +PPEI  +++L+ L +   N++    P ++  
Sbjct  123   FSGRIPPEFGRFPLLEYLAVSGNELGGSIPPEIGNLTSLKELYIGYYNVYEGGIPPEIGN  182

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L+ L  LD  N NLTG++P E+ ++ ++  L L  N  SG +  E G   +L+ + +S N
Sbjct  183   LSQLVRLDAANCNLTGEVPRELGRLQNVDTLFLQVNALSGSLTAELGSLKSLKSMDLSNN  242

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP     L  L  L + + N   G IP  +G+L +L          TG +P  +G
Sbjct  243   MFSGEIPGSFSELKNLTLLNL-FRNKLHGAIPEFIGDLPELQVLQLWENNFTGSIPQGLG  301

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             K   L TL L  N L+G+L P++ +  NL++L    N   G IPES 
Sbjct  302   KNGKLITLDLSSNKLTGTLPPDMCFGNNLQTLITLGNFLFGPIPESL  348


 Score =   101 bits (251),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 78/223 (35%), Positives = 107/223 (48%), Gaps = 1/223 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG L+ ++G L  L ++ ++ N  SG +P   S +  L  LNL  N      P  +  L
Sbjct  220   LSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSELKNLTLLNLFRNKLHGAIPEFIGDL  279

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               LQVL L+ NN TG +P  + K   L  L L  N  +G +PP+     NL+ L   GN 
Sbjct  280   PELQVLQLWENNFTGSIPQGLGKNGKLITLDLSSNKLTGTLPPDMCFGNNLQTLITLGNF  339

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L G IP  +G    L  + +G  N  +G IP  +  L +L + +  +  L G  P     
Sbjct  340   LFGPIPESLGKCGSLSRIRMGE-NFLNGSIPKGLFGLPKLTQVELQDNLLAGSFPETETI  398

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
               NL  + L  N LSGSL P IG    ++ L L  N FSG IP
Sbjct  399   SANLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIP  441


 Score = 93.6 bits (231),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 107/224 (48%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  315   KLTGTLPPDMCFGNNLQTLITLGNFLFGPIPESLGKCGSLSRIRMGENFLNGSIPKGLFG  374

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  375   LPKLTQVELQDNLLAGSFPETETISANLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGN  434

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP EIG L +L ++   + N F G I PE+     L   D +   L GE+P EI 
Sbjct  435   KFSGRIPPEIGRLQQLSKIDFSH-NKFLGPIAPEISQCKLLTFVDLSRNELAGEIPKEIT  493

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L S+D S N  SG +P
Sbjct  494   GMRILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNNLSGLVP  537


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 63/204 (31%), Positives = 109/204 (53%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   L+ L +++N+L+G +PP++   + L+  + L N +FG   P  L 
Sbjct  291  NFTGSIPQGLGKNGKLITLDLSSNKLTGTLPPDMCFGNNLQTLITLGNFLFGP-IPESLG  349

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ +  L  + L  N  +G  P       NL  +++S 
Sbjct  350  KCGSLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDNLLAGSFPETETISANLGQISLSN  409

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +P  IGN + +++L +   N FSG IPPE+G L QL + D ++    G +  EI
Sbjct  410  NRLSGSLPPTIGNFSGVQKLLLDG-NKFSGRIPPEIGRLQQLSKIDFSHNKFLGPIAPEI  468

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  + L  N+L+G +  EI
Sbjct  469  SQCKLLTFVDLSRNELAGEIPKEI  492


 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 97/203 (48%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+   +FP      
Sbjct  340  LFGPIPESLGKCGSLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDNLLAGSFPETETIS  399

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
            ANL  + L NN L+G LP  +   + ++ L L GN FSGRIPPE GR   L  +  S N 
Sbjct  400  ANLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFSHNK  459

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
              G I  EI     L  + +   N  +G IP E+  +  L   + +   L G +P  I  
Sbjct  460  FLGPIAPEISQCKLLTFVDLSR-NELAGEIPKEITGMRILNYLNLSRNHLVGSIPSSIST  518

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            +++L ++    N+LSG L P  G
Sbjct  519  MQSLTSVDFSYNNLSG-LVPGTG  540



>ref|XP_008787359.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1, partial [Phoenix 
dactylifera]
Length=1004

 Score =   309 bits (791),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 175/292 (60%), Positives = 219/292 (75%), Gaps = 5/292 (2%)
 Frame = +2

Query  182   SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvvsl  358
             +A +G G+   V E  ALL +KAA   D   +L  W+ +  HC  W  V CD+   VVSL
Sbjct  19    AAASGRGR---VVEHRALLDLKAAL-GDPSGALAGWDATADHCQAWSGVACDAAGRVVSL  74

Query  359   dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  538
             ++S LNLSG L   V +L  L++LS AAN+LSGP+PPE+S +S LRFLNLSNN F  T P
Sbjct  75    NISXLNLSGPLPRAVSRLRSLLHLSAAANELSGPIPPELSLLSGLRFLNLSNNAFNRTLP  134

Query  539   HQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL  718
               L++L NL VLDLYNNNLTG LPV+V  + +LRHLHLGGN+FSG IPPEYGR+ +LEYL
Sbjct  135   SALSRLKNLHVLDLYNNNLTGVLPVQVADLPALRHLHLGGNFFSGAIPPEYGRWEHLEYL  194

Query  719   AVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGEL  898
             A+SGN L G IP E+GN+T L+ELYIGYFN F GG+P  +GN++ L+R DAANCGL+GE+
Sbjct  195   AISGNELGGPIPPELGNVTTLRELYIGYFNSFQGGLPAAIGNITALVRLDAANCGLSGEI  254

Query  899   PVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             P EIG L+NLDTLFLQVN LSG + PE+G L++LKS+DLSNN  +GEIP +F
Sbjct  255   PPEIGNLQNLDTLFLQVNGLSGEITPELGKLRSLKSMDLSNNVLTGEIPRTF  306


 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 88/277 (32%), Positives = 121/277 (44%), Gaps = 56/277 (20%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG + P++G L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A+L
Sbjct  250   LSGEIPPEIGNLQNLDTLFLQVNGLSGEITPELGKLRSLKSMDLSNNVLTGEIPRTFAEL  309

Query  557   AN------------------------LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  664
              N                        L+VL L+ NN TG++P  +     L+ L L  N 
Sbjct  310   KNLTLLNLFRNKLHGAIPDLIGDLPRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNK  369

Query  665   FSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIG--YFNG---------  811
              +G +PP       L+ L   GN L G IP   G    L  + +G  Y NG         
Sbjct  370   LTGSLPPNLCSGDQLQVLIALGNFLFGSIPESFGRCKSLSRIRMGENYLNGSVPSGLFGL  429

Query  812   ------------FSGGIPPEMGN-----LSQLIRFDAANCGLTGELPVEIGKLKNLDTLF  940
                          +GG P   G+     L Q+I    +N  L+G LP  IGK   +  L 
Sbjct  430   PKLAQVELQDNLLTGGFPETAGSRISPTLGQII---LSNNRLSGALPPSIGKFSGVQKLL  486

Query  941   LQVNDLSGSLAPEIGYlknlksldlsnnAFSGEI-PE  1048
             L  N  SG + PEIG L+ L  +D S N FSG I PE
Sbjct  487   LNQNQFSGRIPPEIGRLQQLSKMDFSGNRFSGPITPE  523


 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 78/253 (31%), Positives = 116/253 (46%), Gaps = 27/253 (11%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L G +   +G LP L  L +  N  +G +P  +     L+ L+LS+N    + P  L  
Sbjct  321   KLHGAIPDLIGDLPRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPNLCS  380

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP------PEYGRF-----  700
                LQVL    N L G +P    +  SL  + +G NY +G +P      P+  +      
Sbjct  381   GDQLQVLIALGNFLFGSIPESFGRCKSLSRIRMGENYLNGSVPSGLFGLPKLAQVELQDN  440

Query  701   ---------------PNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPE  835
                            P L  + +S N LSG +P  IG  + +++L +   N FSG IPPE
Sbjct  441   LLTGGFPETAGSRISPTLGQIILSNNRLSGALPPSIGKFSGVQKLLLNQ-NQFSGRIPPE  499

Query  836   MGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldl  1015
             +G L QL + D +    +G +  EI K K L  + L  N+ SG +  EI  ++ L  L+L
Sbjct  500   IGRLQQLSKMDFSGNRFSGPITPEISKCKLLTFVDLSRNNFSGEIPAEITGMRILNYLNL  559

Query  1016  snnAFSGEIPESF  1054
             S N   G+IP S 
Sbjct  560   SRNHLEGKIPASI  572


 Score = 89.0 bits (219),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 65/199 (33%), Positives = 98/199 (49%), Gaps = 1/199 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            +  G L   +G +  LV L  A   LSG +PPEI  +  L  L L  N        +L +
Sbjct  225  SFQGGLPAAIGNITALVRLDAANCGLSGEIPPEIGNLQNLDTLFLQVNGLSGEITPELGK  284

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L +L+ +DL NN LTG++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  285  LRSLKSMDLSNNVLTGEIPRTFAELKNLTLLNLFRNKLHGAIPDLIGDLPRLEVLQLWEN  344

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              +G IP  +G   +L+ L +   N  +G +PP + +  QL    A    L G +P   G
Sbjct  345  NFTGEIPRRLGTNGRLQLLDLSS-NKLTGSLPPNLCSGDQLQVLIALGNFLFGSIPESFG  403

Query  914  KLKNLDTLFLQVNDLSGSL  970
            + K+L  + +  N L+GS+
Sbjct  404  RCKSLSRIRMGENYLNGSV  422


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 73/231 (32%), Positives = 110/231 (48%), Gaps = 9/231 (4%)
 Frame = +2

Query  374   NLSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  544
              L+G L P++    QL  L+ L    N L G +P       +L  + +  N    + P  
Sbjct  369   KLTGSLPPNLCSGDQLQVLIAL---GNFLFGSIPESFGRCKSLSRIRMGENYLNGSVPSG  425

Query  545   LAQLANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYL  718
             L  L  L  ++L +N LTG  P       S  L  + L  N  SG +PP  G+F  ++ L
Sbjct  426   LFGLPKLAQVELQDNLLTGGFPETAGSRISPTLGQIILSNNRLSGALPPSIGKFSGVQKL  485

Query  719   AVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGEL  898
              ++ N  SG IP EIG L +L ++     N FSG I PE+     L   D +    +GE+
Sbjct  486   LLNQNQFSGRIPPEIGRLQQLSKMDFSG-NRFSGPITPEISKCKLLTFVDLSRNNFSGEI  544

Query  899   PVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
             P EI  ++ L+ L L  N L G +   I  +++L ++D S N  SG +P +
Sbjct  545   PAEITGMRILNYLNLSRNHLEGKIPASISTMQSLTAVDFSYNNLSGLVPST  595



>ref|XP_003611507.1| Receptor-like protein kinase [Medicago truncatula]
Length=1109

 Score =   310 bits (794),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 175/280 (63%), Positives = 226/280 (81%), Gaps = 0/280 (0%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  394
             ++E  ALLS + + T  +  SL+SWN +T+HCTW  VTC++  HV +++L+GL+LSG LS
Sbjct  25    ISEYRALLSFRQSITDSTPPSLSSWNTNTTHCTWFGVTCNTRRHVTAVNLTGLDLSGTLS  84

Query  395   PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  574
              ++  LPFL NLS+A N+ SG +PP +SA++ LR LNLSNN+F  TFP +L+ L NL+VL
Sbjct  85    DELSHLPFLTNLSLADNKFSGQIPPSLSAVTNLRLLNLSNNVFNGTFPSELSLLKNLEVL  144

Query  575   DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  754
             DLYNNN+TG LP+ V ++ +LRHLHLGGNY +G+IPPEYG + +L+YLAVSGN L G IP
Sbjct  145   DLYNNNMTGTLPLAVTELPNLRHLHLGGNYLTGQIPPEYGSWQHLQYLAVSGNELDGTIP  204

Query  755   SEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDT  934
              EIGNLT L+ELYIGYFN ++GGIPP++GNL++LIR DAA CGL+GE+P EIGKL+NLDT
Sbjct  205   PEIGNLTSLRELYIGYFNEYTGGIPPQIGNLTELIRLDAAYCGLSGEIPHEIGKLQNLDT  264

Query  935   LFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             LFLQVN LSGSL  E+G LK+LKS+DLSNN  +GEIP SF
Sbjct  265   LFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSF  304


 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/225 (32%), Positives = 114/225 (51%), Gaps = 2/225 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             L G + P++G L  L  L I   N+ +G +PP+I  ++ L  L+ +        PH++ +
Sbjct  199   LDGTIPPEIGNLTSLRELYIGYFNEYTGGIPPQIGNLTELIRLDAAYCGLSGEIPHEIGK  258

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL  L L  N L+G L  E+  + SL+ + L  N  +G IP  +G   NL  L +  N
Sbjct  259   LQNLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFRN  318

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  IG++  L+ + + + N F+G IP  +G   +L   D ++  LTG LP  + 
Sbjct  319   KLHGAIPEFIGDMPALEVIQL-WENNFTGNIPMSLGTNGKLSLLDISSNKLTGTLPPYLC  377

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPE  1048
                 L TL    N L G +   +G  ++L  + +  N F+G IP+
Sbjct  378   SGNMLQTLITLGNFLFGPIPESLGGCESLTRIRMGENFFNGSIPK  422


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 72/224 (32%), Positives = 109/224 (49%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P +     L  L    N L GP+P  +    +L  + +  N F  + P  L  
Sbjct  367   KLTGTLPPYLCSGNMLQTLITLGNFLFGPIPESLGGCESLTRIRMGENFFNGSIPKGLFG  426

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N L+G+ P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  427   LPKLSQVELQDNYLSGNFPETHSVSVNLGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGN  486

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
                G IPS+IG L +L ++   + N FSG I PE+     L   D +   L+G +P EI 
Sbjct  487   MFEGKIPSQIGRLQQLSKIDFSH-NRFSGPIAPEISKCKLLTFVDLSRNELSGIIPNEIT  545

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              +K L+   +  N L GS+   I  +++L S+D S N  SG +P
Sbjct  546   HMKILNYFNISRNHLVGSIPGSIASMQSLTSVDFSYNNLSGLVP  589


 Score = 89.4 bits (220),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 113/247 (46%), Gaps = 25/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P    +L
Sbjct  248   LSGEIPHEIGKLQNLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGEL  307

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  +  M +L  + L  N F+G IP   G    L  L +S N 
Sbjct  308   KNLTLLNLFRNKLHGAIPEFIGDMPALEVIQLWENNFTGNIPMSLGTNGKLSLLDISSNK  367

Query  737   LSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+G                         IP  +G    L  + +G  N F+G IP  +  
Sbjct  368   LTGTLPPYLCSGNMLQTLITLGNFLFGPIPESLGGCESLTRIRMGE-NFFNGSIPKGLFG  426

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L +L + +  +  L+G  P       NL  + L  N LSG L P IG    ++ L L  N
Sbjct  427   LPKLSQVELQDNYLSGNFPETHSVSVNLGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGN  486

Query  1025  AFSGEIP  1045
              F G+IP
Sbjct  487   MFEGKIP  493


 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 72/228 (32%), Positives = 117/228 (51%), Gaps = 3/228 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
             N +G +   +G    L  L I++N+L+G +PP + + + L+  + L N +FG   P  L 
Sbjct  343   NFTGNIPMSLGTNGKLSLLDISSNKLTGTLPPYLCSGNMLQTLITLGNFLFGP-IPESLG  401

Query  551   QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
                +L  + +  N   G +P  ++ +  L  + L  NY SG  P  +    NL  + +S 
Sbjct  402   GCESLTRIRMGENFFNGSIPKGLFGLPKLSQVELQDNYLSGNFPETHSVSVNLGQITLSN  461

Query  731   NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
             N LSG +P  IGN + +++L +   N F G IP ++G L QL + D ++   +G +  EI
Sbjct  462   NQLSGPLPPSIGNFSGVQKLLLD-GNMFEGKIPSQIGRLQQLSKIDFSHNRFSGPIAPEI  520

Query  911   GKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
              K K L  + L  N+LSG +  EI ++K L   ++S N   G IP S 
Sbjct  521   SKCKLLTFVDLSRNELSGIIPNEITHMKILNYFNISRNHLVGSIPGSI  568



>ref|XP_008790445.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=1019

 Score =   306 bits (785),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 176/276 (64%), Positives = 215/276 (78%), Gaps = 5/276 (2%)
 Frame = +2

Query  239   SIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsl--lhvvsldlsglNLSGVLSPDVG  406
             S+K+A + D  ++L  WN S    HC+W  V CD+     V+SLDL+GLNLSG L P V 
Sbjct  42    SLKSALS-DPGAALAGWNASAYPDHCSWPGVACDNAPLRRVISLDLTGLNLSGSLPPAVA  100

Query  407   QLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  586
              L  L+NLS AAN LSGP+PPE+S +  LR LNLSNN+F  +FP  L +L +L+VLDLYN
Sbjct  101   HLRHLLNLSAAANLLSGPIPPELSLLFDLRHLNLSNNVFNGSFPSALRRLKHLEVLDLYN  160

Query  587   NNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIG  766
             NNLTG LP E   + +LRHLHLGGN+FSG IPPEYGR+ +LEYLAVSGN L G IP EIG
Sbjct  161   NNLTGVLPAEAADLPNLRHLHLGGNFFSGVIPPEYGRWEHLEYLAVSGNELGGAIPPEIG  220

Query  767   NLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQ  946
             NLT+L++LYIGYFN + GGIPPE G LS L+RFDAANCGL+GE+P E+G+L+NLDTLFLQ
Sbjct  221   NLTRLRQLYIGYFNSYDGGIPPEFGKLSALVRFDAANCGLSGEIPPELGRLENLDTLFLQ  280

Query  947   VNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             VN LSG L PE+G L++LKS+DLSNNAF+GEIP +F
Sbjct  281   VNGLSGELPPELGRLRSLKSMDLSNNAFTGEIPPTF  316


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 78/224 (35%), Positives = 114/224 (51%), Gaps = 2/224 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             L G + P++G L  L  L I   N   G +PPE   +S L   + +N       P +L +
Sbjct  211   LGGAIPPEIGNLTRLRQLYIGYFNSYDGGIPPEFGKLSALVRFDAANCGLSGEIPPELGR  270

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL  L L  N L+G+LP E+ ++ SL+ + L  N F+G IPP +    NL  L +  N
Sbjct  271   LENLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNNAFTGEIPPTFADLRNLTLLNLFRN  330

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  IG+L +L+ L + + N F+G IP  +G   +L   D ++  LTG+LP E+ 
Sbjct  331   KLYGTIPDFIGDLPELEVLQL-WDNNFTGIIPRGIGRSGKLQLLDLSSNKLTGDLPPELC  389

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
                 L TL    N L G +   +G   +L  + L  N  +G IP
Sbjct  390   SGNKLQTLIALGNALFGPIPESLGQCSSLSRVRLGENYLNGSIP  433


 Score =   105 bits (262),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 106/203 (52%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P++G+L  L  L +  N LSG +PPE+  + +L+ ++LSNN F    P   A L
Sbjct  260  LSGEIPPELGRLENLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNNAFTGEIPPTFADL  319

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   GR   L+ L +S N 
Sbjct  320  RNLTLLNLFRNKLYGTIPDFIGDLPELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNK  379

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P E+ +  KL+ L I   N   G IP  +G  S L R       L G +P  +  
Sbjct  380  LTGDLPPELCSGNKLQTL-IALGNALFGPIPESLGQCSSLSRVRLGENYLNGSIPSGLLS  438

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            L  L  + LQ N L+G   P+ G
Sbjct  439  LPKLAQVELQDNLLAGEF-PDTG  460


 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 79/226 (35%), Positives = 113/226 (50%), Gaps = 3/226 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L  L    N L GP+P  +   S+L  + L  N    + P  L  
Sbjct  379   KLTGDLPPELCSGNKLQTLIALGNALFGPIPESLGQCSSLSRVRLGENYLNGSIPSGLLS  438

Query  554   LANLQVLDLYNNNLTGDLPV--EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  727
             L  L  ++L +N L G+ P         SL  + L  N  SG +PP  G F  ++ L ++
Sbjct  439   LPKLAQVELQDNLLAGEFPDTGNASISPSLGQISLSNNRLSGPLPPCIGNFSGVQKLLLN  498

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
              N  SG IP+EIG L +L ++     N FSGGIPPEM     L   D     L+GE+P E
Sbjct  499   QNQFSGRIPTEIGRLQQLSKVDFSS-NSFSGGIPPEMSKCKLLTFVDLGRNNLSGEIPGE  557

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             I  ++ L+ L L  N L GS+ P I  +++L ++D S N  SG +P
Sbjct  558   IAGMRILNYLNLSRNHLEGSIPPSIATMQSLTAVDFSYNNLSGLVP  603



>ref|XP_009397330.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1023

 Score =   305 bits (781),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 176/291 (60%), Positives = 218/291 (75%), Gaps = 4/291 (1%)
 Frame = +2

Query  182   SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld  361
             +A  GAG      E  ALLS+KA  + D  ++L  W+ +T HC+W  VTCD    VVSLD
Sbjct  20    AADDGAGY---AEEHRALLSLKAQLS-DPGAALGPWDATTDHCSWPGVTCDDAGAVVSLD  75

Query  362   lsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  541
             LSG NLSG+L P VG+L  L+ LS AAN  SGP+P E++ +  LR LNLSNNIF  +FP 
Sbjct  76    LSGRNLSGLLPPAVGRLRSLLRLSAAANSFSGPIPSELALLPALRHLNLSNNIFNGSFPA  135

Query  542   QLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLA  721
              LA+LA+L+VLDLYNNNLTG LP E+  +  LRH+HLGGN+FSG IPPEYG +  LEYLA
Sbjct  136   PLARLADLRVLDLYNNNLTGPLPRELAALPQLRHIHLGGNFFSGSIPPEYGSWQFLEYLA  195

Query  722   VSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELP  901
             +SGN L G IP EIGNL+ L+ELYIGY+N + GG+PPE+GNLS L+R DAANCGL+G +P
Sbjct  196   ISGNELGGPIPPEIGNLSALRELYIGYYNSYDGGLPPEIGNLSTLLRLDAANCGLSGRIP  255

Query  902   VEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
              E+G L+NLDTLFLQVN L G + PE+  L++LKS+DLSNNA +GEIP SF
Sbjct  256   PEMGNLRNLDTLFLQVNGLGGEIPPELSRLRSLKSMDLSNNALTGEIPPSF  306


 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 75/225 (33%), Positives = 116/225 (52%), Gaps = 2/225 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             L G + P++G L  L  L I   N   G +PPEI  +STL  L+ +N       P ++  
Sbjct  201   LGGPIPPEIGNLSALRELYIGYYNSYDGGLPPEIGNLSTLLRLDAANCGLSGRIPPEMGN  260

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL  L L  N L G++P E+ ++ SL+ + L  N  +G IPP +    NL  L +  N
Sbjct  261   LRNLDTLFLQVNGLGGEIPPELSRLRSLKSMDLSNNALTGEIPPSFAALSNLTLLNLFRN  320

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  +G+L +L+ L + + N F+G IP  +G   +L   D ++  LTG LP ++ 
Sbjct  321   KLFGAIPEFVGDLPELEVLQV-WENNFTGSIPRRLGTNGRLQLLDLSSNKLTGSLPPDLC  379

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPE  1048
                 L TL    N L G +   +G  ++L  + + +N  +G IP+
Sbjct  380   YGNKLQTLIALGNFLFGQIPESLGRCESLSRIRMGDNYLNGTIPQ  424


 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/203 (35%), Positives = 104/203 (51%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P++G L  L  L +  N L G +PPE+S + +L+ ++LSNN      P   A L
Sbjct  250  LSGRIPPEMGNLRNLDTLFLQVNGLGGEIPPELSRLRSLKSMDLSNNALTGEIPPSFAAL  309

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
            +NL +L+L+ N L G +P  V  +  L  L +  N F+G IP   G    L+ L +S N 
Sbjct  310  SNLTLLNLFRNKLFGAIPEFVGDLPELEVLQVWENNFTGSIPRRLGTNGRLQLLDLSSNK  369

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P ++    KL+ L I   N   G IP  +G    L R    +  L G +P  +  
Sbjct  370  LTGSLPPDLCYGNKLQTL-IALGNFLFGQIPESLGRCESLSRIRMGDNYLNGTIPQGLLS  428

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            L NL  + LQ N L+G   P+ G
Sbjct  429  LPNLSQVELQDNYLTGGF-PDTG  450


 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 83/272 (31%), Positives = 126/272 (46%), Gaps = 49/272 (18%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNL-SNNIFGS--------  529
             L G + P++ +L  L ++ ++ N L+G +PP  +A+S L  LNL  N +FG+        
Sbjct  274   LGGEIPPELSRLRSLKSMDLSNNALTGEIPPSFAALSNLTLLNLFRNKLFGAIPEFVGDL  333

Query  530   ---------------TFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  664
                            + P +L     LQ+LDL +N LTG LP ++     L+ L   GN+
Sbjct  334   PELEVLQVWENNFTGSIPRRLGTNGRLQLLDLSSNKLTGSLPPDLCYGNKLQTLIALGNF  393

Query  665   FSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLK--ELYIGYFNG---------  811
               G+IP   GR  +L  + +  N L+G IP  + +L  L   EL   Y  G         
Sbjct  394   LFGQIPESLGRCESLSRIRMGDNYLNGTIPQGLLSLPNLSQVELQDNYLTGGFPDTGSSS  453

Query  812   --------------FSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQV  949
                            +G +PP +GN S L +        TG++P E+G+L+ L  L L  
Sbjct  454   ISPNLGQVCLSNNRLAGPLPPSIGNYSGLQKLLLNQNSFTGKIPPEVGRLQQLSKLDLSS  513

Query  950   NDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             N  SG + PE+   K L  +DLS N  SG++P
Sbjct  514   NRFSGPITPEVSKCKLLTFVDLSRNELSGDVP  545


 Score = 95.1 bits (235),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 118/250 (47%), Gaps = 27/250 (11%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L G +   VG LP L  L +  N  +G +P  +     L+ L+LS+N    + P  L  
Sbjct  321   KLFGAIPEFVGDLPELEVLQVWENNFTGSIPRRLGTNGRLQLLDLSSNKLTGSLPPDLCY  380

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP-----------------  682
                LQ L    N L G +P  + +  SL  + +G NY +G IP                 
Sbjct  381   GNKLQTLIALGNFLFGQIPESLGRCESLSRIRMGDNYLNGTIPQGLLSLPNLSQVELQDN  440

Query  683   ------PEYGRF---PNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPE  835
                   P+ G     PNL  + +S N L+G +P  IGN + L++L +   N F+G IPPE
Sbjct  441   YLTGGFPDTGSSSISPNLGQVCLSNNRLAGPLPPSIGNYSGLQKLLLNQ-NSFTGKIPPE  499

Query  836   MGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldl  1015
             +G L QL + D ++   +G +  E+ K K L  + L  N+LSG +  ++  ++ L  L+L
Sbjct  500   VGRLQQLSKLDLSSNRFSGPITPEVSKCKLLTFVDLSRNELSGDVPADVAAMRILNYLNL  559

Query  1016  snnAFSGEIP  1045
             S N   G IP
Sbjct  560   SRNHLEGPIP  569


 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 70/228 (31%), Positives = 111/228 (49%), Gaps = 3/228 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L PD+     L  L    N L G +P  +    +L  + + +N    T P  L  
Sbjct  369   KLTGSLPPDLCYGNKLQTLIALGNFLFGQIPESLGRCESLSRIRMGDNYLNGTIPQGLLS  428

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  727
             L NL  ++L +N LTG  P       S  L  + L  N  +G +PP  G +  L+ L ++
Sbjct  429   LPNLSQVELQDNYLTGGFPDTGSSSISPNLGQVCLSNNRLAGPLPPSIGNYSGLQKLLLN  488

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
              N  +G IP E+G L +L +L +   N FSG I PE+     L   D +   L+G++P +
Sbjct  489   QNSFTGKIPPEVGRLQQLSKLDLSS-NRFSGPITPEVSKCKLLTFVDLSRNELSGDVPAD  547

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
             +  ++ L+ L L  N L G +   I  +++L ++D S N  SG +P +
Sbjct  548   VAAMRILNYLNLSRNHLEGPIPVAISTMQSLTAVDFSYNNLSGVVPST  595


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 63/120 (53%), Gaps = 1/120 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            + +G + P+VG+L  L  L +++N+ SGP+ PE+S    L F++LS N      P  +A 
Sbjct  491  SFTGKIPPEVGRLQQLSKLDLSSNRFSGPITPEVSKCKLLTFVDLSRNELSGDVPADVAA  550

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            +  L  L+L  N+L G +PV +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  551  MRILNYLNLSRNHLEGPIPVAISTMQSLTAVDFSYNNLSGVV-PSTGQFSYFNATSFVGN  609



>ref|XP_003608587.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES90784.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1005

 Score =   305 bits (780),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 178/280 (64%), Positives = 225/280 (80%), Gaps = 2/280 (1%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  394
             ++E  +LLS K++ T D Q+ LTSWN  T +C+W  + C    HV+SL+L+ L+L+G LS
Sbjct  25    ISEYHSLLSFKSSITNDPQNILTSWNPKTPYCSWYGIKCSQHRHVISLNLTSLSLTGTLS  84

Query  395   PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  574
               +  LPFL NLS+A N+ SGP+P  +S++S+LRFLNLSNNIF  T P +L+ L NLQVL
Sbjct  85    --LSNLPFLTNLSLADNKFSGPIPSSLSSLSSLRFLNLSNNIFNGTLPQELSNLFNLQVL  142

Query  575   DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  754
             DLYNNN+TG LPV V  ++ LRHLHLGGN+F+G+IPPEYG + +LEYLAVSGN LSG IP
Sbjct  143   DLYNNNMTGSLPVSVTHLSFLRHLHLGGNFFTGKIPPEYGSWTHLEYLAVSGNELSGHIP  202

Query  755   SEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDT  934
              EIGN+T LKELYIGY+N + GGIPPE+GNLS+++RFDAA CGLTGE+P E+GKL+ LDT
Sbjct  203   PEIGNITSLKELYIGYYNTYDGGIPPEIGNLSEMVRFDAAYCGLTGEVPPELGKLQKLDT  262

Query  935   LFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             LFLQVN LSGSL  E+G LK+LKS+DLSNNAF+GE+P SF
Sbjct  263   LFLQVNALSGSLTSELGNLKSLKSMDLSNNAFTGEVPVSF  302


 Score = 98.2 bits (243),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 78/247 (32%), Positives = 119/247 (48%), Gaps = 25/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G + P++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN F    P   A+L
Sbjct  246   LTGEVPPELGKLQKLDTLFLQVNALSGSLTSELGNLKSLKSMDLSNNAFTGEVPVSFAEL  305

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  + +M SL  L +  N F+G IP   G+   L  + VS N 
Sbjct  306   KNLTLLNLFRNKLHGAIPEFIGEMPSLEVLQIWENNFTGSIPQSLGKNGKLTLVDVSSNK  365

Query  737   LSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+G                         IP  +G    L  + +G  N  +G IP  +  
Sbjct  366   LTGSLPPFMCFGNKLQTLIALGNFLFGPIPDSLGKCKSLNRIRMGE-NFLNGSIPKGLFG  424

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L +L + +  +  L+G  P  +    NL  + L  N LSG L P IG   +++ L L  N
Sbjct  425   LPELTQVELQDNLLSGNFPQPVSMSINLGQVTLSNNKLSGPLPPSIGNFTSVQKLILDGN  484

Query  1025  AFSGEIP  1045
              FSG+IP
Sbjct  485   QFSGKIP  491


 Score = 98.2 bits (243),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 102/204 (50%), Gaps = 1/204 (0%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             L+G L P +     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  365  KLTGSLPPFMCFGNKLQTLIALGNFLFGPIPDSLGKCKSLNRIRMGENFLNGSIPKGLFG  424

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L  L  ++L +N L+G+ P  V    +L  + L  N  SG +PP  G F +++ L + GN
Sbjct  425  LPELTQVELQDNLLSGNFPQPVSMSINLGQVTLSNNKLSGPLPPSIGNFTSVQKLILDGN  484

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              SG IP+EIG L +L ++   + N FSG I PE+ +   L   D +   L+GE+P EI 
Sbjct  485  QFSGKIPAEIGKLHQLSKIDFSH-NKFSGPIAPEISHCKLLTFVDLSRNELSGEIPKEIT  543

Query  914  KLKNLDTLFLQVNDLSGSLAPEIG  985
            K+K L+ L L  N L G++   I 
Sbjct  544  KMKILNYLNLSRNHLVGTIPGSIA  567


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/196 (33%), Positives = 100/196 (51%), Gaps = 1/196 (1%)
 Frame = +2

Query  383  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  562
            G + P++G L  +V    A   L+G VPPE+  +  L  L L  N    +   +L  L +
Sbjct  224  GGIPPEIGNLSEMVRFDAAYCGLTGEVPPELGKLQKLDTLFLQVNALSGSLTSELGNLKS  283

Query  563  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  742
            L+ +DL NN  TG++PV   ++ +L  L+L  N   G IP   G  P+LE L +  N  +
Sbjct  284  LKSMDLSNNAFTGEVPVSFAELKNLTLLNLFRNKLHGAIPEFIGEMPSLEVLQIWENNFT  343

Query  743  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLK  922
            G IP  +G   KL  + +   N  +G +PP M   ++L    A    L G +P  +GK K
Sbjct  344  GSIPQSLGKNGKLTLVDVSS-NKLTGSLPPFMCFGNKLQTLIALGNFLFGPIPDSLGKCK  402

Query  923  NLDTLFLQVNDLSGSL  970
            +L+ + +  N L+GS+
Sbjct  403  SLNRIRMGENFLNGSI  418


 Score = 85.5 bits (210),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/203 (31%), Positives = 99/203 (49%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP  ++  
Sbjct  390  LFGPIPDSLGKCKSLNRIRMGENFLNGSIPKGLFGLPELTQVELQDNLLSGNFPQPVSMS  449

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL  + L NN L+G LP  +   TS++ L L GN FSG+IP E G+   L  +  S N 
Sbjct  450  INLGQVTLSNNKLSGPLPPSIGNFTSVQKLILDGNQFSGKIPAEIGKLHQLSKIDFSHNK  509

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             SG I  EI +   L  + +   N  SG IP E+  +  L   + +   L G +P  I  
Sbjct  510  FSGPIAPEISHCKLLTFVDLSR-NELSGEIPKEITKMKILNYLNLSRNHLVGTIPGSIAS  568

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            +++L ++    N+L+G L P  G
Sbjct  569  MQSLTSVDFSYNNLTG-LVPGTG  590



>ref|XP_010941985.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1024

 Score =   303 bits (777),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 180/294 (61%), Positives = 221/294 (75%), Gaps = 4/294 (1%)
 Frame = +2

Query  176   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvv  352
             R SA A  G  +G  E  ALL +KAA   D   +L  W+ +  HC  W  V CD+   VV
Sbjct  16    RPSAAASGGGRVG--EHRALLDLKAAL-GDPSGALAGWDAAADHCQAWVGVACDAAGRVV  72

Query  353   sldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  532
             SL++S LNLSG L P V +L  L+ LS AANQLSGP+PPE+S +S LRFLNLSNN F  T
Sbjct  73    SLNISNLNLSGPLPPAVSRLRSLLRLSTAANQLSGPIPPELSLLSGLRFLNLSNNAFNET  132

Query  533   FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE  712
             FP  L++L NL VLDLYNNNLTG LP+EV ++ +LRHLHLGGN+FSG IPPEYGR+ +LE
Sbjct  133   FPSALSRLKNLHVLDLYNNNLTGVLPLEVAELPALRHLHLGGNFFSGAIPPEYGRWEHLE  192

Query  713   YLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTG  892
             YLAVSGN L G IP E+GN+T L+ELYIGYFN F G +P  +GN++ L+R DAANCGL+G
Sbjct  193   YLAVSGNELGGPIPPELGNVTTLRELYIGYFNSFQGSLPAAIGNITALVRLDAANCGLSG  252

Query  893   ELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             ++P EIG L+NLDTLFLQVN LSG + PE+G L++LKS+DLSNNA +GEIP +F
Sbjct  253   KIPPEIGNLQNLDTLFLQVNGLSGGITPELGMLRSLKSMDLSNNALTGEIPRTF  306


 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 80/249 (32%), Positives = 114/249 (46%), Gaps = 27/249 (11%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG + P++G L  L  L +  N LSG + PE+  + +L+ ++LSNN      P   A+L
Sbjct  250   LSGKIPPEIGNLQNLDTLFLQVNGLSGGITPELGMLRSLKSMDLSNNALTGEIPRTFAEL  309

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  310   KNLTLLNLFRNRLHGAIPDLIGDLPRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNK  369

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L+G +P  + +   L+ L I   N   G IP  +G    L R       L G +P  +  
Sbjct  370   LTGSLPPNLCSGNNLQVL-IALGNFLFGSIPESLGRCKSLSRIRMGENYLNGSIPSGLFS  428

Query  917   LKNLDTLFLQV--------------------------NDLSGSLAPEIGYlknlksldls  1018
             L NL  + LQ                           N LSG+L P IG    ++ L L+
Sbjct  429   LPNLAQVELQDNLLTGGFPETAGSSISSTLGQISLSNNRLSGALPPSIGKFSGVQKLLLN  488

Query  1019  nnAFSGEIP  1045
              N FSG IP
Sbjct  489   QNQFSGRIP  497


 Score = 95.5 bits (236),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 117/252 (46%), Gaps = 27/252 (11%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L G +   +G LP L  L +  N  +G +P  +     L+ L+LS+N    + P  L   
Sbjct  322   LHGAIPDLIGDLPRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPNLCSG  381

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEY-------  715
              NLQVL    N L G +P  + +  SL  + +G NY +G IP      PNL         
Sbjct  382   NNLQVLIALGNFLFGSIPESLGRCKSLSRIRMGENYLNGSIPSGLFSLPNLAQVELQDNL  441

Query  716   -------------------LAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  838
                                +++S N LSG +P  IG  + +++L +   N FSG IP E+
Sbjct  442   LTGGFPETAGSSISSTLGQISLSNNRLSGALPPSIGKFSGVQKLLLNQ-NQFSGRIPLEI  500

Query  839   GNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldls  1018
             G L QL + D +    +G +  EI K K L  + L  N+LSG +  EI  ++ L  L+LS
Sbjct  501   GRLQQLSKMDFSGNRFSGPITPEIRKCKLLTFVDLSRNNLSGEIPAEITGMRILNYLNLS  560

Query  1019  nnAFSGEIPESF  1054
              N   GEIP S 
Sbjct  561   RNHLEGEIPASI  572


 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 98/199 (49%), Gaps = 1/199 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            +  G L   +G +  LV L  A   LSG +PPEI  +  L  L L  N        +L  
Sbjct  225  SFQGSLPAAIGNITALVRLDAANCGLSGKIPPEIGNLQNLDTLFLQVNGLSGGITPELGM  284

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L +L+ +DL NN LTG++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  285  LRSLKSMDLSNNALTGEIPRTFAELKNLTLLNLFRNRLHGAIPDLIGDLPRLEVLQLWEN  344

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              +G IP  +G   +L+ L +   N  +G +PP + + + L    A    L G +P  +G
Sbjct  345  NFTGEIPRRLGTNGRLQLLDLSS-NKLTGSLPPNLCSGNNLQVLIALGNFLFGSIPESLG  403

Query  914  KLKNLDTLFLQVNDLSGSL  970
            + K+L  + +  N L+GS+
Sbjct  404  RCKSLSRIRMGENYLNGSI  422


 Score = 86.3 bits (212),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 73/226 (32%), Positives = 109/226 (48%), Gaps = 3/226 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  369   KLTGSLPPNLCSGNNLQVLIALGNFLFGSIPESLGRCKSLSRIRMGENYLNGSIPSGLFS  428

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  727
             L NL  ++L +N LTG  P       S  L  + L  N  SG +PP  G+F  ++ L ++
Sbjct  429   LPNLAQVELQDNLLTGGFPETAGSSISSTLGQISLSNNRLSGALPPSIGKFSGVQKLLLN  488

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
              N  SG IP EIG L +L ++     N FSG I PE+     L   D +   L+GE+P E
Sbjct  489   QNQFSGRIPLEIGRLQQLSKMDFSG-NRFSGPITPEIRKCKLLTFVDLSRNNLSGEIPAE  547

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             I  ++ L+ L L  N L G +   I  +++L ++D S N  SG +P
Sbjct  548   ITGMRILNYLNLSRNHLEGEIPASISTMQSLTAVDFSYNNLSGLVP  593



>emb|CDY08759.1| BnaA06g24650D [Brassica napus]
Length=971

 Score =   301 bits (771),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 166/282 (59%), Positives = 205/282 (73%), Gaps = 27/282 (10%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSS-LTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  391
             ++E  ALLS+K++ T D+ +S L SW  +TS CTW  VTC                    
Sbjct  23    ISEFRALLSLKSSLTGDAPNSPLASWKPTTSFCTWTGVTC--------------------  62

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQ  568
               DV +     NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +++  LANL+
Sbjct  63    --DVSRRH---NLSLADNQISGPIPPEISNLSGLRHLNLSNNVFNGSFPDKISSGLANLR  117

Query  569   VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  748
             VLD+YNNN+TGDLP+ V  +T LRHLHLGGNYF+G IPP YG +P +EYLAVSGN L+G 
Sbjct  118   VLDVYNNNMTGDLPLSVTNLTQLRHLHLGGNYFAGEIPPSYGTWPEIEYLAVSGNELTGK  177

Query  749   IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNL  928
             IP EIGNLT L+ELYIGYFN F  G+PPE+GNLS+L+RFDAANC L GE+P EIG+L+ L
Sbjct  178   IPPEIGNLTTLRELYIGYFNAFEDGLPPEIGNLSELVRFDAANCALNGEIPPEIGRLQKL  237

Query  929   DTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             DTLFLQVN  SG L  E+G L +LKS+DLSNN F+GEIP SF
Sbjct  238   DTLFLQVNVFSGPLTWELGKLSSLKSMDLSNNMFTGEIPASF  279


 Score =   105 bits (262),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 86/247 (35%), Positives = 121/247 (49%), Gaps = 25/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   + L
Sbjct  223   LNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNNMFTGEIPASFSDL  282

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP---EYGRF---------  700
              NL +L+L+ N L G++P  + ++  L  L L  N F+G IP    E GR          
Sbjct  283   KNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIPEKLGENGRLHLVDLSSNK  342

Query  701   ------PN------LEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
                   PN      LE L   GN L G IP  +G    L  + +G  N  +G IP  +  
Sbjct  343   LTGTLPPNMCAGNKLETLITLGNFLFGSIPESLGRCESLTRIRMGE-NFLNGSIPKGLFG  401

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L +L + +  +  LTGELPV      NL  L L  N LSG L P IG    ++ L L  N
Sbjct  402   LPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSNNQLSGQLPPAIGNFTGVQKLLLDGN  461

Query  1025  AFSGEIP  1045
              F G IP
Sbjct  462   KFEGPIP  468


 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 114/224 (51%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  342   KLTGTLPPNMCAGNKLETLITLGNFLFGSIPESLGRCESLTRIRMGENFLNGSIPKGLFG  401

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N LTG+LPV      +L  L L  N  SG++PP  G F  ++ L + GN
Sbjct  402   LPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSNNQLSGQLPPAIGNFTGVQKLLLDGN  461

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
                G IPSE+G L +L ++   + N FSGGI PE+     L   D +   L+GE+P EI 
Sbjct  462   KFEGPIPSEVGKLQQLSKIDFSH-NLFSGGIAPEISRCKLLTFVDLSRNELSGEIPKEIT  520

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              +K L+ L L  N L GS+   I  +++L SLD S N  SG +P
Sbjct  521   GMKILNYLNLSRNHLIGSIPGSISSMQSLTSLDFSYNNLSGLVP  564


 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 113/227 (50%), Gaps = 2/227 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              +G + P  G  P +  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  150   FAGEIPPSYGTWPEIEYLAVSGNELTGKIPPEIGNLTTLRELYIGYFNAFEDGLPPEIGN  209

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L+ L   D  N  L G++P E+ ++  L  L L  N FSG +  E G+  +L+ + +S N
Sbjct  210   LSELVRFDAANCALNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNN  269

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               +G IP+   +L  L  L + + N   G IP  +G L  L          TG +P ++G
Sbjct  270   MFTGEIPASFSDLKNLTLLNL-FRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIPEKLG  328

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             +   L  + L  N L+G+L P +     L++L    N   G IPES 
Sbjct  329   ENGRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNFLFGSIPESL  375


 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 109/204 (53%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   L  + +++N+L+G +PP + A + L   + L N +FGS  P  L 
Sbjct  318  NFTGSIPEKLGENGRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNFLFGS-IPESLG  376

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P       NL  L++S 
Sbjct  377  RCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSN  436

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +P  IGN T +++L +   N F G IP E+G L QL + D ++   +G +  EI
Sbjct  437  NQLSGQLPPAIGNFTGVQKLLLDG-NKFEGPIPSEVGKLQQLSKIDFSHNLFSGGIAPEI  495

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  + L  N+LSG +  EI
Sbjct  496  SRCKLLTFVDLSRNELSGEIPKEI  519



>ref|XP_009394785.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score =   301 bits (772),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 174/282 (62%), Positives = 218/282 (77%), Gaps = 3/282 (1%)
 Frame = +2

Query  218   TEQAALLSIKAAFTADSQSSLTSWNISTS--HCTWRRVTCd-sllhvvsldlsglNLSGV  388
             ++  ALLS+KA F+  + + L++WN S    HC+W  V+CD     VVSLDL+GLNLSG 
Sbjct  30    SDVEALLSLKADFSDATSAVLSAWNSSADDDHCSWPGVSCDPLQGFVVSLDLTGLNLSGT  89

Query  389   LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  568
             LSP VG+L  L+NLS A+N LSGP+P E+S +S LR LNLSNN+F  +FP  LA+L NL 
Sbjct  90    LSPAVGRLRHLLNLSAASNSLSGPIPAELSRLSDLRHLNLSNNLFNGSFPSALARLKNLL  149

Query  569   VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  748
             VLDLYNNNLTG LP EV ++  LRHLHLGGN+F+G IPPE+GR+  LEYLAVSGN L G 
Sbjct  150   VLDLYNNNLTGPLPTEVAELPELRHLHLGGNFFTGVIPPEFGRWEFLEYLAVSGNELGGP  209

Query  749   IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNL  928
             IP E+G LT L++LY+GYFN F G IPPE+G L+ L+R D ANCGL+GE+P E+G L+NL
Sbjct  210   IPPELGKLTTLRQLYLGYFNSFEGRIPPEIGGLAALVRLDMANCGLSGEIPPELGNLQNL  269

Query  929   DTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             DT+FLQVN L+G L PE+G L+NLKS+DLSNNA +GEIP +F
Sbjct  270   DTIFLQVNGLTGDLPPEMGRLRNLKSMDLSNNALAGEIPATF  311


 Score =   110 bits (275),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 78/249 (31%), Positives = 123/249 (49%), Gaps = 26/249 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR--------------------  496
              +GV+ P+ G+  FL  L+++ N+L GP+PPE+  ++TLR                    
Sbjct  182   FTGVIPPEFGRWEFLEYLAVSGNELGGPIPPELGKLTTLRQLYLGYFNSFEGRIPPEIGG  241

Query  497   -----FLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  661
                   L+++N       P +L  L NL  + L  N LTGDLP E+ ++ +L+ + L  N
Sbjct  242   LAALVRLDMANCGLSGEIPPELGNLQNLDTIFLQVNGLTGDLPPEMGRLRNLKSMDLSNN  301

Query  662   YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
               +G IP  +    NL  L +  N L G IP  I +L  L+ L + + N F+GGIP  +G
Sbjct  302   ALAGEIPATFADLQNLTLLNLFRNKLHGSIPEFIADLPTLEVLQL-WENNFTGGIPRRLG  360

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
                QL   D ++  LTG LP ++     L TL +  N L G +   +G  ++L  + +  
Sbjct  361   QSGQLELLDLSSNKLTGNLPPDLCSGNRLQTLIVLGNFLFGPIPDTLGRCESLSRIRMGE  420

Query  1022  nAFSGEIPE  1048
             N  +G IP+
Sbjct  421   NYLNGSIPD  429


 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 81/272 (30%), Positives = 119/272 (44%), Gaps = 49/272 (18%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G L P++G+L  L ++ ++ N L+G +P   + +  L  LNL  N    + P  +A L
Sbjct  279   LTGDLPPEMGRLRNLKSMDLSNNALAGEIPATFADLQNLTLLNLFRNKLHGSIPEFIADL  338

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L+VL L+ NN TG +P  + +   L  L L  N  +G +PP+      L+ L V GN 
Sbjct  339   PTLEVLQLWENNFTGGIPRRLGQSGQLELLDLSSNKLTGNLPPDLCSGNRLQTLIVLGNF  398

Query  737   LSGVIPSEIGNLTKLKELYIG--YFNG---------------------------------  811
             L G IP  +G    L  + +G  Y NG                                 
Sbjct  399   LFGPIPDTLGRCESLSRIRMGENYLNGSIPDGLLSLPRLSQIELQDNLLTGGFPDTGAAL  458

Query  812   --------------FSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQV  949
                            SG +PP +GN S + +        +G +P EIG+L+ L  +    
Sbjct  459   ISPDLGQISLSNNRLSGPLPPSVGNFSGVQKLLLNQNQFSGRIPPEIGRLQQLSKVDFSG  518

Query  950   NDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             N  SG ++PEI   K L  +DLS N  SGEIP
Sbjct  519   NQFSGLISPEISQCKLLTFVDLSRNELSGEIP  550


 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 103/203 (51%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P++G L  L  + +  N L+G +PPE+  +  L+ ++LSNN      P   A L
Sbjct  255  LSGEIPPELGNLQNLDTIFLQVNGLTGDLPPEMGRLRNLKSMDLSNNALAGEIPATFADL  314

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL +L+L+ N L G +P  +  + +L  L L  N F+G IP   G+   LE L +S N 
Sbjct  315  QNLTLLNLFRNKLHGSIPEFIADLPTLEVLQLWENNFTGGIPRRLGQSGQLELLDLSSNK  374

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P ++ +  +L+ L +   N   G IP  +G    L R       L G +P  +  
Sbjct  375  LTGNLPPDLCSGNRLQTLIV-LGNFLFGPIPDTLGRCESLSRIRMGENYLNGSIPDGLLS  433

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            L  L  + LQ N L+G   P+ G
Sbjct  434  LPRLSQIELQDNLLTGGF-PDTG  455


 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 111/226 (49%), Gaps = 3/226 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L PD+     L  L +  N L GP+P  +    +L  + +  N    + P  L  
Sbjct  374   KLTGNLPPDLCSGNRLQTLIVLGNFLFGPIPDTLGRCESLSRIRMGENYLNGSIPDGLLS  433

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  727
             L  L  ++L +N LTG  P     + S  L  + L  N  SG +PP  G F  ++ L ++
Sbjct  434   LPRLSQIELQDNLLTGGFPDTGAALISPDLGQISLSNNRLSGPLPPSVGNFSGVQKLLLN  493

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
              N  SG IP EIG L +L ++     N FSG I PE+     L   D +   L+GE+P E
Sbjct  494   QNQFSGRIPPEIGRLQQLSKVDFSG-NQFSGLISPEISQCKLLTFVDLSRNELSGEIPSE  552

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             I  ++ L+ L L  N L G++   I  +++L ++D S N  SG +P
Sbjct  553   ITGMRILNYLNLSRNQLEGNIPSSIATMQSLTAIDFSYNNLSGLVP  598


 Score = 89.4 bits (220),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 71/229 (31%), Positives = 118/229 (52%), Gaps = 3/229 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             N +G +   +GQ   L  L +++N+L+G +PP++ + + L+ L +  N      P  L +
Sbjct  350   NFTGGIPRRLGQSGQLELLDLSSNKLTGNLPPDLCSGNRLQTLIVLGNFLFGPIPDTLGR  409

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRF--PNLEYLAVS  727
               +L  + +  N L G +P  +  +  L  + L  N  +G  P        P+L  +++S
Sbjct  410   CESLSRIRMGENYLNGSIPDGLLSLPRLSQIELQDNLLTGGFPDTGAALISPDLGQISLS  469

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
              N LSG +P  +GN + +++L +   N FSG IPPE+G L QL + D +    +G +  E
Sbjct  470   NNRLSGPLPPSVGNFSGVQKLLLNQ-NQFSGRIPPEIGRLQQLSKVDFSGNQFSGLISPE  528

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             I + K L  + L  N+LSG +  EI  ++ L  L+LS N   G IP S 
Sbjct  529   ISQCKLLTFVDLSRNELSGEIPSEITGMRILNYLNLSRNQLEGNIPSSI  577



>ref|XP_010936307.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1007

 Score =   301 bits (771),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 177/282 (63%), Positives = 222/282 (79%), Gaps = 5/282 (2%)
 Frame = +2

Query  221   EQAALLSIKAAFTADSQSSLTSWNISTS--HCTWRRVTCdsl--lhvvsldlsglNLSGV  388
             E+ ALLS+K+A + D  ++L  WN S +  HC+W  V CD      V++LDLSGLNLSG 
Sbjct  33    ERVALLSLKSALS-DPGAALAGWNASANPDHCSWPGVACDDAPLRRVIALDLSGLNLSGS  91

Query  389   LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  568
             L P V  L  L+NLS AAN LSGP+P ++S +S LR+LNLSNN+F  +FP  L +L NL+
Sbjct  92    LPPAVAHLRHLLNLSTAANLLSGPIPLDLSLLSDLRYLNLSNNVFNGSFPSALRRLKNLE  151

Query  569   VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  748
             VLDLYNNNLTG LP EV  + +LRHLHLGGN+FSG IP EYGR+ +LEYLAVSGN LSG 
Sbjct  152   VLDLYNNNLTGILPAEVADLHNLRHLHLGGNFFSGVIPREYGRWEHLEYLAVSGNELSGA  211

Query  749   IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNL  928
             IP EIGNLT+L++LY+GYFN + GGIPPE+G+LS L+RFDAANCGL+G++P E+G L++L
Sbjct  212   IPPEIGNLTRLRQLYVGYFNSYDGGIPPEIGHLSALVRFDAANCGLSGQIPPELGHLEHL  271

Query  929   DTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             DTLFLQVN LSG L PE+G L++LKS+DLSNNA +GEIP +F
Sbjct  272   DTLFLQVNGLSGELPPELGRLRSLKSMDLSNNALTGEIPPTF  313


 Score =   105 bits (262),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 114/225 (51%), Gaps = 2/225 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             LSG + P++G L  L  L +   N   G +PPEI  +S L   + +N       P +L  
Sbjct  208   LSGAIPPEIGNLTRLRQLYVGYFNSYDGGIPPEIGHLSALVRFDAANCGLSGQIPPELGH  267

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L +L  L L  N L+G+LP E+ ++ SL+ + L  N  +G IPP +    NL  L +  N
Sbjct  268   LEHLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNNALTGEIPPTFADLRNLTLLNLFRN  327

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  IG+L +L+ L + + N F+G IP  +G   +L   D ++  LTG+LP E+ 
Sbjct  328   KLYGTIPDFIGDLPELEVLQL-WDNNFTGIIPRGIGRSGKLQLLDLSSNKLTGDLPPELC  386

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPE  1048
                 L TL    N L G +   +G   +L  + L  N  +G IP 
Sbjct  387   SGNKLQTLIALANALFGPIPQSLGECLSLSRVRLGENYLNGSIPR  431


 Score =   104 bits (259),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 73/203 (36%), Positives = 104/203 (51%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P++G L  L  L +  N LSG +PPE+  + +L+ ++LSNN      P   A L
Sbjct  257  LSGQIPPELGHLEHLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNNALTGEIPPTFADL  316

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   GR   L+ L +S N 
Sbjct  317  RNLTLLNLFRNKLYGTIPDFIGDLPELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNK  376

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P E+ +  KL+ L I   N   G IP  +G    L R       L G +P  +  
Sbjct  377  LTGDLPPELCSGNKLQTL-IALANALFGPIPQSLGECLSLSRVRLGENYLNGSIPRGLFS  435

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            L NL  + LQ N L+G   P+ G
Sbjct  436  LPNLAQVELQDNLLAGEF-PDTG  457


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 114/226 (50%), Gaps = 3/226 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L  L   AN L GP+P  +    +L  + L  N    + P  L  
Sbjct  376   KLTGDLPPELCSGNKLQTLIALANALFGPIPQSLGECLSLSRVRLGENYLNGSIPRGLFS  435

Query  554   LANLQVLDLYNNNLTGDLPV--EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  727
             L NL  ++L +N L G+ P   +V     L  + L  N  SG +PP  G F  ++ L ++
Sbjct  436   LPNLAQVELQDNLLAGEFPDTGDVSISLGLGQISLSNNRLSGPLPPSIGNFSGVQKLLLN  495

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
              N  SG IP EIG L +L ++     N FS GIPPE+     L   D +   L+G++P E
Sbjct  496   QNQFSGRIPPEIGRLQQLSKVDFSS-NRFSSGIPPEISKCKLLTFVDLSRNNLSGDIPAE  554

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             I  ++ L+ L L  N L GS+ P I  +++L ++D S N  SG +P
Sbjct  555   IAGMRILNYLNLSRNHLEGSIPPSISTMQSLTAVDFSYNNLSGLVP  600


 Score = 98.6 bits (244),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 91/300 (30%), Positives = 131/300 (44%), Gaps = 75/300 (25%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG L P++G+L  L ++ ++ N L+G +PP  + +  L  LNL  N    T P  +  L
Sbjct  281   LSGELPPELGRLRSLKSMDLSNNALTGEIPPTFADLRNLTLLNLFRNKLYGTIPDFIGDL  340

Query  557   ANLQVLDLYNNN------------------------LTGDLPVEVY--------------  622
               L+VL L++NN                        LTGDLP E+               
Sbjct  341   PELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNKLTGDLPPELCSGNKLQTLIALANA  400

Query  623   ----------KMTSLRHLHLGGNYFSGRIPPEYGRFPNLEY-------------------  715
                       +  SL  + LG NY +G IP      PNL                     
Sbjct  401   LFGPIPQSLGECLSLSRVRLGENYLNGSIPRGLFSLPNLAQVELQDNLLAGEFPDTGDVS  460

Query  716   -------LAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAA  874
                    +++S N LSG +P  IGN + +++L +   N FSG IPPE+G L QL + D +
Sbjct  461   ISLGLGQISLSNNRLSGPLPPSIGNFSGVQKLLLNQ-NQFSGRIPPEIGRLQQLSKVDFS  519

Query  875   NCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             +   +  +P EI K K L  + L  N+LSG +  EI  ++ L  L+LS N   G IP S 
Sbjct  520   SNRFSSGIPPEISKCKLLTFVDLSRNNLSGDIPAEIAGMRILNYLNLSRNHLEGSIPPSI  579



>ref|XP_007156674.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
 gb|ESW28668.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
Length=1005

 Score =   301 bits (770),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 179/282 (63%), Positives = 226/282 (80%), Gaps = 0/282 (0%)
 Frame = +2

Query  209   LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGV  388
             L  +E  ALLS+++A T  +   L+SWN STS+C+W  VTCDS  HV++L+L+GL+LSG 
Sbjct  18    LPFSEYTALLSLRSAITDATPPVLSSWNASTSYCSWLGVTCDSHRHVIALNLTGLDLSGT  77

Query  389   LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  568
             LS D+  LPFL NLS+A N+ SGP+PP +S++S+LR LNLSNN F  TFP +L++L +L+
Sbjct  78    LSADIAHLPFLSNLSLATNKFSGPIPPALSSLSSLRLLNLSNNGFNQTFPPELSRLQSLE  137

Query  569   VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  748
             VLDLYNNN+TG LP+   +M +LRHLHLGGN+FSGRIPPEYG++  LEYLAVSGN L G 
Sbjct  138   VLDLYNNNMTGALPLAAAQMLNLRHLHLGGNFFSGRIPPEYGQWQRLEYLAVSGNELEGK  197

Query  749   IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNL  928
             IP EIGNLT L+ELYIGY+N + GGIPPE+GNLS+L+R DAA CGL+GE+   +GKL+ L
Sbjct  198   IPPEIGNLTSLRELYIGYYNTYEGGIPPEIGNLSELVRLDAAYCGLSGEITAALGKLQKL  257

Query  929   DTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             DTLFLQVN LSG L PE+G LK+LKS+DLSNN  SGEIP +F
Sbjct  258   DTLFLQVNALSGPLTPELGNLKSLKSMDLSNNMLSGEIPATF  299


 Score = 98.2 bits (243),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 69/204 (34%), Positives = 108/204 (53%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   L  L I++N+L+G +PP + + +TL+  + L N +FG   P  L 
Sbjct  338  NFTGSIPEGLGKNGRLSVLDISSNKLTGALPPYLCSGNTLQTLITLENFLFG-PIPEALG  396

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
               +L  + +  N L G +P  ++ +  L  + L  NY SG  P       NL  + +S 
Sbjct  397  SCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGGFPEAGSVAVNLGQITLSN  456

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +P  IGN + +++L +   N FSG IPP++G L QL + D +    +G +  EI
Sbjct  457  NQLSGPLPPSIGNFSSVQKLLLD-GNMFSGPIPPQIGRLQQLSKIDFSGNKFSGRIEPEI  515

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  L L  NDLSG +  EI
Sbjct  516  SQCKLLTFLDLSRNDLSGEIPNEI  539


 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 105/203 (52%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG ++  +G+L  L  L +  N LSGP+ PE+  + +L+ ++LSNN+     P   ++L
Sbjct  243  LSGEITAALGKLQKLDTLFLQVNALSGPLTPELGNLKSLKSMDLSNNMLSGEIPATFSEL  302

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             N+ +L+L+ N L G +P  + ++ SL  + L  N F+G IP   G+   L  L +S N 
Sbjct  303  KNITLLNLFRNKLHGAIPEFIGELPSLEVVQLWENNFTGSIPEGLGKNGRLSVLDISSNK  362

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P  + +   L+ L I   N   G IP  +G+   L R       L G +P  +  
Sbjct  363  LTGALPPYLCSGNTLQTL-ITLENFLFGPIPEALGSCESLTRIRMGENFLNGSIPKGLFG  421

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            L  L  + LQ N LSG   PE G
Sbjct  422  LPKLTQVELQDNYLSGGF-PEAG  443


 Score = 92.4 bits (228),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 73/224 (33%), Positives = 110/224 (49%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P +     L  L    N L GP+P  + +  +L  + +  N    + P  L  
Sbjct  362   KLTGALPPYLCSGNTLQTLITLENFLFGPIPEALGSCESLTRIRMGENFLNGSIPKGLFG  421

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N L+G  P       +L  + L  N  SG +PP  G F +++ L + GN
Sbjct  422   LPKLTQVELQDNYLSGGFPEAGSVAVNLGQITLSNNQLSGPLPPSIGNFSSVQKLLLDGN  481

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               SG IP +IG L +L ++     N FSG I PE+     L   D +   L+GE+P EI 
Sbjct  482   MFSGPIPPQIGRLQQLSKIDFS-GNKFSGRIEPEISQCKLLTFLDLSRNDLSGEIPNEIT  540

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L S+D S N  SG +P
Sbjct  541   GMRILNCLNLSSNHLVGSIPSSISSMQSLTSVDFSYNNLSGLVP  584


 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 97/203 (48%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G +   +G    L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  387  LFGPIPEALGSCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGGFPEAGSVA  446

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL  + L NN L+G LP  +   +S++ L L GN FSG IPP+ GR   L  +  SGN 
Sbjct  447  VNLGQITLSNNQLSGPLPPSIGNFSSVQKLLLDGNMFSGPIPPQIGRLQQLSKIDFSGNK  506

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             SG I  EI     L  L +   N  SG IP E+  +  L   + ++  L G +P  I  
Sbjct  507  FSGRIEPEISQCKLLTFLDLSR-NDLSGEIPNEITGMRILNCLNLSSNHLVGSIPSSISS  565

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            +++L ++    N+LSG L P  G
Sbjct  566  MQSLTSVDFSYNNLSG-LVPGTG  587


 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 94/196 (48%), Gaps = 1/196 (1%)
 Frame = +2

Query  383  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  562
            G + P++G L  LV L  A   LSG +   +  +  L  L L  N        +L  L +
Sbjct  221  GGIPPEIGNLSELVRLDAAYCGLSGEITAALGKLQKLDTLFLQVNALSGPLTPELGNLKS  280

Query  563  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  742
            L+ +DL NN L+G++P    ++ ++  L+L  N   G IP   G  P+LE + +  N  +
Sbjct  281  LKSMDLSNNMLSGEIPATFSELKNITLLNLFRNKLHGAIPEFIGELPSLEVVQLWENNFT  340

Query  743  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLK  922
            G IP  +G   +L  L I   N  +G +PP + + + L         L G +P  +G  +
Sbjct  341  GSIPEGLGKNGRLSVLDISS-NKLTGALPPYLCSGNTLQTLITLENFLFGPIPEALGSCE  399

Query  923  NLDTLFLQVNDLSGSL  970
            +L  + +  N L+GS+
Sbjct  400  SLTRIRMGENFLNGSI  415



>ref|XP_009395647.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1004

 Score =   296 bits (759),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 169/265 (64%), Positives = 208/265 (78%), Gaps = 1/265 (0%)
 Frame = +2

Query  263   DSQSSLTSWNISTSHCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIA  439
             D   +L +WN +  HC+W  V CD   + V+SLDL+GLNLSG LSP VG+L  LVNLS A
Sbjct  46    DPSGALYAWNSADGHCSWPGVACDPIRVFVLSLDLTGLNLSGTLSPAVGRLHHLVNLSTA  105

Query  440   ANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEV  619
             +N LSGP+P E+S +S LR LNLSNN+F  +FP   ++L NL VLDLYNNNL G LP EV
Sbjct  106   SNSLSGPLPAELSHLSNLRHLNLSNNLFNGSFPSAFSRLKNLLVLDLYNNNLAGTLPPEV  165

Query  620   YKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIG  799
              ++ +L HLHLGGN+FSG IPPE+G +  LEYLAVSGN L G IP E+GNLT+L++LY+G
Sbjct  166   SELPNLLHLHLGGNFFSGVIPPEFGHWEFLEYLAVSGNELGGPIPPELGNLTRLRQLYVG  225

Query  800   YFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPE  979
             YFN F GGIPPE+G LS+L+R D ANCGLTG++P E+GKL+NLDTLFLQVN LSG L PE
Sbjct  226   YFNSFEGGIPPEIGGLSELVRLDMANCGLTGDIPPELGKLQNLDTLFLQVNGLSGRLPPE  285

Query  980   IGYlknlksldlsnnAFSGEIPESF  1054
             +G L++LKS+DLSNNA +GEIP SF
Sbjct  286   LGGLRSLKSMDLSNNALTGEIPGSF  310


 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 79/227 (35%), Positives = 120/227 (53%), Gaps = 2/227 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              SGV+ P+ G   FL  L+++ N+L GP+PPE+  ++ LR L +   N F    P ++  
Sbjct  181   FSGVIPPEFGHWEFLEYLAVSGNELGGPIPPELGNLTRLRQLYVGYFNSFEGGIPPEIGG  240

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L+ L  LD+ N  LTGD+P E+ K+ +L  L L  N  SGR+PPE G   +L+ + +S N
Sbjct  241   LSELVRLDMANCGLTGDIPPELGKLQNLDTLFLQVNGLSGRLPPELGGLRSLKSMDLSNN  300

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L+G IP    +L  L  L + + N   G IP  +G+L  L          TG +P  +G
Sbjct  301   ALTGEIPGSFADLQNLTLLNL-FRNKLHGSIPEFVGDLPALEVLQLWENNFTGGIPRRLG  359

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             +   L  L +  N L+G+L P + +   L++L    N   G IPE+ 
Sbjct  360   QSGRLQILDISSNKLTGTLPPNLCFGNRLQTLIALGNFLFGSIPETL  406


 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 81/253 (32%), Positives = 116/253 (46%), Gaps = 27/253 (11%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L G +   VG LP L  L +  N  +G +P  +     L+ L++S+N    T P  L  
Sbjct  325   KLHGSIPEFVGDLPALEVLQLWENNFTGGIPRRLGQSGRLQILDISSNKLTGTLPPNLCF  384

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
                LQ L    N L G +P  + +  S+  + +G NY +G IP  +   P L  L +  N
Sbjct  385   GNRLQTLIALGNFLFGSIPETLGQCQSVSRIRMGENYLNGSIPDGFFSLPKLSQLELQDN  444

Query  734   GLSGV--------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPE  835
              L+GV                          +P  IGN + L++L +   N FSGGIPPE
Sbjct  445   LLAGVFPDTGAAAISPDLGQINLSNNRLLGPLPPSIGNFSGLQKLLLNQ-NQFSGGIPPE  503

Query  836   MGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldl  1015
             +G L QL + D +    +G +  EI + K L  + L  N LSG + PEI  ++ L  L+L
Sbjct  504   IGRLQQLSKVDFSGNQFSGPIAPEISRCKLLTFVDLSRNKLSGEILPEIAGMRILNYLNL  563

Query  1016  snnAFSGEIPESF  1054
             S N   G IP S 
Sbjct  564   SRNQLEGSIPPSI  576


 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 69/211 (33%), Positives = 106/211 (50%), Gaps = 9/211 (4%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L+G + P++G+L  L  L +  N LSG +PPE+  + +L+ ++LSNN      P   A L
Sbjct  254  LTGDIPPELGKLQNLDTLFLQVNGLSGRLPPELGGLRSLKSMDLSNNALTGEIPGSFADL  313

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL +L+L+ N L G +P  V  + +L  L L  N F+G IP   G+   L+ L +S N 
Sbjct  314  QNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWENNFTGGIPRRLGQSGRLQILDISSNK  373

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P  +    +L+ L I   N   G IP  +G    + R       L G +P     
Sbjct  374  LTGTLPPNLCFGNRLQTL-IALGNFLFGSIPETLGQCQSVSRIRMGENYLNGSIPDGFFS  432

Query  917  LKNLDTLFLQVNDLSG--------SLAPEIG  985
            L  L  L LQ N L+G        +++P++G
Sbjct  433  LPKLSQLELQDNLLAGVFPDTGAAAISPDLG  463


 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 101/199 (51%), Gaps = 1/199 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            +  G + P++G L  LV L +A   L+G +PPE+  +  L  L L  N      P +L  
Sbjct  229  SFEGGIPPEIGGLSELVRLDMANCGLTGDIPPELGKLQNLDTLFLQVNGLSGRLPPELGG  288

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L +L+ +DL NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N
Sbjct  289  LRSLKSMDLSNNALTGEIPGSFADLQNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWEN  348

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              +G IP  +G   +L+ L I   N  +G +PP +   ++L    A    L G +P  +G
Sbjct  349  NFTGGIPRRLGQSGRLQILDISS-NKLTGTLPPNLCFGNRLQTLIALGNFLFGSIPETLG  407

Query  914  KLKNLDTLFLQVNDLSGSL  970
            + +++  + +  N L+GS+
Sbjct  408  QCQSVSRIRMGENYLNGSI  426


 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 74/150 (49%), Gaps = 7/150 (5%)
 Frame = +2

Query  380  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  559
            +  +SPD+GQ    +NLS   N+L GP+PP I   S L+ L L+ N F    P ++ +L 
Sbjct  455  AAAISPDLGQ----INLS--NNRLLGPLPPSIGNFSGLQKLLLNQNQFSGGIPPEIGRLQ  508

Query  560  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  739
             L  +D   N  +G +  E+ +   L  + L  N  SG I PE      L YL +S N L
Sbjct  509  QLSKVDFSGNQFSGPIAPEISRCKLLTFVDLSRNKLSGEILPEIAGMRILNYLNLSRNQL  568

Query  740  SGVIPSEIGNLTKLKELYIGYFNGFSGGIP  829
             G IP  I  +  L  +   Y N FSG +P
Sbjct  569  EGSIPPSISTMQSLTAVDFSY-NNFSGLVP  597



>ref|XP_011626372.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 isoform X2 [Amborella trichopoda]
Length=966

 Score =   293 bits (751),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 162/279 (58%), Positives = 208/279 (75%), Gaps = 2/279 (1%)
 Frame = +2

Query  221   EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldl-sglNLSGVLSP  397
             E   LLS+KAA   D  +SL SWN ST +C+W  V CD+  + V     S  NL+G L+P
Sbjct  28    EYRYLLSLKAAII-DPDNSLQSWNSSTDYCSWSGVACDASSNHVVSLDLSARNLNGTLAP  86

Query  398   DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  577
             ++G+L  LVN+++A NQ +G +P EIS I+ L+ LNLSNN F + FP   + L NL+VLD
Sbjct  87    EIGRLRSLVNITVAENQFAGGIPLEISQINGLKLLNLSNNYFSANFPANFSGLKNLEVLD  146

Query  578   LYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPS  757
             LYNNNLTG LP+EV +M +LRHLHLGGN+F+G IPPEYG++  +EYLAVSGN L+G IP 
Sbjct  147   LYNNNLTGPLPLEVTEMEALRHLHLGGNFFTGTIPPEYGKWGFIEYLAVSGNELTGKIPG  206

Query  758   EIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTL  937
             E+GNLTKL++LY+GY+N + GGIPPE+GNLS L+R D ANC L+G +P E  KL+ LDTL
Sbjct  207   ELGNLTKLQQLYLGYYNIYEGGIPPELGNLSALVRLDMANCALSGSIPPEFRKLQKLDTL  266

Query  938   FLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             FLQVN LSG + PE+G LK+LKS+DLSNN   G+IP  F
Sbjct  267   FLQVNGLSGPITPELGSLKSLKSMDLSNNMLDGQIPVEF  305


 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 82/228 (36%), Positives = 118/228 (52%), Gaps = 7/228 (3%)
 Frame = +2

Query  377   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  547
             L+G + P +   G+L  L+ L    N L GP+P  +    +L  + +  N    + P  L
Sbjct  369   LTGSVPPQLCYGGKLTTLITLD---NFLFGPIPESLGECVSLARIRMGENYLNGSIPKGL  425

Query  548   AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  727
               L NL  ++L  N LTG+LP       +L  L L  N  SG++P   G+F +L+ L + 
Sbjct  426   LSLPNLVQVELQANYLTGNLPDSGKASENLGQLSLSNNRLSGQLPASIGKFSSLQKLLLD  485

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
             GNG SG IP +IG L +L +L     N FSG I PE+ N   L   D +   L G +P E
Sbjct  486   GNGFSGQIPPDIGKLQQLSKLDFSD-NKFSGEISPEITNCKLLTVVDLSGNELNGTIPSE  544

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
             I K++ L+ L L  N L G + P I  +++L S+D S N  SG +P S
Sbjct  545   ITKMRILNYLNLSRNHLMGGIPPSIQTMQSLTSVDFSYNNLSGLVPGS  592


 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 89/272 (33%), Positives = 132/272 (49%), Gaps = 48/272 (18%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG + P+  +L  L  L +  N LSGP+ PE+ ++ +L+ ++LSNN+     P + ++L
Sbjct  249   LSGSIPPEFRKLQKLDTLFLQVNGLSGPITPELGSLKSLKSMDLSNNMLDGQIPVEFSEL  308

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  +  +  L+ L L  N F+G +P + G   NL  L +S N 
Sbjct  309   KNLTLLNLFRNRLHGSIPGFIGDLPELQVLQLWENNFTGSVPQQLGMNGNLILLDISSNK  368

Query  737   LSGVIPSEI---GNLTKLKELYIGYF--------------------NGFSGGIP------  829
             L+G +P ++   G LT L  L    F                    N  +G IP      
Sbjct  369   LTGSVPPQLCYGGKLTTLITLDNFLFGPIPESLGECVSLARIRMGENYLNGSIPKGLLSL  428

Query  830   -----------------PEMGNLSQ-LIRFDAANCGLTGELPVEIGKLKNLDTLFLQVND  955
                              P+ G  S+ L +   +N  L+G+LP  IGK  +L  L L  N 
Sbjct  429   PNLVQVELQANYLTGNLPDSGKASENLGQLSLSNNRLSGQLPASIGKFSSLQKLLLDGNG  488

Query  956   LSGSLAPEIGYlknlksldlsnnAFSGEI-PE  1048
              SG + P+IG L+ L  LD S+N FSGEI PE
Sbjct  489   FSGQIPPDIGKLQQLSKLDFSDNKFSGEISPE  520


 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 76/227 (33%), Positives = 117/227 (52%), Gaps = 2/227 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              +G + P+ G+  F+  L+++ N+L+G +P E+  ++ L+ L L   NI+    P +L  
Sbjct  176   FTGTIPPEYGKWGFIEYLAVSGNELTGKIPGELGNLTKLQQLYLGYYNIYEGGIPPELGN  235

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L+ L  LD+ N  L+G +P E  K+  L  L L  N  SG I PE G   +L+ + +S N
Sbjct  236   LSALVRLDMANCALSGSIPPEFRKLQKLDTLFLQVNGLSGPITPELGSLKSLKSMDLSNN  295

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP E   L  L  L + + N   G IP  +G+L +L          TG +P ++G
Sbjct  296   MLDGQIPVEFSELKNLTLLNL-FRNRLHGSIPGFIGDLPELQVLQLWENNFTGSVPQQLG  354

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
                NL  L +  N L+GS+ P++ Y   L +L   +N   G IPES 
Sbjct  355   MNGNLILLDISSNKLTGSVPPQLCYGGKLTTLITLDNFLFGPIPESL  401


 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 66/203 (33%), Positives = 108/203 (53%), Gaps = 1/203 (0%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            N +G +   +G    L+ L I++N+L+G VPP++     L  L   +N      P  L +
Sbjct  344  NFTGSVPQQLGMNGNLILLDISSNKLTGSVPPQLCYGGKLTTLITLDNFLFGPIPESLGE  403

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
              +L  + +  N L G +P  +  + +L  + L  NY +G +P       NL  L++S N
Sbjct  404  CVSLARIRMGENYLNGSIPKGLLSLPNLVQVELQANYLTGNLPDSGKASENLGQLSLSNN  463

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
             LSG +P+ IG  + L++L +   NGFSG IPP++G L QL + D ++   +GE+  EI 
Sbjct  464  RLSGQLPASIGKFSSLQKLLLD-GNGFSGQIPPDIGKLQQLSKLDFSDNKFSGEISPEIT  522

Query  914  KLKNLDTLFLQVNDLSGSLAPEI  982
              K L  + L  N+L+G++  EI
Sbjct  523  NCKLLTVVDLSGNELNGTIPSEI  545


 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 100/199 (50%), Gaps = 7/199 (4%)
 Frame = +2

Query  383  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  562
            G + P++G L  LV L +A   LSG +PPE   +  L  L L  N        +L  L +
Sbjct  227  GGIPPELGNLSALVRLDMANCALSGSIPPEFRKLQKLDTLFLQVNGLSGPITPELGSLKS  286

Query  563  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  742
            L+ +DL NN L G +PVE  ++ +L  L+L  N   G IP   G  P L+ L +  N  +
Sbjct  287  LKSMDLSNNMLDGQIPVEFSELKNLTLLNLFRNRLHGSIPGFIGDLPELQVLQLWENNFT  346

Query  743  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM---GNLSQLIRFDAANCGLTGELPVEIG  913
            G +P ++G    L  L I   N  +G +PP++   G L+ LI  D     L G +P  +G
Sbjct  347  GSVPQQLGMNGNLILLDISS-NKLTGSVPPQLCYGGKLTTLITLDNF---LFGPIPESLG  402

Query  914  KLKNLDTLFLQVNDLSGSL  970
            +  +L  + +  N L+GS+
Sbjct  403  ECVSLARIRMGENYLNGSI  421



>ref|XP_006852730.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 isoform X1 [Amborella trichopoda]
 gb|ERN14197.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
Length=1017

 Score =   294 bits (752),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 162/279 (58%), Positives = 208/279 (75%), Gaps = 2/279 (1%)
 Frame = +2

Query  221   EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldl-sglNLSGVLSP  397
             E   LLS+KAA   D  +SL SWN ST +C+W  V CD+  + V     S  NL+G L+P
Sbjct  28    EYRYLLSLKAAII-DPDNSLQSWNSSTDYCSWSGVACDASSNHVVSLDLSARNLNGTLAP  86

Query  398   DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  577
             ++G+L  LVN+++A NQ +G +P EIS I+ L+ LNLSNN F + FP   + L NL+VLD
Sbjct  87    EIGRLRSLVNITVAENQFAGGIPLEISQINGLKLLNLSNNYFSANFPANFSGLKNLEVLD  146

Query  578   LYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPS  757
             LYNNNLTG LP+EV +M +LRHLHLGGN+F+G IPPEYG++  +EYLAVSGN L+G IP 
Sbjct  147   LYNNNLTGPLPLEVTEMEALRHLHLGGNFFTGTIPPEYGKWGFIEYLAVSGNELTGKIPG  206

Query  758   EIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTL  937
             E+GNLTKL++LY+GY+N + GGIPPE+GNLS L+R D ANC L+G +P E  KL+ LDTL
Sbjct  207   ELGNLTKLQQLYLGYYNIYEGGIPPELGNLSALVRLDMANCALSGSIPPEFRKLQKLDTL  266

Query  938   FLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             FLQVN LSG + PE+G LK+LKS+DLSNN   G+IP  F
Sbjct  267   FLQVNGLSGPITPELGSLKSLKSMDLSNNMLDGQIPVEF  305


 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 118/229 (52%), Gaps = 7/229 (3%)
 Frame = +2

Query  374   NLSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  544
              L+G + P +   G+L  L+ L    N L GP+P  +    +L  + +  N    + P  
Sbjct  368   KLTGSVPPQLCYGGKLTTLITLD---NFLFGPIPESLGECVSLARIRMGENYLNGSIPKG  424

Query  545   LAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  724
             L  L NL  ++L  N LTG+LP       +L  L L  N  SG++P   G+F +L+ L +
Sbjct  425   LLSLPNLVQVELQANYLTGNLPDSGKASENLGQLSLSNNRLSGQLPASIGKFSSLQKLLL  484

Query  725   SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPV  904
              GNG SG IP +IG L +L +L     N FSG I PE+ N   L   D +   L G +P 
Sbjct  485   DGNGFSGQIPPDIGKLQQLSKLDFSD-NKFSGEISPEITNCKLLTVVDLSGNELNGTIPS  543

Query  905   EIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
             EI K++ L+ L L  N L G + P I  +++L S+D S N  SG +P S
Sbjct  544   EITKMRILNYLNLSRNHLMGGIPPSIQTMQSLTSVDFSYNNLSGLVPGS  592


 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 89/272 (33%), Positives = 132/272 (49%), Gaps = 48/272 (18%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG + P+  +L  L  L +  N LSGP+ PE+ ++ +L+ ++LSNN+     P + ++L
Sbjct  249   LSGSIPPEFRKLQKLDTLFLQVNGLSGPITPELGSLKSLKSMDLSNNMLDGQIPVEFSEL  308

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  +  +  L+ L L  N F+G +P + G   NL  L +S N 
Sbjct  309   KNLTLLNLFRNRLHGSIPGFIGDLPELQVLQLWENNFTGSVPQQLGMNGNLILLDISSNK  368

Query  737   LSGVIPSEI---GNLTKLKELYIGYF--------------------NGFSGGIP------  829
             L+G +P ++   G LT L  L    F                    N  +G IP      
Sbjct  369   LTGSVPPQLCYGGKLTTLITLDNFLFGPIPESLGECVSLARIRMGENYLNGSIPKGLLSL  428

Query  830   -----------------PEMGNLSQ-LIRFDAANCGLTGELPVEIGKLKNLDTLFLQVND  955
                              P+ G  S+ L +   +N  L+G+LP  IGK  +L  L L  N 
Sbjct  429   PNLVQVELQANYLTGNLPDSGKASENLGQLSLSNNRLSGQLPASIGKFSSLQKLLLDGNG  488

Query  956   LSGSLAPEIGYlknlksldlsnnAFSGEI-PE  1048
              SG + P+IG L+ L  LD S+N FSGEI PE
Sbjct  489   FSGQIPPDIGKLQQLSKLDFSDNKFSGEISPE  520


 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 76/227 (33%), Positives = 117/227 (52%), Gaps = 2/227 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              +G + P+ G+  F+  L+++ N+L+G +P E+  ++ L+ L L   NI+    P +L  
Sbjct  176   FTGTIPPEYGKWGFIEYLAVSGNELTGKIPGELGNLTKLQQLYLGYYNIYEGGIPPELGN  235

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L+ L  LD+ N  L+G +P E  K+  L  L L  N  SG I PE G   +L+ + +S N
Sbjct  236   LSALVRLDMANCALSGSIPPEFRKLQKLDTLFLQVNGLSGPITPELGSLKSLKSMDLSNN  295

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP E   L  L  L + + N   G IP  +G+L +L          TG +P ++G
Sbjct  296   MLDGQIPVEFSELKNLTLLNL-FRNRLHGSIPGFIGDLPELQVLQLWENNFTGSVPQQLG  354

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
                NL  L +  N L+GS+ P++ Y   L +L   +N   G IPES 
Sbjct  355   MNGNLILLDISSNKLTGSVPPQLCYGGKLTTLITLDNFLFGPIPESL  401


 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 66/203 (33%), Positives = 108/203 (53%), Gaps = 1/203 (0%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            N +G +   +G    L+ L I++N+L+G VPP++     L  L   +N      P  L +
Sbjct  344  NFTGSVPQQLGMNGNLILLDISSNKLTGSVPPQLCYGGKLTTLITLDNFLFGPIPESLGE  403

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
              +L  + +  N L G +P  +  + +L  + L  NY +G +P       NL  L++S N
Sbjct  404  CVSLARIRMGENYLNGSIPKGLLSLPNLVQVELQANYLTGNLPDSGKASENLGQLSLSNN  463

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
             LSG +P+ IG  + L++L +   NGFSG IPP++G L QL + D ++   +GE+  EI 
Sbjct  464  RLSGQLPASIGKFSSLQKLLLD-GNGFSGQIPPDIGKLQQLSKLDFSDNKFSGEISPEIT  522

Query  914  KLKNLDTLFLQVNDLSGSLAPEI  982
              K L  + L  N+L+G++  EI
Sbjct  523  NCKLLTVVDLSGNELNGTIPSEI  545


 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 100/199 (50%), Gaps = 7/199 (4%)
 Frame = +2

Query  383  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  562
            G + P++G L  LV L +A   LSG +PPE   +  L  L L  N        +L  L +
Sbjct  227  GGIPPELGNLSALVRLDMANCALSGSIPPEFRKLQKLDTLFLQVNGLSGPITPELGSLKS  286

Query  563  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  742
            L+ +DL NN L G +PVE  ++ +L  L+L  N   G IP   G  P L+ L +  N  +
Sbjct  287  LKSMDLSNNMLDGQIPVEFSELKNLTLLNLFRNRLHGSIPGFIGDLPELQVLQLWENNFT  346

Query  743  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM---GNLSQLIRFDAANCGLTGELPVEIG  913
            G +P ++G    L  L I   N  +G +PP++   G L+ LI  D     L G +P  +G
Sbjct  347  GSVPQQLGMNGNLILLDISS-NKLTGSVPPQLCYGGKLTTLITLDNF---LFGPIPESLG  402

Query  914  KLKNLDTLFLQVNDLSGSL  970
            +  +L  + +  N L+GS+
Sbjct  403  ECVSLARIRMGENYLNGSI  421



>ref|XP_009408581.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1016

 Score =   293 bits (751),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 166/278 (60%), Positives = 203/278 (73%), Gaps = 2/278 (1%)
 Frame = +2

Query  221   EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPD  400
             E  ALLSIK+  + D  ++LT+W+ +T HC W  VTCD    V        NLSG LSP 
Sbjct  30    EHHALLSIKSQLS-DPGAALTAWDPATDHCAWPGVTCDRAAVVELDLSGR-NLSGPLSPA  87

Query  401   VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDL  580
              G L  L+ LS A N LSGP+PP ++ ++ LR LNLSNN+F  +FP  LA LA+L+VLDL
Sbjct  88    FGSLRSLLRLSAAENSLSGPIPPALALLTVLRHLNLSNNLFDGSFPPALAGLADLRVLDL  147

Query  581   YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSE  760
             YNNNLTG LP EV  +  LRHLHLGGN+FSG IP EYGR+  LEYLAVSGN L G IP E
Sbjct  148   YNNNLTGPLPREVAALHQLRHLHLGGNFFSGSIPSEYGRWQFLEYLAVSGNELGGPIPPE  207

Query  761   IGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLF  940
             IGNL+ L+ELYIGY+N + GG+PPE+GNLS L+R D ANCGL+G +P EIG L+ LD+LF
Sbjct  208   IGNLSSLRELYIGYYNSYEGGLPPEIGNLSTLLRLDVANCGLSGRIPPEIGNLRILDSLF  267

Query  941   LQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             LQVN L G +  E+G L++LKS+DLSNNA +GEIP SF
Sbjct  268   LQVNGLVGEIPLELGRLRSLKSMDLSNNALTGEIPPSF  305


 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 74/225 (33%), Positives = 116/225 (52%), Gaps = 2/225 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             L G + P++G L  L  L I   N   G +PPEI  +STL  L+++N       P ++  
Sbjct  200   LGGPIPPEIGNLSSLRELYIGYYNSYEGGLPPEIGNLSTLLRLDVANCGLSGRIPPEIGN  259

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  L L  N L G++P+E+ ++ SL+ + L  N  +G IPP +    NL  L +  N
Sbjct  260   LRILDSLFLQVNGLVGEIPLELGRLRSLKSMDLSNNALTGEIPPSFADLGNLTLLNLFRN  319

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  +G+L +L+ L + + N F+G +P  +G   +L   D ++  LTG LP ++ 
Sbjct  320   KLFGAIPEFVGDLPELEVLQL-WENNFTGSVPRRLGKNGRLQSLDLSSNKLTGSLPPDLC  378

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPE  1048
                 L TL    N L G +   +G  K+L  + ++ N  +G IP 
Sbjct  379   YGNKLQTLIALGNFLFGPIPESLGRCKSLSRIRMAENYLNGSIPR  423


 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 103/203 (51%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P++G L  L +L +  N L G +P E+  + +L+ ++LSNN      P   A L
Sbjct  249  LSGRIPPEIGNLRILDSLFLQVNGLVGEIPLELGRLRSLKSMDLSNNALTGEIPPSFADL  308

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL +L+L+ N L G +P  V  +  L  L L  N F+G +P   G+   L+ L +S N 
Sbjct  309  GNLTLLNLFRNKLFGAIPEFVGDLPELEVLQLWENNFTGSVPRRLGKNGRLQSLDLSSNK  368

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P ++    KL+ L I   N   G IP  +G    L R   A   L G +P  +  
Sbjct  369  LTGSLPPDLCYGNKLQTL-IALGNFLFGPIPESLGRCKSLSRIRMAENYLNGSIPRGLFS  427

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            L NL  + LQ N L+G   P+ G
Sbjct  428  LPNLSQVELQDNLLTGGF-PDTG  449


 Score = 96.7 bits (239),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 82/253 (32%), Positives = 117/253 (46%), Gaps = 27/253 (11%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L G +   VG LP L  L +  N  +G VP  +     L+ L+LS+N    + P  L  
Sbjct  320   KLFGAIPEFVGDLPELEVLQLWENNFTGSVPRRLGKNGRLQSLDLSSNKLTGSLPPDLCY  379

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP-----------------  682
                LQ L    N L G +P  + +  SL  + +  NY +G IP                 
Sbjct  380   GNKLQTLIALGNFLFGPIPESLGRCKSLSRIRMAENYLNGSIPRGLFSLPNLSQVELQDN  439

Query  683   ------PEYGRFP---NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPE  835
                   P+ GR P   NL  + +S N L+G +P  I N   L++L +   N F+GGIPPE
Sbjct  440   LLTGGFPDTGRSPISPNLGQICLSNNRLTGPLPPSIANFFGLQKLLLNQ-NSFTGGIPPE  498

Query  836   MGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldl  1015
             +G L QL + D +     G +  EI K K L  + L  N+LSG +  EI  ++ L  L+L
Sbjct  499   VGRLQQLSKLDFSGNRFAGPITPEISKCKLLTFVDLSRNELSGDIPEEIAAMRILNYLNL  558

Query  1016  snnAFSGEIPESF  1054
             S N   G+IP + 
Sbjct  559   SRNHLEGQIPAAI  571


 Score = 89.7 bits (221),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 78/251 (31%), Positives = 114/251 (45%), Gaps = 25/251 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G + P    L  L  L++  N+L G +P  +  +  L  L L  N F  + P +L + 
Sbjct  297   LTGEIPPSFADLGNLTLLNLFRNKLFGAIPEFVGDLPELEVLQLWENNFTGSVPRRLGKN  356

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               LQ LDL +N LTG LP ++     L+ L   GN+  G IP   GR  +L  + ++ N 
Sbjct  357   GRLQSLDLSSNKLTGSLPPDLCYGNKLQTLIALGNFLFGPIPESLGRCKSLSRIRMAENY  416

Query  737   LSGVIPSEIGNLTKLKE------LYIGYF-------------------NGFSGGIPPEMG  841
             L+G IP  + +L  L +      L  G F                   N  +G +PP + 
Sbjct  417   LNGSIPRGLFSLPNLSQVELQDNLLTGGFPDTGRSPISPNLGQICLSNNRLTGPLPPSIA  476

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
             N   L +        TG +P E+G+L+ L  L    N  +G + PEI   K L  +DLS 
Sbjct  477   NFFGLQKLLLNQNSFTGGIPPEVGRLQQLSKLDFSGNRFAGPITPEISKCKLLTFVDLSR  536

Query  1022  nAFSGEIPESF  1054
             N  SG+IPE  
Sbjct  537   NELSGDIPEEI  547


 Score = 85.5 bits (210),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 71/226 (31%), Positives = 108/226 (48%), Gaps = 3/226 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L PD+     L  L    N L GP+P  +    +L  + ++ N    + P  L  
Sbjct  368   KLTGSLPPDLCYGNKLQTLIALGNFLFGPIPESLGRCKSLSRIRMAENYLNGSIPRGLFS  427

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  727
             L NL  ++L +N LTG  P       S  L  + L  N  +G +PP    F  L+ L ++
Sbjct  428   LPNLSQVELQDNLLTGGFPDTGRSPISPNLGQICLSNNRLTGPLPPSIANFFGLQKLLLN  487

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
              N  +G IP E+G L +L +L     N F+G I PE+     L   D +   L+G++P E
Sbjct  488   QNSFTGGIPPEVGRLQQLSKLDFSG-NRFAGPITPEISKCKLLTFVDLSRNELSGDIPEE  546

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             I  ++ L+ L L  N L G +   I  +++L  +D S N  SG +P
Sbjct  547   IAAMRILNYLNLSRNHLEGQIPAAISTMQSLTQVDFSYNNLSGVVP  592



>ref|XP_009394620.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1003

 Score =   293 bits (749),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 169/282 (60%), Positives = 216/282 (77%), Gaps = 4/282 (1%)
 Frame = +2

Query  218   TEQAALLSIKAAFTADSQSSLTSWNIS--TSHCTWRRVTCd-sllhvvsldlsglNLSGV  388
             TE  ALL +KAA  +D  ++L++WN S    HC+W  V CD     VVSLDLSGLNLSG 
Sbjct  29    TEVEALLELKAA-VSDPSAALSAWNSSDGVDHCSWPGVACDPLRGSVVSLDLSGLNLSGT  87

Query  389   LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  568
             LSP VG+L  L+NLS+A+N LSGP+P ++S ++ LR LNLS+N+   +FP  LA L NL 
Sbjct  88    LSPAVGRLRHLLNLSVASNSLSGPIPADLSRLADLRHLNLSDNLLNGSFPSALAHLKNLL  147

Query  569   VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  748
             VLDLYNNNLTG LP EV ++ +LRHLHLGGN+F+G IPPE+G +  LEYLAVSGN L G 
Sbjct  148   VLDLYNNNLTGPLPAEVAELPNLRHLHLGGNFFTGVIPPEFGGWEFLEYLAVSGNDLGGP  207

Query  749   IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNL  928
             IP E+GNLT+L++LY+GYFN F GGIPPE+G L+ L+R D ANCGL+G +P E+G L+NL
Sbjct  208   IPPELGNLTRLRQLYVGYFNSFVGGIPPEIGRLAALVRLDMANCGLSGAIPPELGNLQNL  267

Query  929   DTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             DTLFLQVN L+G +   +G L++LKS+D+SNNA +GEIP +F
Sbjct  268   DTLFLQVNGLAGDIPSALGRLRSLKSMDISNNALTGEIPSTF  309


 Score = 92.0 bits (227),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 76/253 (30%), Positives = 118/253 (47%), Gaps = 27/253 (11%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L G +   VG LP L  L +  N  +G +P  +   + L+ L++S+N      P  L  
Sbjct  324   KLQGSIPECVGDLPALEVLQLWENNFTGGIPQRLGESARLQLLDVSSNKLTGNLPPDLCS  383

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP-----------------  682
                LQ L +  N L G +P  + +  SL  + +G NY +  IP                 
Sbjct  384   GNRLQTLIVLRNFLFGPIPETLGRCESLGRIRMGQNYLNASIPDALFSLPKLSQIELEDN  443

Query  683   ------PEYGRF---PNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPE  835
                   P+ G     P+L  + +S N LSG +P  IG  + +++L +   N FSG IPPE
Sbjct  444   LLTGGFPDTGNAAISPDLGLINLSNNRLSGPLPRSIGKYSGVQKLLLNQ-NQFSGRIPPE  502

Query  836   MGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldl  1015
              G L +L + D +    +G +  EI + K L  + L  N++SG + P+I  ++ L  L+L
Sbjct  503   TGRLQELCKLDLSGNRFSGPIAPEISRCKLLAFVDLSRNEISGEIPPDIAGMRILNYLNL  562

Query  1016  snnAFSGEIPESF  1054
             S N   G IP+S 
Sbjct  563   SRNHLEGSIPQSL  575


 Score = 91.7 bits (226),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 101/196 (52%), Gaps = 1/196 (1%)
 Frame = +2

Query  383  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  562
            G + P++G+L  LV L +A   LSG +PPE+  +  L  L L  N      P  L +L +
Sbjct  231  GGIPPEIGRLAALVRLDMANCGLSGAIPPELGNLQNLDTLFLQVNGLAGDIPSALGRLRS  290

Query  563  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  742
            L+ +D+ NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N  +
Sbjct  291  LKSMDISNNALTGEIPSTFADLQNLTLLNLFRNKLQGSIPECVGDLPALEVLQLWENNFT  350

Query  743  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLK  922
            G IP  +G   +L+ L +   N  +G +PP++ + ++L         L G +P  +G+ +
Sbjct  351  GGIPQRLGESARLQLLDVSS-NKLTGNLPPDLCSGNRLQTLIVLRNFLFGPIPETLGRCE  409

Query  923  NLDTLFLQVNDLSGSL  970
            +L  + +  N L+ S+
Sbjct  410  SLGRIRMGQNYLNASI  425


 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 80/251 (32%), Positives = 116/251 (46%), Gaps = 28/251 (11%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G +   +G+L  L ++ I+ N L+G +P   + +  L  LNL  N    + P  +  L
Sbjct  277   LAGDIPSALGRLRSLKSMDISNNALTGEIPSTFADLQNLTLLNLFRNKLQGSIPECVGDL  336

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L+VL L+ NN TG +P  + +   L+ L +  N  +G +PP+      L+ L V  N 
Sbjct  337   PALEVLQLWENNFTGGIPQRLGESARLQLLDVSSNKLTGNLPPDLCSGNRLQTLIVLRNF  396

Query  737   LSGVIPSEIGNLTKLKELYIG--YFNG---------------------FSGGIPPEMGNL  847
             L G IP  +G    L  + +G  Y N                       +GG  P+ GN 
Sbjct  397   LFGPIPETLGRCESLGRIRMGQNYLNASIPDALFSLPKLSQIELEDNLLTGGF-PDTGNA  455

Query  848   S---QLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldls  1018
             +    L   + +N  L+G LP  IGK   +  L L  N  SG + PE G L+ L  LDLS
Sbjct  456   AISPDLGLINLSNNRLSGPLPRSIGKYSGVQKLLLNQNQFSGRIPPETGRLQELCKLDLS  515

Query  1019  nnAFSGEI-PE  1048
              N FSG I PE
Sbjct  516   GNRFSGPIAPE  526


 Score = 71.2 bits (173),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 70/143 (49%), Gaps = 6/143 (4%)
 Frame = +2

Query  380  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  559
            +  +SPD+G    L+NLS   N+LSGP+P  I   S ++ L L+ N F    P +  +L 
Sbjct  454  NAAISPDLG----LINLS--NNRLSGPLPRSIGKYSGVQKLLLNQNQFSGRIPPETGRLQ  507

Query  560  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  739
             L  LDL  N  +G +  E+ +   L  + L  N  SG IPP+      L YL +S N L
Sbjct  508  ELCKLDLSGNRFSGPIAPEISRCKLLAFVDLSRNEISGEIPPDIAGMRILNYLNLSRNHL  567

Query  740  SGVIPSEIGNLTKLKELYIGYFN  808
             G IP  +  +  L  +   Y N
Sbjct  568  EGSIPQSLATIQSLTAVDFSYNN  590


 Score = 65.1 bits (157),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 77/162 (48%), Gaps = 4/162 (2%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG L   +G+   +  L +  NQ SG +PPE   +  L  L+LS N F      ++++ 
Sbjct  471  LSGPLPRSIGKYSGVQKLLLNQNQFSGRIPPETGRLQELCKLDLSGNRFSGPIAPEISRC  530

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              L  +DL  N ++G++P ++  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  531  KLLAFVDLSRNEISGEIPPDIAGMRILNYLNLSRNHLEGSIPQSLATIQSLTAVDFSYNN  590

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  862
            LSG++ S  G  +      +  F G  G   P +G  S  I+
Sbjct  591  LSGLV-SGTGQFSYFN---VSSFVGNPGLCGPYLGPCSSAIK  628



>gb|ADB85326.1| putative receptor protein kinase [Phyllostachys edulis]
Length=265

 Score =   274 bits (700),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/230 (62%), Positives = 177/230 (77%), Gaps = 1/230 (0%)
 Frame = +2

Query  260  ADSQSSLTSW-NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSI  436
            +D   +L SW N + SHC W  VTC +   VV LD++GLNLSG L P + +L  L  LS+
Sbjct  36   SDPTGALASWANGTASHCAWAGVTCSTRGTVVGLDVAGLNLSGALPPALSRLRGLFRLSV  95

Query  437  AANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVE  616
            AAN  SGP+P  ++ +  L  LNLSNN F  +FP  LA+L +L+VLDLYNNNLT  LP+E
Sbjct  96   AANAFSGPIPASLARLQFLVHLNLSNNAFDGSFPAPLARLRSLRVLDLYNNNLTSPLPLE  155

Query  617  VYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYI  796
            V +M  LRHLHLGGN+FSG IPPEYGR+  L+YLAVSGN LSG IP E+GNLT L+ELYI
Sbjct  156  VVQMPQLRHLHLGGNFFSGEIPPEYGRWGRLQYLAVSGNELSGKIPPELGNLTSLRELYI  215

Query  797  GYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQ  946
            GY+N +SGG+PPE+GNL++L+RFDAANCGL+GE+P E+GKL+ LDTLFLQ
Sbjct  216  GYYNSYSGGLPPELGNLTELVRFDAANCGLSGEIPPELGKLQTLDTLFLQ  265


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 68/138 (49%), Gaps = 1/138 (1%)
 Frame = +2

Query  572  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  751
            LD+   NL+G LP  + ++  L  L +  N FSG IP    R   L +L +S N   G  
Sbjct  69   LDVAGLNLSGALPPALSRLRGLFRLSVAANAFSGPIPASLARLQFLVHLNLSNNAFDGSF  128

Query  752  PSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLD  931
            P+ +  L  L+ L + Y N  +  +P E+  + QL          +GE+P E G+   L 
Sbjct  129  PAPLARLRSLRVLDL-YNNNLTSPLPLEVVQMPQLRHLHLGGNFFSGEIPPEYGRWGRLQ  187

Query  932  TLFLQVNDLSGSLAPEIG  985
             L +  N+LSG + PE+G
Sbjct  188  YLAVSGNELSGKIPPELG  205


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 64/134 (48%), Gaps = 1/134 (1%)
 Frame = +2

Query  644   LHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGG  823
             L + G   SG +PP   R   L  L+V+ N  SG IP+ +  L  L  L +   N F G 
Sbjct  69    LDVAGLNLSGALPPALSRLRGLFRLSVAANAFSGPIPASLARLQFLVHLNLSN-NAFDGS  127

Query  824   IPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlk  1003
              P  +  L  L   D  N  LT  LP+E+ ++  L  L L  N  SG + PE G    L+
Sbjct  128   FPAPLARLRSLRVLDLYNNNLTSPLPLEVVQMPQLRHLHLGGNFFSGEIPPEYGRWGRLQ  187

Query  1004  sldlsnnAFSGEIP  1045
              L +S N  SG+IP
Sbjct  188   YLAVSGNELSGKIP  201



>ref|XP_008665503.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Zea mays]
 tpg|DAA51666.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1034

 Score =   290 bits (741),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 165/271 (61%), Positives = 206/271 (76%), Gaps = 6/271 (2%)
 Frame = +2

Query  260   ADSQSSLTSWNISTS-HCTWRRVTCd----sllhvvsldlsglNLSGVLSPDVGQLPFLV  424
             +D   +L SW+ ++S HC W  VTC         VV LD+SGLNLSG L P + +L  L 
Sbjct  34    SDPTGALASWDAASSDHCAWVGVTCAPRGSGGGVVVGLDVSGLNLSGALPPALSRLRGLQ  93

Query  425   NLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT-G  601
              LS+AAN   GP+PP ++ +  L  LNLSNN F  +FP  LA+L  L+VLDLYNNNLT  
Sbjct  94    RLSVAANGFYGPIPPSLARLQLLVHLNLSNNAFNGSFPPALARLRALRVLDLYNNNLTSA  153

Query  602   DLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKL  781
              LP+EV  M  LRHLHLGGN+FSG IPPEYGR+P L+YLAVSGN LSG IP E+GNLT L
Sbjct  154   TLPLEVTHMPMLRHLHLGGNFFSGEIPPEYGRWPRLQYLAVSGNELSGKIPPELGNLTSL  213

Query  782   KELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLS  961
             +ELYIGY+N ++GG+PPE+GNL++L+R DAANCGL+GE+P E+G+L+NLDTLFLQVN L+
Sbjct  214   RELYIGYYNSYTGGLPPELGNLTELVRLDAANCGLSGEIPPELGRLQNLDTLFLQVNGLT  273

Query  962   GSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             GS+  E+GYL++L SLDLSNNA +GEIP SF
Sbjct  274   GSIPSELGYLRSLSSLDLSNNALTGEIPASF  304


 Score =   108 bits (271),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 128/229 (56%), Gaps = 4/229 (2%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
             N +G +   +G+   L  L +++N+L+G +PPE+ A   L+  + L N +FG+  P  L 
Sbjct  343   NFTGGVPRRLGRNGRLQLLDLSSNKLTGTLPPELCAGGKLQTLIALGNFLFGA-IPDSLG  401

Query  551   QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRF-PNLEYLAVS  727
             Q  +L  + L  N L G +P  ++++  L  + L  N  +G  P   G   PNL  +++S
Sbjct  402   QCKSLSRVRLGENYLNGSIPKGLFELPKLTQVELQDNLLTGNFPAVIGAAAPNLGEISLS  461

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
              N L+G +P+ +GN + +++L +   N FSG IPPE+G L QL + D ++    G +P E
Sbjct  462   NNQLTGALPASLGNFSGVQKLLLDQ-NAFSGAIPPEIGRLQQLSKADLSSNKFEGGVPPE  520

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             +GK + L  L +  N+LSG + P I  ++ L  L+LS N   GEIP S 
Sbjct  521   VGKCRLLTYLDMSQNNLSGKIPPAISGMRILNYLNLSRNHLDGEIPPSI  569


 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 105/203 (52%), Gaps = 1/203 (0%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN      P   ++L
Sbjct  248  LSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGYLRSLSSLDLSNNALTGEIPASFSEL  307

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  308  KNLTLLNLFRNKLRGDIPGFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNK  367

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P E+    KL+ L I   N   G IP  +G    L R       L G +P  + +
Sbjct  368  LTGTLPPELCAGGKLQTL-IALGNFLFGAIPDSLGQCKSLSRVRLGENYLNGSIPKGLFE  426

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            L  L  + LQ N L+G+    IG
Sbjct  427  LPKLTQVELQDNLLTGNFPAVIG  449


 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/228 (32%), Positives = 114/228 (50%), Gaps = 8/228 (4%)
 Frame = +2

Query  374   NLSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  544
              L+G L P++   G+L  L+ L    N L G +P  +    +L  + L  N    + P  
Sbjct  367   KLTGTLPPELCAGGKLQTLIAL---GNFLFGAIPDSLGQCKSLSRVRLGENYLNGSIPKG  423

Query  545   LAQLANLQVLDLYNNNLTGDLPVEV-YKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLA  721
             L +L  L  ++L +N LTG+ P  +     +L  + L  N  +G +P   G F  ++ L 
Sbjct  424   LFELPKLTQVELQDNLLTGNFPAVIGAAAPNLGEISLSNNQLTGALPASLGNFSGVQKLL  483

Query  722   VSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELP  901
             +  N  SG IP EIG L +L +  +   N F GG+PPE+G    L   D +   L+G++P
Sbjct  484   LDQNAFSGAIPPEIGRLQQLSKADLSS-NKFEGGVPPEVGKCRLLTYLDMSQNNLSGKIP  542

Query  902   VEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
               I  ++ L+ L L  N L G + P I  +++L ++D S N  SG +P
Sbjct  543   PAISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVP  590


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 102/197 (52%), Gaps = 1/197 (1%)
 Frame = +2

Query  380  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  559
            +G L P++G L  LV L  A   LSG +PPE+  +  L  L L  N    + P +L  L 
Sbjct  225  TGGLPPELGNLTELVRLDAANCGLSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGYLR  284

Query  560  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  739
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +  N  
Sbjct  285  SLSSLDLSNNALTGEIPASFSELKNLTLLNLFRNKLRGDIPGFVGDLPSLEVLQLWENNF  344

Query  740  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKL  919
            +G +P  +G   +L+ L +   N  +G +PPE+    +L    A    L G +P  +G+ 
Sbjct  345  TGGVPRRLGRNGRLQLLDLSS-NKLTGTLPPELCAGGKLQTLIALGNFLFGAIPDSLGQC  403

Query  920  KNLDTLFLQVNDLSGSL  970
            K+L  + L  N L+GS+
Sbjct  404  KSLSRVRLGENYLNGSI  420



>ref|XP_002466378.1| hypothetical protein SORBIDRAFT_01g006690 [Sorghum bicolor]
 gb|EER93376.1| hypothetical protein SORBIDRAFT_01g006690 [Sorghum bicolor]
Length=1030

 Score =   289 bits (739),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 166/265 (63%), Positives = 205/265 (77%), Gaps = 5/265 (2%)
 Frame = +2

Query  275   SLTSWNISTS-HCTWRRVTCd---sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAA  442
             +L SW +++S HC W  VTC    S   VV LD+SGLNLSG L P + +L  L  LS+AA
Sbjct  46    ALASWGVASSDHCAWAGVTCAPRGSGGVVVGLDVSGLNLSGALPPALSRLRGLQRLSVAA  105

Query  443   NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT-GDLPVEV  619
             N   GP+PP ++ +  L  LNLSNN F  +FP  LA+L  L+VLDLYNNNLT   LP+EV
Sbjct  106   NGFYGPIPPSLARLQLLVHLNLSNNAFNGSFPPALARLRALRVLDLYNNNLTSATLPLEV  165

Query  620   YKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIG  799
               M  LRHLHLGGN+FSG IPPEYGR+P L+YLAVSGN LSG IP E+GNLT L+ELYIG
Sbjct  166   THMPMLRHLHLGGNFFSGEIPPEYGRWPRLQYLAVSGNELSGKIPPELGNLTSLRELYIG  225

Query  800   YFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPE  979
             Y+N ++GG+PPE+GNL++L+R DAANCGL+GE+P E+G+L+NLDTLFLQVN L+GS+  E
Sbjct  226   YYNSYTGGLPPELGNLTELVRLDAANCGLSGEIPPELGRLQNLDTLFLQVNGLTGSIPSE  285

Query  980   IGYlknlksldlsnnAFSGEIPESF  1054
             +GYLK+L SLDLSNNA +GEIP SF
Sbjct  286   LGYLKSLSSLDLSNNALTGEIPASF  310


 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 128/229 (56%), Gaps = 4/229 (2%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
             N +G +   +G+   L  L +++N+L+G +PPE+ A   L+  + L N +FG+  P  L 
Sbjct  349   NFTGGVPRSLGRNGRLQLLDLSSNKLTGTLPPELCAGGKLQTLIALGNFLFGA-IPDSLG  407

Query  551   QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRF-PNLEYLAVS  727
             Q  +L  + L  N L G +P  ++++  L  + L  N  +G  P   G   PNL  +++S
Sbjct  408   QCKSLSRVRLGENYLNGSIPKGLFELPKLTQVELQDNLLTGNFPAVIGAAAPNLGEISLS  467

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
              N L+G +P+ +GN + +++L +   N FSG IPPE+G L QL + D ++    G +P E
Sbjct  468   NNQLTGALPASLGNFSGVQKLLLDQ-NAFSGAIPPEIGRLQQLSKADLSSNKFEGGVPPE  526

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             IGK + L  L +  N+LSG + P I  ++ L  L+LS N   GEIP S 
Sbjct  527   IGKCRLLTYLDMSQNNLSGKIPPAISGMRILNYLNLSRNHLDGEIPPSI  575


 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 105/203 (52%), Gaps = 1/203 (0%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN      P   ++L
Sbjct  254  LSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGYLKSLSSLDLSNNALTGEIPASFSEL  313

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  314  KNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRSLGRNGRLQLLDLSSNK  373

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P E+    KL+ L I   N   G IP  +G    L R       L G +P  + +
Sbjct  374  LTGTLPPELCAGGKLQTL-IALGNFLFGAIPDSLGQCKSLSRVRLGENYLNGSIPKGLFE  432

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            L  L  + LQ N L+G+    IG
Sbjct  433  LPKLTQVELQDNLLTGNFPAVIG  455


 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 72/228 (32%), Positives = 114/228 (50%), Gaps = 8/228 (4%)
 Frame = +2

Query  374   NLSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  544
              L+G L P++   G+L  L+ L    N L G +P  +    +L  + L  N    + P  
Sbjct  373   KLTGTLPPELCAGGKLQTLIAL---GNFLFGAIPDSLGQCKSLSRVRLGENYLNGSIPKG  429

Query  545   LAQLANLQVLDLYNNNLTGDLPVEV-YKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLA  721
             L +L  L  ++L +N LTG+ P  +     +L  + L  N  +G +P   G F  ++ L 
Sbjct  430   LFELPKLTQVELQDNLLTGNFPAVIGAAAPNLGEISLSNNQLTGALPASLGNFSGVQKLL  489

Query  722   VSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELP  901
             +  N  SG IP EIG L +L +  +   N F GG+PPE+G    L   D +   L+G++P
Sbjct  490   LDQNAFSGAIPPEIGRLQQLSKADLSS-NKFEGGVPPEIGKCRLLTYLDMSQNNLSGKIP  548

Query  902   VEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
               I  ++ L+ L L  N L G + P I  +++L ++D S N  SG +P
Sbjct  549   PAISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVP  596


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 102/197 (52%), Gaps = 1/197 (1%)
 Frame = +2

Query  380  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  559
            +G L P++G L  LV L  A   LSG +PPE+  +  L  L L  N    + P +L  L 
Sbjct  231  TGGLPPELGNLTELVRLDAANCGLSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGYLK  290

Query  560  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  739
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +  N  
Sbjct  291  SLSSLDLSNNALTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNF  350

Query  740  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKL  919
            +G +P  +G   +L+ L +   N  +G +PPE+    +L    A    L G +P  +G+ 
Sbjct  351  TGGVPRSLGRNGRLQLLDLSS-NKLTGTLPPELCAGGKLQTLIALGNFLFGAIPDSLGQC  409

Query  920  KNLDTLFLQVNDLSGSL  970
            K+L  + L  N L+GS+
Sbjct  410  KSLSRVRLGENYLNGSI  426



>ref|XP_006650665.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Oryza brachyantha]
Length=1021

 Score =   287 bits (735),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 165/269 (61%), Positives = 205/269 (76%), Gaps = 4/269 (1%)
 Frame = +2

Query  260   ADSQSSLTSW----NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVN  427
             +D   +L SW    N STSHC+W  VTC S   VV LD+SG NLSG L  ++ +L  L+ 
Sbjct  32    SDPTGALASWGNGTNTSTSHCSWAGVTCSSRGTVVGLDVSGFNLSGALPAELSRLRGLLR  91

Query  428   LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  607
             L++ AN  SGP+P  +  +  L +LNLSNN F  +FP  LA+L  L+VLDLYNNNLT  L
Sbjct  92    LAVGANAFSGPIPGSLGRLQFLTYLNLSNNAFNGSFPAALARLRGLRVLDLYNNNLTSPL  151

Query  608   PVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKE  787
             P+EV +M  LRHLHLGGN+FSG IPPEYGR+  ++YLAVSGN LSG IP E+GNLT L+E
Sbjct  152   PMEVVQMPLLRHLHLGGNFFSGEIPPEYGRWGRMQYLAVSGNELSGRIPPELGNLTSLRE  211

Query  788   LYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGS  967
             LYIGY+N +SGG+PPE+GNL++LIR DAANCGL+GE+P E+GKL+NLDTLFLQVN L+G 
Sbjct  212   LYIGYYNSYSGGLPPELGNLTELIRLDAANCGLSGEIPPELGKLQNLDTLFLQVNGLTGG  271

Query  968   LAPEIGYlknlksldlsnnAFSGEIPESF  1054
             +  E+GYLK+L SLDLSNN  +GEIP SF
Sbjct  272   IPSELGYLKSLSSLDLSNNVLTGEIPASF  300


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 127/229 (55%), Gaps = 4/229 (2%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
             N +G +   +G+   L  L +++N+L+G +PPE+ A   +   + L N +FG+  P  L 
Sbjct  339   NFTGGVPRRLGRNGRLQLLDLSSNRLTGTLPPELCAGGKMHTLIALGNFLFGA-IPDSLG  397

Query  551   QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYG-RFPNLEYLAVS  727
             +  +L  + L  N L G +P  ++++  L  + L  N  +G  P   G   PNL  +++S
Sbjct  398   ECRSLSRVRLGENYLNGSIPKGLFELPKLTQVELQDNLLTGNFPAVSGVAAPNLGEISLS  457

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
              N L+G +P+ IGN + +++L +   N FSG +PPE+G L QL + D ++    G +P E
Sbjct  458   NNQLTGALPASIGNFSGVQKLLLDR-NSFSGVVPPEIGQLQQLSKADLSSNAFEGGVPPE  516

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             IGK + L  L L  N++SG + P I  ++ L  L+LS N   GEIP S 
Sbjct  517   IGKCRLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNHLDGEIPPSI  565


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 115/227 (51%), Gaps = 8/227 (4%)
 Frame = +2

Query  377   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  547
             L+G L P++   G++  L+ L    N L G +P  +    +L  + L  N    + P  L
Sbjct  364   LTGTLPPELCAGGKMHTLIAL---GNFLFGAIPDSLGECRSLSRVRLGENYLNGSIPKGL  420

Query  548   AQLANLQVLDLYNNNLTGDLP-VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  724
              +L  L  ++L +N LTG+ P V      +L  + L  N  +G +P   G F  ++ L +
Sbjct  421   FELPKLTQVELQDNLLTGNFPAVSGVAAPNLGEISLSNNQLTGALPASIGNFSGVQKLLL  480

Query  725   SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPV  904
               N  SGV+P EIG L +L +  +   N F GG+PPE+G    L   D +   ++G++P 
Sbjct  481   DRNSFSGVVPPEIGQLQQLSKADLSS-NAFEGGVPPEIGKCRLLTYLDLSRNNISGKIPP  539

Query  905   EIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              I  ++ L+ L L  N L G + P I  +++L ++D S N  SG +P
Sbjct  540   AISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVP  586


 Score = 92.4 bits (228),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 88/272 (32%), Positives = 121/272 (44%), Gaps = 50/272 (18%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  244   LSGEIPPELGKLQNLDTLFLQVNGLTGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  303

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  304   KNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNR  363

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFD----------------  868
             L+G +P E+    K+  L I   N   G IP  +G    L R                  
Sbjct  364   LTGTLPPELCAGGKMHTL-IALGNFLFGAIPDSLGECRSLSRVRLGENYLNGSIPKGLFE  422

Query  869   -------------------------AANCG--------LTGELPVEIGKLKNLDTLFLQV  949
                                      A N G        LTG LP  IG    +  L L  
Sbjct  423   LPKLTQVELQDNLLTGNFPAVSGVAAPNLGEISLSNNQLTGALPASIGNFSGVQKLLLDR  482

Query  950   NDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             N  SG + PEIG L+ L   DLS+NAF G +P
Sbjct  483   NSFSGVVPPEIGQLQQLSKADLSSNAFEGGVP  514


 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 66/197 (34%), Positives = 101/197 (51%), Gaps = 1/197 (1%)
 Frame = +2

Query  380  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  559
            SG L P++G L  L+ L  A   LSG +PPE+  +  L  L L  N      P +L  L 
Sbjct  221  SGGLPPELGNLTELIRLDAANCGLSGEIPPELGKLQNLDTLFLQVNGLTGGIPSELGYLK  280

Query  560  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  739
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +  N  
Sbjct  281  SLSSLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNF  340

Query  740  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKL  919
            +G +P  +G   +L+ L +   N  +G +PPE+    ++    A    L G +P  +G+ 
Sbjct  341  TGGVPRRLGRNGRLQLLDLSS-NRLTGTLPPELCAGGKMHTLIALGNFLFGAIPDSLGEC  399

Query  920  KNLDTLFLQVNDLSGSL  970
            ++L  + L  N L+GS+
Sbjct  400  RSLSRVRLGENYLNGSI  416


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 63/125 (50%), Gaps = 2/125 (2%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            + SGV+ P++GQL  L    +++N   G VPPEI     L +L+LS N      P  ++ 
Sbjct  484  SFSGVVPPEIGQLQQLSKADLSSNAFEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISG  543

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            +  L  L+L  N+L G++P  +  M SL  +    N  SG +P   G+F      +  GN
Sbjct  544  MRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVPGT-GQFSYFNATSFIGN  602

Query  734  -GLSG  745
             GL G
Sbjct  603  PGLCG  607



>ref|XP_004981595.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1029

 Score =   287 bits (735),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 166/268 (62%), Positives = 204/268 (76%), Gaps = 8/268 (3%)
 Frame = +2

Query  275   SLTSWN-ISTSHCTWRRVTCd------sllhvvsldlsglNLSGVLSPDVGQLPFLVNLS  433
             +L SWN  S  HC W  VTC           VV LD+SGLNLSG L   + +L  L  LS
Sbjct  41    ALRSWNATSPDHCAWAGVTCAPPGGGRGGGIVVGLDVSGLNLSGALPQALSRLHGLQRLS  100

Query  434   IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT-GDLP  610
             +AAN L GP+PP ++ +  L  LNLSNN F  +FP  LA+L  L+VLDLYNNNLT   LP
Sbjct  101   VAANALYGPIPPSLARLQQLVHLNLSNNAFNGSFPPALARLRGLRVLDLYNNNLTSATLP  160

Query  611   VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKEL  790
             +EV +M  LRHLHLGGN+FSG IPPEYGR+P L+YLAVSGN LSG IP E+GNLT L+EL
Sbjct  161   LEVTQMPMLRHLHLGGNFFSGEIPPEYGRWPRLQYLAVSGNELSGRIPPELGNLTTLREL  220

Query  791   YIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSL  970
             YIGY+N ++GG+PPE+GNL++L+R DAANCGL+GE+P E+G+L+NLDTLFLQVN L+GS+
Sbjct  221   YIGYYNSYTGGLPPELGNLTELVRLDAANCGLSGEIPPELGRLQNLDTLFLQVNGLTGSI  280

Query  971   APEIGYlknlksldlsnnAFSGEIPESF  1054
               E+G+LK+L SLDLSNNA +GEIPESF
Sbjct  281   PSELGHLKSLSSLDLSNNALTGEIPESF  308


 Score =   106 bits (265),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 127/229 (55%), Gaps = 4/229 (2%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
             N +G +   +G+   L  L +++N+L+G +PPE+ A   L+  + L N +FG+  P  L 
Sbjct  347   NFTGGVPRRLGRNGRLQLLDLSSNKLTGTLPPELCAGGKLQTLIALGNFLFGA-IPDSLG  405

Query  551   QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYG-RFPNLEYLAVS  727
             Q  +L  + L  N L G +P  ++++  L  + L  N  +G  P   G   PNL  +++S
Sbjct  406   QCKSLSRVRLGENYLNGSIPKGLFELPKLTQVELQDNLLTGNFPAVIGVAAPNLGEISLS  465

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
              N L+G +P+ +G+ + +++L +   N FSG +PPE+G L QL + D ++    G +P E
Sbjct  466   NNQLTGALPASLGSFSGIQKLLLDR-NSFSGAVPPEIGRLQQLSKADLSSNKFEGGVPPE  524

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             IGK + L  L +  N+LSG + P I  +  L  L+LS N   GEIP S 
Sbjct  525   IGKCRLLTYLDMSQNNLSGKIPPAISGMWILNYLNLSRNHLDGEIPPSI  573


 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 73/203 (36%), Positives = 105/203 (52%), Gaps = 1/203 (0%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN      P   ++L
Sbjct  252  LSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGHLKSLSSLDLSNNALTGEIPESFSEL  311

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL +L+L+ N L GD+P  V  M SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  312  KNLTLLNLFRNKLRGDIPDFVGDMPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNK  371

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P E+    KL+ L I   N   G IP  +G    L R       L G +P  + +
Sbjct  372  LTGTLPPELCAGGKLQTL-IALGNFLFGAIPDSLGQCKSLSRVRLGENYLNGSIPKGLFE  430

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            L  L  + LQ N L+G+    IG
Sbjct  431  LPKLTQVELQDNLLTGNFPAVIG  453


 Score = 95.9 bits (237),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 84/273 (31%), Positives = 122/273 (45%), Gaps = 48/273 (18%)
 Frame = +2

Query  380   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  559
             S  L  +V Q+P L +L +  N  SG +PPE      L++L +S N      P +L  L 
Sbjct  156   SATLPLEVTQMPMLRHLHLGGNFFSGEIPPEYGRWPRLQYLAVSGNELSGRIPPELGNLT  215

Query  560   NLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              L+ L + Y N+ TG LP E+  +T L  L       SG IPPE GR  NL+ L +  NG
Sbjct  216   TLRELYIGYYNSYTGGLPPELGNLTELVRLDAANCGLSGEIPPELGRLQNLDTLFLQVNG  275

Query  737   LSGVIPSEIGN---------------------LTKLKEL----------------YIG--  799
             L+G IPSE+G+                      ++LK L                ++G  
Sbjct  276   LTGSIPSELGHLKSLSSLDLSNNALTGEIPESFSELKNLTLLNLFRNKLRGDIPDFVGDM  335

Query  800   --------YFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVND  955
                     + N F+GG+P  +G   +L   D ++  LTG LP E+     L TL    N 
Sbjct  336   PSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNKLTGTLPPELCAGGKLQTLIALGNF  395

Query  956   LSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             L G++   +G  K+L  + L  N  +G IP+  
Sbjct  396   LFGAIPDSLGQCKSLSRVRLGENYLNGSIPKGL  428


 Score = 91.7 bits (226),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 71/228 (31%), Positives = 113/228 (50%), Gaps = 8/228 (4%)
 Frame = +2

Query  374   NLSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  544
              L+G L P++   G+L  L+ L    N L G +P  +    +L  + L  N    + P  
Sbjct  371   KLTGTLPPELCAGGKLQTLIAL---GNFLFGAIPDSLGQCKSLSRVRLGENYLNGSIPKG  427

Query  545   LAQLANLQVLDLYNNNLTGDLPVEV-YKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLA  721
             L +L  L  ++L +N LTG+ P  +     +L  + L  N  +G +P   G F  ++ L 
Sbjct  428   LFELPKLTQVELQDNLLTGNFPAVIGVAAPNLGEISLSNNQLTGALPASLGSFSGIQKLL  487

Query  722   VSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELP  901
             +  N  SG +P EIG L +L +  +   N F GG+PPE+G    L   D +   L+G++P
Sbjct  488   LDRNSFSGAVPPEIGRLQQLSKADLSS-NKFEGGVPPEIGKCRLLTYLDMSQNNLSGKIP  546

Query  902   VEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
               I  +  L+ L L  N L G + P I  +++L ++D S N  SG +P
Sbjct  547   PAISGMWILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVP  594


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 63/125 (50%), Gaps = 2/125 (2%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            + SG + P++G+L  L    +++N+  G VPPEI     L +L++S N      P  ++ 
Sbjct  492  SFSGAVPPEIGRLQQLSKADLSSNKFEGGVPPEIGKCRLLTYLDMSQNNLSGKIPPAISG  551

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            +  L  L+L  N+L G++P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  552  MWILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLV-PGTGQFTYFNATSFVGN  610

Query  734  -GLSG  745
             GL G
Sbjct  611  PGLCG  615



>emb|CDY02112.1| BnaA03g40550D [Brassica napus]
Length=969

 Score =   286 bits (733),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 157/266 (59%), Positives = 192/266 (72%), Gaps = 25/266 (9%)
 Frame = +2

Query  263   DSQSS-LTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIA  439
             D Q S L SW++STS C W  VTCD                         L  +++L ++
Sbjct  42    DQQHSPLASWDLSTSFCLWTGVTCD-----------------------ASLRHVISLDLS  78

Query  440   ANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPVE  616
                LSG +P  ++++S LR LNLSNN+F  +FP +L A L NL+VLDLYNNNLTGDLPV 
Sbjct  79    GLNLSGTLPSSMASLSELRRLNLSNNVFNGSFPDELSAGLVNLRVLDLYNNNLTGDLPVS  138

Query  617   VYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYI  796
             +  +T LRHLHLGGNYF+GRIPP YG +P LEYLAVSGN L+G IP EIGNLT L+ELYI
Sbjct  139   ITNLTELRHLHLGGNYFAGRIPPAYGSWPTLEYLAVSGNELAGKIPPEIGNLTTLRELYI  198

Query  797   GYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAP  976
             GYFN F GG+PPE+GNLS+L+R DAANCGL GE+P EIG+L+ LDTLFLQVN  SG+L P
Sbjct  199   GYFNAFDGGLPPEIGNLSELLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPP  258

Query  977   EIGYlknlksldlsnnAFSGEIPESF  1054
             E+G + +LKS+DLSNN F+GEIP SF
Sbjct  259   ELGTISSLKSMDLSNNMFTGEIPPSF  284


 Score =   107 bits (268),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 86/249 (35%), Positives = 120/249 (48%), Gaps = 27/249 (11%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L G + P++G+L  L  L +  N  SG +PPE+  IS+L+ ++LSNN+F    P    QL
Sbjct  228   LRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPPSFEQL  287

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  +  M  L  L L  N F+G IP + G    L  L +S N 
Sbjct  288   RNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQLWENNFTGSIPRKLGENGRLVILDLSSNK  347

Query  737   LSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+G                         IP  +G    L  + +G  N  +G IP  +  
Sbjct  348   LTGTLPPNMCFGNRLVTLITLGNFLFGSIPDSLGKCESLTRIRMGQ-NFLNGSIPNVLFG  406

Query  845   LSQLIRFDAANCGLTGELPVEI--GKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldls  1018
             L +L + +  +  LTGELP+ I  G   NL  + L  N LSG L P IG    ++ L L 
Sbjct  407   LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGSFSGVQKLLLD  466

Query  1019  nnAFSGEIP  1045
              N FSG IP
Sbjct  467   GNKFSGAIP  475


 Score =   104 bits (259),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 79/228 (35%), Positives = 119/228 (52%), Gaps = 3/228 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     LV L    N L G +P  +    +L  + +  N    + P+ L  
Sbjct  347   KLTGTLPPNMCFGNRLVTLITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIPNVLFG  406

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  727
             L  L  ++L +N LTG+LP+ +    S  L  + L  N  SG +PP  G F  ++ L + 
Sbjct  407   LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGSFSGVQKLLLD  466

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
             GN  SG IPSEIG L +L +L   + N FSGGIPPE+     L   D +   L+G++P E
Sbjct  467   GNKFSGAIPSEIGRLQQLSKLDFSH-NLFSGGIPPEISRCKLLTYVDLSRNELSGDIPNE  525

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
             I  ++ L+ L +  N L GS+   I  +++L S+D S N  SG +P +
Sbjct  526   ITSMRILNYLNVSRNHLVGSIPVTISSMQSLTSIDFSYNNLSGLVPST  573


 Score = 99.0 bits (245),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 116/224 (52%), Gaps = 2/224 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             L+G + P++G L  L  L I   N   G +PPEI  +S L  L+ +N       P ++ +
Sbjct  179   LAGKIPPEIGNLTTLRELYIGYFNAFDGGLPPEIGNLSELLRLDAANCGLRGEIPPEIGR  238

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  L L  N  +G LP E+  ++SL+ + L  N F+G IPP + +  NL  L +  N
Sbjct  239   LRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPPSFEQLRNLTLLNLFRN  298

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  IG++  L+ L + + N F+G IP ++G   +L+  D ++  LTG LP  + 
Sbjct  299   KLYGAIPEFIGDMPGLEVLQL-WENNFTGSIPRKLGENGRLVILDLSSNKLTGTLPPNMC  357

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
                 L TL    N L GS+   +G  ++L  + +  N  +G IP
Sbjct  358   FGNRLVTLITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIP  401


 Score = 92.0 bits (227),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 67/206 (33%), Positives = 112/206 (54%), Gaps = 5/206 (2%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTL-RFLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   LV L +++N+L+G +PP +   + L   + L N +FGS  P  L 
Sbjct  323  NFTGSIPRKLGENGRLVILDLSSNKLTGTLPPNMCFGNRLVTLITLGNFLFGS-IPDSLG  381

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEY--GRFPNLEYLAV  724
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P     G   NL  +++
Sbjct  382  KCESLTRIRMGQNFLNGSIPNVLFGLPELSQVELQDNYLTGELPLPISGGVSVNLGQISL  441

Query  725  SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPV  904
            S N LSG +P  IG+ + +++L +   N FSG IP E+G L QL + D ++   +G +P 
Sbjct  442  SNNQLSGPLPPAIGSFSGVQKLLLDG-NKFSGAIPSEIGRLQQLSKLDFSHNLFSGGIPP  500

Query  905  EIGKLKNLDTLFLQVNDLSGSLAPEI  982
            EI + K L  + L  N+LSG +  EI
Sbjct  501  EISRCKLLTYVDLSRNELSGDIPNEI  526


 Score = 76.6 bits (187),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 92/188 (49%), Gaps = 5/188 (3%)
 Frame = +2

Query  410  LPFLVNLSIAANQLSGPVPPEISAISTLRF--LNLSNNIFGSTFPHQLAQLANLQVLDLY  583
            LP L  + +  N L+G +P  IS   ++    ++LSNN      P  +   + +Q L L 
Sbjct  407  LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGSFSGVQKLLLD  466

Query  584  NNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEI  763
             N  +G +P E+ ++  L  L    N FSG IPPE  R   L Y+ +S N LSG IP+EI
Sbjct  467  GNKFSGAIPSEIGRLQQLSKLDFSHNLFSGGIPPEISRCKLLTYVDLSRNELSGDIPNEI  526

Query  764  GNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLD-TLF  940
             ++  L  L +   N   G IP  + ++  L   D +   L+G +P   G+    + T F
Sbjct  527  TSMRILNYLNVSR-NHLVGSIPVTISSMQSLTSIDFSYNNLSGLVP-STGQFGYFNHTSF  584

Query  941  LQVNDLSG  964
            L  +DL G
Sbjct  585  LGNSDLCG  592



>ref|XP_009396449.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score =   286 bits (733),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 167/269 (62%), Positives = 206/269 (77%), Gaps = 3/269 (1%)
 Frame = +2

Query  257   TADSQSSLTSWNISTS--HCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVN  427
              +D   +L++WN S S  HC+W  V CD     VVSLDL+G NLSG LS  V +L  L+N
Sbjct  43    VSDPSDALSAWNNSASGGHCSWPGVACDPLRGFVVSLDLTGFNLSGTLSLAVVRLRHLLN  102

Query  428   LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  607
             LS A+N LSGP+P E+S +S LR LNLSNN+F  +FP  + +L NL VLD+YNNNLTG L
Sbjct  103   LSAASNSLSGPIPAELSRLSNLRHLNLSNNLFNGSFPSAIVRLKNLLVLDIYNNNLTGPL  162

Query  608   PVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKE  787
             P EV ++ +LRHLHLGGN+FSG IPP +GR+  LEYLAVSGN L G IP E+GNLT+L++
Sbjct  163   PAEVSELPNLRHLHLGGNFFSGVIPPVFGRWEFLEYLAVSGNELGGPIPPELGNLTRLRQ  222

Query  788   LYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGS  967
             LY+GYFN F GGIPPE+G L +L+R D ANCGLTGE+P E+G L+NLDTLFLQVN LSG 
Sbjct  223   LYLGYFNNFEGGIPPEIGGLPELVRLDMANCGLTGEIPPELGNLQNLDTLFLQVNGLSGR  282

Query  968   LAPEIGYlknlksldlsnnAFSGEIPESF  1054
             L  E+G L++LKS+DLSNNA +GEIP SF
Sbjct  283   LPVELGRLRSLKSMDLSNNALTGEIPSSF  311


 Score =   112 bits (279),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 79/227 (35%), Positives = 120/227 (53%), Gaps = 2/227 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              SGV+ P  G+  FL  L+++ N+L GP+PPE+  ++ LR L L   N F    P ++  
Sbjct  182   FSGVIPPVFGRWEFLEYLAVSGNELGGPIPPELGNLTRLRQLYLGYFNNFEGGIPPEIGG  241

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  LD+ N  LTG++P E+  + +L  L L  N  SGR+P E GR  +L+ + +S N
Sbjct  242   LPELVRLDMANCGLTGEIPPELGNLQNLDTLFLQVNGLSGRLPVELGRLRSLKSMDLSNN  301

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L+G IPS   +L  L  L + + N   G IP  +G+L  L          TG +P  +G
Sbjct  302   ALTGEIPSSFADLQNLTLLNL-FRNKLHGSIPEFVGDLPALEVLQLWENNFTGGIPRRLG  360

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             +   L  + L  N L+G+L P++ +   L++L    N   G IPE+ 
Sbjct  361   QSGRLQIVDLSSNKLTGTLPPDLCFGNKLQTLIALGNFLFGPIPETL  407


 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 87/253 (34%), Positives = 121/253 (48%), Gaps = 27/253 (11%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L G +   VG LP L  L +  N  +G +P  +     L+ ++LS+N    T P  L  
Sbjct  326   KLHGSIPEFVGDLPALEVLQLWENNFTGGIPRRLGQSGRLQIVDLSSNKLTGTLPPDLCF  385

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP-----------------  682
                LQ L    N L G +P  + +  SL  + +G NY +G IP                 
Sbjct  386   GNKLQTLIALGNFLFGPIPETLGRCESLGRIRMGENYLNGSIPHGLFSLPKLSQLELQDN  445

Query  683   ------PEYGRF---PNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPE  835
                   P+ G     P+L  +++S N LSG +P  IGNLT L++L +   N FSG IPPE
Sbjct  446   LLTGGFPDTGAAAISPDLGQISLSNNRLSGPLPPSIGNLTGLQKLLLNQ-NQFSGRIPPE  504

Query  836   MGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldl  1015
             MG L QL + D +    +G +  EI + K L  + L  N+LSG L PEI  ++ L  L+L
Sbjct  505   MGRLQQLSKLDFSGNRFSGPIAPEISRCKLLTFVDLSRNELSGELPPEIAGMRILNYLNL  564

Query  1016  snnAFSGEIPESF  1054
             S N   G IP S 
Sbjct  565   SRNQLEGSIPASI  577


 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 104/199 (52%), Gaps = 1/199 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            N  G + P++G LP LV L +A   L+G +PPE+  +  L  L L  N      P +L +
Sbjct  230  NFEGGIPPEIGGLPELVRLDMANCGLTGEIPPELGNLQNLDTLFLQVNGLSGRLPVELGR  289

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L +L+ +DL NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N
Sbjct  290  LRSLKSMDLSNNALTGEIPSSFADLQNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWEN  349

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              +G IP  +G   +L+ + +   N  +G +PP++   ++L    A    L G +P  +G
Sbjct  350  NFTGGIPRRLGQSGRLQIVDLSS-NKLTGTLPPDLCFGNKLQTLIALGNFLFGPIPETLG  408

Query  914  KLKNLDTLFLQVNDLSGSL  970
            + ++L  + +  N L+GS+
Sbjct  409  RCESLGRIRMGENYLNGSI  427


 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 102/203 (50%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L+G + P++G L  L  L +  N LSG +P E+  + +L+ ++LSNN      P   A L
Sbjct  255  LTGEIPPELGNLQNLDTLFLQVNGLSGRLPVELGRLRSLKSMDLSNNALTGEIPSSFADL  314

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL +L+L+ N L G +P  V  + +L  L L  N F+G IP   G+   L+ + +S N 
Sbjct  315  QNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWENNFTGGIPRRLGQSGRLQIVDLSSNK  374

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P ++    KL+ L I   N   G IP  +G    L R       L G +P  +  
Sbjct  375  LTGTLPPDLCFGNKLQTL-IALGNFLFGPIPETLGRCESLGRIRMGENYLNGSIPHGLFS  433

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            L  L  L LQ N L+G   P+ G
Sbjct  434  LPKLSQLELQDNLLTGGF-PDTG  455


 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 78/226 (35%), Positives = 109/226 (48%), Gaps = 3/226 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + PH L  
Sbjct  374   KLTGTLPPDLCFGNKLQTLIALGNFLFGPIPETLGRCESLGRIRMGENYLNGSIPHGLFS  433

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  727
             L  L  L+L +N LTG  P       S  L  + L  N  SG +PP  G    L+ L ++
Sbjct  434   LPKLSQLELQDNLLTGGFPDTGAAAISPDLGQISLSNNRLSGPLPPSIGNLTGLQKLLLN  493

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
              N  SG IP E+G L +L +L     N FSG I PE+     L   D +   L+GELP E
Sbjct  494   QNQFSGRIPPEMGRLQQLSKLDFSG-NRFSGPIAPEISRCKLLTFVDLSRNELSGELPPE  552

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             I  ++ L+ L L  N L GS+   I  +++L ++D S N  SG +P
Sbjct  553   IAGMRILNYLNLSRNQLEGSIPASIATMQSLTAVDFSYNNLSGLVP  598



>emb|CDY23037.1| BnaC07g31500D [Brassica napus]
Length=967

 Score =   283 bits (725),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 156/265 (59%), Positives = 188/265 (71%), Gaps = 24/265 (9%)
 Frame = +2

Query  263   DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAA  442
             D  S L SWN+STS C W  VTCD                         L  + +L ++ 
Sbjct  42    DQHSPLASWNLSTSFCLWTGVTCD-----------------------ASLRHVTSLYLSG  78

Query  443   NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPVEV  619
               LSG +   ++++S LR LNLSNN+F  +FP +L A L NL+VLDLYNNNLTGDLPV +
Sbjct  79    LNLSGTLSSSMASLSELRLLNLSNNVFNGSFPDELSAGLVNLRVLDLYNNNLTGDLPVSL  138

Query  620   YKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIG  799
               +T LRHLHLGGNYF+GRIPP YG +P LEYLAVSGN L+G IP EIGNLT L+ELYIG
Sbjct  139   TNLTELRHLHLGGNYFAGRIPPAYGSWPALEYLAVSGNELAGKIPPEIGNLTALRELYIG  198

Query  800   YFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPE  979
             YFN F GG+PPE+GNLS L+R DAANCGL GE+P EIG+L+ LDTLFLQVN  SG+L PE
Sbjct  199   YFNAFDGGLPPEIGNLSDLLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPE  258

Query  980   IGYlknlksldlsnnAFSGEIPESF  1054
             +G + +LKS+DLSNN F+GEIP SF
Sbjct  259   LGTISSLKSMDLSNNMFTGEIPPSF  283


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 86/249 (35%), Positives = 120/249 (48%), Gaps = 27/249 (11%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L G + P++G+L  L  L +  N  SG +PPE+  IS+L+ ++LSNN+F    P    QL
Sbjct  227   LRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPPSFEQL  286

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  +  M  L  L L  N F+G IP + G    L  L +S N 
Sbjct  287   RNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQLWENNFTGSIPRKLGGNGRLVILDLSSNK  346

Query  737   LSGV------------------------IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+G                         IP  +G    L  + +G  N  +G IP  +  
Sbjct  347   LTGTLPPNMCFGNRLVTVITLGNFLFGSIPDSLGKCESLTRIRMGQ-NFLNGSIPNGLFG  405

Query  845   LSQLIRFDAANCGLTGELPVEI--GKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldls  1018
             L +L + +  +  LTGELP+ I  G   NL  + L  N LSG L P IG    ++ L L 
Sbjct  406   LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGNFSGVQKLLLD  465

Query  1019  nnAFSGEIP  1045
              N FSG IP
Sbjct  466   GNKFSGPIP  474


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 118/228 (52%), Gaps = 3/228 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     LV +    N L G +P  +    +L  + +  N    + P+ L  
Sbjct  346   KLTGTLPPNMCFGNRLVTVITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIPNGLFG  405

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  727
             L  L  ++L +N LTG+LP+ +    S  L  + L  N  SG +PP  G F  ++ L + 
Sbjct  406   LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGNFSGVQKLLLD  465

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
             GN  SG IPSEIG L +L +L   + N FSGGI PE+     L   D +   L+GE+P E
Sbjct  466   GNKFSGPIPSEIGRLQQLSKLDFSH-NLFSGGIAPEISRCKLLTYVDLSRNELSGEIPNE  524

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
             I  ++ L+ L +  N L GS+   I  +++L S+D S N  SG +P +
Sbjct  525   ITSMRILNYLNVSRNHLVGSIPATISSMQSLTSVDFSYNNLSGLVPST  572


 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 116/224 (52%), Gaps = 2/224 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             L+G + P++G L  L  L I   N   G +PPEI  +S L  L+ +N       P ++ +
Sbjct  178   LAGKIPPEIGNLTALRELYIGYFNAFDGGLPPEIGNLSDLLRLDAANCGLRGEIPPEIGR  237

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  L L  N  +G LP E+  ++SL+ + L  N F+G IPP + +  NL  L +  N
Sbjct  238   LRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPPSFEQLRNLTLLNLFRN  297

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  IG++  L+ L + + N F+G IP ++G   +L+  D ++  LTG LP  + 
Sbjct  298   KLYGAIPEFIGDMPGLEVLQL-WENNFTGSIPRKLGGNGRLVILDLSSNKLTGTLPPNMC  356

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
                 L T+    N L GS+   +G  ++L  + +  N  +G IP
Sbjct  357   FGNRLVTVITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIP  400


 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 67/206 (33%), Positives = 110/206 (53%), Gaps = 5/206 (2%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTL-RFLNLSNNIFGSTFPHQLA  550
            N +G +   +G    LV L +++N+L+G +PP +   + L   + L N +FGS  P  L 
Sbjct  322  NFTGSIPRKLGGNGRLVILDLSSNKLTGTLPPNMCFGNRLVTVITLGNFLFGS-IPDSLG  380

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEY--GRFPNLEYLAV  724
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P     G   NL  +++
Sbjct  381  KCESLTRIRMGQNFLNGSIPNGLFGLPELSQVELQDNYLTGELPLPISGGVSVNLGQISL  440

Query  725  SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPV  904
            S N LSG +P  IGN + +++L +   N FSG IP E+G L QL + D ++   +G +  
Sbjct  441  SNNQLSGPLPPAIGNFSGVQKLLLDG-NKFSGPIPSEIGRLQQLSKLDFSHNLFSGGIAP  499

Query  905  EIGKLKNLDTLFLQVNDLSGSLAPEI  982
            EI + K L  + L  N+LSG +  EI
Sbjct  500  EISRCKLLTYVDLSRNELSGEIPNEI  525


 Score = 73.6 bits (179),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 91/188 (48%), Gaps = 5/188 (3%)
 Frame = +2

Query  410  LPFLVNLSIAANQLSGPVPPEISAISTLRF--LNLSNNIFGSTFPHQLAQLANLQVLDLY  583
            LP L  + +  N L+G +P  IS   ++    ++LSNN      P  +   + +Q L L 
Sbjct  406  LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGNFSGVQKLLLD  465

Query  584  NNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEI  763
             N  +G +P E+ ++  L  L    N FSG I PE  R   L Y+ +S N LSG IP+EI
Sbjct  466  GNKFSGPIPSEIGRLQQLSKLDFSHNLFSGGIAPEISRCKLLTYVDLSRNELSGEIPNEI  525

Query  764  GNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLD-TLF  940
             ++  L  L +   N   G IP  + ++  L   D +   L+G +P   G+    + T F
Sbjct  526  TSMRILNYLNVSR-NHLVGSIPATISSMQSLTSVDFSYNNLSGLVP-STGQFGYFNHTSF  583

Query  941  LQVNDLSG  964
            L  +DL G
Sbjct  584  LGNSDLCG  591



>ref|NP_001058840.2| Os07g0134200 [Oryza sativa Japonica Group]
 dbj|BAF20754.2| Os07g0134200 [Oryza sativa Japonica Group]
Length=883

 Score =   282 bits (722),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 168/282 (60%), Positives = 206/282 (73%), Gaps = 5/282 (2%)
 Frame = +2

Query  221   EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-  391
             E  ALL++KAA   D   +L SW  N ++S C W  V C++   VV LD+SG NL+G L 
Sbjct  27    EADALLAVKAALD-DPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLP  85

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQ  568
                +  L  L  L +AAN LSGP+P  +S ++  L  LNLSNN    TFP QL++L  L+
Sbjct  86    GAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALR  145

Query  569   VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  748
             VLDLYNNNLTG LP+EV  M  LRHLHLGGN+FSG IPPEYGR+  L+YLAVSGN LSG 
Sbjct  146   VLDLYNNNLTGALPLEVVSMAQLRHLHLGGNFFSGGIPPEYGRWGRLQYLAVSGNELSGK  205

Query  749   IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNL  928
             IP E+GNLT L+ELYIGYFN +SGGIPPE+GN++ L+R DAANCGL+GE+P E+G L NL
Sbjct  206   IPPELGNLTSLRELYIGYFNSYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELGNLANL  265

Query  929   DTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             DTLFLQVN L+G +  E+G L +L SLDLSNNA +GEIP +F
Sbjct  266   DTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATF  307


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 85/252 (34%), Positives = 121/252 (48%), Gaps = 26/252 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L G +   VG LP L  L +  N  +G +P  +      + L+LS+N    T P  L  
Sbjct  322   KLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCA  381

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE-------  712
                L+ L    N+L G +P  + K TSL  + LG NY +G IP      PNL        
Sbjct  382   GGKLETLIALGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGLFELPNLTQVELQDN  441

Query  713   -----YLAVSGNG-------------LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  838
                  + AVSG G             L+G +P+ IG+ + +++L +   N F+G IPPE+
Sbjct  442   LISGGFPAVSGTGAPNLGQISLSNNQLTGALPAFIGSFSGVQKLLLDQ-NAFTGEIPPEI  500

Query  839   GNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldls  1018
             G L QL + D +     G +P EIGK + L  L L  N+LSG + P I  ++ L  L+LS
Sbjct  501   GRLQQLSKADLSGNSFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLS  560

Query  1019  nnAFSGEIPESF  1054
              N   GEIP + 
Sbjct  561   RNQLDGEIPATI  572


 Score = 95.9 bits (237),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 103/196 (53%), Gaps = 1/196 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P++G L  L  L +  N L+G +P E+  +++L  L+LSNN      P   A L
Sbjct  251  LSGEIPPELGNLANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADL  310

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G IP   GR    + L +S N 
Sbjct  311  KNLTLLNLFRNKLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNR  370

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P ++    KL+ L I   N   G IP  +G  + L R    +  L G +P  + +
Sbjct  371  LTGTLPPDLCAGGKLETL-IALGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGLFE  429

Query  917  LKNLDTLFLQVNDLSG  964
            L NL  + LQ N +SG
Sbjct  430  LPNLTQVELQDNLISG  445


 Score = 95.5 bits (236),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 79/227 (35%), Positives = 115/227 (51%), Gaps = 2/227 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             LSG + P++G L  L  L I   N  SG +PPE+  ++ L  L+ +N       P +L  
Sbjct  202   LSGKIPPELGNLTSLRELYIGYFNSYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELGN  261

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             LANL  L L  N L G +P E+ K+ SL  L L  N  +G IP  +    NL  L +  N
Sbjct  262   LANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADLKNLTLLNLFRN  321

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  +G+L  L+ L + + N F+GGIP  +G   +    D ++  LTG LP ++ 
Sbjct  322   KLRGDIPEFVGDLPSLEVLQL-WENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLC  380

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
                 L+TL    N L G++   +G   +L  + L +N  +G IPE  
Sbjct  381   AGGKLETLIALGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGL  427


 Score = 92.4 bits (228),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 72/229 (31%), Positives = 116/229 (51%), Gaps = 8/229 (3%)
 Frame = +2

Query  377   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  547
             L+G L PD+   G+L  L+ L    N L G +P  +   ++L  + L +N    + P  L
Sbjct  371   LTGTLPPDLCAGGKLETLIAL---GNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGL  427

Query  548   AQLANLQVLDLYNNNLTGDLP-VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  724
              +L NL  ++L +N ++G  P V      +L  + L  N  +G +P   G F  ++ L +
Sbjct  428   FELPNLTQVELQDNLISGGFPAVSGTGAPNLGQISLSNNQLTGALPAFIGSFSGVQKLLL  487

Query  725   SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPV  904
               N  +G IP EIG L +L +  +   N F GG+PPE+G    L   D +   L+GE+P 
Sbjct  488   DQNAFTGEIPPEIGRLQQLSKADLSG-NSFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPP  546

Query  905   EIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
              I  ++ L+ L L  N L G +   I  +++L ++D S N  SG +P +
Sbjct  547   AISGMRILNYLNLSRNQLDGEIPATIAAMQSLTAVDFSYNNLSGLVPAT  595


 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            +  G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  515  SFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAA  574

Query  554  LANLQVLDLYNNNLTGDLPV  613
            + +L  +D   NNL+G +P 
Sbjct  575  MQSLTAVDFSYNNLSGLVPA  594



>dbj|BAJ84911.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96166.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1020

 Score =   283 bits (724),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 155/266 (58%), Positives = 192/266 (72%), Gaps = 2/266 (1%)
 Frame = +2

Query  263   DSQSSLTSW-NISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSI  436
             D   SL SW N ST  C W  V+CD     V        NLSG +     +LP+L  L++
Sbjct  37    DPTGSLASWSNASTGPCAWSGVSCDGRSGAVVGVDLSGRNLSGAVPRAFSRLPYLARLNL  96

Query  437   AANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVE  616
             AAN LSGP+PP +S +  L +LNLS+N+   +FP  LA+L  L+VLDLYNNN TG LP+E
Sbjct  97    AANSLSGPIPPSLSRLGLLTYLNLSSNLLNGSFPPPLARLRALRVLDLYNNNFTGSLPLE  156

Query  617   VYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYI  796
             V  M  LRHLHLGGN+FSG IPPEYGR+  L+YLAVSGN LSG IP E+GNLT L++LYI
Sbjct  157   VVGMAQLRHLHLGGNFFSGEIPPEYGRWGRLQYLAVSGNELSGKIPPELGNLTSLRQLYI  216

Query  797   GYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAP  976
             GY+N +SGGIP E+GN+++L+R DAANCGL+GE+P E+G L  LDTLFLQVN L+G + P
Sbjct  217   GYYNNYSGGIPAELGNMTELVRLDAANCGLSGEIPPELGNLAKLDTLFLQVNGLTGGIPP  276

Query  977   EIGYlknlksldlsnnAFSGEIPESF  1054
              +G L +L SLDLSNNA SGEIP +F
Sbjct  277   VLGRLGSLSSLDLSNNALSGEIPATF  302


 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 79/248 (32%), Positives = 118/248 (48%), Gaps = 26/248 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L G +   VG LP L  L +  N  +G +P  +      + L+LS+N    T P +L   
Sbjct  318   LRGDIPQFVGDLPGLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPELCAG  377

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEY-------  715
               L+ L    N+L G +P  + K  +L  + LG N+ +G IP      PNL         
Sbjct  378   GKLETLIALGNSLFGPIPDSLGKCKALTRVRLGENFLNGSIPEGLFELPNLTQVELQDNL  437

Query  716   ------------------LAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
                               +++S N L+G +P+ IG+ + L++L +   N F+G IPPE+G
Sbjct  438   LSGSFPAVVSAGGPNLGGISLSNNQLTGSLPASIGSFSGLQKLLLDQ-NAFTGAIPPEIG  496

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
              L QL + D +     G +P EIGK + L  L +  N LSG + P I  ++ L  L+LS 
Sbjct  497   RLQQLSKADLSGNSFDGGVPSEIGKCRLLTYLDVSQNKLSGDIPPAISGMRILNYLNLSR  556

Query  1022  nAFSGEIP  1045
             N   GEIP
Sbjct  557   NQLDGEIP  564


 Score = 97.8 bits (242),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 69/205 (34%), Positives = 102/205 (50%), Gaps = 3/205 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-A  550
            +L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+   +FP  + A
Sbjct  389  SLFGPIPDSLGKCKALTRVRLGENFLNGSIPEGLFELPNLTQVELQDNLLSGSFPAVVSA  448

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
               NL  + L NN LTG LP  +   + L+ L L  N F+G IPPE GR   L    +SG
Sbjct  449  GGPNLGGISLSNNQLTGSLPASIGSFSGLQKLLLDQNAFTGAIPPEIGRLQQLSKADLSG  508

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N   G +PSEIG    L  L +   N  SG IPP +  +  L   + +   L GE+PV I
Sbjct  509  NSFDGGVPSEIGKCRLLTYLDVSQ-NKLSGDIPPAISGMRILNYLNLSRNQLDGEIPVTI  567

Query  911  GKLKNLDTLFLQVNDLSGSLAPEIG  985
              +++L  +    N+LSG L P  G
Sbjct  568  AAMQSLTAVDFSYNNLSG-LVPVTG  591


 Score = 92.4 bits (228),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 98/198 (49%), Gaps = 1/198 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P++G L  L  L +  N L+G +PP +  + +L  L+LSNN      P     L
Sbjct  246  LSGEIPPELGNLAKLDTLFLQVNGLTGGIPPVLGRLGSLSSLDLSNNALSGEIPATFVAL  305

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL + +L+ N L GD+P  V  +  L  L L  N F+G IP   GR    + L +S N 
Sbjct  306  KNLTLFNLFRNRLRGDIPQFVGDLPGLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNR  365

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P E+    KL+ L I   N   G IP  +G    L R       L G +P  + +
Sbjct  366  LTGTLPPELCAGGKLETL-IALGNSLFGPIPDSLGKCKALTRVRLGENFLNGSIPEGLFE  424

Query  917  LKNLDTLFLQVNDLSGSL  970
            L NL  + LQ N LSGS 
Sbjct  425  LPNLTQVELQDNLLSGSF  442



>dbj|BAC82955.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 dbj|BAD30615.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 gb|EAZ38608.1| hypothetical protein OsJ_22997 [Oryza sativa Japonica Group]
 dbj|BAH01666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1023

 Score =   282 bits (721),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 168/282 (60%), Positives = 206/282 (73%), Gaps = 5/282 (2%)
 Frame = +2

Query  221   EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-  391
             E  ALL++KAA   D   +L SW  N ++S C W  V C++   VV LD+SG NL+G L 
Sbjct  27    EADALLAVKAALD-DPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLP  85

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQ  568
                +  L  L  L +AAN LSGP+P  +S ++  L  LNLSNN    TFP QL++L  L+
Sbjct  86    GAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALR  145

Query  569   VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  748
             VLDLYNNNLTG LP+EV  M  LRHLHLGGN+FSG IPPEYGR+  L+YLAVSGN LSG 
Sbjct  146   VLDLYNNNLTGALPLEVVSMAQLRHLHLGGNFFSGGIPPEYGRWGRLQYLAVSGNELSGK  205

Query  749   IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNL  928
             IP E+GNLT L+ELYIGYFN +SGGIPPE+GN++ L+R DAANCGL+GE+P E+G L NL
Sbjct  206   IPPELGNLTSLRELYIGYFNSYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELGNLANL  265

Query  929   DTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             DTLFLQVN L+G +  E+G L +L SLDLSNNA +GEIP +F
Sbjct  266   DTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATF  307


 Score =   105 bits (262),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 85/252 (34%), Positives = 121/252 (48%), Gaps = 26/252 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L G +   VG LP L  L +  N  +G +P  +      + L+LS+N    T P  L  
Sbjct  322   KLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCA  381

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE-------  712
                L+ L    N+L G +P  + K TSL  + LG NY +G IP      PNL        
Sbjct  382   GGKLETLIALGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGLFELPNLTQVELQDN  441

Query  713   -----YLAVSGNG-------------LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  838
                  + AVSG G             L+G +P+ IG+ + +++L +   N F+G IPPE+
Sbjct  442   LISGGFPAVSGTGAPNLGQISLSNNQLTGALPAFIGSFSGVQKLLLDQ-NAFTGEIPPEI  500

Query  839   GNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldls  1018
             G L QL + D +     G +P EIGK + L  L L  N+LSG + P I  ++ L  L+LS
Sbjct  501   GRLQQLSKADLSGNSFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLS  560

Query  1019  nnAFSGEIPESF  1054
              N   GEIP + 
Sbjct  561   RNQLDGEIPATI  572


 Score = 95.5 bits (236),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 103/196 (53%), Gaps = 1/196 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P++G L  L  L +  N L+G +P E+  +++L  L+LSNN      P   A L
Sbjct  251  LSGEIPPELGNLANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADL  310

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G IP   GR    + L +S N 
Sbjct  311  KNLTLLNLFRNKLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNR  370

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P ++    KL+ L I   N   G IP  +G  + L R    +  L G +P  + +
Sbjct  371  LTGTLPPDLCAGGKLETL-IALGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGLFE  429

Query  917  LKNLDTLFLQVNDLSG  964
            L NL  + LQ N +SG
Sbjct  430  LPNLTQVELQDNLISG  445


 Score = 95.1 bits (235),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 79/227 (35%), Positives = 115/227 (51%), Gaps = 2/227 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             LSG + P++G L  L  L I   N  SG +PPE+  ++ L  L+ +N       P +L  
Sbjct  202   LSGKIPPELGNLTSLRELYIGYFNSYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELGN  261

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             LANL  L L  N L G +P E+ K+ SL  L L  N  +G IP  +    NL  L +  N
Sbjct  262   LANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADLKNLTLLNLFRN  321

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  +G+L  L+ L + + N F+GGIP  +G   +    D ++  LTG LP ++ 
Sbjct  322   KLRGDIPEFVGDLPSLEVLQL-WENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLC  380

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
                 L+TL    N L G++   +G   +L  + L +N  +G IPE  
Sbjct  381   AGGKLETLIALGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGL  427


 Score = 92.4 bits (228),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 72/229 (31%), Positives = 116/229 (51%), Gaps = 8/229 (3%)
 Frame = +2

Query  377   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  547
             L+G L PD+   G+L  L+ L    N L G +P  +   ++L  + L +N    + P  L
Sbjct  371   LTGTLPPDLCAGGKLETLIAL---GNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGL  427

Query  548   AQLANLQVLDLYNNNLTGDLP-VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  724
              +L NL  ++L +N ++G  P V      +L  + L  N  +G +P   G F  ++ L +
Sbjct  428   FELPNLTQVELQDNLISGGFPAVSGTGAPNLGQISLSNNQLTGALPAFIGSFSGVQKLLL  487

Query  725   SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPV  904
               N  +G IP EIG L +L +  +   N F GG+PPE+G    L   D +   L+GE+P 
Sbjct  488   DQNAFTGEIPPEIGRLQQLSKADLSG-NSFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPP  546

Query  905   EIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
              I  ++ L+ L L  N L G +   I  +++L ++D S N  SG +P +
Sbjct  547   AISGMRILNYLNLSRNQLDGEIPATIAAMQSLTAVDFSYNNLSGLVPAT  595


 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            +  G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  515  SFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAA  574

Query  554  LANLQVLDLYNNNLTGDLPV  613
            + +L  +D   NNL+G +P 
Sbjct  575  MQSLTAVDFSYNNLSGLVPA  594



>gb|EAZ02682.1| hypothetical protein OsI_24796 [Oryza sativa Indica Group]
Length=1023

 Score =   282 bits (721),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 168/282 (60%), Positives = 206/282 (73%), Gaps = 5/282 (2%)
 Frame = +2

Query  221   EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-  391
             E  ALL++KAA   D   +L SW  N ++S C W  V C++   VV LD+SG NL+G L 
Sbjct  27    EADALLAVKAALD-DPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLP  85

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQ  568
                +  L  L  L +AAN LSGP+P  +S ++  L  LNLSNN    TFP QL++L  L+
Sbjct  86    GAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALR  145

Query  569   VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  748
             VLDLYNNNLTG LP+EV  M  LRHLHLGGN+FSG IPPEYGR+  L+YLAVSGN LSG 
Sbjct  146   VLDLYNNNLTGALPLEVVSMAQLRHLHLGGNFFSGGIPPEYGRWGRLQYLAVSGNELSGK  205

Query  749   IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNL  928
             IP E+GNLT L+ELYIGYFN +SGGIPPE+GN++ L+R DAANCGL+GE+P E+G L NL
Sbjct  206   IPPELGNLTSLRELYIGYFNSYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELGNLANL  265

Query  929   DTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             DTLFLQVN L+G +  E+G L +L SLDLSNNA +GEIP +F
Sbjct  266   DTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATF  307


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 85/252 (34%), Positives = 121/252 (48%), Gaps = 26/252 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L G +   VG LP L  L +  N  +G +P  +      + L+LS+N    T P  L  
Sbjct  322   KLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCA  381

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE-------  712
                L+ L    N+L G +P  + K TSL  + LG NY +G IP      PNL        
Sbjct  382   GGKLETLIALGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGLFELPNLTQVELQDN  441

Query  713   -----YLAVSGNG-------------LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  838
                  + AVSG G             L+G +P+ IG+ + +++L +   N F+G IPPE+
Sbjct  442   LISGGFPAVSGTGAPNLGQISLSNNQLTGALPAFIGSFSGVQKLLLDQ-NAFTGEIPPEI  500

Query  839   GNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldls  1018
             G L QL + D +     G +P EIGK + L  L L  N+LSG + P I  ++ L  L+LS
Sbjct  501   GRLQQLSKADLSGNSFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLS  560

Query  1019  nnAFSGEIPESF  1054
              N   GEIP + 
Sbjct  561   RNQLDGEIPATI  572


 Score = 95.5 bits (236),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 103/196 (53%), Gaps = 1/196 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P++G L  L  L +  N L+G +P E+  +++L  L+LSNN      P   A L
Sbjct  251  LSGEIPPELGNLANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADL  310

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G IP   GR    + L +S N 
Sbjct  311  KNLTLLNLFRNKLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNR  370

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P ++    KL+ L I   N   G IP  +G  + L R    +  L G +P  + +
Sbjct  371  LTGTLPPDLCAGGKLETL-IALGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGLFE  429

Query  917  LKNLDTLFLQVNDLSG  964
            L NL  + LQ N +SG
Sbjct  430  LPNLTQVELQDNLISG  445


 Score = 95.1 bits (235),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 79/227 (35%), Positives = 115/227 (51%), Gaps = 2/227 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             LSG + P++G L  L  L I   N  SG +PPE+  ++ L  L+ +N       P +L  
Sbjct  202   LSGKIPPELGNLTSLRELYIGYFNSYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELGN  261

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             LANL  L L  N L G +P E+ K+ SL  L L  N  +G IP  +    NL  L +  N
Sbjct  262   LANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADLKNLTLLNLFRN  321

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  +G+L  L+ L + + N F+GGIP  +G   +    D ++  LTG LP ++ 
Sbjct  322   KLRGDIPEFVGDLPSLEVLQL-WENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLC  380

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
                 L+TL    N L G++   +G   +L  + L +N  +G IPE  
Sbjct  381   AGGKLETLIALGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGL  427


 Score = 92.4 bits (228),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 72/229 (31%), Positives = 116/229 (51%), Gaps = 8/229 (3%)
 Frame = +2

Query  377   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  547
             L+G L PD+   G+L  L+ L    N L G +P  +   ++L  + L +N    + P  L
Sbjct  371   LTGTLPPDLCAGGKLETLIAL---GNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGL  427

Query  548   AQLANLQVLDLYNNNLTGDLP-VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  724
              +L NL  ++L +N ++G  P V      +L  + L  N  +G +P   G F  ++ L +
Sbjct  428   FELPNLTQVELQDNLISGGFPAVSGTGAPNLGQISLSNNQLTGALPAFIGSFSGVQKLLL  487

Query  725   SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPV  904
               N  +G IP EIG L +L +  +   N F GG+PPE+G    L   D +   L+GE+P 
Sbjct  488   DQNAFTGEIPPEIGRLQQLSKADLS-GNSFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPP  546

Query  905   EIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
              I  ++ L+ L L  N L G +   I  +++L ++D S N  SG +P +
Sbjct  547   AISGMRILNYLNLSRNQLDGEIPATIAAMQSLTAVDFSYNNLSGLVPAT  595


 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            +  G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  515  SFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAA  574

Query  554  LANLQVLDLYNNNLTGDLPV  613
            + +L  +D   NNL+G +P 
Sbjct  575  MQSLTAVDFSYNNLSGLVPA  594



>ref|XP_004955422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1030

 Score =   280 bits (717),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 155/262 (59%), Positives = 198/262 (76%), Gaps = 2/262 (1%)
 Frame = +2

Query  275   SLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQ  448
             +L SW  N + S C W  VTC++   V+ +DLSG NLSG +   + +LP L  L +AAN 
Sbjct  48    ALASWTANATASPCAWSGVTCNARGAVIGVDLSGRNLSGPVPAALSRLPHLARLDLAANA  107

Query  449   LSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKM  628
              SGP+P  ++ +  L  LNLSNN+   TFP  LA+L  L+V+DLYNNNLTG LP+ V  +
Sbjct  108   FSGPIPTPLARLRYLTHLNLSNNVLNGTFPPPLARLRALRVVDLYNNNLTGPLPLGVAAL  167

Query  629   TSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFN  808
              +LRHLHLGGN+FSG IPPEYG +  L+YLAVSGN LSG IP E+GNLT L+ELYIGY+N
Sbjct  168   PALRHLHLGGNFFSGEIPPEYGTWGRLQYLAVSGNELSGRIPPELGNLTSLRELYIGYYN  227

Query  809   GFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGY  988
              +SGGIPPE+GN+++L+R DAANCGL+GE+P E+G L NLDTLFLQVN L+G + PE+G 
Sbjct  228   SYSGGIPPELGNMTELVRLDAANCGLSGEIPPELGNLANLDTLFLQVNGLAGGIPPELGR  287

Query  989   lknlksldlsnnAFSGEIPESF  1054
             L++L SLDLSNNA +GEIP +F
Sbjct  288   LRSLSSLDLSNNALTGEIPATF  309


 Score =   104 bits (260),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 84/252 (33%), Positives = 121/252 (48%), Gaps = 26/252 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L G +   VG LP L  L +  N  +G +P  +     L+ ++LS+N    T P  L  
Sbjct  324   KLRGSIPELVGDLPSLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNRLTGTLPPDLCA  383

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEY--------------  691
                L+ L    N L G +P  + K  +L  + LG NY +G IP                 
Sbjct  384   GGKLETLIALGNFLFGSIPESLGKCEALSRIRLGENYLNGSIPEGLFELPNLVQVELQDN  443

Query  692   ---GRFP--------NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  838
                G FP        NL  + +S N L+G +P+ IGN + L++L +   N F+G +PPE+
Sbjct  444   LLSGGFPAVAGAAASNLGSITLSNNQLTGALPASIGNFSGLQKLLLDQ-NAFNGAVPPEI  502

Query  839   GNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldls  1018
             G L QL + D +   L G +P EIGK + L  L L  N+LSG + P I  ++ L  L+LS
Sbjct  503   GRLQQLSKADLSGNSLDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLS  562

Query  1019  nnAFSGEIPESF  1054
              N   GEIP + 
Sbjct  563   RNHLDGEIPATI  574


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 80/227 (35%), Positives = 115/227 (51%), Gaps = 2/227 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             LSG + P++G L  L  L I   N  SG +PPE+  ++ L  L+ +N       P +L  
Sbjct  204   LSGRIPPELGNLTSLRELYIGYYNSYSGGIPPELGNMTELVRLDAANCGLSGEIPPELGN  263

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             LANL  L L  N L G +P E+ ++ SL  L L  N  +G IP  +    NL  L +  N
Sbjct  264   LANLDTLFLQVNGLAGGIPPELGRLRSLSSLDLSNNALTGEIPATFAALKNLTLLNLFRN  323

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  +G+L  L+ L + + N F+GGIP  +G   +L   D ++  LTG LP ++ 
Sbjct  324   KLRGSIPELVGDLPSLEVLQL-WENNFTGGIPRRLGRNGRLQLVDLSSNRLTGTLPPDLC  382

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
                 L+TL    N L GS+   +G  + L  + L  N  +G IPE  
Sbjct  383   AGGKLETLIALGNFLFGSIPESLGKCEALSRIRLGENYLNGSIPEGL  429


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 116/271 (43%), Gaps = 48/271 (18%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI------------------------SAI  484
             LSG + P++G L  L  L +  N L+G +PPE+                        +A+
Sbjct  253   LSGEIPPELGNLANLDTLFLQVNGLAGGIPPELGRLRSLSSLDLSNNALTGEIPATFAAL  312

Query  485   STLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  664
               L  LNL  N    + P  +  L +L+VL L+ NN TG +P  + +   L+ + L  N 
Sbjct  313   KNLTLLNLFRNKLRGSIPELVGDLPSLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNR  372

Query  665   FSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIG--YFNG---------  811
              +G +PP+      LE L   GN L G IP  +G    L  + +G  Y NG         
Sbjct  373   LTGTLPPDLCAGGKLETLIALGNFLFGSIPESLGKCEALSRIRLGENYLNGSIPEGLFEL  432

Query  812   ------------FSGGIPPEMG-NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVN  952
                          SGG P   G   S L     +N  LTG LP  IG    L  L L  N
Sbjct  433   PNLVQVELQDNLLSGGFPAVAGAAASNLGSITLSNNQLTGALPASIGNFSGLQKLLLDQN  492

Query  953   DLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
               +G++ PEIG L+ L   DLS N+  G +P
Sbjct  493   AFNGAVPPEIGRLQQLSKADLSGNSLDGGVP  523


 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 72/229 (31%), Positives = 113/229 (49%), Gaps = 8/229 (3%)
 Frame = +2

Query  377   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  547
             L+G L PD+   G+L  L+ L    N L G +P  +     L  + L  N    + P  L
Sbjct  373   LTGTLPPDLCAGGKLETLIAL---GNFLFGSIPESLGKCEALSRIRLGENYLNGSIPEGL  429

Query  548   AQLANLQVLDLYNNNLTGDLP-VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  724
              +L NL  ++L +N L+G  P V     ++L  + L  N  +G +P   G F  L+ L +
Sbjct  430   FELPNLVQVELQDNLLSGGFPAVAGAAASNLGSITLSNNQLTGALPASIGNFSGLQKLLL  489

Query  725   SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPV  904
               N  +G +P EIG L +L +  +   N   GG+PPE+G    L   D +   L+GE+P 
Sbjct  490   DQNAFNGAVPPEIGRLQQLSKADLS-GNSLDGGVPPEIGKCRLLTYLDLSRNNLSGEIPP  548

Query  905   EIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
              I  ++ L+ L L  N L G +   I  +++L ++D S N  SG +P +
Sbjct  549   AISGMRILNYLNLSRNHLDGEIPATIAAMQSLTAVDFSYNNLSGLVPAT  597


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            +L G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  517  SLDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLDGEIPATIAA  576

Query  554  LANLQVLDLYNNNLTGDLPV  613
            + +L  +D   NNL+G +P 
Sbjct  577  MQSLTAVDFSYNNLSGLVPA  596



>ref|XP_009411355.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1009

 Score =   279 bits (714),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 162/269 (60%), Positives = 204/269 (76%), Gaps = 3/269 (1%)
 Frame = +2

Query  257   TADSQSSLTSWNIS--TSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVN  427
              +D  +SL++WN S    HC+W  V CD +   V        NLSG L P VG+L  L+N
Sbjct  41    VSDPSASLSAWNSSAGVGHCSWPGVGCDPIQGSVVSLDLTGFNLSGSLFPAVGRLRHLLN  100

Query  428   LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  607
             LS A+N LSGP+P EIS +++LR LNLSNN+   +FP  LA+L NL VLDLYNNNLTG L
Sbjct  101   LSAASNSLSGPIPAEISRLASLRHLNLSNNLLNGSFPSALARLKNLLVLDLYNNNLTGPL  160

Query  608   PVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKE  787
             PVEV ++ +LRHLHLGGN+F+G IPPE+GR+  LEYLAVSGN L G IP E+GNLT+L++
Sbjct  161   PVEVAQLPNLRHLHLGGNFFTGVIPPEFGRWEFLEYLAVSGNELGGPIPPELGNLTRLRQ  220

Query  788   LYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGS  967
             LY+GYFN F GGIPPE+G+L  L+R D ANCGL GE+P E+ KL+NLDTLFLQVN L+G 
Sbjct  221   LYVGYFNSFEGGIPPEIGSLPALVRLDMANCGLNGEIPPELWKLQNLDTLFLQVNGLAGD  280

Query  968   LAPEIGYlknlksldlsnnAFSGEIPESF  1054
             + PE+G L++LKS+DLSNNA +GEIP +F
Sbjct  281   IPPELGRLRSLKSMDLSNNALTGEIPATF  309


 Score =   108 bits (271),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 79/248 (32%), Positives = 127/248 (51%), Gaps = 24/248 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              +GV+ P+ G+  FL  L+++ N+L GP+PPE+  ++ LR L +   N F    P ++  
Sbjct  180   FTGVIPPEFGRWEFLEYLAVSGNELGGPIPPELGNLTRLRQLYVGYFNSFEGGIPPEIGS  239

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  LD+ N  L G++P E++K+ +L  L L  N  +G IPPE GR  +L+ + +S N
Sbjct  240   LPALVRLDMANCGLNGEIPPELWKLQNLDTLFLQVNGLAGDIPPELGRLRSLKSMDLSNN  299

Query  734   GLSGVIPSEIGNLTKLKEL-------------YIG----------YFNGFSGGIPPEMGN  844
              L+G IP+   +L  L  L             +IG          + N F+GGIP ++G 
Sbjct  300   ALTGEIPATFADLENLTLLNLFRNKLRGLIPEFIGELPALEVLQLWENNFTGGIPRQLGR  359

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
               +L   D ++  LTG LP  +     L+T+    N L G +   +G  K+L  + +  N
Sbjct  360   SGRLQLLDLSSNKLTGTLPTGLCSENTLETVIALGNFLFGPIPETLGRCKSLSRIRMGEN  419

Query  1025  AFSGEIPE  1048
               +G IP+
Sbjct  420   YLNGSIPD  427


 Score = 95.1 bits (235),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 104/203 (51%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L+G + P++ +L  L  L +  N L+G +PPE+  + +L+ ++LSNN      P   A L
Sbjct  253  LNGEIPPELWKLQNLDTLFLQVNGLAGDIPPELGRLRSLKSMDLSNNALTGEIPATFADL  312

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL +L+L+ N L G +P  + ++ +L  L L  N F+G IP + GR   L+ L +S N 
Sbjct  313  ENLTLLNLFRNKLRGLIPEFIGELPALEVLQLWENNFTGGIPRQLGRSGRLQLLDLSSNK  372

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P+ + +   L E  I   N   G IP  +G    L R       L G +P  +  
Sbjct  373  LTGTLPTGLCSENTL-ETVIALGNFLFGPIPETLGRCKSLSRIRMGENYLNGSIPDGLFS  431

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            L  L  + LQ N L+G   P+ G
Sbjct  432  LPMLSQIELQDNLLTGGF-PDTG  453


 Score = 94.7 bits (234),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 79/253 (31%), Positives = 121/253 (48%), Gaps = 27/253 (11%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L G++   +G+LP L  L +  N  +G +P ++     L+ L+LS+N    T P  L  
Sbjct  324   KLRGLIPEFIGELPALEVLQLWENNFTGGIPRQLGRSGRLQLLDLSSNKLTGTLPTGLCS  383

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP-----------------  682
                L+ +    N L G +P  + +  SL  + +G NY +G IP                 
Sbjct  384   ENTLETVIALGNFLFGPIPETLGRCKSLSRIRMGENYLNGSIPDGLFSLPMLSQIELQDN  443

Query  683   ------PEYGRF---PNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPE  835
                   P+ G     P+L  + +S N LSG IP  IGN + +++L +   N FS  IPPE
Sbjct  444   LLTGGFPDTGAAAISPDLGEINLSNNRLSGSIPPSIGNYSGVQKLLLNQ-NQFSDRIPPE  502

Query  836   MGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldl  1015
             +G L +L + D +    +G +  EI + K L  + L  N+LSG + PEI  ++ L  L+L
Sbjct  503   IGRLQELSKVDFSGNRFSGPITPEISRCKLLTFVDLSRNELSGEIPPEIARMRILNYLNL  562

Query  1016  snnAFSGEIPESF  1054
             S N   G IP S 
Sbjct  563   SRNQLEGGIPPSI  575


 Score = 92.8 bits (229),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 103/199 (52%), Gaps = 1/199 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            +  G + P++G LP LV L +A   L+G +PPE+  +  L  L L  N      P +L +
Sbjct  228  SFEGGIPPEIGSLPALVRLDMANCGLNGEIPPELWKLQNLDTLFLQVNGLAGDIPPELGR  287

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L +L+ +DL NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N
Sbjct  288  LRSLKSMDLSNNALTGEIPATFADLENLTLLNLFRNKLRGLIPEFIGELPALEVLQLWEN  347

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              +G IP ++G   +L+ L +   N  +G +P  + + + L    A    L G +P  +G
Sbjct  348  NFTGGIPRQLGRSGRLQLLDLSS-NKLTGTLPTGLCSENTLETVIALGNFLFGPIPETLG  406

Query  914  KLKNLDTLFLQVNDLSGSL  970
            + K+L  + +  N L+GS+
Sbjct  407  RCKSLSRIRMGENYLNGSI  425


 Score = 88.6 bits (218),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 102/205 (50%), Gaps = 3/205 (1%)
 Frame = +2

Query  443   NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVY  622
             N L GP+P  +    +L  + +  N    + P  L  L  L  ++L +N LTG  P    
Sbjct  395   NFLFGPIPETLGRCKSLSRIRMGENYLNGSIPDGLFSLPMLSQIELQDNLLTGGFPDTGA  454

Query  623   KMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYI  796
                S  L  ++L  N  SG IPP  G +  ++ L ++ N  S  IP EIG L +L ++  
Sbjct  455   AAISPDLGEINLSNNRLSGSIPPSIGNYSGVQKLLLNQNQFSDRIPPEIGRLQELSKVDF  514

Query  797   GYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAP  976
                N FSG I PE+     L   D +   L+GE+P EI +++ L+ L L  N L G + P
Sbjct  515   SG-NRFSGPITPEISRCKLLTFVDLSRNELSGEIPPEIARMRILNYLNLSRNQLEGGIPP  573

Query  977   EIGYlknlksldlsnnAFSGEIPES  1051
              I  +++L ++D S N  SG +P S
Sbjct  574   SIATMQSLTAVDFSYNKLSGHVPGS  598


 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 75/150 (50%), Gaps = 7/150 (5%)
 Frame = +2

Query  380  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  559
            +  +SPD+G+    +NLS   N+LSG +PP I   S ++ L L+ N F    P ++ +L 
Sbjct  454  AAAISPDLGE----INLS--NNRLSGSIPPSIGNYSGVQKLLLNQNQFSDRIPPEIGRLQ  507

Query  560  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  739
             L  +D   N  +G +  E+ +   L  + L  N  SG IPPE  R   L YL +S N L
Sbjct  508  ELSKVDFSGNRFSGPITPEISRCKLLTFVDLSRNELSGEIPPEIARMRILNYLNLSRNQL  567

Query  740  SGVIPSEIGNLTKLKELYIGYFNGFSGGIP  829
             G IP  I  +  L  +   Y N  SG +P
Sbjct  568  EGGIPPSIATMQSLTAVDFSY-NKLSGHVP  596


 Score = 70.9 bits (172),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P +G    +  L +  NQ S  +PPEI  +  L  ++ S N F      ++++ 
Sbjct  471  LSGSIPPSIGNYSGVQKLLLNQNQFSDRIPPEIGRLQELSKVDFSGNRFSGPITPEISRC  530

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              L  +DL  N L+G++P E+ +M  L +L+L  N   G IPP      +L  +  S N 
Sbjct  531  KLLTFVDLSRNELSGEIPPEIARMRILNYLNLSRNQLEGGIPPSIATMQSLTAVDFSYNK  590

Query  737  LSGVIP  754
            LSG +P
Sbjct  591  LSGHVP  596



>tpg|DAA59489.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1037

 Score =   280 bits (715),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 158/267 (59%), Positives = 197/267 (74%), Gaps = 2/267 (1%)
 Frame = +2

Query  260   ADSQSSLTSWN--ISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLS  433
             +D   +L SW    ST  C W  VTC++   V+ LDLSG NLSG +   + +L  L  L 
Sbjct  45    SDPAGALASWTNATSTGACAWSGVTCNARAAVIGLDLSGRNLSGPVPTALSRLAHLARLD  104

Query  434   IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  613
             +AAN L GP+P  +S + +L  LNLSNN+   TFP  LA+L  L+VLDLYNNNLTG LP+
Sbjct  105   LAANALCGPIPAPLSRLQSLTHLNLSNNVLNGTFPPPLARLRALRVLDLYNNNLTGPLPL  164

Query  614   EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELY  793
              V  +  LRHLHLGGN+FSG IPPEYGR+  L+YLAVSGN LSG IP E+G LT L+ELY
Sbjct  165   AVVGLPVLRHLHLGGNFFSGEIPPEYGRWRRLQYLAVSGNELSGRIPPELGGLTTLRELY  224

Query  794   IGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLA  973
             IGY+N +S G+PPE+GN++ L+R DAANCGL+GE+P E+G L NLDTLFLQVN L+G++ 
Sbjct  225   IGYYNSYSSGLPPELGNMTDLVRLDAANCGLSGEIPPELGNLANLDTLFLQVNGLAGAIP  284

Query  974   PEIGYlknlksldlsnnAFSGEIPESF  1054
             PE+G LK+L SLDLSNNA +GEIP SF
Sbjct  285   PELGRLKSLSSLDLSNNALTGEIPASF  311


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 125/229 (55%), Gaps = 4/229 (2%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
             N +G +   +G+   L  + +++N+L+G +PPE+ A   L   + L N +FGS  P  L 
Sbjct  350   NFTGGIPRRLGRNGRLQLVDLSSNRLTGTLPPELCAGGKLETLIALGNFLFGS-IPEPLG  408

Query  551   QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGR-FPNLEYLAVS  727
             +   L  + L  N L G +P  ++++ +L  + L  N  SG  P   G   PNL  + +S
Sbjct  409   KCEALSRIRLGENYLNGSIPDGLFELPNLTQVELQDNLLSGGFPAVSGTGAPNLGAITLS  468

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
              N L+G +P+ IG  + L++L +   N F+G +PPE+G L QL + D +   L G +P E
Sbjct  469   NNQLTGALPASIGKFSGLQKLLLDQ-NAFTGAVPPEIGRLQQLSKADLSGNTLDGGVPPE  527

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             IGK + L  L L  N+LSG + P I  ++ L  L+LS N   GEIP + 
Sbjct  528   IGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLGGEIPATI  576


 Score = 95.1 bits (235),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 87/272 (32%), Positives = 120/272 (44%), Gaps = 50/272 (18%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI------------------------SAI  484
             LSG + P++G L  L  L +  N L+G +PPE+                        +A+
Sbjct  255   LSGEIPPELGNLANLDTLFLQVNGLAGAIPPELGRLKSLSSLDLSNNALTGEIPASFAAL  314

Query  485   STLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  664
               L  LNL  N    + P  +  L +L+VL L+ NN TG +P  + +   L+ + L  N 
Sbjct  315   RNLTLLNLFRNKLRGSIPELVGDLPSLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNR  374

Query  665   FSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPP---E  835
              +G +PPE      LE L   GN L G IP  +G    L  + +G  N  +G IP    E
Sbjct  375   LTGTLPPELCAGGKLETLIALGNFLFGSIPEPLGKCEALSRIRLGE-NYLNGSIPDGLFE  433

Query  836   MGNLSQLIRFD--------------AANCG--------LTGELPVEIGKLKNLDTLFLQV  949
             + NL+Q+   D              A N G        LTG LP  IGK   L  L L  
Sbjct  434   LPNLTQVELQDNLLSGGFPAVSGTGAPNLGAITLSNNQLTGALPASIGKFSGLQKLLLDQ  493

Query  950   NDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             N  +G++ PEIG L+ L   DLS N   G +P
Sbjct  494   NAFTGAVPPEIGRLQQLSKADLSGNTLDGGVP  525


 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 87/258 (34%), Positives = 125/258 (48%), Gaps = 10/258 (4%)
 Frame = +2

Query  284   SWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAA-NQLSGP  460
             S  I   +  WRR+          L +SG  LSG + P++G L  L  L I   N  S  
Sbjct  183   SGEIPPEYGRWRRLQ--------YLAVSGNELSGRIPPELGGLTTLRELYIGYYNSYSSG  234

Query  461   VPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLR  640
             +PPE+  ++ L  L+ +N       P +L  LANL  L L  N L G +P E+ ++ SL 
Sbjct  235   LPPELGNMTDLVRLDAANCGLSGEIPPELGNLANLDTLFLQVNGLAGAIPPELGRLKSLS  294

Query  641   HLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSG  820
              L L  N  +G IP  +    NL  L +  N L G IP  +G+L  L+ L + + N F+G
Sbjct  295   SLDLSNNALTGEIPASFAALRNLTLLNLFRNKLRGSIPELVGDLPSLEVLQL-WENNFTG  353

Query  821   GIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknl  1000
             GIP  +G   +L   D ++  LTG LP E+     L+TL    N L GS+   +G  + L
Sbjct  354   GIPRRLGRNGRLQLVDLSSNRLTGTLPPELCAGGKLETLIALGNFLFGSIPEPLGKCEAL  413

Query  1001  ksldlsnnAFSGEIPESF  1054
               + L  N  +G IP+  
Sbjct  414   SRIRLGENYLNGSIPDGL  431


 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 71/229 (31%), Positives = 113/229 (49%), Gaps = 8/229 (3%)
 Frame = +2

Query  377   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  547
             L+G L P++   G+L  L+ L    N L G +P  +     L  + L  N    + P  L
Sbjct  375   LTGTLPPELCAGGKLETLIAL---GNFLFGSIPEPLGKCEALSRIRLGENYLNGSIPDGL  431

Query  548   AQLANLQVLDLYNNNLTGDLP-VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  724
              +L NL  ++L +N L+G  P V      +L  + L  N  +G +P   G+F  L+ L +
Sbjct  432   FELPNLTQVELQDNLLSGGFPAVSGTGAPNLGAITLSNNQLTGALPASIGKFSGLQKLLL  491

Query  725   SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPV  904
               N  +G +P EIG L +L +  +   N   GG+PPE+G    L   D +   L+GE+P 
Sbjct  492   DQNAFTGAVPPEIGRLQQLSKADLS-GNTLDGGVPPEIGKCRLLTYLDLSRNNLSGEIPP  550

Query  905   EIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
              I  ++ L+ L L  N L G +   I  +++L ++D S N  SG +P +
Sbjct  551   AISGMRILNYLNLSRNHLGGEIPATIAAMQSLTAVDFSYNNLSGLVPAT  599



>emb|CDY45620.1| BnaCnng13280D [Brassica napus]
Length=973

 Score =   277 bits (708),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 159/282 (56%), Positives = 202/282 (72%), Gaps = 25/282 (9%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSS-LTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  391
             ++E  ALLS+K++ T D+ +S L SW  +TS CTW  VTC                    
Sbjct  23    ISEFRALLSLKSSLTGDAPNSPLASWKPTTSFCTWTGVTC--------------------  62

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQ  568
               DV +   + +L +++  LSG +  +IS +S LR LNLSNN+F  +FP +++  LANL+
Sbjct  63    --DVSRR-HVTSLDLSSLNLSGTLSRDISNLSGLRHLNLSNNVFNGSFPDEISSGLANLR  119

Query  569   VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  748
             VLD+YNNN+TGDLP+ V  +T LRHLHLGGNYF+G IPP YG +P +EYLAVSGN L+G 
Sbjct  120   VLDVYNNNMTGDLPLSVTNLTQLRHLHLGGNYFAGEIPPSYGTWPEIEYLAVSGNELTGK  179

Query  749   IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNL  928
             IP EIGNLT L+ELYIGYFN F  G+PPE+GNLS+L+RFDAANCGL GE+P EIG+L+ L
Sbjct  180   IPPEIGNLTTLRELYIGYFNAFEDGLPPEIGNLSELVRFDAANCGLNGEIPPEIGRLQKL  239

Query  929   DTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             DTLFLQVN  SG L  E+G L +LKS+DLSNN F+GEIP SF
Sbjct  240   DTLFLQVNVFSGPLTWELGKLSSLKSMDLSNNMFTGEIPSSF  281


 Score =   106 bits (264),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 86/247 (35%), Positives = 121/247 (49%), Gaps = 25/247 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   + L
Sbjct  225   LNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNNMFTGEIPSSFSDL  284

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP---EYGRF---------  700
              NL +L+L+ N L G++P  + ++  L  L L  N F+G IP    E GR          
Sbjct  285   KNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIPEKLGENGRLHLVDLSSNK  344

Query  701   ------PN------LEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
                   PN      LE L   GN L G IP  +G    L  + +G  N  +G IP  +  
Sbjct  345   LTGTLPPNMCAGNKLETLITLGNFLFGSIPESLGKCESLTRIRMGE-NFLNGSIPKGLFG  403

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L +L + +  +  LTGELPV      NL  L L  N LSG L P IG    ++ L L  N
Sbjct  404   LPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSNNQLSGQLPPAIGNFTGVQKLLLDGN  463

Query  1025  AFSGEIP  1045
              F G IP
Sbjct  464   KFEGPIP  470


 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 77/224 (34%), Positives = 113/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  344   KLTGTLPPNMCAGNKLETLITLGNFLFGSIPESLGKCESLTRIRMGENFLNGSIPKGLFG  403

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  ++L +N LTG+LPV      +L  L L  N  SG++PP  G F  ++ L + GN
Sbjct  404   LPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSNNQLSGQLPPAIGNFTGVQKLLLDGN  463

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
                G IPSE+G L +L ++   + N FSG I PE+     L   D +   L+GE+P EI 
Sbjct  464   KFEGPIPSEVGKLQQLSKIDFSH-NLFSGRIAPEISRCKLLTFVDLSRNELSGEIPKEIT  522

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              ++ L+ L L  N L GS+   I  +++L SLD S N  SG +P
Sbjct  523   GMRILNYLNLSRNHLIGSIPGSISSMQSLTSLDFSYNNLSGLVP  566


 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 72/227 (32%), Positives = 113/227 (50%), Gaps = 2/227 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              +G + P  G  P +  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  152   FAGEIPPSYGTWPEIEYLAVSGNELTGKIPPEIGNLTTLRELYIGYFNAFEDGLPPEIGN  211

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L+ L   D  N  L G++P E+ ++  L  L L  N FSG +  E G+  +L+ + +S N
Sbjct  212   LSELVRFDAANCGLNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNN  271

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
               +G IPS   +L  L  L + + N   G IP  +G L  L          TG +P ++G
Sbjct  272   MFTGEIPSSFSDLKNLTLLNL-FRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIPEKLG  330

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             +   L  + L  N L+G+L P +     L++L    N   G IPES 
Sbjct  331   ENGRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNFLFGSIPESL  377


 Score = 95.5 bits (236),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 109/204 (53%), Gaps = 3/204 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
            N +G +   +G+   L  + +++N+L+G +PP + A + L   + L N +FGS  P  L 
Sbjct  320  NFTGSIPEKLGENGRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNFLFGS-IPESLG  378

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P       NL  L++S 
Sbjct  379  KCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSN  438

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
            N LSG +P  IGN T +++L +   N F G IP E+G L QL + D ++   +G +  EI
Sbjct  439  NQLSGQLPPAIGNFTGVQKLLLDG-NKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEI  497

Query  911  GKLKNLDTLFLQVNDLSGSLAPEI  982
             + K L  + L  N+LSG +  EI
Sbjct  498  SRCKLLTFVDLSRNELSGEIPKEI  521



>ref|XP_008787754.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=990

 Score =   276 bits (706),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 157/294 (53%), Positives = 201/294 (68%), Gaps = 27/294 (9%)
 Frame = +2

Query  176   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvv  352
             R SA A AG+   V E  ALL +KAA +     S   W+ +  HC +W  V CD+     
Sbjct  15    RPSAAADAGEVTAV-EHRALLDVKAA-SGSPSGSFAGWDATADHCRSWAGVACDAAGR--  70

Query  353   sldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  532
                                   +V+L I+   LSGP+PPE+S +S LR+LNLSNN+F  T
Sbjct  71    ----------------------VVSLDISNLNLSGPIPPELSLLSGLRYLNLSNNVFNGT  108

Query  533   FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE  712
             FP  L+ L NL+VLD+YNNNLTG LPV+V  + +LRHLHLGGN+FSG IPPEYGR+ ++E
Sbjct  109   FPSALSSLKNLRVLDIYNNNLTGVLPVDVADLPALRHLHLGGNFFSGAIPPEYGRWEHIE  168

Query  713   YLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTG  892
             YLA+SGN L G I  E+GNLT L+ELYIGYFN + G +P  +GNL+ L+R DAANCGL+G
Sbjct  169   YLAISGNELGGPITPELGNLTSLRELYIGYFNSYQGSLPAAIGNLTSLVRLDAANCGLSG  228

Query  893   ELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             E+P E+G L+NLDTLFLQVN L G + PE+G L++LKS+DLSNNA +GEIP +F
Sbjct  229   EIPPEMGNLQNLDTLFLQVNGLFGEITPELGKLRSLKSMDLSNNALAGEIPPTF  282


 Score =   107 bits (268),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 81/228 (36%), Positives = 125/228 (55%), Gaps = 4/228 (2%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
             N +G +   +G    L  L +++N+L+G +PP++ +   L+  + L N +FGS  P  L 
Sbjct  321   NFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPDLCSGDKLQTLIALGNFLFGS-IPESLG  379

Query  551   QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
             +  +L  + L  N LTG +P+ ++ + +L  + L  N  +G   PE    P L  +++S 
Sbjct  380   RCKSLSRIRLGENYLTGSIPIGLFSLRNLVQVELQDNLLNGSF-PEKASSPTLGQISLSN  438

Query  731   NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
             N LSG +PS IGN   L++L +G  N FSG IPPE+G L QL + D +    +  +P E 
Sbjct  439   NRLSGALPSSIGNFPGLQKLLLGQ-NQFSGCIPPEIGKLQQLSKMDFSGNRFSCPIPAET  497

Query  911   GKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
              K K L  + L  N+LSG +  EI  ++ L  L+LS N   GEIP S 
Sbjct  498   SKCKLLTFIDLSRNNLSGEIPVEITEMRILNYLNLSRNHLEGEIPTSI  545


 Score =   103 bits (258),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 81/226 (36%), Positives = 115/226 (51%), Gaps = 2/226 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG + P++G L  L  L +  N L G + PE+  + +L+ ++LSNN      P   A L
Sbjct  226   LSGEIPPEMGNLQNLDTLFLQVNGLFGEITPELGKLRSLKSMDLSNNALAGEIPPTFADL  285

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L G +P  V  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  286   KNLTLLNLFRNKLYGAIPDFVGDLPQLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNK  345

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L+G +P ++ +  KL+ L I   N   G IP  +G    L R       LTG +P+ +  
Sbjct  346   LTGSLPPDLCSGDKLQTL-IALGNFLFGSIPESLGRCKSLSRIRLGENYLTGSIPIGLFS  404

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             L+NL  + LQ N L+GS  PE      L  + LSNN  SG +P S 
Sbjct  405   LRNLVQVELQDNLLNGSF-PEKASSPTLGQISLSNNRLSGALPSSI  449


 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 86/271 (32%), Positives = 123/271 (45%), Gaps = 48/271 (18%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L G +   VG LP L  L +  N  +G +P  +     L+ L+LS+N    + P  L  
Sbjct  297   KLYGAIPDFVGDLPQLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPDLCS  356

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP-----------------  682
                LQ L    N L G +P  + +  SL  + LG NY +G IP                 
Sbjct  357   GDKLQTLIALGNFLFGSIPESLGRCKSLSRIRLGENYLTGSIPIGLFSLRNLVQVELQDN  416

Query  683   ------PEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
                   PE    P L  +++S N LSG +PS IGN   L++L +G  N FSG IPPE+G 
Sbjct  417   LLNGSFPEKASSPTLGQISLSNNRLSGALPSSIGNFPGLQKLLLGQ-NQFSGCIPPEIGK  475

Query  845   LSQLIRFD-------------AANC-----------GLTGELPVEIGKLKNLDTLFLQVN  952
             L QL + D              + C            L+GE+PVEI +++ L+ L L  N
Sbjct  476   LQQLSKMDFSGNRFSCPIPAETSKCKLLTFIDLSRNNLSGEIPVEITEMRILNYLNLSRN  535

Query  953   DLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              L G +   I  +++L ++D S N  SG +P
Sbjct  536   HLEGEIPTSISTMQSLTAVDFSYNNLSGLVP  566



>gb|ABF99108.1| Receptor protein kinase CLAVATA1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=792

 Score =   273 bits (698),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 155/244 (64%), Positives = 191/244 (78%), Gaps = 0/244 (0%)
 Frame = +2

Query  323   VTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL  502
             VTC S   VV LD+SGLNLSG L  ++  L  L+ LS+ AN  SGP+P  +  +  L +L
Sbjct  65    VTCSSRGAVVGLDVSGLNLSGALPAELTGLRGLMRLSVGANAFSGPIPASLGRLQFLTYL  124

Query  503   NLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  682
             NLSNN F  +FP  LA+L  L+VLDLYNNNLT  LP+EV +M  LRHLHLGGN+FSG IP
Sbjct  125   NLSNNAFNGSFPAALARLRGLRVLDLYNNNLTSPLPMEVVQMPLLRHLHLGGNFFSGEIP  184

Query  683   PEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  862
             PEYGR+  ++YLAVSGN LSG IP E+GNLT L+ELYIGY+N +SGG+PPE+GNL++L+R
Sbjct  185   PEYGRWGRMQYLAVSGNELSGKIPPELGNLTSLRELYIGYYNSYSGGLPPELGNLTELVR  244

Query  863   FDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEI  1042
              DAANCGL+GE+P E+GKL+NLDTLFLQVN L+G +  E+GYLK+L SLDLSNN  +GEI
Sbjct  245   LDAANCGLSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEI  304

Query  1043  PESF  1054
             P SF
Sbjct  305   PASF  308


 Score =   105 bits (261),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 128/229 (56%), Gaps = 4/229 (2%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
             N +G +   +G+   L  L +++N+L+G +PPE+ A   +   + L N +FG+  P  L 
Sbjct  347   NFTGGVPRRLGRNGRLQLLDLSSNRLTGTLPPELCAGGKMHTLIALGNFLFGA-IPDSLG  405

Query  551   QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRF-PNLEYLAVS  727
             +  +L  + L  N L G +P  ++++  L  + L  N  +G  P   G   PNL  +++S
Sbjct  406   ECKSLSRVRLGENYLNGSIPKGLFELPKLTQVELQDNLLTGNFPAVSGAAAPNLGEISLS  465

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
              N L+G +P+ IGN + +++L +   N FSG +PPE+G L +L + D ++  L G +P E
Sbjct  466   NNQLTGALPASIGNFSGVQKLLLDR-NSFSGVVPPEIGRLQKLSKADLSSNALEGGVPPE  524

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             IGK + L  L L  N++SG + P I  ++ L  L+LS N   GEIP S 
Sbjct  525   IGKCRLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNHLDGEIPPSI  573


 Score = 92.4 bits (228),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 73/210 (35%), Positives = 107/210 (51%), Gaps = 8/210 (4%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  252  LSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  311

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  312  KNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNR  371

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P E+    K+  L I   N   G IP  +G    L R       L G +P  + +
Sbjct  372  LTGTLPPELCAGGKMHTL-IALGNFLFGAIPDSLGECKSLSRVRLGENYLNGSIPKGLFE  430

Query  917  LKNLDTLFLQVNDL-------SGSLAPEIG  985
            L  L  + LQ N L       SG+ AP +G
Sbjct  431  LPKLTQVELQDNLLTGNFPAVSGAAAPNLG  460


 Score = 91.7 bits (226),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 114/227 (50%), Gaps = 8/227 (4%)
 Frame = +2

Query  377   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  547
             L+G L P++   G++  L+ L    N L G +P  +    +L  + L  N    + P  L
Sbjct  372   LTGTLPPELCAGGKMHTLIAL---GNFLFGAIPDSLGECKSLSRVRLGENYLNGSIPKGL  428

Query  548   AQLANLQVLDLYNNNLTGDLP-VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  724
              +L  L  ++L +N LTG+ P V      +L  + L  N  +G +P   G F  ++ L +
Sbjct  429   FELPKLTQVELQDNLLTGNFPAVSGAAAPNLGEISLSNNQLTGALPASIGNFSGVQKLLL  488

Query  725   SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPV  904
               N  SGV+P EIG L KL +  +   N   GG+PPE+G    L   D +   ++G++P 
Sbjct  489   DRNSFSGVVPPEIGRLQKLSKADLSS-NALEGGVPPEIGKCRLLTYLDLSRNNISGKIPP  547

Query  905   EIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              I  ++ L+ L L  N L G + P I  +++L ++D S N  SG +P
Sbjct  548   AISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVP  594


 Score = 84.0 bits (206),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 101/197 (51%), Gaps = 1/197 (1%)
 Frame = +2

Query  380  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  559
            SG L P++G L  LV L  A   LSG +PPE+  +  L  L L  N      P +L  L 
Sbjct  229  SGGLPPELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLK  288

Query  560  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  739
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +  N  
Sbjct  289  SLSSLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNF  348

Query  740  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKL  919
            +G +P  +G   +L+ L +   N  +G +PPE+    ++    A    L G +P  +G+ 
Sbjct  349  TGGVPRRLGRNGRLQLLDLSS-NRLTGTLPPELCAGGKMHTLIALGNFLFGAIPDSLGEC  407

Query  920  KNLDTLFLQVNDLSGSL  970
            K+L  + L  N L+GS+
Sbjct  408  KSLSRVRLGENYLNGSI  424


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 64/125 (51%), Gaps = 2/125 (2%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            + SGV+ P++G+L  L    +++N L G VPPEI     L +L+LS N      P  ++ 
Sbjct  492  SFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISG  551

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            +  L  L+L  N+L G++P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  552  MRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLV-PGTGQFSYFNATSFVGN  610

Query  734  -GLSG  745
             GL G
Sbjct  611  PGLCG  615



>ref|XP_010943209.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Elaeis guineensis]
Length=995

 Score =   276 bits (705),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 158/294 (54%), Positives = 198/294 (67%), Gaps = 27/294 (9%)
 Frame = +2

Query  176   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvv  352
             R SA A  G+     E  AL+ +KAA   +   SL  W+ +  HC +W  V CD+     
Sbjct  15    RPSATAATGEGTAA-EHRALVELKAAI-GNPTGSLAGWDAAADHCRSWAGVACDAAGR--  70

Query  353   sldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  532
                                   +V+L I+   LSGP+PPE+S +S LR+LNLSNN+F  T
Sbjct  71    ----------------------VVSLDISNLNLSGPIPPELSLLSGLRYLNLSNNVFNGT  108

Query  533   FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE  712
             FP  L++L NL+ LDLYNNNLT  LPV V  +  LRHLHLGGN+FSG IPPEYGR+ ++E
Sbjct  109   FPSDLSRLKNLRALDLYNNNLTDVLPVVVADLPVLRHLHLGGNFFSGAIPPEYGRWEHIE  168

Query  713   YLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTG  892
             YLA+SGN LSG IP E+GNLT L+ELYIGYFN + GG+P   GNL+ L+R DAANCGL+G
Sbjct  169   YLAISGNELSGPIPPELGNLTTLRELYIGYFNSYQGGLPAAFGNLTSLVRLDAANCGLSG  228

Query  893   ELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             E+P E+G L+NLDTLFLQVN LSG + PE+G L  LKS+DLSNNA +GEIP +F
Sbjct  229   EIPPEMGDLQNLDTLFLQVNGLSGEITPELGKLWGLKSMDLSNNALTGEIPPTF  282


 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 116/246 (47%), Gaps = 24/246 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG ++P++G+L  L ++ ++ N L+G +PP  + +  L  LNL  N      P  +  L
Sbjct  250   LSGEITPELGKLWGLKSMDLSNNALTGEIPPTFADLKNLTLLNLFRNKLHGAIPDFVGDL  309

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L+VL L+ NN TG++P  +     L+ L L  N  +G +PP+      LE L   GN 
Sbjct  310   PELEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPDLCSGDKLETLIALGNF  369

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFD----------------  868
             L G IP  +G    L  + +G  N  +G IP  + +L +L + +                
Sbjct  370   LFGSIPESLGRCKSLTRIRLGE-NYLTGSIPSGLFSLRKLAQVELQDNLLNGSFPAKASS  428

Query  869   -------AANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnA  1027
                     +N  L+G LP  IG    L  L L  N  SG + PEIG L+ L  +D S N 
Sbjct  429   PTLGQISLSNNRLSGALPSSIGNFPGLQKLLLNQNQFSGCIPPEIGRLQQLSKMDFSGNR  488

Query  1028  FSGEIP  1045
             FS  IP
Sbjct  489   FSCPIP  494


 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 82/250 (33%), Positives = 117/250 (47%), Gaps = 24/250 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L G +   VG LP L  L +  N  +G +P  +     L+ L+LS+N    + P  L  
Sbjct  297   KLHGAIPDFVGDLPELEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPDLCS  356

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP-----------------  682
                L+ L    N L G +P  + +  SL  + LG NY +G IP                 
Sbjct  357   GDKLETLIALGNFLFGSIPESLGRCKSLTRIRLGENYLTGSIPSGLFSLRKLAQVELQDN  416

Query  683   ------PEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
                   P     P L  +++S N LSG +PS IGN   L++L +   N FSG IPPE+G 
Sbjct  417   LLNGSFPAKASSPTLGQISLSNNRLSGALPSSIGNFPGLQKLLLNQ-NQFSGCIPPEIGR  475

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
             L QL + D +    +  +P EI K + +  + L  N+LSG +  EI  ++ L  L+LS N
Sbjct  476   LQQLSKMDFSGNRFSCPIPPEISKCRLVTFIDLSRNNLSGEIPVEITEMRILNYLNLSRN  535

Query  1025  AFSGEIPESF  1054
                GEIP S 
Sbjct  536   HLEGEIPTSI  545


 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 100/198 (51%), Gaps = 1/198 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P++G L  L  L +  N LSG + PE+  +  L+ ++LSNN      P   A L
Sbjct  226  LSGEIPPEMGDLQNLDTLFLQVNGLSGEITPELGKLWGLKSMDLSNNALTGEIPPTFADL  285

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL +L+L+ N L G +P  V  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  286  KNLTLLNLFRNKLHGAIPDFVGDLPELEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNK  345

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P ++ +  KL+ L I   N   G IP  +G    L R       LTG +P  +  
Sbjct  346  LTGSLPPDLCSGDKLETL-IALGNFLFGSIPESLGRCKSLTRIRLGENYLTGSIPSGLFS  404

Query  917  LKNLDTLFLQVNDLSGSL  970
            L+ L  + LQ N L+GS 
Sbjct  405  LRKLAQVELQDNLLNGSF  422


 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 96/203 (47%), Gaps = 3/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   +FP + A  
Sbjct  370  LFGSIPESLGRCKSLTRIRLGENYLTGSIPSGLFSLRKLAQVELQDNLLNGSFPAK-ASS  428

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              L  + L NN L+G LP  +     L+ L L  N FSG IPPE GR   L  +  SGN 
Sbjct  429  PTLGQISLSNNRLSGALPSSIGNFPGLQKLLLNQNQFSGCIPPEIGRLQQLSKMDFSGNR  488

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             S  IP EI    +L        N  SG IP E+  +  L   + +   L GE+P  I  
Sbjct  489  FSCPIPPEISK-CRLVTFIDLSRNNLSGEIPVEITEMRILNYLNLSRNHLEGEIPTSIST  547

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            +++L  +    N+LSG L P  G
Sbjct  548  MQSLTAVDFSYNNLSG-LVPGTG  569


 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 96/196 (49%), Gaps = 1/196 (1%)
 Frame = +2

Query  383  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  562
            G L    G L  LV L  A   LSG +PPE+  +  L  L L  N        +L +L  
Sbjct  204  GGLPAAFGNLTSLVRLDAANCGLSGEIPPEMGDLQNLDTLFLQVNGLSGEITPELGKLWG  263

Query  563  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  742
            L+ +DL NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N  +
Sbjct  264  LKSMDLSNNALTGEIPPTFADLKNLTLLNLFRNKLHGAIPDFVGDLPELEVLQLWENNFT  323

Query  743  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLK  922
            G IP  +G   +L+ L +   N  +G +PP++ +  +L    A    L G +P  +G+ K
Sbjct  324  GEIPRRLGTNGRLQLLDLSS-NKLTGSLPPDLCSGDKLETLIALGNFLFGSIPESLGRCK  382

Query  923  NLDTLFLQVNDLSGSL  970
            +L  + L  N L+GS+
Sbjct  383  SLTRIRLGENYLTGSI  398



>gb|EAY92008.1| hypothetical protein OsI_13698 [Oryza sativa Indica Group]
Length=1029

 Score =   274 bits (701),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 155/244 (64%), Positives = 191/244 (78%), Gaps = 0/244 (0%)
 Frame = +2

Query  323   VTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL  502
             VTC S   VV LD+SGLNLSG L  ++  L  L+ LS+ AN  SGP+P  +  +  L +L
Sbjct  65    VTCSSRGAVVGLDVSGLNLSGALPAELTGLRGLMRLSVGANAFSGPIPASLGRLQFLTYL  124

Query  503   NLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  682
             NLSNN F  +FP  LA+L  L+VLDLYNNNLT  LP+EV +M  LRHLHLGGN+FSG IP
Sbjct  125   NLSNNAFNGSFPAALARLRGLRVLDLYNNNLTSPLPMEVVQMPLLRHLHLGGNFFSGEIP  184

Query  683   PEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  862
             PEYGR+  ++YLAVSGN LSG IP E+GNLT L+ELYIGY+N +SGG+PPE+GNL++L+R
Sbjct  185   PEYGRWGRMQYLAVSGNELSGKIPPELGNLTSLRELYIGYYNSYSGGLPPELGNLTELVR  244

Query  863   FDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEI  1042
              DAANCGL+GE+P E+GKL+NLDTLFLQVN L+G +  E+GYLK+L SLDLSNN  +GEI
Sbjct  245   LDAANCGLSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEI  304

Query  1043  PESF  1054
             P SF
Sbjct  305   PASF  308


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 128/229 (56%), Gaps = 4/229 (2%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
             N +G +   +G+   L  L +++N+L+G +PPE+ A   +   + L N +FG+  P  L 
Sbjct  347   NFTGGVPRRLGRNGRLQLLDLSSNRLTGTLPPELCAGGKMHTLIALGNFLFGA-IPDSLG  405

Query  551   QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRF-PNLEYLAVS  727
             +  +L  + L  N L G +P  ++++  L  + L  N  +G  P   G   PNL  +++S
Sbjct  406   ECKSLSRVRLGENYLNGSIPKGLFELPKLTQVELQDNLLTGNFPAVSGAAAPNLGEISLS  465

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
              N L+G +P+ IGN + +++L +   N FSG +PPE+G L +L + D ++  L G +P E
Sbjct  466   NNQLTGALPASIGNFSGVQKLLLDR-NSFSGVVPPEIGRLQKLSKADLSSNALEGGVPPE  524

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             IGK + L  L L  N++SG + P I  ++ L  L+LS N   GEIP S 
Sbjct  525   IGKCRLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNHLDGEIPPSI  573


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 73/210 (35%), Positives = 107/210 (51%), Gaps = 8/210 (4%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  252  LSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  311

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  312  KNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNR  371

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P E+    K+  L I   N   G IP  +G    L R       L G +P  + +
Sbjct  372  LTGTLPPELCAGGKMHTL-IALGNFLFGAIPDSLGECKSLSRVRLGENYLNGSIPKGLFE  430

Query  917  LKNLDTLFLQVNDL-------SGSLAPEIG  985
            L  L  + LQ N L       SG+ AP +G
Sbjct  431  LPKLTQVELQDNLLTGNFPAVSGAAAPNLG  460


 Score = 92.4 bits (228),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 114/227 (50%), Gaps = 8/227 (4%)
 Frame = +2

Query  377   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  547
             L+G L P++   G++  L+ L    N L G +P  +    +L  + L  N    + P  L
Sbjct  372   LTGTLPPELCAGGKMHTLIAL---GNFLFGAIPDSLGECKSLSRVRLGENYLNGSIPKGL  428

Query  548   AQLANLQVLDLYNNNLTGDLP-VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  724
              +L  L  ++L +N LTG+ P V      +L  + L  N  +G +P   G F  ++ L +
Sbjct  429   FELPKLTQVELQDNLLTGNFPAVSGAAAPNLGEISLSNNQLTGALPASIGNFSGVQKLLL  488

Query  725   SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPV  904
               N  SGV+P EIG L KL +  +   N   GG+PPE+G    L   D +   ++G++P 
Sbjct  489   DRNSFSGVVPPEIGRLQKLSKADLSS-NALEGGVPPEIGKCRLLTYLDLSRNNISGKIPP  547

Query  905   EIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              I  ++ L+ L L  N L G + P I  +++L ++D S N  SG +P
Sbjct  548   AISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVP  594


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 101/197 (51%), Gaps = 1/197 (1%)
 Frame = +2

Query  380  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  559
            SG L P++G L  LV L  A   LSG +PPE+  +  L  L L  N      P +L  L 
Sbjct  229  SGGLPPELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLK  288

Query  560  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  739
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +  N  
Sbjct  289  SLSSLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNF  348

Query  740  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKL  919
            +G +P  +G   +L+ L +   N  +G +PPE+    ++    A    L G +P  +G+ 
Sbjct  349  TGGVPRRLGRNGRLQLLDLSS-NRLTGTLPPELCAGGKMHTLIALGNFLFGAIPDSLGEC  407

Query  920  KNLDTLFLQVNDLSGSL  970
            K+L  + L  N L+GS+
Sbjct  408  KSLSRVRLGENYLNGSI  424


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 64/125 (51%), Gaps = 2/125 (2%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            + SGV+ P++G+L  L    +++N L G VPPEI     L +L+LS N      P  ++ 
Sbjct  492  SFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISG  551

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            +  L  L+L  N+L G++P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  552  MRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLV-PGTGQFSYFNATSFVGN  610

Query  734  -GLSG  745
             GL G
Sbjct  611  PGLCG  615



>gb|AAP68887.1| putative receptor-like protein kinase 1 [Oryza sativa Japonica 
Group]
 gb|ABF99107.1| Receptor protein kinase CLAVATA1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=1029

 Score =   274 bits (701),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 155/244 (64%), Positives = 191/244 (78%), Gaps = 0/244 (0%)
 Frame = +2

Query  323   VTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL  502
             VTC S   VV LD+SGLNLSG L  ++  L  L+ LS+ AN  SGP+P  +  +  L +L
Sbjct  65    VTCSSRGAVVGLDVSGLNLSGALPAELTGLRGLMRLSVGANAFSGPIPASLGRLQFLTYL  124

Query  503   NLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  682
             NLSNN F  +FP  LA+L  L+VLDLYNNNLT  LP+EV +M  LRHLHLGGN+FSG IP
Sbjct  125   NLSNNAFNGSFPAALARLRGLRVLDLYNNNLTSPLPMEVVQMPLLRHLHLGGNFFSGEIP  184

Query  683   PEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIR  862
             PEYGR+  ++YLAVSGN LSG IP E+GNLT L+ELYIGY+N +SGG+PPE+GNL++L+R
Sbjct  185   PEYGRWGRMQYLAVSGNELSGKIPPELGNLTSLRELYIGYYNSYSGGLPPELGNLTELVR  244

Query  863   FDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEI  1042
              DAANCGL+GE+P E+GKL+NLDTLFLQVN L+G +  E+GYLK+L SLDLSNN  +GEI
Sbjct  245   LDAANCGLSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEI  304

Query  1043  PESF  1054
             P SF
Sbjct  305   PASF  308


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 128/229 (56%), Gaps = 4/229 (2%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
             N +G +   +G+   L  L +++N+L+G +PPE+ A   +   + L N +FG+  P  L 
Sbjct  347   NFTGGVPRRLGRNGRLQLLDLSSNRLTGTLPPELCAGGKMHTLIALGNFLFGA-IPDSLG  405

Query  551   QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRF-PNLEYLAVS  727
             +  +L  + L  N L G +P  ++++  L  + L  N  +G  P   G   PNL  +++S
Sbjct  406   ECKSLSRVRLGENYLNGSIPKGLFELPKLTQVELQDNLLTGNFPAVSGAAAPNLGEISLS  465

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
              N L+G +P+ IGN + +++L +   N FSG +PPE+G L +L + D ++  L G +P E
Sbjct  466   NNQLTGALPASIGNFSGVQKLLLDR-NSFSGVVPPEIGRLQKLSKADLSSNALEGGVPPE  524

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             IGK + L  L L  N++SG + P I  ++ L  L+LS N   GEIP S 
Sbjct  525   IGKCRLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNHLDGEIPPSI  573


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 73/210 (35%), Positives = 107/210 (51%), Gaps = 8/210 (4%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  252  LSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  311

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  312  KNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNR  371

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P E+    K+  L I   N   G IP  +G    L R       L G +P  + +
Sbjct  372  LTGTLPPELCAGGKMHTL-IALGNFLFGAIPDSLGECKSLSRVRLGENYLNGSIPKGLFE  430

Query  917  LKNLDTLFLQVNDL-------SGSLAPEIG  985
            L  L  + LQ N L       SG+ AP +G
Sbjct  431  LPKLTQVELQDNLLTGNFPAVSGAAAPNLG  460


 Score = 92.4 bits (228),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 114/227 (50%), Gaps = 8/227 (4%)
 Frame = +2

Query  377   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  547
             L+G L P++   G++  L+ L    N L G +P  +    +L  + L  N    + P  L
Sbjct  372   LTGTLPPELCAGGKMHTLIAL---GNFLFGAIPDSLGECKSLSRVRLGENYLNGSIPKGL  428

Query  548   AQLANLQVLDLYNNNLTGDLP-VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  724
              +L  L  ++L +N LTG+ P V      +L  + L  N  +G +P   G F  ++ L +
Sbjct  429   FELPKLTQVELQDNLLTGNFPAVSGAAAPNLGEISLSNNQLTGALPASIGNFSGVQKLLL  488

Query  725   SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPV  904
               N  SGV+P EIG L KL +  +   N   GG+PPE+G    L   D +   ++G++P 
Sbjct  489   DRNSFSGVVPPEIGRLQKLSKADLSS-NALEGGVPPEIGKCRLLTYLDLSRNNISGKIPP  547

Query  905   EIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              I  ++ L+ L L  N L G + P I  +++L ++D S N  SG +P
Sbjct  548   AISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVP  594


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 101/197 (51%), Gaps = 1/197 (1%)
 Frame = +2

Query  380  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  559
            SG L P++G L  LV L  A   LSG +PPE+  +  L  L L  N      P +L  L 
Sbjct  229  SGGLPPELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLK  288

Query  560  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  739
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +  N  
Sbjct  289  SLSSLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNF  348

Query  740  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKL  919
            +G +P  +G   +L+ L +   N  +G +PPE+    ++    A    L G +P  +G+ 
Sbjct  349  TGGVPRRLGRNGRLQLLDLSS-NRLTGTLPPELCAGGKMHTLIALGNFLFGAIPDSLGEC  407

Query  920  KNLDTLFLQVNDLSGSL  970
            K+L  + L  N L+GS+
Sbjct  408  KSLSRVRLGENYLNGSI  424


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 64/125 (51%), Gaps = 2/125 (2%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            + SGV+ P++G+L  L    +++N L G VPPEI     L +L+LS N      P  ++ 
Sbjct  492  SFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISG  551

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            +  L  L+L  N+L G++P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  552  MRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLV-PGTGQFSYFNATSFVGN  610

Query  734  -GLSG  745
             GL G
Sbjct  611  PGLCG  615



>ref|XP_002461427.1| hypothetical protein SORBIDRAFT_02g002450 [Sorghum bicolor]
 gb|EER97948.1| hypothetical protein SORBIDRAFT_02g002450 [Sorghum bicolor]
Length=1031

 Score =   274 bits (700),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 157/268 (59%), Positives = 197/268 (74%), Gaps = 3/268 (1%)
 Frame = +2

Query  260   ADSQSSLTSWN--ISTSHCTWRRVTCdsllhvvsldlsglNLSG-VLSPDVGQLPFLVNL  430
             +D   +L SW    ST  C W  VTC++   V+ LDLSG NLSG V +  + +L  L  L
Sbjct  42    SDPAGALASWTNATSTGPCAWSGVTCNARGAVIGLDLSGRNLSGAVPAAALSRLAHLARL  101

Query  431   SIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLP  610
              +AAN LSGP+P  +S + +L  LNLSNN+   TFP   A+L  L+VLDLYNNNLTG LP
Sbjct  102   DLAANALSGPIPAPLSRLQSLTHLNLSNNVLNGTFPPPFARLRALRVLDLYNNNLTGPLP  161

Query  611   VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKEL  790
             + V  +  LRHLHLGGN+FSG IPPEYG++  L+YLAVSGN LSG IP E+G LT L+EL
Sbjct  162   LVVVALPMLRHLHLGGNFFSGEIPPEYGQWRRLQYLAVSGNELSGKIPPELGGLTSLREL  221

Query  791   YIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSL  970
             YIGY+N +S GIPPE GN++ L+R DAANCGL+GE+P E+G L+NLDTLFLQVN L+G++
Sbjct  222   YIGYYNSYSSGIPPEFGNMTDLVRLDAANCGLSGEIPPELGNLENLDTLFLQVNGLTGAI  281

Query  971   APEIGYlknlksldlsnnAFSGEIPESF  1054
              PE+G L++L SLDLSNN  +GEIP SF
Sbjct  282   PPELGRLRSLSSLDLSNNGLTGEIPASF  309


 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 126/229 (55%), Gaps = 4/229 (2%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  550
             N +G +   +G+   L  + +++N+L+G +PPE+ A   L   + L N +FGS  P  L 
Sbjct  348   NFTGGIPRRLGRNGRLQLVDLSSNRLTGTLPPELCAGGKLETLIALGNFLFGS-IPESLG  406

Query  551   QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGR-FPNLEYLAVS  727
             +   L  + L  N L G +P  ++++ +L  + L  N  SG  P   G   PNL  + +S
Sbjct  407   KCEALSRIRLGENYLNGSIPEGLFELPNLTQVELQDNLLSGGFPAVAGTGAPNLGAITLS  466

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
              N L+G +P+ IGN + L++L +   N F+G +PPE+G L QL + D +   L G +P E
Sbjct  467   NNQLTGALPASIGNFSGLQKLLLDQ-NAFTGAVPPEIGRLQQLSKADLSGNALDGGMPPE  525

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             IGK + L  L L  N+LSG + P I  ++ L  L+LS N   GEIP + 
Sbjct  526   IGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLDGEIPATI  574


 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 78/227 (34%), Positives = 118/227 (52%), Gaps = 2/227 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              SG + P+ GQ   L  L+++ N+LSG +PPE+  +++LR L +   N + S  P +   
Sbjct  180   FSGEIPPEYGQWRRLQYLAVSGNELSGKIPPELGGLTSLRELYIGYYNSYSSGIPPEFGN  239

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             + +L  LD  N  L+G++P E+  + +L  L L  N  +G IPPE GR  +L  L +S N
Sbjct  240   MTDLVRLDAANCGLSGEIPPELGNLENLDTLFLQVNGLTGAIPPELGRLRSLSSLDLSNN  299

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
             GL+G IP+    L  L  L + + N   G IP  +G+L  L          TG +P  +G
Sbjct  300   GLTGEIPASFAALKNLTLLNL-FRNKLRGSIPELVGDLPNLEVLQLWENNFTGGIPRRLG  358

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             +   L  + L  N L+G+L PE+     L++L    N   G IPES 
Sbjct  359   RNGRLQLVDLSSNRLTGTLPPELCAGGKLETLIALGNFLFGSIPESL  405


 Score = 96.7 bits (239),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 86/271 (32%), Positives = 115/271 (42%), Gaps = 48/271 (18%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI------------------------SAI  484
             LSG + P++G L  L  L +  N L+G +PPE+                        +A+
Sbjct  253   LSGEIPPELGNLENLDTLFLQVNGLTGAIPPELGRLRSLSSLDLSNNGLTGEIPASFAAL  312

Query  485   STLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  664
               L  LNL  N    + P  +  L NL+VL L+ NN TG +P  + +   L+ + L  N 
Sbjct  313   KNLTLLNLFRNKLRGSIPELVGDLPNLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNR  372

Query  665   FSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIG--YFNG---------  811
              +G +PPE      LE L   GN L G IP  +G    L  + +G  Y NG         
Sbjct  373   LTGTLPPELCAGGKLETLIALGNFLFGSIPESLGKCEALSRIRLGENYLNGSIPEGLFEL  432

Query  812   ------------FSGGIPPEMGN-LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVN  952
                          SGG P   G     L     +N  LTG LP  IG    L  L L  N
Sbjct  433   PNLTQVELQDNLLSGGFPAVAGTGAPNLGAITLSNNQLTGALPASIGNFSGLQKLLLDQN  492

Query  953   DLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
               +G++ PEIG L+ L   DLS NA  G +P
Sbjct  493   AFTGAVPPEIGRLQQLSKADLSGNALDGGMP  523


 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 71/229 (31%), Positives = 112/229 (49%), Gaps = 8/229 (3%)
 Frame = +2

Query  377   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  547
             L+G L P++   G+L  L+ L    N L G +P  +     L  + L  N    + P  L
Sbjct  373   LTGTLPPELCAGGKLETLIAL---GNFLFGSIPESLGKCEALSRIRLGENYLNGSIPEGL  429

Query  548   AQLANLQVLDLYNNNLTGDLP-VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  724
              +L NL  ++L +N L+G  P V      +L  + L  N  +G +P   G F  L+ L +
Sbjct  430   FELPNLTQVELQDNLLSGGFPAVAGTGAPNLGAITLSNNQLTGALPASIGNFSGLQKLLL  489

Query  725   SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPV  904
               N  +G +P EIG L +L +  +   N   GG+PPE+G    L   D +   L+GE+P 
Sbjct  490   DQNAFTGAVPPEIGRLQQLSKADLSG-NALDGGMPPEIGKCRLLTYLDLSRNNLSGEIPP  548

Query  905   EIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
              I  ++ L+ L L  N L G +   I  +++L ++D S N  SG +P +
Sbjct  549   AISGMRILNYLNLSRNHLDGEIPATIAAMQSLTAVDFSYNNLSGLVPAT  597


 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 99/197 (50%), Gaps = 2/197 (1%)
 Frame = +2

Query  389  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  568
            + P+ G +  LV L  A   LSG +PPE+  +  L  L L  N      P +L +L +L 
Sbjct  233  IPPEFGNMTDLVRLDAANCGLSGEIPPELGNLENLDTLFLQVNGLTGAIPPELGRLRSLS  292

Query  569  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  748
             LDL NN LTG++P     + +L  L+L  N   G IP   G  PNLE L +  N  +G 
Sbjct  293  SLDLSNNGLTGEIPASFAALKNLTLLNLFRNKLRGSIPELVGDLPNLEVLQLWENNFTGG  352

Query  749  IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNL  928
            IP  +G   +L+ + +   N  +G +PPE+    +L    A    L G +P  +GK + L
Sbjct  353  IPRRLGRNGRLQLVDLSS-NRLTGTLPPELCAGGKLETLIALGNFLFGSIPESLGKCEAL  411

Query  929  DTLFLQVNDLSGSLAPE  979
              + L  N L+GS+ PE
Sbjct  412  SRIRLGENYLNGSI-PE  427



>gb|EEE60014.1| hypothetical protein OsJ_12761 [Oryza sativa Japonica Group]
Length=979

 Score =   272 bits (695),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 144/227 (63%), Positives = 179/227 (79%), Gaps = 0/227 (0%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             NLSG L  ++  L  L+ LS+ AN  SGP+P  +  +  L +LNLSNN F  +FP  LA+
Sbjct  56    NLSGALPAELTGLRGLMRLSVGANAFSGPIPASLGRLQFLTYLNLSNNAFNGSFPAALAR  115

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L+VLDLYNNNLT  LP+EV +M  LRHLHLGGN+FSG IPPEYGR+  ++YLAVSGN
Sbjct  116   LRGLRVLDLYNNNLTSPLPMEVVQMPLLRHLHLGGNFFSGEIPPEYGRWGRMQYLAVSGN  175

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              LSG IP E+GNLT L+ELYIGY+N +SGG+PPE+GNL++L+R DAANCGL+GE+P E+G
Sbjct  176   ELSGKIPPELGNLTSLRELYIGYYNSYSGGLPPELGNLTELVRLDAANCGLSGEIPPELG  235

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             KL+NLDTLFLQVN L+G +  E+GYLK+L SLDLSNN  +GEIP SF
Sbjct  236   KLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEIPASF  282


 Score =   111 bits (278),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 81/223 (36%), Positives = 127/223 (57%), Gaps = 5/223 (2%)
 Frame = +2

Query  395   PD-VGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLAQLANLQ  568
             PD VG LP L  L +++N+L+G +PPE+ A   +   + L N +FG+  P  L +  +L 
Sbjct  303   PDFVGDLPSLELLDLSSNRLTGTLPPELCAGGKMHTLIALGNFLFGA-IPDSLGECKSLS  361

Query  569   VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRF-PNLEYLAVSGNGLSG  745
              + L  N L G +P  ++++  L  + L  N  +G  P   G   PNL  +++S N L+G
Sbjct  362   RVRLGENYLNGSIPKGLFELPKLTQVELQDNLLTGNFPAVSGAAAPNLGEISLSNNQLTG  421

Query  746   VIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKN  925
              +P+ IGN + +++L +   N FSG +PPE+G L +L + D ++  L G +P EIGK + 
Sbjct  422   ALPASIGNFSGVQKLLLDR-NSFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKCRL  480

Query  926   LDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             L  L L  N++SG + P I  ++ L  L+LS N   GEIP S 
Sbjct  481   LTYLDLSRNNISGKIPPAISGMRILNYLNLSRNHLDGEIPPSI  523


 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 84/248 (34%), Positives = 119/248 (48%), Gaps = 26/248 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  226   LSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  285

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              NL +L+L+ N L GD+P  V  + SL  L L  N  +G +PPE      +  L   GN 
Sbjct  286   KNLTLLNLFRNKLRGDIPDFVGDLPSLELLDLSSNRLTGTLPPELCAGGKMHTLIALGNF  345

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFD----------------  868
             L G IP  +G    L  + +G  N  +G IP  +  L +L + +                
Sbjct  346   LFGAIPDSLGECKSLSRVRLGE-NYLNGSIPKGLFELPKLTQVELQDNLLTGNFPAVSGA  404

Query  869   -AANCG--------LTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
              A N G        LTG LP  IG    +  L L  N  SG + PEIG L+ L   DLS+
Sbjct  405   AAPNLGEISLSNNQLTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRLQKLSKADLSS  464

Query  1022  nAFSGEIP  1045
             NA  G +P
Sbjct  465   NALEGGVP  472


 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 97/204 (48%), Gaps = 3/204 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP      
Sbjct  346  LFGAIPDSLGECKSLSRVRLGENYLNGSIPKGLFELPKLTQVELQDNLLTGNFPAVSGAA  405

Query  557  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            A NL  + L NN LTG LP  +   + ++ L L  N FSG +PPE GR   L    +S N
Sbjct  406  APNLGEISLSNNQLTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRLQKLSKADLSSN  465

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
             L G +P EIG    L  L +   N  SG IPP +  +  L   + +   L GE+P  I 
Sbjct  466  ALEGGVPPEIGKCRLLTYLDLSR-NNISGKIPPAISGMRILNYLNLSRNHLDGEIPPSIA  524

Query  914  KLKNLDTLFLQVNDLSGSLAPEIG  985
             +++L  +    N+LSG L P  G
Sbjct  525  TMQSLTAVDFSYNNLSG-LVPGTG  547


 Score = 86.7 bits (213),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 75/209 (36%), Positives = 101/209 (48%), Gaps = 8/209 (4%)
 Frame = +2

Query  380  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  559
            SG L P++G L  LV L  A   LSG +PPE+  +  L  L L  N      P +L  L 
Sbjct  203  SGGLPPELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLK  262

Query  560  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  739
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +S N L
Sbjct  263  SLSSLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLELLDLSSNRL  322

Query  740  SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKL  919
            +G +P E+    K+  L I   N   G IP  +G    L R       L G +P  + +L
Sbjct  323  TGTLPPELCAGGKMHTL-IALGNFLFGAIPDSLGECKSLSRVRLGENYLNGSIPKGLFEL  381

Query  920  KNLDTLFLQVNDL-------SGSLAPEIG  985
              L  + LQ N L       SG+ AP +G
Sbjct  382  PKLTQVELQDNLLTGNFPAVSGAAAPNLG  410


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 64/125 (51%), Gaps = 2/125 (2%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            + SGV+ P++G+L  L    +++N L G VPPEI     L +L+LS N      P  ++ 
Sbjct  442  SFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISG  501

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            +  L  L+L  N+L G++P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  502  MRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLV-PGTGQFSYFNATSFVGN  560

Query  734  -GLSG  745
             GL G
Sbjct  561  PGLCG  565



>ref|XP_003558681.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1027

 Score =   269 bits (687),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 194/265 (73%), Gaps = 5/265 (2%)
 Frame = +2

Query  275   SLTSW-----NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIA  439
             +L SW     N S +HC W  VTC     VV LD+ GLNLSG L P + +L  L+ L + 
Sbjct  43    ALASWAAPKKNESAAHCAWAGVTCGPRGTVVGLDVGGLNLSGALPPALSRLRGLLRLDVG  102

Query  440   ANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEV  619
             AN   GPVP  +  +  L  LNLSNN F  + P  LA L  L+VLDLYNNNLT  LP+EV
Sbjct  103   ANAFFGPVPAALGHLQFLTHLNLSNNAFNGSLPPALACLRALRVLDLYNNNLTSPLPLEV  162

Query  620   YKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIG  799
              +M  LRHLHLGGN+FSG+IPPEYGR+  L+YLAVSGN LSG IP E+GNLT L+ELY+G
Sbjct  163   AQMPLLRHLHLGGNFFSGQIPPEYGRWARLQYLAVSGNELSGTIPPELGNLTSLRELYLG  222

Query  800   YFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPE  979
             Y+N +SGG+P E+GNL++L+R DAANCGL+GE+P E+GKL+ LDTLFLQVN LSGS+  E
Sbjct  223   YYNSYSGGLPAELGNLTELVRLDAANCGLSGEIPPELGKLQKLDTLFLQVNGLSGSIPTE  282

Query  980   IGYlknlksldlsnnAFSGEIPESF  1054
             +GYLK+L SLDLSNN  +G IP SF
Sbjct  283   LGYLKSLSSLDLSNNVLTGVIPASF  307


 Score =   103 bits (258),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 85/246 (35%), Positives = 122/246 (50%), Gaps = 27/246 (11%)
 Frame = +2

Query  395   PD-VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  571
             PD VG LP L  L +  N  +G VP  +     L+ ++LS+N   ST P +L     L  
Sbjct  328   PDFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLVDLSSNKLTSTLPAELCAGGKLHT  387

Query  572   LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEY-----------------GRF  700
             L    N+L G +P  + +  SL  + LG NY +G IP                    G F
Sbjct  388   LIALGNSLFGSIPDSLGQCKSLSRIRLGENYLNGSIPKGLFELQKLTQVELQDNLLTGNF  447

Query  701   P--------NLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQL  856
             P        NL  + +S N L+G +P+ IGN + +++L +   N FSG +P E+G L QL
Sbjct  448   PAVVGVAAPNLGEINLSNNQLTGTLPASIGNFSGVQKLLLDR-NSFSGVMPAEIGRLQQL  506

Query  857   IRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSG  1036
              + D ++  + G +P EIGK + L  L L  N+LSG + P I  ++ L  L+LS N   G
Sbjct  507   SKADLSSNSIEGGVPPEIGKCRLLTYLDLSRNNLSGDIPPAISGMRILNYLNLSRNHLDG  566

Query  1037  EIPESF  1054
             EIP S 
Sbjct  567   EIPPSI  572


 Score = 95.9 bits (237),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 106/203 (52%), Gaps = 1/203 (0%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P++G+L  L  L +  N LSG +P E+  + +L  L+LSNN+     P   ++L
Sbjct  251  LSGEIPPELGKLQKLDTLFLQVNGLSGSIPTELGYLKSLSSLDLSNNVLTGVIPASFSEL  310

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             N+ +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ + +S N 
Sbjct  311  KNMTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLVDLSSNK  370

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+  +P+E+    KL  L I   N   G IP  +G    L R       L G +P  + +
Sbjct  371  LTSTLPAELCAGGKLHTL-IALGNSLFGSIPDSLGQCKSLSRIRLGENYLNGSIPKGLFE  429

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            L+ L  + LQ N L+G+    +G
Sbjct  430  LQKLTQVELQDNLLTGNFPAVVG  452


 Score = 92.4 bits (228),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 68/215 (32%), Positives = 109/215 (51%), Gaps = 5/215 (2%)
 Frame = +2

Query  404   GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLY  583
             G+L  L+ L    N L G +P  +    +L  + L  N    + P  L +L  L  ++L 
Sbjct  383   GKLHTLIAL---GNSLFGSIPDSLGQCKSLSRIRLGENYLNGSIPKGLFELQKLTQVELQ  439

Query  584   NNNLTGDLPVEV-YKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSE  760
             +N LTG+ P  V     +L  ++L  N  +G +P   G F  ++ L +  N  SGV+P+E
Sbjct  440   DNLLTGNFPAVVGVAAPNLGEINLSNNQLTGTLPASIGNFSGVQKLLLDRNSFSGVMPAE  499

Query  761   IGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLF  940
             IG L +L +  +   N   GG+PPE+G    L   D +   L+G++P  I  ++ L+ L 
Sbjct  500   IGRLQQLSKADLSS-NSIEGGVPPEIGKCRLLTYLDLSRNNLSGDIPPAISGMRILNYLN  558

Query  941   LQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             L  N L G + P I  +++L ++D S N  SG +P
Sbjct  559   LSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVP  593


 Score = 77.4 bits (189),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 84/177 (47%), Gaps = 2/177 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEIS-AISTLRFLNLSNNIFGSTFPHQLAQ  553
            L+G +   + +L  L  + +  N L+G  P  +  A   L  +NLSNN    T P  +  
Sbjct  419  LNGSIPKGLFELQKLTQVELQDNLLTGNFPAVVGVAAPNLGEINLSNNQLTGTLPASIGN  478

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             + +Q L L  N+ +G +P E+ ++  L    L  N   G +PPE G+   L YL +S N
Sbjct  479  FSGVQKLLLDRNSFSGVMPAEIGRLQQLSKADLSSNSIEGGVPPEIGKCRLLTYLDLSRN  538

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPV  904
             LSG IP  I  +  L  L +   N   G IPP +  +  L   D +   L+G +PV
Sbjct  539  NLSGDIPPAISGMRILNYLNLSR-NHLDGEIPPSIATMQSLTAVDFSYNNLSGLVPV  594


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 63/127 (50%), Gaps = 0/127 (0%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             L+G L   +G    +  L +  N  SG +P EI  +  L   +LS+N      P ++ +
Sbjct  467  QLTGTLPASIGNFSGVQKLLLDRNSFSGVMPAEIGRLQQLSKADLSSNSIEGGVPPEIGK  526

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
               L  LDL  NNL+GD+P  +  M  L +L+L  N+  G IPP      +L  +  S N
Sbjct  527  CRLLTYLDLSRNNLSGDIPPAISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYN  586

Query  734  GLSGVIP  754
             LSG++P
Sbjct  587  NLSGLVP  593



>ref|XP_009399076.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1021

 Score =   266 bits (680),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 175/278 (63%), Positives = 218/278 (78%), Gaps = 1/278 (0%)
 Frame = +2

Query  221   EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPD  400
             E  ALLS+K+  + +  ++L +W  +T HC+W  VTC S   VV+LDLSG NLSG L P 
Sbjct  28    EHRALLSLKSELS-NPGAALAAWEAATDHCSWPGVTCGSSGAVVALDLSGRNLSGPLPPA  86

Query  401   VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDL  580
             VG+L  L+ LS+AAN LSGP+PPE++ +  LR LNLSNN+   +FP  LA+LA+L++LDL
Sbjct  87    VGRLRSLLRLSVAANFLSGPIPPELALLPDLRHLNLSNNLLNGSFPVALARLADLRLLDL  146

Query  581   YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSE  760
             YNNNLTG LP EV  MT LRHLHLGGN+FSG IPPEYG +  LEYLA+SGN LSG IP E
Sbjct  147   YNNNLTGPLPQEVAAMTLLRHLHLGGNFFSGSIPPEYGHWQFLEYLAISGNELSGPIPRE  206

Query  761   IGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLF  940
             IGNL+ L+ELYIGYFN + GG+PPE+GNLS L+R DAANCGL+G +P E+G L+NLDTLF
Sbjct  207   IGNLSALRELYIGYFNSYDGGVPPEIGNLSALLRLDAANCGLSGGIPSEMGNLRNLDTLF  266

Query  941   LQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             LQVN LSG + PE+G L++LKS+DLSNNA +G+IP SF
Sbjct  267   LQVNGLSGEIPPELGRLRSLKSMDLSNNALTGQIPPSF  304


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 86/251 (34%), Positives = 118/251 (47%), Gaps = 28/251 (11%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG + P++G+L  L ++ ++ N L+G +PP  S +S L  LNL  N    T P  +  L
Sbjct  272   LSGEIPPELGRLRSLKSMDLSNNALTGQIPPSFSGLSNLTLLNLFRNKLFGTIPEFVGDL  331

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L+VL ++ NN TG +P  +     L+ L L  N  +G +PP+      LE L   GN 
Sbjct  332   PELEVLQMWENNFTGSIPRRLGTNGQLQLLDLSSNKLTGSLPPDLCYGNKLETLIALGNF  391

Query  737   LSGVIPSEIGNLTKLKELYIG--YFNG---------------------FSGGIPPEMGNL  847
             L G IP  +G    L  + +G  Y NG                      +GG  P+ G+ 
Sbjct  392   LFGSIPESLGRCESLSRIRMGDNYLNGSIPHGLFSLPNLSQVEFQDNLLTGGF-PDTGDS  450

Query  848   S---QLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldls  1018
             S    L +   +N  L G LP  IG    L  L L  N  SGS+ PE+  L+ L  LD S
Sbjct  451   SISPSLGQICLSNNRLVGPLPPSIGNFSGLQKLLLSQNSFSGSIPPEVRRLQQLSKLDFS  510

Query  1019  nnAFSGEI-PE  1048
              N FSG I PE
Sbjct  511   GNRFSGPITPE  521


 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 102/203 (50%), Gaps = 2/203 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG +  ++G L  L  L +  N LSG +PPE+  + +L+ ++LSNN      P   + L
Sbjct  248  LSGGIPSEMGNLRNLDTLFLQVNGLSGEIPPELGRLRSLKSMDLSNNALTGQIPPSFSGL  307

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
            +NL +L+L+ N L G +P  V  +  L  L +  N F+G IP   G    L+ L +S N 
Sbjct  308  SNLTLLNLFRNKLFGTIPEFVGDLPELEVLQMWENNFTGSIPRRLGTNGQLQLLDLSSNK  367

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P ++    KL+ L I   N   G IP  +G    L R    +  L G +P  +  
Sbjct  368  LTGSLPPDLCYGNKLETL-IALGNFLFGSIPESLGRCESLSRIRMGDNYLNGSIPHGLFS  426

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            L NL  +  Q N L+G   P+ G
Sbjct  427  LPNLSQVEFQDNLLTGGF-PDTG  448


 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 72/228 (32%), Positives = 108/228 (47%), Gaps = 3/228 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L PD+     L  L    N L G +P  +    +L  + + +N    + PH L  
Sbjct  367   KLTGSLPPDLCYGNKLETLIALGNFLFGSIPESLGRCESLSRIRMGDNYLNGSIPHGLFS  426

Query  554   LANLQVLDLYNNNLTGDLPV--EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  727
             L NL  ++  +N LTG  P   +     SL  + L  N   G +PP  G F  L+ L +S
Sbjct  427   LPNLSQVEFQDNLLTGGFPDTGDSSISPSLGQICLSNNRLVGPLPPSIGNFSGLQKLLLS  486

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
              N  SG IP E+  L +L +L     N FSG I PE+     L   D +   ++G +P +
Sbjct  487   QNSFSGSIPPEVRRLQQLSKLDFSG-NRFSGPITPEISKCKLLTFVDLSRNEISGNVPSD  545

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
             I  L+ L+ L L  N L G +   I  +++L ++D S N  SG +P +
Sbjct  546   IAALRILNYLNLSRNHLEGQIPSAISTMQSLTAVDFSYNNLSGLVPST  593


 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 100/196 (51%), Gaps = 1/196 (1%)
 Frame = +2

Query  383  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  562
            G + P++G L  L+ L  A   LSG +P E+  +  L  L L  N      P +L +L +
Sbjct  226  GGVPPEIGNLSALLRLDAANCGLSGGIPSEMGNLRNLDTLFLQVNGLSGEIPPELGRLRS  285

Query  563  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  742
            L+ +DL NN LTG +P     +++L  L+L  N   G IP   G  P LE L +  N  +
Sbjct  286  LKSMDLSNNALTGQIPPSFSGLSNLTLLNLFRNKLFGTIPEFVGDLPELEVLQMWENNFT  345

Query  743  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLK  922
            G IP  +G   +L+ L +   N  +G +PP++   ++L    A    L G +P  +G+ +
Sbjct  346  GSIPRRLGTNGQLQLLDLSS-NKLTGSLPPDLCYGNKLETLIALGNFLFGSIPESLGRCE  404

Query  923  NLDTLFLQVNDLSGSL  970
            +L  + +  N L+GS+
Sbjct  405  SLSRIRMGDNYLNGSI  420


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            + SG + P+V +L  L  L  + N+ SGP+ PEIS    L F++LS N      P  +A 
Sbjct  489  SFSGSIPPEVRRLQQLSKLDFSGNRFSGPITPEISKCKLLTFVDLSRNEISGNVPSDIAA  548

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L  L  L+L  N+L G +P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  549  LRILNYLNLSRNHLEGQIPSAISTMQSLTAVDFSYNNLSGLV-PSTGQFSYFNATSFVGN  607



>dbj|BAJ89729.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1030

 Score =   265 bits (676),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 154/268 (57%), Positives = 195/268 (73%), Gaps = 8/268 (3%)
 Frame = +2

Query  275   SLTSWNISTS--------HCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNL  430
             +L SW +  +        HC W  V+C +   V  L L GLNLSG L P + +L  L+ L
Sbjct  40    ALASWEVPAAASNGTGYAHCAWAGVSCGARGAVAGLALGGLNLSGALPPALSRLRGLLRL  99

Query  431   SIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLP  610
              + AN LSGPVP  +  +  L  LNLSNN F  + P  LA+L  L+VLDLYNNNLT  LP
Sbjct  100   DVGANALSGPVPAALGHLRFLTHLNLSNNAFNGSLPPALARLRGLRVLDLYNNNLTSPLP  159

Query  611   VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKEL  790
             +EV +M  LRHLHLGGN+FSG IPPEYGR+  L+YLA+SGN LSG IP E+GNLT L+EL
Sbjct  160   IEVAQMPMLRHLHLGGNFFSGEIPPEYGRWTRLQYLALSGNELSGKIPPELGNLTSLREL  219

Query  791   YIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSL  970
             YIGY+N +SGG+PPE+GNL+ L+R DAANCGL+G++P E+G+L+ LDTLFLQVN L+G++
Sbjct  220   YIGYYNAYSGGVPPELGNLTDLVRLDAANCGLSGKIPPELGRLQKLDTLFLQVNGLTGAI  279

Query  971   APEIGYlknlksldlsnnAFSGEIPESF  1054
               ++G LK+L SLDLSNNA +GEIP SF
Sbjct  280   PSDLGSLKSLSSLDLSNNALAGEIPPSF  307


 Score =   105 bits (262),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 121/214 (57%), Gaps = 6/214 (3%)
 Frame = +2

Query  419   LVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNL  595
             LV+LS  +N+L+G +PP++ A   L   + L N++FG+  P  L Q  +L  + L  N L
Sbjct  363   LVDLS--SNRLTGTLPPDLCAGGKLHTLIALGNSLFGA-IPDSLGQCKSLSRIRLGENYL  419

Query  596   TGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRF-PNLEYLAVSGNGLSGVIPSEIGNL  772
              G +P  ++++  L  + L  N  +G  P   G   PNL  + +S N L+GV+P+ IGN 
Sbjct  420   NGSIPEGLFELQKLTQVELQDNLLTGDFPAVVGAAAPNLGEINLSNNQLTGVLPASIGNF  479

Query  773   TKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVN  952
             + +++L +   N FSG +P E+G L QL + D +   + G +P E+GK + L  L L  N
Sbjct  480   SGVQKLLLDR-NSFSGALPAEVGRLQQLSKADLSGNAIEGGVPPEVGKCRLLTYLDLSRN  538

Query  953   DLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             +LSG + P I  ++ L  L+LS N   GEIP S 
Sbjct  539   NLSGKIPPAISGMRILNYLNLSRNHLDGEIPPSI  572


 Score = 95.9 bits (237),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 72/227 (32%), Positives = 115/227 (51%), Gaps = 8/227 (4%)
 Frame = +2

Query  377   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  547
             L+G L PD+   G+L  L+ L    N L G +P  +    +L  + L  N    + P  L
Sbjct  371   LTGTLPPDLCAGGKLHTLIAL---GNSLFGAIPDSLGQCKSLSRIRLGENYLNGSIPEGL  427

Query  548   AQLANLQVLDLYNNNLTGDLPVEV-YKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  724
              +L  L  ++L +N LTGD P  V     +L  ++L  N  +G +P   G F  ++ L +
Sbjct  428   FELQKLTQVELQDNLLTGDFPAVVGAAAPNLGEINLSNNQLTGVLPASIGNFSGVQKLLL  487

Query  725   SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPV  904
               N  SG +P+E+G L +L +  +   N   GG+PPE+G    L   D +   L+G++P 
Sbjct  488   DRNSFSGALPAEVGRLQQLSKADLS-GNAIEGGVPPEVGKCRLLTYLDLSRNNLSGKIPP  546

Query  905   EIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              I  ++ L+ L L  N L G + P I  +++L ++D S N  SG +P
Sbjct  547   AISGMRILNYLNLSRNHLDGEIPPSISTMQSLTAVDFSYNNLSGLVP  593


 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 77/227 (34%), Positives = 116/227 (51%), Gaps = 2/227 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             LSG + P++G L  L  L I   N  SG VPPE+  ++ L  L+ +N       P +L +
Sbjct  202   LSGKIPPELGNLTSLRELYIGYYNAYSGGVPPELGNLTDLVRLDAANCGLSGKIPPELGR  261

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  L L  N LTG +P ++  + SL  L L  N  +G IPP + +  N+  L +  N
Sbjct  262   LQKLDTLFLQVNGLTGAIPSDLGSLKSLSSLDLSNNALAGEIPPSFSQLKNMTLLNLFRN  321

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  +G+L  L+ L + + N F+G +P  +G  ++L   D ++  LTG LP ++ 
Sbjct  322   KLRGDIPDFVGDLPSLEVLQL-WENNFTGSVPRRLGGNNRLQLVDLSSNRLTGTLPPDLC  380

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
                 L TL    N L G++   +G  K+L  + L  N  +G IPE  
Sbjct  381   AGGKLHTLIALGNSLFGAIPDSLGQCKSLSRIRLGENYLNGSIPEGL  427


 Score = 88.6 bits (218),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 104/203 (51%), Gaps = 1/203 (0%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P++G+L  L  L +  N L+G +P ++ ++ +L  L+LSNN      P   +QL
Sbjct  251  LSGKIPPELGRLQKLDTLFLQVNGLTGAIPSDLGSLKSLSSLDLSNNALAGEIPPSFSQL  310

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             N+ +L+L+ N L GD+P  V  + SL  L L  N F+G +P   G    L+ + +S N 
Sbjct  311  KNMTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGSVPRRLGGNNRLQLVDLSSNR  370

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P ++    KL  L I   N   G IP  +G    L R       L G +P  + +
Sbjct  371  LTGTLPPDLCAGGKLHTL-IALGNSLFGAIPDSLGQCKSLSRIRLGENYLNGSIPEGLFE  429

Query  917  LKNLDTLFLQVNDLSGSLAPEIG  985
            L+ L  + LQ N L+G     +G
Sbjct  430  LQKLTQVELQDNLLTGDFPAVVG  452


 Score = 58.5 bits (140),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            + SG L  +VG+L  L    ++ N + G VPPE+     L +L+LS N      P  ++ 
Sbjct  491  SFSGALPAEVGRLQQLSKADLSGNAIEGGVPPEVGKCRLLTYLDLSRNNLSGKIPPAISG  550

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  682
            +  L  L+L  N+L G++P  +  M SL  +    N  SG +P
Sbjct  551  MRILNYLNLSRNHLDGEIPPSISTMQSLTAVDFSYNNLSGLVP  593



>ref|XP_006853709.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Amborella trichopoda]
 gb|ERN15176.1| hypothetical protein AMTR_s00056p00150470 [Amborella trichopoda]
Length=918

 Score =   263 bits (673),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 161/284 (57%), Positives = 208/284 (73%), Gaps = 3/284 (1%)
 Frame = +2

Query  209   LGVTEQAALLSIKAAFTADSQSSLTSWNI--STSHCTWRRVTCdsllhvvsldlsglNLS  382
             + V     L ++K A   D +SSL +W+   S+++C+W  + CD   +V  LD+S + LS
Sbjct  19    ISVDNSGPLWAVKFAIN-DPESSLETWSKGNSSNYCSWIGIQCDDSGYVSVLDISDMGLS  77

Query  383   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  562
             G +SP++G L  L  LS+A N+ SG +P EI+ IS L  LNLSNN+F  TFP  L+ L N
Sbjct  78    GQISPEIGNLQRLTTLSLAVNEFSGQIPAEIARISGLNLLNLSNNLFNGTFPVSLSGLKN  137

Query  563   LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  742
             L+VLDLYNNNLTG LP  V +++ ++HLHLGGNYF+G IPPEYG+   +EYLA+SGN LS
Sbjct  138   LEVLDLYNNNLTGPLPKGVAEISGIKHLHLGGNYFNGEIPPEYGKLKEIEYLALSGNELS  197

Query  743   GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLK  922
             G IP E+GNLTKL++LY+GYFN FSGGIPPE GNL +L R D A+CGL+GE+P EIG L 
Sbjct  198   GNIPKELGNLTKLEQLYLGYFNWFSGGIPPEFGNLRRLFRLDMASCGLSGEIPAEIGNLT  257

Query  923   NLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
              L TLFLQVN+L+G + PE+G L+ LKSLDLSNN  SGEIP +F
Sbjct  258   LLGTLFLQVNELTGKIPPEMGNLRVLKSLDLSNNKLSGEIPANF  301


 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 80/227 (35%), Positives = 121/227 (53%), Gaps = 4/227 (2%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              +G + P+ G+L  +  L+++ N+LSG +P E+  ++ L  L L   N F    P +   
Sbjct  172   FNGEIPPEYGKLKEIEYLALSGNELSGNIPKELGNLTKLEQLYLGYFNWFSGGIPPEFGN  231

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L  L  LD+ +  L+G++P E+  +T L  L L  N  +G+IPPE G    L+ L +S N
Sbjct  232   LRRLFRLDMASCGLSGEIPAEIGNLTLLGTLFLQVNELTGKIPPEMGNLRVLKSLDLSNN  291

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              LSG IP+    L  LK L + + N   G IPP +  L +L      +   +GEL  + G
Sbjct  292   KLSGEIPANFAELKNLKLLNL-FINSLKGTIPPFVAELPELEVLQLWDNEFSGELDGKFG  350

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
               +NL  L L  N L+G + PEI     L++L L NN+FSG++P S 
Sbjct  351   --RNLKLLDLSSNKLAGKIPPEICSGGLLQTLILLNNSFSGQVPGSL  395


 Score = 95.5 bits (236),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 108/198 (55%), Gaps = 3/198 (2%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG +  ++G L  L  L +  N+L+G +PPE+  +  L+ L+LSNN      P   A+L
Sbjct  245  LSGEIPAEIGNLTLLGTLFLQVNELTGKIPPEMGNLRVLKSLDLSNNKLSGEIPANFAEL  304

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL++L+L+ N+L G +P  V ++  L  L L  N FSG +  ++GR  NL+ L +S N 
Sbjct  305  KNLKLLNLFINSLKGTIPPFVAELPELEVLQLWDNEFSGELDGKFGR--NLKLLDLSSNK  362

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G IP EI +   L+ L +   N FSG +P  +     L R    +  L G LP  +  
Sbjct  363  LAGKIPPEICSGGLLQTLIL-LNNSFSGQVPGSLTTCQSLKRVRLGDNLLNGSLPYGLLS  421

Query  917  LKNLDTLFLQVNDLSGSL  970
            L+NL  L L+ N L+G  
Sbjct  422  LQNLTQLELKNNKLTGKF  439


 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 100/186 (54%), Gaps = 10/186 (5%)
 Frame = +2

Query  428  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  607
            L +++N+L+G +PPEI +   L+ L L NN F    P  L    +L+ + L +N L G L
Sbjct  356  LDLSSNKLAGKIPPEICSGGLLQTLILLNNSFSGQVPGSLTTCQSLKRVRLGDNLLNGSL  415

Query  608  PVEVYKMTSLRHLHLG-----GNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNL  772
            P  +  + +L  L L      G +FSG +         L  L++S N L+G IP+ IG+ 
Sbjct  416  PYGLLSLQNLTQLELKNNKLTGKFFSGNLSVS----ETLLELSLSNNQLNGEIPAIIGDF  471

Query  773  TKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVN  952
              L++L++   N FSG IPP++ +L+ L   D +    +GE+P +I  +++L  L L  N
Sbjct  472  GSLQKLFLAG-NQFSGEIPPKICSLNDLSVLDLSRNNFSGEIPAKIAGMRSLTYLNLSKN  530

Query  953  DLSGSL  970
             L G +
Sbjct  531  HLVGQI  536


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 79/177 (45%), Gaps = 26/177 (15%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             L+G + P++     L  L +  N  SG VP  ++   +L+ + L +N+   + P+ L  
Sbjct  362  KLAGKIPPEICSGGLLQTLILLNNSFSGQVPGSLTTCQSLKRVRLGDNLLNGSLPYGLLS  421

Query  554  LANLQVLDLYNNNLTG-------------------------DLPVEVYKMTSLRHLHLGG  658
            L NL  L+L NN LTG                         ++P  +    SL+ L L G
Sbjct  422  LQNLTQLELKNNKLTGKFFSGNLSVSETLLELSLSNNQLNGEIPAIIGDFGSLQKLFLAG  481

Query  659  NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  829
            N FSG IPP+     +L  L +S N  SG IP++I  +  L  L +   N   G IP
Sbjct  482  NQFSGEIPPKICSLNDLSVLDLSRNNFSGEIPAKIAGMRSLTYLNLSK-NHLVGQIP  537


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 69/127 (54%), Gaps = 2/127 (2%)
 Frame = +2

Query  419  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  598
            L+ LS++ NQL+G +P  I    +L+ L L+ N F    P ++  L +L VLDL  NN +
Sbjct  450  LLELSLSNNQLNGEIPAIIGDFGSLQKLFLAGNQFSGEIPPKICSLNDLSVLDLSRNNFS  509

Query  599  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG--VIPSEIGNL  772
            G++P ++  M SL +L+L  N+  G+IP  +        +  S N L+   V  S  G +
Sbjct  510  GEIPAKIAGMRSLTYLNLSKNHLVGQIPAAFQAMKGSASMDFSYNDLTEPLVGSSGFGEM  569

Query  773  TKLKELY  793
            ++++  +
Sbjct  570  SRVRAWW  576


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 60/126 (48%), Gaps = 8/126 (6%)
 Frame = +2

Query  404  GQLPF-------LVNLSIAANQLSGPV-PPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  559
            G LP+       L  L +  N+L+G      +S   TL  L+LSNN      P  +    
Sbjct  413  GSLPYGLLSLQNLTQLELKNNKLTGKFFSGNLSVSETLLELSLSNNQLNGEIPAIIGDFG  472

Query  560  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  739
            +LQ L L  N  +G++P ++  +  L  L L  N FSG IP +     +L YL +S N L
Sbjct  473  SLQKLFLAGNQFSGEIPPKICSLNDLSVLDLSRNNFSGEIPAKIAGMRSLTYLNLSKNHL  532

Query  740  SGVIPS  757
             G IP+
Sbjct  533  VGQIPA  538



>ref|XP_008440463.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Cucumis melo]
Length=973

 Score =   259 bits (662),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 157/280 (56%), Positives = 210/280 (75%), Gaps = 3/280 (1%)
 Frame = +2

Query  221   EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsglNLSGVLS  394
             E  ALLS+K++ + D  SSL+SWN +   +HC+W  VTCDS  HVV+LDLS L+L+  LS
Sbjct  39    ESQALLSLKSSISDDPHSSLSSWNPAAVATHCSWLGVTCDSHRHVVALDLSSLDLTATLS  98

Query  395   PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  574
             P +  L FL N+S   N+ SG +PPEI+++S+L+ LNLS+N+   + P + ++L NLQVL
Sbjct  99    PHIASLRFLTNVSFGLNKFSGGIPPEIASLSSLQLLNLSSNVLNGSIPSEFSRLKNLQVL  158

Query  575   DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  754
             D+YNNNLTG+ P  V +M +LR+LHLGGN+F+GRIPPE GR   LE+LA+ GN L G IP
Sbjct  159   DVYNNNLTGEFPRVVTEMPNLRYLHLGGNFFTGRIPPEVGRLQFLEFLAIHGNDLEGPIP  218

Query  755   SEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDT  934
               IGNLTKL+EL+IGY+N F GGIP  +GNLS+L+R DAA+CGL+G++P E+GKL+ L  
Sbjct  219   QTIGNLTKLRELFIGYYNTFVGGIPATIGNLSELVRLDAASCGLSGKIPRELGKLQKLTY  278

Query  935   LFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             LFLQ N LSG L  E+G LK++++LD+S N   GEIP SF
Sbjct  279   LFLQQNALSGPLM-ELGGLKSIEALDISCNMLVGEIPISF  317


 Score =   123 bits (309),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 87/226 (38%), Positives = 119/226 (53%), Gaps = 2/226 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG L  ++G L  +  L I+ N L G +P   +    LR L+L +N      P  +A L
Sbjct  286   LSGPLM-ELGGLKSIEALDISCNMLVGEIPISFAVFKNLRLLHLFDNKLSGEIPGFMADL  344

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L++L L+NNN TG +P  + K   LR L L  N+ +G IPPE      LE L   GN 
Sbjct  345   PKLEILQLWNNNFTGSIPRNLGKNGMLRTLDLAFNHLTGTIPPEVCHGNKLEVLIAMGNS  404

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             LSG+IP  +GN   LK + + + N  +G IP  +  L  + + D  +  L+GELP+    
Sbjct  405   LSGLIPESLGNCISLKRILL-WGNALNGSIPKRLLGLPNITQIDLHDNFLSGELPITNSV  463

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
               NL  + L  N LSGSL P IG L  ++ L L  N FSG+IP S 
Sbjct  464   SANLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRNKFSGQIPSSI  509


 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 99/203 (49%), Gaps = 1/203 (0%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            +L+G + P+V     L  L    N LSG +P  +    +L+ + L  N    + P +L  
Sbjct  380  HLTGTIPPEVCHGNKLEVLIAMGNSLSGLIPESLGNCISLKRILLWGNALNGSIPKRLLG  439

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L N+  +DL++N L+G+LP+      +L  + L  N  SG +PP  G    ++ L +  N
Sbjct  440  LPNITQIDLHDNFLSGELPITNSVSANLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRN  499

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              SG IPS IG L +L  +     N FSG I  E+     LI  D +   L+GE+P  I 
Sbjct  500  KFSGQIPSSIGRLQQLSRINFSQ-NKFSGSIVAEISECKHLIFLDLSGNELSGEIPNHIT  558

Query  914  KLKNLDTLFLQVNDLSGSLAPEI  982
             +K L+ + L  N L G +   I
Sbjct  559  NMKLLNYMNLSRNHLVGPIPASI  581


 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 69/146 (47%), Gaps = 8/146 (5%)
 Frame = +2

Query  404  GQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  562
            G+LP        L+ +S++ N LSG +PP I ++  ++ L L  N F    P  + +L  
Sbjct  455  GELPITNSVSANLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRNKFSGQIPSSIGRLQQ  514

Query  563  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  742
            L  ++   N  +G +  E+ +   L  L L GN  SG IP        L Y+ +S N L 
Sbjct  515  LSRINFSQNKFSGSIVAEISECKHLIFLDLSGNELSGEIPNHITNMKLLNYMNLSRNHLV  574

Query  743  GVIPSEIGNLTKLKELYIGYFNGFSG  820
            G IP+ I N+  L  +   Y N  SG
Sbjct  575  GPIPASIVNMQSLTSVDFSY-NNLSG  599



>ref|XP_004143533.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Cucumis sativus]
 gb|KGN48656.1| Receptor-like protein kinase 3 [Cucumis sativus]
Length=984

 Score =   257 bits (657),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 156/280 (56%), Positives = 209/280 (75%), Gaps = 3/280 (1%)
 Frame = +2

Query  221   EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsglNLSGVLS  394
             E  ALLS+K++ + D  SSL+SWN +   +HC+W  VTCDS  HVV+LDLS L+L+  +S
Sbjct  41    ESQALLSLKSSISDDPHSSLSSWNPAAVHAHCSWLGVTCDSRRHVVALDLSSLDLTATIS  100

Query  395   PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  574
             P +  L FL N+S   N++ G +PPEI+++S+L+ LNLS+N+   + P + ++L NLQVL
Sbjct  101   PHISSLRFLTNVSFGLNKIFGGIPPEIASLSSLQLLNLSSNVLNGSIPSEFSRLKNLQVL  160

Query  575   DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  754
             D+YNNNLTGD P  V +M +LR+LHLGGN+F+GRIPPE GR   LE+LA+ GN L G IP
Sbjct  161   DVYNNNLTGDFPRVVTEMPNLRYLHLGGNFFTGRIPPEVGRLQFLEFLAIHGNDLEGPIP  220

Query  755   SEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDT  934
               IGNLTKL+EL+IGY+N F GGIP  +GNLS+L+R DAA+CGL+G+ P E+GKL+ L  
Sbjct  221   PAIGNLTKLRELFIGYYNTFVGGIPATIGNLSELVRLDAASCGLSGKFPRELGKLQKLTE  280

Query  935   LFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             L+LQ N LSGSL  E+G LK+++ LD+S N   GEIP SF
Sbjct  281   LYLQQNALSGSLM-ELGGLKSIEELDISCNMLVGEIPISF  319


 Score =   119 bits (299),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 116/223 (52%), Gaps = 2/223 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG L  ++G L  +  L I+ N L G +P   +    LR L L +N      P  +A L
Sbjct  288   LSGSLM-ELGGLKSIEELDISCNMLVGEIPISFAVFKNLRLLQLFDNKLSGEIPEFMADL  346

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L++L L+NNN TG +P  + K   LR L L  N+ +G IPPE      LE L    N 
Sbjct  347   PKLEILQLWNNNFTGSIPRNLGKNGMLRTLDLAFNHLTGTIPPEICHGNKLEVLIAMDNS  406

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             LSG+IP  +GN   LK + + + N  +G IP  +  L  + + D  +  L+GELP+    
Sbjct  407   LSGLIPESLGNCLSLKRILL-WGNALNGSIPRRLLGLPNITQIDLHDNFLSGELPIINSV  465

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
               NL  + L  N LSGSL P IG L  ++ L L  N FSG+IP
Sbjct  466   SVNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRNKFSGQIP  508


 Score = 95.5 bits (236),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 100/203 (49%), Gaps = 1/203 (0%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            +L+G + P++     L  L    N LSG +P  +    +L+ + L  N    + P +L  
Sbjct  382  HLTGTIPPEICHGNKLEVLIAMDNSLSGLIPESLGNCLSLKRILLWGNALNGSIPRRLLG  441

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L N+  +DL++N L+G+LP+      +L  + L  N  SG +PP  G    ++ L +  N
Sbjct  442  LPNITQIDLHDNFLSGELPIINSVSVNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRN  501

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              SG IPS IG L +L  +     N FSG I PE+     LI  D +   L+GE+P  I 
Sbjct  502  KFSGQIPSNIGRLQQLSRINFSQ-NKFSGSIVPEISECKHLIFLDLSGNELSGEIPNHIT  560

Query  914  KLKNLDTLFLQVNDLSGSLAPEI  982
             +K L+ + L  N L G +   I
Sbjct  561  NMKLLNYMNLSRNHLVGPIPASI  583


 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 69/146 (47%), Gaps = 8/146 (5%)
 Frame = +2

Query  404  GQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  562
            G+LP        L+ +S++ N LSG +PP I ++  ++ L L  N F    P  + +L  
Sbjct  457  GELPIINSVSVNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRNKFSGQIPSNIGRLQQ  516

Query  563  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  742
            L  ++   N  +G +  E+ +   L  L L GN  SG IP        L Y+ +S N L 
Sbjct  517  LSRINFSQNKFSGSIVPEISECKHLIFLDLSGNELSGEIPNHITNMKLLNYMNLSRNHLV  576

Query  743  GVIPSEIGNLTKLKELYIGYFNGFSG  820
            G IP+ I N+  L  +   Y N  SG
Sbjct  577  GPIPASIVNMQSLTSVDFSY-NNLSG  601



>ref|XP_003557615.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1019

 Score =   252 bits (644),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 148/266 (56%), Positives = 188/266 (71%), Gaps = 6/266 (2%)
 Frame = +2

Query  275   SLTSW-NISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQ  448
             +L SW + S + C W  V+C +  + V        NLSG + P +  LP L+ L +AAN 
Sbjct  39    ALASWTSTSPNPCAWSGVSCAAGSNSVVSLDLSGRNLSGRIPPSLSSLPALILLDLAANA  98

Query  449   LSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQVLDLYNNNLTGDLPVEVY-  622
             LSGP+P ++S +  L  LNLS+N    +FP QL++ L  L+VLDLYNNNLTG LPVE+  
Sbjct  99    LSGPIPAQLSRLRRLASLNLSSNALSGSFPPQLSRRLRALKVLDLYNNNLTGPLPVEIAA  158

Query  623   -KMTSLRHLHLGGNYFSGRIPPEYGRF-PNLEYLAVSGNGLSGVIPSEIGNLTKLKELYI  796
               M  L H+HLGGN+FSG IP  YGR   NL YLAVSGN LSG +P E+GNLT L+ELYI
Sbjct  159   GTMPELSHVHLGGNFFSGAIPAAYGRLGKNLRYLAVSGNELSGNLPPELGNLTSLRELYI  218

Query  797   GYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAP  976
             GY+N +SGGIP E GN+++L+RFDAANCGL+GE+P E+G+L  LDTLFLQVN L+ ++  
Sbjct  219   GYYNSYSGGIPKEFGNMTELVRFDAANCGLSGEIPPELGRLAKLDTLFLQVNGLTDAIPM  278

Query  977   EIGYlknlksldlsnnAFSGEIPESF  1054
             E+G L +L SLDLSNN  SGEIP SF
Sbjct  279   ELGNLGSLSSLDLSNNELSGEIPPSF  304


 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 75/210 (36%), Positives = 118/210 (56%), Gaps = 4/210 (2%)
 Frame = +2

Query  428   LSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGD  604
             L +++N+L+G +PPE+ A   L   + L N++FG+  P  L +  +L  + L  N L G 
Sbjct  361   LDLSSNRLTGTLPPELCAGGKLHTLIALGNSLFGA-IPESLGECRSLARVRLGENFLNGS  419

Query  605   LPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLK  784
             +P  ++++ +L  + L GN  SG  P   G   NL  + +S N L+G +P+ IG+ + L+
Sbjct  420   IPEGLFQLPNLTQVELQGNLLSGGFPAMAGA-SNLGGIILSNNQLTGALPASIGSFSGLQ  478

Query  785   ELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSG  964
             +L +   N FSG IPPE+G L QL + D +     G +P EIGK + L  L +  N+LS 
Sbjct  479   KLLLDQ-NAFSGPIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKCRLLTYLDVSRNNLSA  537

Query  965   SLAPEIGYlknlksldlsnnAFSGEIPESF  1054
              + P I  ++ L  L+LS N   GEIP + 
Sbjct  538   EIPPAISGMRILNYLNLSRNHLEGEIPATI  567


 Score = 92.4 bits (228),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 83/270 (31%), Positives = 110/270 (41%), Gaps = 48/270 (18%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAAN------------------------QLSGPVPPEISAI  484
             LSG + P++G+L  L  L +  N                        +LSG +PP  + +
Sbjct  248   LSGEIPPELGRLAKLDTLFLQVNGLTDAIPMELGNLGSLSSLDLSNNELSGEIPPSFAEL  307

Query  485   STLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  664
               L   NL  N      P  +  L  L+VL L+ NN TG +P  + +    + L L  N 
Sbjct  308   KNLTLFNLFRNKLRGNIPEFVGDLPGLEVLQLWENNFTGGIPRHLGRNGRFQLLDLSSNR  367

Query  665   FSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIG--YFNG---------  811
              +G +PPE      L  L   GN L G IP  +G    L  + +G  + NG         
Sbjct  368   LTGTLPPELCAGGKLHTLIALGNSLFGAIPESLGECRSLARVRLGENFLNGSIPEGLFQL  427

Query  812   ------------FSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVND  955
                          SGG  P M   S L     +N  LTG LP  IG    L  L L  N 
Sbjct  428   PNLTQVELQGNLLSGGF-PAMAGASNLGGIILSNNQLTGALPASIGSFSGLQKLLLDQNA  486

Query  956   LSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              SG + PEIG L+ L   DLS N+F G +P
Sbjct  487   FSGPIPPEIGRLQQLSKADLSGNSFDGGVP  516


 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 113/228 (50%), Gaps = 8/228 (4%)
 Frame = +2

Query  377   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  547
             L+G L P++   G+L  L+ L    N L G +P  +    +L  + L  N    + P  L
Sbjct  368   LTGTLPPELCAGGKLHTLIAL---GNSLFGAIPESLGECRSLARVRLGENFLNGSIPEGL  424

Query  548   AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  727
              QL NL  ++L  N L+G  P  +   ++L  + L  N  +G +P   G F  L+ L + 
Sbjct  425   FQLPNLTQVELQGNLLSGGFPA-MAGASNLGGIILSNNQLTGALPASIGSFSGLQKLLLD  483

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
              N  SG IP EIG L +L +  +   N F GG+PPE+G    L   D +   L+ E+P  
Sbjct  484   QNAFSGPIPPEIGRLQQLSKADLSG-NSFDGGVPPEIGKCRLLTYLDVSRNNLSAEIPPA  542

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
             I  ++ L+ L L  N L G +   I  +++L ++D S N  SG +P +
Sbjct  543   ISGMRILNYLNLSRNHLEGEIPATIAAMQSLTAVDFSYNNLSGLVPAT  590


 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 78/225 (35%), Positives = 111/225 (49%), Gaps = 2/225 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             LSG L P++G L  L  L I   N  SG +P E   ++ L   + +N       P +L +
Sbjct  199   LSGNLPPELGNLTSLRELYIGYYNSYSGGIPKEFGNMTELVRFDAANCGLSGEIPPELGR  258

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             LA L  L L  N LT  +P+E+  + SL  L L  N  SG IPP +    NL    +  N
Sbjct  259   LAKLDTLFLQVNGLTDAIPMELGNLGSLSSLDLSNNELSGEIPPSFAELKNLTLFNLFRN  318

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L G IP  +G+L  L+ L + + N F+GGIP  +G   +    D ++  LTG LP E+ 
Sbjct  319   KLRGNIPEFVGDLPGLEVLQL-WENNFTGGIPRHLGRNGRFQLLDLSSNRLTGTLPPELC  377

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPE  1048
                 L TL    N L G++   +G  ++L  + L  N  +G IPE
Sbjct  378   AGGKLHTLIALGNSLFGAIPESLGECRSLARVRLGENFLNGSIPE  422


 Score = 54.7 bits (130),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 43/80 (54%), Gaps = 0/80 (0%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            +  G + P++G+   L  L ++ N LS  +PP IS +  L +LNLS N      P  +A 
Sbjct  510  SFDGGVPPEIGKCRLLTYLDVSRNNLSAEIPPAISGMRILNYLNLSRNHLEGEIPATIAA  569

Query  554  LANLQVLDLYNNNLTGDLPV  613
            + +L  +D   NNL+G +P 
Sbjct  570  MQSLTAVDFSYNNLSGLVPA  589



>ref|XP_009418700.1| PREDICTED: leucine-rich repeat receptor-like kinase protein FLORAL 
ORGAN NUMBER1 [Musa acuminata subsp. malaccensis]
Length=993

 Score =   251 bits (640),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 141/283 (50%), Positives = 197/283 (70%), Gaps = 2/283 (1%)
 Frame = +2

Query  212   GVTEQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvsldlsglNLSGV  388
             G  +  AL+ +KAA  A   S+L +W+  S  +C++  V CD    VV+L+ +G+ L+G 
Sbjct  24    GDADLEALIKLKAALVAPGSSALGNWDPASADYCSFTGVACDENSRVVALNFTGVQLNGT  83

Query  389   LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ-LAQLANL  565
             L P++G L  LVNL+++ + + GP+P E++A+ +LR LN+SNN F   FPH        L
Sbjct  84    LPPEIGILSGLVNLTVSCSGVVGPLPMELAALPSLRLLNVSNNNFSGAFPHVGPGGFPTL  143

Query  566   QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  745
             +V+D YNNN +G LP+ +    SLR+LHLGGNYF+G IP EY    NLEYL ++GN L+G
Sbjct  144   EVIDAYNNNFSGRLPLGLAAAPSLRYLHLGGNYFNGTIPKEYSDIKNLEYLGLNGNALTG  203

Query  746   VIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKN  925
              +P+ +  L+KLKE+YIGY+N + GGIPPE+G LS L+R D A CGL+G +P  +G LK+
Sbjct  204   RVPASLSRLSKLKEMYIGYYNMYVGGIPPELGMLSSLVRLDMAGCGLSGPIPASLGSLKH  263

Query  926   LDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             LDTLFLQ+N LSGS+ PE+G L  L+SLDLS N  +GE+PESF
Sbjct  264   LDTLFLQINRLSGSIPPELGGLSMLESLDLSINELTGEVPESF  306


 Score =   110 bits (276),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 80/224 (36%), Positives = 117/224 (52%), Gaps = 2/224 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              ++G + PD+     L  L +  N   GP+P ++    +L  + L+ N    + P  L  
Sbjct  369   RITGTIPPDLCASGRLETLVLMENGFFGPIPEKLGECKSLTRVRLAKNFLNGSIPAGLFD  428

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L +  +L+L  N L+GDLP  V     L  L L  N  +G IPP  G  P L+ LA+  N
Sbjct  429   LPSNDMLELSENFLSGDLP-PVIAGNKLGMLALSNNLITGSIPPAIGSLPALQNLALDSN  487

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              +SG IP EIG L +L +L +   N  SG IP ++   S L+  D +   LTG +PV I 
Sbjct  488   QISGAIPPEIGQLKQLSKLNLSG-NSLSGDIPVDLTRCSSLVMIDLSRNNLTGAIPVRIP  546

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              L+ L+TL L  N +SG + PE+  +++L   DLS N  +G IP
Sbjct  547   ALQILNTLNLSRNQISGVIPPEMQRMRSLTIFDLSYNRLAGVIP  590


 Score = 98.2 bits (243),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 77/128 (60%), Gaps = 0/128 (0%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            ++G + P +G LP L NL++ +NQ+SG +PPEI  +  L  LNLS N      P  L + 
Sbjct  465  ITGSIPPAIGSLPALQNLALDSNQISGAIPPEIGQLKQLSKLNLSGNSLSGDIPVDLTRC  524

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
            ++L ++DL  NNLTG +PV +  +  L  L+L  N  SG IPPE  R  +L    +S N 
Sbjct  525  SSLVMIDLSRNNLTGAIPVRIPALQILNTLNLSRNQISGVIPPEMQRMRSLTIFDLSYNR  584

Query  737  LSGVIPSE  760
            L+GVIP++
Sbjct  585  LAGVIPAQ  592


 Score = 95.1 bits (235),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 123/247 (50%), Gaps = 24/247 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              LSG + P++G L  L +L ++ N+L+G VP   + +  L+ L+L  N      P  +A+
Sbjct  273   RLSGSIPPELGGLSMLESLDLSINELTGEVPESFAELKELKLLSLFRNHIRGAIPPFVAE  332

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL+VL+L+ NN T  LP  + +   L  L +  N  +G IPP+      LE L +  N
Sbjct  333   LPNLEVLELWENNFTMQLPESLGRNGRLLKLDVASNRITGTIPPDLCASGRLETLVLMEN  392

Query  734   GLSGVIPSEIGNLTKLKELYIG--YFNG---------------------FSGGIPPEMGN  844
             G  G IP ++G    L  + +   + NG                      SG +PP +  
Sbjct  393   GFFGPIPEKLGECKSLTRVRLAKNFLNGSIPAGLFDLPSNDMLELSENFLSGDLPPVIAG  452

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
              ++L     +N  +TG +P  IG L  L  L L  N +SG++ PEIG LK L  L+LS N
Sbjct  453   -NKLGMLALSNNLITGSIPPAIGSLPALQNLALDSNQISGAIPPEIGQLKQLSKLNLSGN  511

Query  1025  AFSGEIP  1045
             + SG+IP
Sbjct  512   SLSGDIP  518


 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 74/136 (54%), Gaps = 1/136 (1%)
 Frame = +2

Query  428  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  607
            L+++ N ++G +PP I ++  L+ L L +N      P ++ QL  L  L+L  N+L+GD+
Sbjct  458  LALSNNLITGSIPPAIGSLPALQNLALDSNQISGAIPPEIGQLKQLSKLNLSGNSLSGDI  517

Query  608  PVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKE  787
            PV++ + +SL  + L  N  +G IP        L  L +S N +SGVIP E+  +  L  
Sbjct  518  PVDLTRCSSLVMIDLSRNNLTGAIPVRIPALQILNTLNLSRNQISGVIPPEMQRMRSLTI  577

Query  788  LYIGYFNGFSGGIPPE  835
              + Y N  +G IP +
Sbjct  578  FDLSY-NRLAGVIPAQ  592



>gb|AAF73373.1|AF193835_1 LRK1 protein [Oryza sativa]
Length=970

 Score =   249 bits (636),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 142/259 (55%), Positives = 179/259 (69%), Gaps = 5/259 (2%)
 Frame = +2

Query  221  EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-  391
            E  ALL++KAA   D   +L SW  N ++S C W  V C++   VV LD+SG NL+G L 
Sbjct  27   EADALLAVKAALD-DPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLP  85

Query  392  SPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQ  568
               +  L  L  L +AAN LSGP+P  +S ++  L  LNLSNN    TFP QL++L  L+
Sbjct  86   GAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALR  145

Query  569  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  748
            VLDLYNNNLTG LP+EV  +  LRHLHLGGN FSG IPPEYG   + +YLA+    LSG 
Sbjct  146  VLDLYNNNLTGALPLEVVSLRKLRHLHLGGNIFSGGIPPEYGHGGSFKYLALRQTSLSGY  205

Query  749  IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNL  928
             P  +GNLT L+E YIGYFN +SGGIPPE+GN++ L+R DAANCGL+GE+P E+G L NL
Sbjct  206  PPGGLGNLTSLREFYIGYFNSYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELGNLANL  265

Query  929  DTLFLQVNDLSGSLAPEIG  985
            DTLFL+VN L+G +  E+G
Sbjct  266  DTLFLRVNGLAGGIPRELG  284


 Score =   103 bits (257),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 85/244 (35%), Positives = 120/244 (49%), Gaps = 27/244 (11%)
 Frame = +2

Query  401   VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDL  580
             VG LP L  L +  N  +G +P  +      + L+LS+N    T P  L     L+ L  
Sbjct  334   VGDLPSLEVLQLWENNFTGGMPRRLGRNGRFQLLDLSSNRLTGTLPPDLCAGGKLETLIA  393

Query  581   YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE------------YLAV  724
               N+L G +P  + K TSL  + LG NY +G IP      PNL             + AV
Sbjct  394   LGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGLFELPNLTQVELQDNLISGGFPAV  453

Query  725   SGNG-------------LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRF  865
             SG G             L+G +P+ IG+ + +++L +   N F+G IPPE+G L QL + 
Sbjct  454   SGTGAPNLGQISLSNNQLTGALPAFIGSFSGVQKLLLDQ-NAFTGEIPPEIGRLQQLSKA  512

Query  866   DAANCGL-TGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEI  1042
             D +   L TG +P EIGK + L  L L  N+LSG + P I  ++ L  L+LS N   GEI
Sbjct  513   DLSGNSLPTGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEI  572

Query  1043  PESF  1054
             P + 
Sbjct  573   PATI  576


 Score = 89.0 bits (219),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 70/229 (31%), Positives = 116/229 (51%), Gaps = 7/229 (3%)
 Frame = +2

Query  377   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  547
             L+G L PD+   G+L  L+ L    N L G +P  +   ++L  + L +N    + P  L
Sbjct  374   LTGTLPPDLCAGGKLETLIAL---GNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGL  430

Query  548   AQLANLQVLDLYNNNLTGDLP-VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  724
              +L NL  ++L +N ++G  P V      +L  + L  N  +G +P   G F  ++ L +
Sbjct  431   FELPNLTQVELQDNLISGGFPAVSGTGAPNLGQISLSNNQLTGALPAFIGSFSGVQKLLL  490

Query  725   SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPV  904
               N  +G IP EIG L +L +  +   +  +GG+PPE+G    L   D +   L+GE+P 
Sbjct  491   DQNAFTGEIPPEIGRLQQLSKADLSGNSLPTGGVPPEIGKCRLLTYLDLSRNNLSGEIPP  550

Query  905   EIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
              I  ++ L+ L L  N L G +   I  +++L ++D S N  SG +P +
Sbjct  551   AISGMRILNYLNLSRNQLDGEIPATIAAMQSLTAVDFSYNNLSGLVPAT  599


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 68/160 (43%), Gaps = 27/160 (17%)
 Frame = +2

Query  572   LDLYNNNLTGDLP-VEVYKMTSLRHLHLGGNYFSGRIPPEYGRF-PNLEYLAVSGNGLSG  745
             LD+   NLTG LP   +  +  L  L L  N  SG IP    R  P L +L +S NGL+G
Sbjct  73    LDVSGRNLTGGLPGAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNG  132

Query  746   VIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKN  925
                                        PP++  L  L   D  N  LTG LP+E+  L+ 
Sbjct  133   T-------------------------FPPQLSRLRALRVLDLYNNNLTGALPLEVVSLRK  167

Query  926   LDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             L  L L  N  SG + PE G+  + K L L   + SG  P
Sbjct  168   LRHLHLGGNIFSGGIPPEYGHGGSFKYLALRQTSLSGYPP  207



>ref|XP_004295533.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Fragaria vesca subsp. vesca]
Length=982

 Score =   247 bits (630),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 145/284 (51%), Positives = 188/284 (66%), Gaps = 5/284 (2%)
 Frame = +2

Query  215   VTEQAALL-SIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lNLS  382
             +  QA++L S+K  F A S  SL+SWN+S     C+W  + CD+L   V        NLS
Sbjct  26    LRRQASILASVKQGFEA-SDPSLSSWNVSNYKFLCSWAGIMCDNLSRSVISLDVSNYNLS  84

Query  383   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  562
             G LSPD+ +L  LVNLS++ N  SG  P  I  +  L++LN+SNN FG +   + AQL  
Sbjct  85    GSLSPDITELRTLVNLSVSGNDFSGSFPAGIHKLPRLQYLNISNNGFGGSMDWEFAQLKE  144

Query  563   LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  742
             L +LD YNN+  G LP+ V ++  L+ L  GGNYFSG IPP YG    L YL+V+GN LS
Sbjct  145   LILLDAYNNDFNGSLPLGVTQLPKLKRLDFGGNYFSGSIPPSYGNMSQLNYLSVAGNDLS  204

Query  743   GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLK  922
             G IPSE+GNLT L +L++GY+N F GGIPPE+G L+ L   D ANCGL G +P E+G LK
Sbjct  205   GFIPSELGNLTNLTQLFLGYYNDFDGGIPPEIGKLTNLFHLDLANCGLEGSIPPELGNLK  264

Query  923   NLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
              LDTLFLQ N LSGS+  ++G L +L+SLDLSNNA +G+IP  F
Sbjct  265   KLDTLFLQTNQLSGSIPAQLGNLSSLRSLDLSNNALTGDIPVEF  308


 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 127/252 (50%), Gaps = 27/252 (11%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLS------------------------GPVPPEISA  481
             N +G +   +GQ   LV L ++ N+L+                        GP+P ++  
Sbjct  347   NFTGAIPSKLGQNGKLVELDLSTNKLTGEVPKSLCFGRKLKILILLNNFLFGPLPDDLGE  406

Query  482   ISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKM--TSLRHLHLG  655
               TL  + L  N    + P     L  L +++L NN LTG L ++      + L  L+L 
Sbjct  407   CDTLVRVRLGQNYLSGSIPRGFLYLPELTLMELQNNYLTGQLDMQEKSQVPSKLSQLNLS  466

Query  656   GNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPE  835
              N  SG  P   G F +L+ L +SGN  +G IPS+IG L  + +L +   N FSG IPPE
Sbjct  467   SNRLSGSPPASIGNFSSLQILLLSGNRFTGEIPSDIGRLRNVLKLDMSR-NNFSGSIPPE  525

Query  836   MGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldl  1015
             +GN + L   D +   L+G +P ++ ++  L+   +  N L+ SL  E+G LK+L S D 
Sbjct  526   IGNCTLLTYLDLSQNQLSGPIPPQVVQIHILNYFNVSWNHLNQSLPKELGSLKSLTSADF  585

Query  1016  snnAFSGEIPES  1051
             S+N+FSG +P++
Sbjct  586   SHNSFSGSVPQT  597


 Score = 97.8 bits (242),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 105/199 (53%), Gaps = 1/199 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            +  G + P++G+L  L +L +A   L G +PPE+  +  L  L L  N    + P QL  
Sbjct  227  DFDGGIPPEIGKLTNLFHLDLANCGLEGSIPPELGNLKKLDTLFLQTNQLSGSIPAQLGN  286

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L++L+ LDL NN LTGD+PVE   +  L  L+L  N F G IP E    PNLE L +  N
Sbjct  287  LSSLRSLDLSNNALTGDIPVEFSALRELTLLNLFINKFHGEIPHEIAELPNLEVLKLWQN  346

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              +G IPS++G   KL EL +   N  +G +P  +    +L      N  L G LP ++G
Sbjct  347  NFTGAIPSKLGQNGKLVELDLST-NKLTGEVPKSLCFGRKLKILILLNNFLFGPLPDDLG  405

Query  914  KLKNLDTLFLQVNDLSGSL  970
            +   L  + L  N LSGS+
Sbjct  406  ECDTLVRVRLGQNYLSGSI  424


 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 88/273 (32%), Positives = 126/273 (46%), Gaps = 51/273 (19%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG +   +G L  L +L ++ N L+G +P E SA+  L  LNL  N F    PH++A+L
Sbjct  276   LSGSIPAQLGNLSSLRSLDLSNNALTGDIPVEFSALRELTLLNLFINKFHGEIPHEIAEL  335

Query  557   ANLQVL------------------------DLYNNNLTGD--------------------  604
              NL+VL                        DL  N LTG+                    
Sbjct  336   PNLEVLKLWQNNFTGAIPSKLGQNGKLVELDLSTNKLTGEVPKSLCFGRKLKILILLNNF  395

Query  605   ----LPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNL  772
                 LP ++ +  +L  + LG NY SG IP  +   P L  + +  N L+G +  +  + 
Sbjct  396   LFGPLPDDLGECDTLVRVRLGQNYLSGSIPRGFLYLPELTLMELQNNYLTGQLDMQEKSQ  455

Query  773   --TKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQ  946
               +KL +L +   N  SG  P  +GN S L     +    TGE+P +IG+L+N+  L + 
Sbjct  456   VPSKLSQLNLSS-NRLSGSPPASIGNFSSLQILLLSGNRFTGEIPSDIGRLRNVLKLDMS  514

Query  947   VNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              N+ SGS+ PEIG    L  LDLS N  SG IP
Sbjct  515   RNNFSGSIPPEIGNCTLLTYLDLSQNQLSGPIP  547



>ref|XP_007214567.1| hypothetical protein PRUPE_ppa000837mg [Prunus persica]
 gb|EMJ15766.1| hypothetical protein PRUPE_ppa000837mg [Prunus persica]
Length=986

 Score =   246 bits (629),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 146/286 (51%), Positives = 189/286 (66%), Gaps = 5/286 (2%)
 Frame = +2

Query  209   LGVTEQAALL-SIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lN  376
             L +  QA++L S+K +F A S  SL SWN+S     C+W  + CD++   V        N
Sbjct  29    LSLRRQASILVSVKQSFEA-SNPSLNSWNVSNYMFICSWAGIHCDNMNISVVSLDISNYN  87

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG LSP + +L  LVNLS++ N  SG  PPEI  ++ L++LN+SNN F      + AQL
Sbjct  88    LSGSLSPAITELRTLVNLSVSGNGFSGIFPPEIHKLARLQYLNISNNGFSGNLSWEFAQL  147

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L +LD YNN+  G LP+ V ++  L+ L  GGNYFSG IPP YG    L YL+V+GN 
Sbjct  148   KELILLDAYNNDFNGSLPLGVTQIPKLKRLDFGGNYFSGNIPPSYGNMVQLNYLSVAGND  207

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             LSG IPSE+GNLT LK+L++GY+N F GGIPPE+G L  L   D ANCGL G +P E+G 
Sbjct  208   LSGFIPSELGNLTNLKQLFLGYYNEFEGGIPPEIGKLINLFHLDLANCGLEGPIPPELGN  267

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             LK LDTLFLQ N LSGS+  ++G L +L+SLDLSNNA +G+IP  F
Sbjct  268   LKQLDTLFLQTNQLSGSIPAQLGNLSSLRSLDLSNNALTGDIPAEF  313


 Score =   107 bits (266),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 87/251 (35%), Positives = 129/251 (51%), Gaps = 26/251 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             N +G +   +GQ   L++L +++N+L+G VP  +     L+ L L NN      P  L +
Sbjct  352   NFTGAIPSKLGQNGKLIDLDLSSNKLTGVVPKSLCFGRRLKILILLNNFLFGALPDDLGK  411

Query  554   ------------------------LANLQVLDLYNNNLTGDLPVEVYKMTS-LRHLHLGG  658
                                     L  L +++L NN LTG L  E  K+ S L  L+L  
Sbjct  412   CDTLVRVRMGQNYLTGSIPQGFLYLPELSLVELQNNYLTGQLLEEASKVPSKLSQLNLSS  471

Query  659   NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  838
             N  SG +P   G F +L+ L +SGN  +G IPS+IG L  + +L     N FSG IP E+
Sbjct  472   NRLSGPLPTSIGNFSSLQNLLLSGNQFTGEIPSDIGRLVNVLKLDFSR-NNFSGRIPLEV  530

Query  839   GNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldls  1018
             GN   L   D +   LTG +PV+I ++  L+   +  N L+ SL  E+G +K+L S D S
Sbjct  531   GNCLSLTYLDLSQNQLTGPIPVQIVQIHILNYFNVSWNHLNQSLPKELGSMKSLTSADFS  590

Query  1019  nnAFSGEIPES  1051
             +N+FSG IP++
Sbjct  591   HNSFSGSIPQT  601


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 83/226 (37%), Positives = 119/226 (53%), Gaps = 6/226 (3%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG +   +G L  L +L ++ N L+G +P E SA+  L  LNL  N F    PH +A+L
Sbjct  281   LSGSIPAQLGNLSSLRSLDLSNNALTGDIPAEFSALRKLTLLNLFINKFHGEIPHAIAEL  340

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPE--YGRFPNLEYLAVSG  730
               L+VL L++NN TG +P ++ +   L  L L  N  +G +P    +GR   L+ L +  
Sbjct  341   PKLEVLKLWHNNFTGAIPSKLGQNGKLIDLDLSSNKLTGVVPKSLCFGR--RLKILILLN  398

Query  731   NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
             N L G +P ++G    L  + +G  N  +G IP     L +L   +  N  LTG+L  E 
Sbjct  399   NFLFGALPDDLGKCDTLVRVRMGQ-NYLTGSIPQGFLYLPELSLVELQNNYLTGQLLEEA  457

Query  911   GKL-KNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              K+   L  L L  N LSG L   IG   +L++L LS N F+GEIP
Sbjct  458   SKVPSKLSQLNLSSNRLSGPLPTSIGNFSSLQNLLLSGNQFTGEIP  503


 Score = 91.7 bits (226),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 102/198 (52%), Gaps = 1/198 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
              G + P++G+L  L +L +A   L GP+PPE+  +  L  L L  N    + P QL  L
Sbjct  233  FEGGIPPEIGKLINLFHLDLANCGLEGPIPPELGNLKQLDTLFLQTNQLSGSIPAQLGNL  292

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
            ++L+ LDL NN LTGD+P E   +  L  L+L  N F G IP      P LE L +  N 
Sbjct  293  SSLRSLDLSNNALTGDIPAEFSALRKLTLLNLFINKFHGEIPHAIAELPKLEVLKLWHNN  352

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             +G IPS++G   KL +L +   N  +G +P  +    +L      N  L G LP ++GK
Sbjct  353  FTGAIPSKLGQNGKLIDLDLSS-NKLTGVVPKSLCFGRRLKILILLNNFLFGALPDDLGK  411

Query  917  LKNLDTLFLQVNDLSGSL  970
               L  + +  N L+GS+
Sbjct  412  CDTLVRVRMGQNYLTGSI  429



>gb|AHJ14779.1| CLAVATA1 [Rhododendron ovatum]
Length=992

 Score =   246 bits (627),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 137/278 (49%), Positives = 180/278 (65%), Gaps = 3/278 (1%)
 Frame = +2

Query  221   EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsgl-NLSGVL  391
             +   LLS+K AF     S LTSWN+S   S CTW  + CD+    +        N+SG L
Sbjct  37    QATILLSLKQAFEPPEDSCLTSWNVSNYNSLCTWTGIKCDAKNTSILSLDISNYNISGYL  96

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  571
              P +  +  LVNLS++ N LSG  P +I  +  L+FLN+SNN F  +   Q ++L  L V
Sbjct  97    LPAISDIHTLVNLSVSGNSLSGTFPVDIHKLVRLQFLNISNNQFNGSLNWQFSKLKKLVV  156

Query  572   LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  751
             LD YNN  +G LP+ V  ++ L+HL  GGNYFSG+IPP YG   NL+YL+++GN L G I
Sbjct  157   LDAYNNEFSGSLPLGVTDLSKLKHLDFGGNYFSGKIPPVYGSLENLDYLSLAGNNLVGYI  216

Query  752   PSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLD  931
             P ++GNLT L +L++GY+N F GGIP E+GNL  L+R D ++CGL G +P E+G L  LD
Sbjct  217   PKQLGNLTNLNQLHLGYYNLFDGGIPAELGNLVNLVRLDLSSCGLKGPIPPELGNLNKLD  276

Query  932   TLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             TLFLQ N LSGS+ PE+  L  LKS DLSNN  +GEIP
Sbjct  277   TLFLQTNQLSGSIPPELANLTTLKSFDLSNNVLTGEIP  314


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 75/204 (37%), Positives = 110/204 (54%), Gaps = 2/204 (1%)
 Frame = +2

Query  443   NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVY  622
             N L GP+P ++    TL  + +  N    + P+    L  L +++L NN LTG L  +  
Sbjct  404   NFLFGPLPKDLGKCDTLSRVRIGQNYLSGSIPNGFLYLPQLSLVELQNNYLTGQLEQQRS  463

Query  623   KM-TSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIG  799
             K+   L  L+L  N  SG +P   G F +L  L ++GN   G IPS+IG L  + +L + 
Sbjct  464   KLPMKLGQLNLANNRLSGSLPASIGNFSSLNILLLNGNRFIGDIPSDIGRLKNIFKLDMS  523

Query  800   YFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPE  979
               N FSG IP E+ N   L   D +   L+G +P +I ++  L+ L +  N L+ SL  E
Sbjct  524   R-NNFSGQIPAEISNCLMLTYLDLSQNQLSGPIPDQIAQIHILNYLNISWNHLNQSLPKE  582

Query  980   IGYlknlksldlsnnAFSGEIPES  1051
             IG +K+L S D S+N FSG IPE+
Sbjct  583   IGLMKSLTSADFSHNNFSGPIPET  606


 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 85/249 (34%), Positives = 119/249 (48%), Gaps = 27/249 (11%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI------------  520
             L G + P++G L  L  L +  NQLSG +PPE++ ++TL+  +LSNN+            
Sbjct  261   LKGPIPPELGNLNKLDTLFLQTNQLSGSIPPELANLTTLKSFDLSNNVLTGEIPVELFSG  320

Query  521   -------------FGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  661
                          F    P  LA+L NL+VL L+ NN TG +P  + +  +L+ + L  N
Sbjct  321   LKELTLLNLFLNKFHGEIPRVLAELPNLEVLKLWQNNFTGSIPSMLGQNGNLKEIDLSTN  380

Query  662   YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
               +G +P        L  L +  N L G +P ++G    L  + IG  N  SG IP    
Sbjct  381   KLTGLVPKFLCSGRRLTILILLNNFLFGPLPKDLGKCDTLSRVRIGQ-NYLSGSIPNGFL  439

Query  842   NLSQLIRFDAANCGLTGELPVEIGKL-KNLDTLFLQVNDLSGSLAPEIGYlknlksldls  1018
              L QL   +  N  LTG+L  +  KL   L  L L  N LSGSL   IG   +L  L L+
Sbjct  440   YLPQLSLVELQNNYLTGQLEQQRSKLPMKLGQLNLANNRLSGSLPASIGNFSSLNILLLN  499

Query  1019  nnAFSGEIP  1045
              N F G+IP
Sbjct  500   GNRFIGDIP  508


 Score = 89.4 bits (220),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 99/204 (49%), Gaps = 6/204 (3%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
             SG + P  G L  L  LS+A N L G +P ++  ++ L  L+L   N+F    P +L  
Sbjct  188  FSGKIPPVYGSLENLDYLSLAGNNLVGYIPKQLGNLTNLNQLHLGYYNLFDGGIPAELGN  247

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L NL  LDL +  L G +P E+  +  L  L L  N  SG IPPE      L+   +S N
Sbjct  248  LVNLVRLDLSSCGLKGPIPPELGNLNKLDTLFLQTNQLSGSIPPELANLTTLKSFDLSNN  307

Query  734  GLSGVIPSEIGNLTKLKELYI--GYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
             L+G IP E+   + LKEL +   + N F G IP  +  L  L          TG +P  
Sbjct  308  VLTGEIPVEL--FSGLKELTLLNLFLNKFHGEIPRVLAELPNLEVLKLWQNNFTGSIPSM  365

Query  908  IGKLKNLDTLFLQVNDLSGSLAPE  979
            +G+  NL  + L  N L+G L P+
Sbjct  366  LGQNGNLKEIDLSTNKLTG-LVPK  388


 Score = 85.5 bits (210),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 65/197 (33%), Positives = 94/197 (48%), Gaps = 14/197 (7%)
 Frame = +2

Query  377  LSGVLSPDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            L+G L     +LP  L  L++A N+LSG +P  I   S+L  L L+ N F    P  + +
Sbjct  454  LTGQLEQQRSKLPMKLGQLNLANNRLSGSLPASIGNFSSLNILLLNGNRFIGDIPSDIGR  513

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L N+  LD+  NN +G +P E+     L +L L  N  SG IP +  +   L YL +S N
Sbjct  514  LKNIFKLDMSRNNFSGQIPAEISNCLMLTYLDLSQNQLSGPIPDQIAQIHILNYLNISWN  573

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLS-----------QLIRFDAANC  880
             L+  +P EIG +  L      + N FSG I PE G  S           QL  F  + C
Sbjct  574  HLNQSLPKEIGLMKSLTSADFSH-NNFSGPI-PETGQYSVFNSTSFIGNPQLCGFYLSPC  631

Query  881  GLTGELPVEIGKLKNLD  931
              +   P+ + K  N++
Sbjct  632  NDSATSPIRVDKQNNVN  648


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            N SG +  ++     L  L ++ NQLSGP+P +I+ I  L +LN+S N    + P ++  
Sbjct  526  NFSGQIPAEISNCLMLTYLDLSQNQLSGPIPDQIAQIHILNYLNISWNHLNQSLPKEIGL  585

Query  554  LANLQVLDLYNNNLTGDLP  610
            + +L   D  +NN +G +P
Sbjct  586  MKSLTSADFSHNNFSGPIP  604



>ref|XP_010260843.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
 ref|XP_010260847.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
Length=1006

 Score =   244 bits (624),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 146/281 (52%), Positives = 191/281 (68%), Gaps = 4/281 (1%)
 Frame = +2

Query  221   EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsl-lhvvsldlsglNLSGVL  391
             + +  LS+K AF   + + L +WN S   S C+W  + CD +   VVSLD+S  N+SGV+
Sbjct  53    QASIFLSLKQAFYVPT-TCLDTWNESNFMSLCSWTGIQCDDMGSSVVSLDISNFNISGVI  111

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  571
             SP +G+L  L+NLSIA N  SG  PPE+  +++LRFLN+SNN F  +     + L  L+V
Sbjct  112   SPAIGELQSLLNLSIAGNSFSGLFPPELHKLTSLRFLNISNNQFNGSLSWNFSSLRELEV  171

Query  572   LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  751
             LD+YNNN  G LP+ V ++  L+HL LGGNY SG+IPP YG    L YL+++GN L G+I
Sbjct  172   LDVYNNNFFGSLPLGVTELPKLKHLDLGGNYISGKIPPSYGAMEELNYLSLAGNDLGGLI  231

Query  752   PSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLD  931
             P E+GNLT LK+LY+GYFN F GGIPPE G L  L+  D ++CGL G +P E+G L  LD
Sbjct  232   PGELGNLTNLKQLYLGYFNEFDGGIPPEFGKLVNLVHLDLSSCGLEGPIPPELGNLNKLD  291

Query  932   TLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             TLFLQ N LSGS+  + G L +LKSLDLSNN  +GEIP  F
Sbjct  292   TLFLQTNQLSGSIPHQFGNLSSLKSLDLSNNGLTGEIPVEF  332


 Score =   108 bits (269),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 90/251 (36%), Positives = 129/251 (51%), Gaps = 26/251 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNN-IFG--------  526
             N +G + P +GQ   L  L ++ N+L+G VP  +     LR L L NN +FG        
Sbjct  371   NFTGTIPPKLGQNGKLTELDLSTNKLTGLVPRSLCLGRKLRILILLNNFLFGPLPDDLGD  430

Query  527   ---------------STFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTS-LRHLHLGG  658
                             + P+    L  L +++L NN LTG    +  K+ S L  L+L  
Sbjct  431   CVTLLRVRLGQNYLSGSIPYGFLYLPELSLMELQNNYLTGWFAEDPNKVPSKLGQLNLSN  490

Query  659   NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  838
             N  SG IP   G F +L+ L + GN  +G IPSE+G L  L +L +   N  +G IPP++
Sbjct  491   NRLSGSIPSSIGNFSSLQALLLGGNQFTGEIPSELGRLKNLLKLDMSR-NNLTGRIPPDI  549

Query  839   GNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldls  1018
             GN   L   D +   L+G +PV+I ++  L+ L +  N L+ SL  EIG +K+L S D S
Sbjct  550   GNCLLLTYLDLSQNQLSGPIPVQISQIHILNYLNISWNHLNQSLPKEIGAIKSLTSADFS  609

Query  1019  nnAFSGEIPES  1051
             +N FSG IPES
Sbjct  610   HNDFSGRIPES  620


 Score = 93.6 bits (231),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 103/198 (52%), Gaps = 1/198 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
              G + P+ G+L  LV+L +++  L GP+PPE+  ++ L  L L  N    + PHQ   L
Sbjct  252  FDGGIPPEFGKLVNLVHLDLSSCGLEGPIPPELGNLNKLDTLFLQTNQLSGSIPHQFGNL  311

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
            ++L+ LDL NN LTG++PVE  ++  L  LHL  N   G IP      P LE L +  N 
Sbjct  312  SSLKSLDLSNNGLTGEIPVEFSELRELSLLHLFINKLHGEIPRFIAELPKLEVLKLWQNN  371

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             +G IP ++G   KL EL +   N  +G +P  +    +L      N  L G LP ++G 
Sbjct  372  FTGTIPPKLGQNGKLTELDLST-NKLTGLVPRSLCLGRKLRILILLNNFLFGPLPDDLGD  430

Query  917  LKNLDTLFLQVNDLSGSL  970
               L  + L  N LSGS+
Sbjct  431  CVTLLRVRLGQNYLSGSI  448



>ref|XP_009405747.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Musa acuminata subsp. malaccensis]
Length=984

 Score =   243 bits (619),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 143/282 (51%), Positives = 190/282 (67%), Gaps = 6/282 (2%)
 Frame = +2

Query  221   EQAALLSIKAAFTADSQSSLTSWNISTSH---CTWRRVTCdsllhvvsldlsg-lNLSGV  388
             + + LLSIK +F   SQS L SWN S++H   C W  V CD   H+V        N SG 
Sbjct  35    QASILLSIKRSFH-HSQSLLPSWN-SSAHAALCAWDGVRCDDSNHLVLALDVANSNFSGS  92

Query  389   LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  568
             LSP + +L  L +LS+A N LSGP P  IS +  LR+LN+SNN F  T     +  A L+
Sbjct  93    LSPAIAELKGLASLSVAGNSLSGPFPHAISELPRLRYLNISNNQFNGTLNWSFSDTAELE  152

Query  569   VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  748
             VLD Y+N+ +G LPV + ++T LRHL LGGNYFSG IP  YG F  + YL+++GN L G 
Sbjct  153   VLDAYDNDFSGPLPVGLPRLTKLRHLDLGGNYFSGAIPFAYGGFSAITYLSLAGNDLGGF  212

Query  749   IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNL  928
             IP E+GN+T LK+LY+GY+N F GG+P E+GNL  L+  D ++CGL GE+P E+G LKNL
Sbjct  213   IPPELGNVTTLKQLYLGYYNEFDGGVPAEIGNLIGLLHLDLSSCGLEGEIPPELGNLKNL  272

Query  929   DTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             DTLFLQ N L+G++  ++G L +L+ LD+SNNA +GEIP+ F
Sbjct  273   DTLFLQTNQLTGAIPFQLGNLSSLRYLDISNNALTGEIPKEF  314


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/201 (35%), Positives = 106/201 (53%), Gaps = 1/201 (0%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G + P++G L  L  L +  NQL+G +P ++  +S+LR+L++SNN      P + ++L
Sbjct  258  LEGEIPPELGNLKNLDTLFLQTNQLTGAIPFQLGNLSSLRYLDISNNALTGEIPKEFSKL  317

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              L +L ++ N L  ++P  V ++ SL  L L  N F+G IP   GR   L  L +S N 
Sbjct  318  HQLTLLHVFMNRLHSEIPGFVAELPSLEVLKLWQNNFTGSIPAALGRNGRLRELDLSTNK  377

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G+IP  +    KL E+ I   N   G +P ++G+   L R       LTG +P     
Sbjct  378  LTGLIPPSLCFGKKL-EILILLNNFLFGPLPDDLGDCMTLSRVRMGQNYLTGSIPRGFLY  436

Query  917  LKNLDTLFLQVNDLSGSLAPE  979
            L  L  L LQ N L+G +A E
Sbjct  437  LPELSLLELQNNYLTGVVAEE  457


 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 111/228 (49%), Gaps = 2/228 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  550
             +L G + P++G +  L  L +   N+  G VP EI  +  L  L+LS+       P +L 
Sbjct  208   DLGGFIPPELGNVTTLKQLYLGYYNEFDGGVPAEIGNLIGLLHLDLSSCGLEGEIPPELG  267

Query  551   QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
              L NL  L L  N LTG +P ++  ++SLR+L +  N  +G IP E+ +   L  L V  
Sbjct  268   NLKNLDTLFLQTNQLTGAIPFQLGNLSSLRYLDISNNALTGEIPKEFSKLHQLTLLHVFM  327

Query  731   NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
             N L   IP  +  L  L+ L + + N F+G IP  +G   +L   D +   LTG +P  +
Sbjct  328   NRLHSEIPGFVAELPSLEVLKL-WQNNFTGSIPAALGRNGRLRELDLSTNKLTGLIPPSL  386

Query  911   GKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
                K L+ L L  N L G L  ++G    L  + +  N  +G IP  F
Sbjct  387   CFGKKLEILILLNNFLFGPLPDDLGDCMTLSRVRMGQNYLTGSIPRGF  434


 Score = 95.5 bits (236),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 80/250 (32%), Positives = 118/250 (47%), Gaps = 24/250 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             N +G +   +G+   L  L ++ N+L+G +PP +     L  L L NN      P  L  
Sbjct  353   NFTGSIPAALGRNGRLRELDLSTNKLTGLIPPSLCFGKKLEILILLNNFLFGPLPDDLGD  412

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFP-NLEYLAVSG  730
                L  + +  N LTG +P     +  L  L L  NY +G +  E  + P  L  L +S 
Sbjct  413   CMTLSRVRMGQNYLTGSIPRGFLYLPELSLLELQNNYLTGVVAEEPAQKPAKLGLLNLSN  472

Query  731   NGLSGVIPSEIGNLTKLKELYIG-----------------------YFNGFSGGIPPEMG  841
             N L+G +PS IGN + L+ L +G                         N FSG IPPE+G
Sbjct  473   NRLTGPLPSSIGNFSSLQILLLGGNEFAGEIPSQLGLLKQVLKVDMSRNNFSGRIPPEIG  532

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
             + S L   D ++  L G +P  I +++ L  L L  N LS  +  E+  +K+L S D S+
Sbjct  533   DCSSLTYLDLSHNQLAGPIPARISQVRILSYLNLSWNRLSQRIPQEMASMKSLTSADFSH  592

Query  1022  nAFSGEIPES  1051
             N FSG+IPE+
Sbjct  593   NDFSGKIPET  602


 Score = 83.6 bits (205),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 90/176 (51%), Gaps = 3/176 (2%)
 Frame = +2

Query  410  LPFLVNLSIAANQLSGPVPPE-ISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  586
            LP L  L +  N L+G V  E     + L  LNLSNN      P  +   ++LQ+L L  
Sbjct  437  LPELSLLELQNNYLTGVVAEEPAQKPAKLGLLNLSNNRLTGPLPSSIGNFSSLQILLLGG  496

Query  587  NNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIG  766
            N   G++P ++  +  +  + +  N FSGRIPPE G   +L YL +S N L+G IP+ I 
Sbjct  497  NEFAGEIPSQLGLLKQVLKVDMSRNNFSGRIPPEIGDCSSLTYLDLSHNQLAGPIPARIS  556

Query  767  NLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDT  934
             +  L  L + + N  S  IP EM ++  L   D ++   +G++P E G+   L+ 
Sbjct  557  QVRILSYLNLSW-NRLSQRIPQEMASMKSLTSADFSHNDFSGKIP-ETGQFAYLNA  610



>ref|XP_009415746.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Musa acuminata subsp. malaccensis]
Length=978

 Score =   243 bits (619),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 144/281 (51%), Positives = 189/281 (67%), Gaps = 4/281 (1%)
 Frame = +2

Query  221   EQAALLSIKAAFTADSQSSLTSWNIS--TSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  391
             + + L+SIK +F + S+S L SWN S   S C W  V CD+ +HVV       LN+SG L
Sbjct  30    QASVLISIKRSFHS-SESFLPSWNPSNHASLCAWDGVRCDAAMHVVLALDLSNLNISGSL  88

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  571
             SP +G+L  L  LS+A N LSG  P  +  ++ LR LN+SNN F  T     + +A L+V
Sbjct  89    SPVIGELKGLTYLSVAGNSLSGLFPSSVGKLAGLRHLNVSNNQFNGTLSWSFSYMAELEV  148

Query  572   LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  751
             LD YNN+  G LPV + K+  LRHL LGGNYFSG IP  YG F  L YL+V+GN L G I
Sbjct  149   LDAYNNDFFGALPVGLSKLPKLRHLDLGGNYFSGTIPAAYGGFRALSYLSVAGNDLGGFI  208

Query  752   PSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLD  931
             P E+GN+T LK+LY+GY+N F GGIP E+G+L  L+  D ++CGL GE+P E+G LK LD
Sbjct  209   PPELGNVTTLKQLYLGYYNEFDGGIPAELGSLIDLVHLDLSSCGLEGEIPPELGNLKKLD  268

Query  932   TLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             TLFLQ N L+G++ P +G L +L+ LD+SNNA +GEIP+ F
Sbjct  269   TLFLQTNQLTGTIPPHLGNLSSLRYLDISNNALTGEIPKEF  309


 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 109/201 (54%), Gaps = 1/201 (0%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G + P++G L  L  L +  NQL+G +PP +  +S+LR+L++SNN      P + A+L
Sbjct  253  LEGEIPPELGNLKKLDTLFLQTNQLTGTIPPHLGNLSSLRYLDISNNALTGEIPKEFAEL  312

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              L +L ++ N   G++P  V ++ +L  L L  N F+G IP E GR   L  + +S N 
Sbjct  313  HQLSLLHMFMNRFHGEIPRFVAELPNLEVLKLWQNNFTGAIPAELGRNGRLREVDLSTNK  372

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G +P  +    KL E+ I   N   G +P ++G+ + L+R       LTG LP     
Sbjct  373  LTGSVPRFLCYGRKL-EILILLKNFLFGSLPDDLGDCTTLLRVRMGQNYLTGSLPKGFLY  431

Query  917  LKNLDTLFLQVNDLSGSLAPE  979
            L  L  L LQ N L+G++A E
Sbjct  432  LPELSLLELQNNYLTGAMAEE  452


 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 78/251 (31%), Positives = 124/251 (49%), Gaps = 26/251 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPV------------------------PPEISA  481
             N +G +  ++G+   L  + ++ N+L+G V                        P ++  
Sbjct  348   NFTGAIPAELGRNGRLREVDLSTNKLTGSVPRFLCYGRKLEILILLKNFLFGSLPDDLGD  407

Query  482   ISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKM-TSLRHLHLGG  658
              +TL  + +  N    + P     L  L +L+L NN LTG +  E  K    L  L+L  
Sbjct  408   CTTLLRVRMGQNYLTGSLPKGFLYLPELSLLELQNNYLTGAMAEETAKKPAKLVQLNLSN  467

Query  659   NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  838
             N  SG +P   G F +L+ L +SGN  +G +PS++G L  + ++ +   N FSGGIPPE+
Sbjct  468   NRLSGPLPSSIGNFSSLQMLLLSGNQFTGELPSQLGVLKHVLKIDVSR-NNFSGGIPPEI  526

Query  839   GNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldls  1018
             G+   +   D +   L G +P  + + + L  L L  N LS S+  +IG +K+L S D S
Sbjct  527   GDCISVTYLDLSQNELIGPIPARLSQARVLSYLNLSWNHLSESIPQDIGSMKSLTSADFS  586

Query  1019  nnAFSGEIPES  1051
             +N FSG IPE+
Sbjct  587   HNDFSGRIPET  597


 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/228 (31%), Positives = 112/228 (49%), Gaps = 2/228 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  550
             +L G + P++G +  L  L +   N+  G +P E+ ++  L  L+LS+       P +L 
Sbjct  203   DLGGFIPPELGNVTTLKQLYLGYYNEFDGGIPAELGSLIDLVHLDLSSCGLEGEIPPELG  262

Query  551   QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
              L  L  L L  N LTG +P  +  ++SLR+L +  N  +G IP E+     L  L +  
Sbjct  263   NLKKLDTLFLQTNQLTGTIPPHLGNLSSLRYLDISNNALTGEIPKEFAELHQLSLLHMFM  322

Query  731   NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
             N   G IP  +  L  L+ L + + N F+G IP E+G   +L   D +   LTG +P  +
Sbjct  323   NRFHGEIPRFVAELPNLEVLKL-WQNNFTGAIPAELGRNGRLREVDLSTNKLTGSVPRFL  381

Query  911   GKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
                + L+ L L  N L GSL  ++G    L  + +  N  +G +P+ F
Sbjct  382   CYGRKLEILILLKNFLFGSLPDDLGDCTTLLRVRMGQNYLTGSLPKGF  429


 Score = 86.3 bits (212),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 98/204 (48%), Gaps = 3/204 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G L  D+G    L+ + +  N L+G +P     +  L  L L NN        + A+ 
Sbjct  397  LFGSLPDDLGDCTTLLRVRMGQNYLTGSLPKGFLYLPELSLLELQNNYLTGAMAEETAKK  456

Query  557  -ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             A L  L+L NN L+G LP  +   +SL+ L L GN F+G +P + G   ++  + VS N
Sbjct  457  PAKLVQLNLSNNRLSGPLPSSIGNFSSLQMLLLSGNQFTGELPSQLGVLKHVLKIDVSRN  516

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              SG IP EIG+   +  L +   N   G IP  +     L   + +   L+  +P +IG
Sbjct  517  NFSGGIPPEIGDCISVTYLDLSQ-NELIGPIPARLSQARVLSYLNLSWNHLSESIPQDIG  575

Query  914  KLKNLDTLFLQVNDLSGSLAPEIG  985
             +K+L +     ND SG + PE G
Sbjct  576  SMKSLTSADFSHNDFSGRI-PETG  598



>ref|XP_008225951.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Prunus mume]
Length=986

 Score =   243 bits (619),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 144/286 (50%), Positives = 188/286 (66%), Gaps = 5/286 (2%)
 Frame = +2

Query  209   LGVTEQAALL-SIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lN  376
             L +  QA++L S+K +F A S  SL SWN+S     C+W  + CD++   V        N
Sbjct  29    LSLRRQASILVSVKQSFEA-SNPSLNSWNVSNYMFLCSWAGIHCDNMNISVVSLDISNYN  87

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG LSP + +L  LVNLS++ N  SG  PPEI  ++ L++LN+SNN F      + AQL
Sbjct  88    LSGSLSPAITELRTLVNLSVSGNGFSGIFPPEIHKLARLQYLNISNNGFSGNLSWEFAQL  147

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L +LD YNN+  G LP+ V ++  L+ L  GGNYFS  IPP YG    L YL+V+GN 
Sbjct  148   KELILLDAYNNDFNGSLPLGVTQIPKLKRLDFGGNYFSRNIPPSYGNMVQLNYLSVAGND  207

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             LSG IPSE+GNLT LK+L++GY+N F GGIPPE+G L  L   D ANCGL G +P E+G 
Sbjct  208   LSGFIPSELGNLTNLKQLFLGYYNEFEGGIPPEIGKLINLFHLDLANCGLEGPIPPELGN  267

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             LK LDTLFLQ N LSGS+  ++G L +L+SLDLSNNA +G++P  F
Sbjct  268   LKQLDTLFLQTNQLSGSIPAQLGNLSSLRSLDLSNNALTGDMPAEF  313


 Score =   107 bits (268),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 87/251 (35%), Positives = 129/251 (51%), Gaps = 26/251 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             N +G +   +GQ   L+ L +++N+L+G VP  +     L+ L L NN      P+ L +
Sbjct  352   NFTGAIPSKLGQNGKLIELDLSSNKLTGVVPKSLCFGRRLKILILLNNFLFGPLPNDLGK  411

Query  554   ------------------------LANLQVLDLYNNNLTGDLPVEVYKMTS-LRHLHLGG  658
                                     L  L +++L NN LTG L  E  K+ S L  L+L  
Sbjct  412   CDTLVRVRMGQNYLTGSIPQGFLYLPELSLVELQNNYLTGQLLEEASKVPSKLSQLNLSS  471

Query  659   NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  838
             N  SG +P   G F +L+ L +SGN  +G IPS+IG L  + +L     N FSG IPPE+
Sbjct  472   NRLSGPLPTSIGNFSSLQNLLLSGNQFTGEIPSDIGRLVNVLKLDFSR-NNFSGRIPPEV  530

Query  839   GNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldls  1018
             GN   L   D +   LTG +P +I ++  L+   +  N L+ SL  E+G +K+L S D S
Sbjct  531   GNCLSLTYLDLSQNQLTGPIPFQIVQIHILNYFNVSWNHLNQSLPRELGSMKSLTSADFS  590

Query  1019  nnAFSGEIPES  1051
             +N+FSG IP++
Sbjct  591   HNSFSGSIPQT  601


 Score = 92.8 bits (229),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 102/198 (52%), Gaps = 1/198 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
              G + P++G+L  L +L +A   L GP+PPE+  +  L  L L  N    + P QL  L
Sbjct  233  FEGGIPPEIGKLINLFHLDLANCGLEGPIPPELGNLKQLDTLFLQTNQLSGSIPAQLGNL  292

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
            ++L+ LDL NN LTGD+P E   +  L  L+L  N F G IP      P LE L +  N 
Sbjct  293  SSLRSLDLSNNALTGDMPAEFSALRELTLLNLFINKFHGEIPHAIAELPKLEVLKLWHNN  352

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             +G IPS++G   KL EL +   N  +G +P  +    +L      N  L G LP ++GK
Sbjct  353  FTGAIPSKLGQNGKLIELDLSS-NKLTGVVPKSLCFGRRLKILILLNNFLFGPLPNDLGK  411

Query  917  LKNLDTLFLQVNDLSGSL  970
               L  + +  N L+GS+
Sbjct  412  CDTLVRVRMGQNYLTGSI  429


 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 85/250 (34%), Positives = 120/250 (48%), Gaps = 30/250 (12%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPV------------------------PPEISAI  484
             L G + P++G L  L  L +  NQLSG +                        P E SA+
Sbjct  257   LEGPIPPELGNLKQLDTLFLQTNQLSGSIPAQLGNLSSLRSLDLSNNALTGDMPAEFSAL  316

Query  485   STLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  664
               L  LNL  N F    PH +A+L  L+VL L++NN TG +P ++ +   L  L L  N 
Sbjct  317   RELTLLNLFINKFHGEIPHAIAELPKLEVLKLWHNNFTGAIPSKLGQNGKLIELDLSSNK  376

Query  665   FSGRIPPE--YGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  838
              +G +P    +GR   L+ L +  N L G +P+++G    L  + +G  N  +G IP   
Sbjct  377   LTGVVPKSLCFGR--RLKILILLNNFLFGPLPNDLGKCDTLVRVRMGQ-NYLTGSIPQGF  433

Query  839   GNLSQLIRFDAANCGLTGELPVEIGKL-KNLDTLFLQVNDLSGSLAPEIGYlknlksldl  1015
               L +L   +  N  LTG+L  E  K+   L  L L  N LSG L   IG   +L++L L
Sbjct  434   LYLPELSLVELQNNYLTGQLLEEASKVPSKLSQLNLSSNRLSGPLPTSIGNFSSLQNLLL  493

Query  1016  snnAFSGEIP  1045
             S N F+GEIP
Sbjct  494   SGNQFTGEIP  503


 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 79/275 (29%), Positives = 118/275 (43%), Gaps = 48/275 (17%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             + +G L   V Q+P L  L    N  S  +PP    +  L +L+++ N      P +L  
Sbjct  159   DFNGSLPLGVTQIPKLKRLDFGGNYFSRNIPPSYGNMVQLNYLSVAGNDLSGFIPSELGN  218

Query  554   LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
             L NL+ L L Y N   G +P E+ K+ +L HL L      G IPPE G    L+ L +  
Sbjct  219   LTNLKQLFLGYYNEFEGGIPPEIGKLINLFHLDLANCGLEGPIPPELGNLKQLDTLFLQT  278

Query  731   NGLSGVIPSEIGN---------------------LTKLKEL-----YIGYFNG-------  811
             N LSG IP+++GN                      + L+EL     +I  F+G       
Sbjct  279   NQLSGSIPAQLGNLSSLRSLDLSNNALTGDMPAEFSALRELTLLNLFINKFHGEIPHAIA  338

Query  812   --------------FSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQV  949
                           F+G IP ++G   +LI  D ++  LTG +P  +   + L  L L  
Sbjct  339   ELPKLEVLKLWHNNFTGAIPSKLGQNGKLIELDLSSNKLTGVVPKSLCFGRRLKILILLN  398

Query  950   NDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             N L G L  ++G    L  + +  N  +G IP+ F
Sbjct  399   NFLFGPLPNDLGKCDTLVRVRMGQNYLTGSIPQGF  433



>ref|XP_002985227.1| hypothetical protein SELMODRAFT_121783 [Selaginella moellendorffii]
 gb|EFJ13721.1| hypothetical protein SELMODRAFT_121783 [Selaginella moellendorffii]
Length=1023

 Score =   242 bits (617),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 139/280 (50%), Positives = 186/280 (66%), Gaps = 3/280 (1%)
 Frame = +2

Query  212   GVTEQAALLSIKAAFTADSQSSLTSW-NISTSHCTWRRVTCdsllhvvsldlsg-lNLSG  385
             G  +++ALL++KAA   DS  SL  W     + C W  +TCD  L  V        NLSG
Sbjct  22    GFQDKSALLALKAAMI-DSSGSLDDWTETDDTPCLWTGITCDDRLSRVVALDLSNKNLSG  80

Query  386   VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  565
             + S  +G+L  L+NL++  N  +G +P E++ +  L FLN+S+N F   FP + + L  L
Sbjct  81    IFSSSIGRLTELINLTLDVNNFTGNLPSELATLHDLHFLNVSHNTFTGDFPGRFSNLQLL  140

Query  566   QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  745
             +VLD YNNN +G LP+E+ ++ +LRHLHLGG+YF G IPP YG   +L YLA+ GN L G
Sbjct  141   EVLDAYNNNFSGPLPIELSRLPNLRHLHLGGSYFEGEIPPSYGNMTSLSYLALCGNCLVG  200

Query  746   VIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKN  925
              IP E+G L  L+ELY+GYFN F+GGIPPE+G L  L + D A+CGL G +P E+G L N
Sbjct  201   PIPPELGYLVGLEELYLGYFNHFTGGIPPELGRLLNLQKLDIASCGLEGVIPAELGNLSN  260

Query  926   LDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             LD+LFLQ+N LSG + P++G L NLKSLDLSNN  +G IP
Sbjct  261   LDSLFLQINHLSGPIPPQLGDLVNLKSLDLSNNNLTGAIP  300


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 100/175 (57%), Gaps = 1/175 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L GV+  ++G L  L +L +  N LSGP+PP++  +  L+ L+LSNN      P +L +L
Sbjct  247  LEGVIPAELGNLSNLDSLFLQINHLSGPIPPQLGDLVNLKSLDLSNNNLTGAIPIELRKL  306

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             NL++L L+ N L+G++P  V  + +L+ L L  N F+G +P   G   NL  L VS N 
Sbjct  307  QNLELLSLFLNGLSGEIPAFVADLPNLQALLLWTNNFTGELPQRLGENMNLTELDVSSNP  366

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELP  901
            L+G +P  +    +L E+ +   NG +G IPP +G+   LI+   A   LTG +P
Sbjct  367  LTGPLPPNLCKGGQL-EVLVLIENGITGTIPPALGHCKSLIKVRLAGNHLTGPIP  420


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 75/225 (33%), Positives = 125/225 (56%), Gaps = 2/225 (1%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             L G + P++G L  L  L +   N  +G +PPE+  +  L+ L++++       P +L  
Sbjct  198   LVGPIPPELGYLVGLEELYLGYFNHFTGGIPPELGRLLNLQKLDIASCGLEGVIPAELGN  257

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L+NL  L L  N+L+G +P ++  + +L+ L L  N  +G IP E  +  NLE L++  N
Sbjct  258   LSNLDSLFLQINHLSGPIPPQLGDLVNLKSLDLSNNNLTGAIPIELRKLQNLELLSLFLN  317

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
             GLSG IP+ + +L  L+ L + + N F+G +P  +G    L   D ++  LTG LP  + 
Sbjct  318   GLSGEIPAFVADLPNLQALLL-WTNNFTGELPQRLGENMNLTELDVSSNPLTGPLPPNLC  376

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPE  1048
             K   L+ L L  N ++G++ P +G+ K+L  + L+ N  +G IPE
Sbjct  377   KGGQLEVLVLIENGITGTIPPALGHCKSLIKVRLAGNHLTGPIPE  421


 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 76/247 (31%), Positives = 117/247 (47%), Gaps = 24/247 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             +LSG + P +G L  L +L ++ N L+G +P E+  +  L  L+L  N      P  +A 
Sbjct  270   HLSGPIPPQLGDLVNLKSLDLSNNNLTGAIPIELRKLQNLELLSLFLNGLSGEIPAFVAD  329

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NLQ L L+ NN TG+LP  + +  +L  L +  N  +G +PP   +   LE L +  N
Sbjct  330   LPNLQALLLWTNNFTGELPQRLGENMNLTELDVSSNPLTGPLPPNLCKGGQLEVLVLIEN  389

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP-----------------------PEMGN  844
             G++G IP  +G+   L ++ +   N  +G IP                       P + +
Sbjct  390   GITGTIPPALGHCKSLIKVRLAG-NHLTGPIPEGLLGLKMLEMLELLDNRLTGMIPAIVD  448

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
                L   D +   L G +P  + +L +L  LFL  N   G +  E+G L +L  LDL +N
Sbjct  449   APLLDFLDLSQNELQGSIPAGVARLPSLQKLFLHSNQFVGGIPVELGQLSHLLHLDLHSN  508

Query  1025  AFSGEIP  1045
               SG IP
Sbjct  509   RLSGAIP  515


 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 79/248 (32%), Positives = 120/248 (48%), Gaps = 26/248 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             N +G L   +G+   L  L +++N L+GP+PP +     L  L L  N    T P  L  
Sbjct  342   NFTGELPQRLGENMNLTELDVSSNPLTGPLPPNLCKGGQLEVLVLIENGITGTIPPALGH  401

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
               +L  + L  N+LTG +P  +  +  L  L L  N  +G IP      P L++L +S N
Sbjct  402   CKSLIKVRLAGNHLTGPIPEGLLGLKMLEMLELLDNRLTGMIPAIVDA-PLLDFLDLSQN  460

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG------------------------  841
              L G IP+ +  L  L++L++ + N F GGIP E+G                        
Sbjct  461   ELQGSIPAGVARLPSLQKLFL-HSNQFVGGIPVELGQLSHLLHLDLHSNRLSGAIPAELA  519

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
               S+L   D ++  LTG +P E+G ++ L+ L +  N LSG + P+I   ++L S D S 
Sbjct  520   QCSKLNYLDVSDNRLTGPIPAELGSMEVLELLNVSRNRLSGGIPPQILGQESLTSADFSY  579

Query  1022  nAFSGEIP  1045
             N FSG +P
Sbjct  580   NDFSGTVP  587


 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 85/153 (56%), Gaps = 2/153 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L+G++ P +   P L  L ++ N+L G +P  ++ + +L+ L L +N F    P +L QL
Sbjct  439  LTGMI-PAIVDAPLLDFLDLSQNELQGSIPAGVARLPSLQKLFLHSNQFVGGIPVELGQL  497

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
            ++L  LDL++N L+G +P E+ + + L +L +  N  +G IP E G    LE L VS N 
Sbjct  498  SHLLHLDLHSNRLSGAIPAELAQCSKLNYLDVSDNRLTGPIPAELGSMEVLELLNVSRNR  557

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPE  835
            LSG IP +I     L      Y N FSG +P +
Sbjct  558  LSGGIPPQILGQESLTSADFSY-NDFSGTVPSD  589



>ref|XP_011004294.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Populus euphratica]
Length=988

 Score =   241 bits (615),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 136/281 (48%), Positives = 181/281 (64%), Gaps = 4/281 (1%)
 Frame = +2

Query  221   EQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lNLSGVL  391
             + + L+S+K +  +    SL SWN+S  H  C+W  + CD +   V        N+SG L
Sbjct  36    QASILVSLKQSLES-YDPSLDSWNVSNYHLLCSWTGIQCDDMNRSVVALDISNSNISGTL  94

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  571
             SP + +L  LVNLSI  N  S   P EI  +  L+FLN+SNN+F      + +QL  LQV
Sbjct  95    SPAITELRSLVNLSIQGNSFSDEFPREIHKLIRLQFLNISNNLFSGELAWEFSQLKELQV  154

Query  572   LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  751
             LD+YNNNL G LP+ V ++  L++L  GGNYF G IPP YG    L YL++ GN L G+I
Sbjct  155   LDVYNNNLNGTLPLGVTQLGKLKYLDFGGNYFQGTIPPSYGSMQQLNYLSLKGNDLRGLI  214

Query  752   PSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLD  931
             P E+GNLT L++LY+GY+N F GGIPPE G L  L+  D ANC L+G +P E+G L  LD
Sbjct  215   PGELGNLTSLEQLYLGYYNEFDGGIPPEFGKLINLVHIDLANCSLSGPIPPELGGLNKLD  274

Query  932   TLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             TLFLQ N+L+G + PE+G L ++ SLDLSNNA +G+IP  F
Sbjct  275   TLFLQTNELTGPIPPELGNLSSIISLDLSNNALTGDIPLEF  315


 Score =   101 bits (251),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 82/250 (33%), Positives = 119/250 (48%), Gaps = 26/250 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             N +G +   +G+   L  L +++N+L+G VP  +     L+ L L  N      P  L  
Sbjct  354   NFTGAIPAKLGENGRLTELDLSSNKLTGLVPKSLCLGRKLQILILRINFLFGPLPDDLGH  413

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPE---------------  688
                L  + L  N LTG +P     +  L  + L  NY SG++P +               
Sbjct  414   CDTLWRVRLGQNYLTGSIPSGFLYLPELSLMELQNNYLSGQVPQQISKTPSKLAQMNLAD  473

Query  689   ----------YGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  838
                        G F NL+ L +SGN  +G IPS+IG L  +  L +   N  SG IPPE+
Sbjct  474   NRLSGPLPASIGNFSNLQILLLSGNRFTGEIPSQIGQLKNVFTLDMSR-NNLSGNIPPEI  532

Query  839   GNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldls  1018
             G+   L   D +   L+G +PV I ++  L+ L +  N L+ SL  EIG +K+L S D S
Sbjct  533   GDCRTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWNHLNQSLPKEIGSMKSLTSADFS  592

Query  1019  nnAFSGEIPE  1048
             +N FSG IPE
Sbjct  593   HNNFSGSIPE  602


 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 107/202 (53%), Gaps = 1/202 (0%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P++G L  L  L +  N+L+GP+PPE+  +S++  L+LSNN      P + + L
Sbjct  259  LSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSGL  318

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              L +L+L+ N L G++P  + ++  L  L L  N F+G IP + G    L  L +S N 
Sbjct  319  RRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHNNFTGAIPAKLGENGRLTELDLSSNK  378

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G++P  +    KL ++ I   N   G +P ++G+   L R       LTG +P     
Sbjct  379  LTGLVPKSLCLGRKL-QILILRINFLFGPLPDDLGHCDTLWRVRLGQNYLTGSIPSGFLY  437

Query  917  LKNLDTLFLQVNDLSGSLAPEI  982
            L  L  + LQ N LSG +  +I
Sbjct  438  LPELSLMELQNNYLSGQVPQQI  459


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 116/250 (46%), Gaps = 24/250 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
               G + P  G +  L  LS+  N L G +P E+  +++L  L L   N F    P +  +
Sbjct  186   FQGTIPPSYGSMQQLNYLSLKGNDLRGLIPGELGNLTSLEQLYLGYYNEFDGGIPPEFGK  245

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL  +DL N +L+G +P E+  +  L  L L  N  +G IPPE G   ++  L +S N
Sbjct  246   LINLVHIDLANCSLSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNN  305

Query  734   GLSGVIPSEIGNLTKLKEL---------YIGYF--------------NGFSGGIPPEMGN  844
              L+G IP E   L +L  L          I YF              N F+G IP ++G 
Sbjct  306   ALTGDIPLEFSGLRRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHNNFTGAIPAKLGE  365

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
               +L   D ++  LTG +P  +   + L  L L++N L G L  ++G+   L  + L  N
Sbjct  366   NGRLTELDLSSNKLTGLVPKSLCLGRKLQILILRINFLFGPLPDDLGHCDTLWRVRLGQN  425

Query  1025  AFSGEIPESF  1054
               +G IP  F
Sbjct  426   YLTGSIPSGF  435


 Score = 92.8 bits (229),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 86/159 (54%), Gaps = 3/159 (2%)
 Frame = +2

Query  377  LSGVLSPDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            LSG +   + + P  L  +++A N+LSGP+P  I   S L+ L LS N F    P Q+ Q
Sbjct  451  LSGQVPQQISKTPSKLAQMNLADNRLSGPLPASIGNFSNLQILLLSGNRFTGEIPSQIGQ  510

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L N+  LD+  NNL+G++P E+    +L +L L  N  SG IP    +   L YL +S N
Sbjct  511  LKNVFTLDMSRNNLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWN  570

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLS  850
             L+  +P EIG++  L      + N FSG I PE G  S
Sbjct  571  HLNQSLPKEIGSMKSLTSADFSH-NNFSGSI-PEFGQYS  607



>ref|XP_008808401.1| PREDICTED: leucine-rich repeat receptor-like kinase protein FLORAL 
ORGAN NUMBER1 [Phoenix dactylifera]
Length=989

 Score =   241 bits (615),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 135/276 (49%), Positives = 189/276 (68%), Gaps = 1/276 (0%)
 Frame = +2

Query  230   ALLSIKAAFTADSQSSLTSWNIST-SHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVG  406
             AL+ +K      + + L  W+ S  +HC++  VTCD+   VV+L++S +     L P++ 
Sbjct  31    ALMKLKEGLLGSAGNDLHDWDPSAPTHCSFSGVTCDADARVVALNVSHIRFHRPLPPEIS  90

Query  407   QLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  586
             +L  LVNL++A + L+G +PPEI+A+  LRFLN+SNN F   FP        L+VLD YN
Sbjct  91    RLDRLVNLTVACDSLAGRLPPEIAALPALRFLNISNNNFTGHFPDVDGGFLALEVLDAYN  150

Query  587   NNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIG  766
             NN +G LP+ + K+  LR++HLGGN+FSG IP  YG   +LEYL ++GNGLSG +P  + 
Sbjct  151   NNFSGPLPLGLAKLPHLRYIHLGGNFFSGEIPESYGGIGSLEYLGLNGNGLSGRVPVSLS  210

Query  767   NLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQ  946
              LT L+E+YIGY++ + GGIPPE G L+ L+R D ANC LTG +P  +G+LK LD+LFLQ
Sbjct  211   RLTNLREMYIGYYSMYEGGIPPEFGMLTSLVRLDMANCNLTGRIPASLGQLKLLDSLFLQ  270

Query  947   VNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
              N L+GS+ PE+G L  L+SLDLS N  +GE+PESF
Sbjct  271   WNHLAGSIPPELGGLDLLESLDLSINELTGELPESF  306


 Score =   105 bits (261),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 83/227 (37%), Positives = 123/227 (54%), Gaps = 9/227 (4%)
 Frame = +2

Query  377   LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  547
             L+G +  D+   G+L  LV   +  N   GP+P ++    +L  + L+ N    T P  L
Sbjct  370   LTGTIPSDLCASGRLELLV---LMENAFFGPIPEKLGDCKSLLHVRLAKNFLDGTIPAGL  426

Query  548   AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  727
               L ++ +L+L +N L+G+LP  +     L  L L  N  SG IPP  G F  L+ L++ 
Sbjct  427   FDLPSVDMLELSDNYLSGELPARIAG-DKLGMLLLANNRISGPIPPAIGNFRGLQTLSLQ  485

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLS-QLIRFDAANCGLTGELPV  904
              N +SG IP +IG+L +L  L +   N  +G IP ++   +  L   D +   LTGE+P 
Sbjct  486   SNRISGEIPPQIGDLKQLSNLNLSG-NNLTGEIPSDLARCAGTLEAVDLSRNRLTGEIPE  544

Query  905   EIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              I KL+NL+TL L  N LSG +  +I  + +L +LDLS N  SGEIP
Sbjct  545   AITKLQNLNTLNLSRNQLSGEIPADIQRMLSLTTLDLSYNNLSGEIP  591


 Score = 92.8 bits (229),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 105/203 (52%), Gaps = 1/203 (0%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            NL+G +   +GQL  L +L +  N L+G +PPE+  +  L  L+LS N      P   A+
Sbjct  249  NLTGRIPASLGQLKLLDSLFLQWNHLAGSIPPELGGLDLLESLDLSINELTGELPESFAE  308

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L  L++L+L+ N+  G +P  +  + +L  L +  N F+  +P   GR   L  L V+ N
Sbjct  309  LKQLKLLNLFRNHFRGHIPPFIADLPNLEVLQVWENNFTFELPEGLGRNGRLIKLDVATN  368

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
             L+G IPS++    +L EL +   N F G IP ++G+   L+    A   L G +P  + 
Sbjct  369  RLTGTIPSDLCASGRL-ELLVLMENAFFGPIPEKLGDCKSLLHVRLAKNFLDGTIPAGLF  427

Query  914  KLKNLDTLFLQVNDLSGSLAPEI  982
             L ++D L L  N LSG L   I
Sbjct  428  DLPSVDMLELSDNYLSGELPARI  450


 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 99/199 (50%), Gaps = 1/199 (1%)
 Frame = +2

Query  383  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  562
            G +   +G    L+++ +A N L G +P  +  + ++  L LS+N      P ++A    
Sbjct  396  GPIPEKLGDCKSLLHVRLAKNFLDGTIPAGLFDLPSVDMLELSDNYLSGELPARIAG-DK  454

Query  563  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  742
            L +L L NN ++G +P  +     L+ L L  N  SG IPP+ G    L  L +SGN L+
Sbjct  455  LGMLLLANNRISGPIPPAIGNFRGLQTLSLQSNRISGEIPPQIGDLKQLSNLNLSGNNLT  514

Query  743  GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLK  922
            G IPS++       E      N  +G IP  +  L  L   + +   L+GE+P +I ++ 
Sbjct  515  GEIPSDLARCAGTLEAVDLSRNRLTGEIPEAITKLQNLNTLNLSRNQLSGEIPADIQRML  574

Query  923  NLDTLFLQVNDLSGSLAPE  979
            +L TL L  N+LSG +  E
Sbjct  575  SLTTLDLSYNNLSGEIPVE  593


 Score = 89.0 bits (219),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 72/228 (32%), Positives = 112/228 (49%), Gaps = 3/228 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             +  G + P +  LP L  L +  N  +  +P  +     L  L+++ N    T P  L  
Sbjct  321   HFRGHIPPFIADLPNLEVLQVWENNFTFELPEGLGRNGRLIKLDVATNRLTGTIPSDLCA  380

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
                L++L L  N   G +P ++    SL H+ L  N+  G IP      P+++ L +S N
Sbjct  381   SGRLELLVLMENAFFGPIPEKLGDCKSLLHVRLAKNFLDGTIPAGLFDLPSVDMLELSDN  440

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              LSG +P+ I    KL  L +   N  SG IPP +GN   L      +  ++GE+P +IG
Sbjct  441   YLSGELPARIAG-DKLGMLLLAN-NRISGPIPPAIGNFRGLQTLSLQSNRISGEIPPQIG  498

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlk-nlksldlsnnAFSGEIPESF  1054
              LK L  L L  N+L+G +  ++      L+++DLS N  +GEIPE+ 
Sbjct  499   DLKQLSNLNLSGNNLTGEIPSDLARCAGTLEAVDLSRNRLTGEIPEAI  546


 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 79/252 (31%), Positives = 114/252 (45%), Gaps = 26/252 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             N SG L   + +LP L  + +  N  SG +P     I +L +L L+ N      P  L++
Sbjct  152   NFSGPLPLGLAKLPHLRYIHLGGNFFSGEIPESYGGIGSLEYLGLNGNGLSGRVPVSLSR  211

Query  554   LANLQ-------------------------VLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  658
             L NL+                          LD+ N NLTG +P  + ++  L  L L  
Sbjct  212   LTNLREMYIGYYSMYEGGIPPEFGMLTSLVRLDMANCNLTGRIPASLGQLKLLDSLFLQW  271

Query  659   NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  838
             N+ +G IPPE G    LE L +S N L+G +P     L +LK L + + N F G IPP +
Sbjct  272   NHLAGSIPPELGGLDLLESLDLSINELTGELPESFAELKQLKLLNL-FRNHFRGHIPPFI  330

Query  839   GNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldls  1018
              +L  L          T ELP  +G+   L  L +  N L+G++  ++     L+ L L 
Sbjct  331   ADLPNLEVLQVWENNFTFELPEGLGRNGRLIKLDVATNRLTGTIPSDLCASGRLELLVLM  390

Query  1019  nnAFSGEIPESF  1054
              NAF G IPE  
Sbjct  391   ENAFFGPIPEKL  402


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 73/129 (57%), Gaps = 1/129 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            +SG + P +G    L  LS+ +N++SG +PP+I  +  L  LNLS N      P  LA+ 
Sbjct  465  ISGPIPPAIGNFRGLQTLSLQSNRISGEIPPQIGDLKQLSNLNLSGNNLTGEIPSDLARC  524

Query  557  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            A  L+ +DL  N LTG++P  + K+ +L  L+L  N  SG IP +  R  +L  L +S N
Sbjct  525  AGTLEAVDLSRNRLTGEIPEAITKLQNLNTLNLSRNQLSGEIPADIQRMLSLTTLDLSYN  584

Query  734  GLSGVIPSE  760
             LSG IP E
Sbjct  585  NLSGEIPVE  593


 Score = 82.8 bits (203),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 63/197 (32%), Positives = 97/197 (49%), Gaps = 3/197 (2%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G +   +  LP +  L ++ N LSG +P  I+    L  L L+NN      P  +   
Sbjct  418  LDGTIPAGLFDLPSVDMLELSDNYLSGELPARIAG-DKLGMLLLANNRISGPIPPAIGNF  476

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFP-NLEYLAVSGN  733
              LQ L L +N ++G++P ++  +  L +L+L GN  +G IP +  R    LE + +S N
Sbjct  477  RGLQTLSLQSNRISGEIPPQIGDLKQLSNLNLSGNNLTGEIPSDLARCAGTLEAVDLSRN  536

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
             L+G IP  I  L  L  L +   N  SG IP ++  +  L   D +   L+GE+PVE  
Sbjct  537  RLTGEIPEAITKLQNLNTLNLSR-NQLSGEIPADIQRMLSLTTLDLSYNNLSGEIPVEGQ  595

Query  914  KLKNLDTLFLQVNDLSG  964
             L   ++ F+   DL G
Sbjct  596  FLVFNESSFIGNPDLCG  612



>ref|XP_002264952.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Vitis vinifera]
Length=988

 Score =   241 bits (615),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 146/281 (52%), Positives = 188/281 (67%), Gaps = 4/281 (1%)
 Frame = +2

Query  221   EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllh-vvsldlsglNLSGVL  391
             + + L+++K AF A    SL SW +S   S C+W  V CD     VVSLD+S  N+SG L
Sbjct  36    QASTLVALKQAFEA-PHPSLNSWKVSNYRSLCSWTGVQCDDTSTWVVSLDISNSNISGAL  94

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  571
             SP + +L  L NLS+  N L+G  PPEI  +S L++LN+SNN F  +   +  QL  L V
Sbjct  95    SPAIMELGSLRNLSVCGNNLAGSFPPEIHKLSRLQYLNISNNQFNGSLNWEFHQLKELAV  154

Query  572   LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  751
             LD Y+NN  G LPV V ++  L+HL  GGNYFSG+IP  YG    L YL+++GN L G I
Sbjct  155   LDAYDNNFLGSLPVGVTQLPKLKHLDFGGNYFSGKIPRNYGGMVQLTYLSLAGNDLGGYI  214

Query  752   PSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLD  931
             P E+GNLT LK LY+GY+N F GGIPPE+G L  L+  D ++CGL G +P E+G LK+LD
Sbjct  215   PVELGNLTNLKRLYLGYYNEFDGGIPPELGKLVNLVHLDLSSCGLEGPIPPELGNLKHLD  274

Query  932   TLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             TLFLQ N LSGS+ P++G L +LKSLDLSNN  +GEIP  F
Sbjct  275   TLFLQTNQLSGSIPPQLGNLSSLKSLDLSNNGLTGEIPLEF  315


 Score =   108 bits (270),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 77/203 (38%), Positives = 117/203 (58%), Gaps = 2/203 (1%)
 Frame = +2

Query  443   NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVY  622
             N L GP+P ++    TL+ + L  N      P+    L  L +++L NN LTG  P E  
Sbjct  401   NFLFGPLPDDLGRCETLQRVRLGQNYLSGFIPNGFLYLPQLSLMELQNNYLTGGFPEESS  460

Query  623   KMTS-LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIG  799
             K+ S +  L+L  N  SG +P   G F +L+ L ++GN  +G IPSEIG L  + +L + 
Sbjct  461   KVPSKVGQLNLSNNRLSGSLPTSIGNFSSLQILLLNGNRFTGNIPSEIGQLISILKLDMR  520

Query  800   YFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPE  979
               N FSG IPPE+G+   L   D +   ++G +PV+I ++  L+ L L  N ++ +L  E
Sbjct  521   R-NNFSGIIPPEIGHCLSLTYLDLSQNQISGPIPVQIAQIHILNYLNLSWNHMNQNLPKE  579

Query  980   IGYlknlksldlsnnAFSGEIPE  1048
             IG++K+L S+D S+N FSG IP+
Sbjct  580   IGFMKSLTSVDFSHNNFSGWIPQ  602


 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 83/271 (31%), Positives = 127/271 (47%), Gaps = 48/271 (18%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN--------------  514
             L G + P++G L  L  L +  NQLSG +PP++  +S+L+ L+LSN              
Sbjct  259   LEGPIPPELGNLKHLDTLFLQTNQLSGSIPPQLGNLSSLKSLDLSNNGLTGEIPLEFSEL  318

Query  515   ----------NIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  664
                       N F    PH +A+L  L+VL L+ NN TG +P ++ +   L  L L  N 
Sbjct  319   TELTLLQLFINKFHGEIPHFIAELPKLEVLKLWQNNFTGTIPSKLGRNGKLSELDLSTNK  378

Query  665   FSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIG--YFNGF--------  814
              +G IP        L+ L +  N L G +P ++G    L+ + +G  Y +GF        
Sbjct  379   LTGLIPKSLCFGRRLKILILLNNFLFGPLPDDLGRCETLQRVRLGQNYLSGFIPNGFLYL  438

Query  815   -------------SGGIPPEMGNL-SQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVN  952
                          +GG P E   + S++ + + +N  L+G LP  IG   +L  L L  N
Sbjct  439   PQLSLMELQNNYLTGGFPEESSKVPSKVGQLNLSNNRLSGSLPTSIGNFSSLQILLLNGN  498

Query  953   DLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
               +G++  EIG L ++  LD+  N FSG IP
Sbjct  499   RFTGNIPSEIGQLISILKLDMRRNNFSGIIP  529


 Score = 85.9 bits (211),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 72/196 (37%), Positives = 105/196 (54%), Gaps = 1/196 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
              G + P++G+L  LV+L +++  L GP+PPE+  +  L  L L  N    + P QL  L
Sbjct  235  FDGGIPPELGKLVNLVHLDLSSCGLEGPIPPELGNLKHLDTLFLQTNQLSGSIPPQLGNL  294

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
            ++L+ LDL NN LTG++P+E  ++T L  L L  N F G IP      P LE L +  N 
Sbjct  295  SSLKSLDLSNNGLTGEIPLEFSELTELTLLQLFINKFHGEIPHFIAELPKLEVLKLWQNN  354

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             +G IPS++G   KL EL +   N  +G IP  +    +L      N  L G LP ++G+
Sbjct  355  FTGTIPSKLGRNGKLSELDLST-NKLTGLIPKSLCFGRRLKILILLNNFLFGPLPDDLGR  413

Query  917  LKNLDTLFLQVNDLSG  964
             + L  + L  N LSG
Sbjct  414  CETLQRVRLGQNYLSG  429


 Score = 82.8 bits (203),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 85/276 (31%), Positives = 117/276 (42%), Gaps = 50/276 (18%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             N  G L   V QLP L +L    N  SG +P     +  L +L+L+ N  G   P +L  
Sbjct  161   NFLGSLPVGVTQLPKLKHLDFGGNYFSGKIPRNYGGMVQLTYLSLAGNDLGGYIPVELGN  220

Query  554   LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL----  718
             L NL+ L L Y N   G +P E+ K+ +L HL L      G IPPE G   +L+ L    
Sbjct  221   LTNLKRLYLGYYNEFDGGIPPELGKLVNLVHLDLSSCGLEGPIPPELGNLKHLDTLFLQT  280

Query  719   -AVSG-------------------NGLSGVIPSE------------------------IG  766
               +SG                   NGL+G IP E                        I 
Sbjct  281   NQLSGSIPPQLGNLSSLKSLDLSNNGLTGEIPLEFSELTELTLLQLFINKFHGEIPHFIA  340

Query  767   NLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQ  946
              L KL+ L + + N F+G IP ++G   +L   D +   LTG +P  +   + L  L L 
Sbjct  341   ELPKLEVLKL-WQNNFTGTIPSKLGRNGKLSELDLSTNKLTGLIPKSLCFGRRLKILILL  399

Query  947   VNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
              N L G L  ++G  + L+ + L  N  SG IP  F
Sbjct  400   NNFLFGPLPDDLGRCETLQRVRLGQNYLSGFIPNGF  435


 Score = 77.8 bits (190),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 82/152 (54%), Gaps = 2/152 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLV-NLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            L+G    +  ++P  V  L+++ N+LSG +P  I   S+L+ L L+ N F    P ++ Q
Sbjct  451  LTGGFPEESSKVPSKVGQLNLSNNRLSGSLPTSIGNFSSLQILLLNGNRFTGNIPSEIGQ  510

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L ++  LD+  NN +G +P E+    SL +L L  N  SG IP +  +   L YL +S N
Sbjct  511  LISILKLDMRRNNFSGIIPPEIGHCLSLTYLDLSQNQISGPIPVQIAQIHILNYLNLSWN  570

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP  829
             ++  +P EIG +  L  +   + N FSG IP
Sbjct  571  HMNQNLPKEIGFMKSLTSVDFSH-NNFSGWIP  601


 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            N SG++ P++G    L  L ++ NQ+SGP+P +I+ I  L +LNLS N      P ++  
Sbjct  523  NFSGIIPPEIGHCLSLTYLDLSQNQISGPIPVQIAQIHILNYLNLSWNHMNQNLPKEIGF  582

Query  554  LANLQVLDLYNNNLTGDLP  610
            + +L  +D  +NN +G +P
Sbjct  583  MKSLTSVDFSHNNFSGWIP  601



>ref|XP_011004295.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X2 [Populus euphratica]
Length=893

 Score =   240 bits (613),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 136/281 (48%), Positives = 181/281 (64%), Gaps = 4/281 (1%)
 Frame = +2

Query  221   EQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lNLSGVL  391
             + + L+S+K +  +    SL SWN+S  H  C+W  + CD +   V        N+SG L
Sbjct  36    QASILVSLKQSLES-YDPSLDSWNVSNYHLLCSWTGIQCDDMNRSVVALDISNSNISGTL  94

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  571
             SP + +L  LVNLSI  N  S   P EI  +  L+FLN+SNN+F      + +QL  LQV
Sbjct  95    SPAITELRSLVNLSIQGNSFSDEFPREIHKLIRLQFLNISNNLFSGELAWEFSQLKELQV  154

Query  572   LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  751
             LD+YNNNL G LP+ V ++  L++L  GGNYF G IPP YG    L YL++ GN L G+I
Sbjct  155   LDVYNNNLNGTLPLGVTQLGKLKYLDFGGNYFQGTIPPSYGSMQQLNYLSLKGNDLRGLI  214

Query  752   PSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLD  931
             P E+GNLT L++LY+GY+N F GGIPPE G L  L+  D ANC L+G +P E+G L  LD
Sbjct  215   PGELGNLTSLEQLYLGYYNEFDGGIPPEFGKLINLVHIDLANCSLSGPIPPELGGLNKLD  274

Query  932   TLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             TLFLQ N+L+G + PE+G L ++ SLDLSNNA +G+IP  F
Sbjct  275   TLFLQTNELTGPIPPELGNLSSIISLDLSNNALTGDIPLEF  315


 Score =   100 bits (250),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 82/250 (33%), Positives = 119/250 (48%), Gaps = 26/250 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             N +G +   +G+   L  L +++N+L+G VP  +     L+ L L  N      P  L  
Sbjct  354   NFTGAIPAKLGENGRLTELDLSSNKLTGLVPKSLCLGRKLQILILRINFLFGPLPDDLGH  413

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPE---------------  688
                L  + L  N LTG +P     +  L  + L  NY SG++P +               
Sbjct  414   CDTLWRVRLGQNYLTGSIPSGFLYLPELSLMELQNNYLSGQVPQQISKTPSKLAQMNLAD  473

Query  689   ----------YGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  838
                        G F NL+ L +SGN  +G IPS+IG L  +  L +   N  SG IPPE+
Sbjct  474   NRLSGPLPASIGNFSNLQILLLSGNRFTGEIPSQIGQLKNVFTLDMSR-NNLSGNIPPEI  532

Query  839   GNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldls  1018
             G+   L   D +   L+G +PV I ++  L+ L +  N L+ SL  EIG +K+L S D S
Sbjct  533   GDCRTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWNHLNQSLPKEIGSMKSLTSADFS  592

Query  1019  nnAFSGEIPE  1048
             +N FSG IPE
Sbjct  593   HNNFSGSIPE  602


 Score = 99.0 bits (245),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 107/202 (53%), Gaps = 1/202 (0%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P++G L  L  L +  N+L+GP+PPE+  +S++  L+LSNN      P + + L
Sbjct  259  LSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSGL  318

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              L +L+L+ N L G++P  + ++  L  L L  N F+G IP + G    L  L +S N 
Sbjct  319  RRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHNNFTGAIPAKLGENGRLTELDLSSNK  378

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G++P  +    KL ++ I   N   G +P ++G+   L R       LTG +P     
Sbjct  379  LTGLVPKSLCLGRKL-QILILRINFLFGPLPDDLGHCDTLWRVRLGQNYLTGSIPSGFLY  437

Query  917  LKNLDTLFLQVNDLSGSLAPEI  982
            L  L  + LQ N LSG +  +I
Sbjct  438  LPELSLMELQNNYLSGQVPQQI  459


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 116/250 (46%), Gaps = 24/250 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
               G + P  G +  L  LS+  N L G +P E+  +++L  L L   N F    P +  +
Sbjct  186   FQGTIPPSYGSMQQLNYLSLKGNDLRGLIPGELGNLTSLEQLYLGYYNEFDGGIPPEFGK  245

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL  +DL N +L+G +P E+  +  L  L L  N  +G IPPE G   ++  L +S N
Sbjct  246   LINLVHIDLANCSLSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNN  305

Query  734   GLSGVIPSEIGNLTKLKEL---------YIGYF--------------NGFSGGIPPEMGN  844
              L+G IP E   L +L  L          I YF              N F+G IP ++G 
Sbjct  306   ALTGDIPLEFSGLRRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHNNFTGAIPAKLGE  365

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
               +L   D ++  LTG +P  +   + L  L L++N L G L  ++G+   L  + L  N
Sbjct  366   NGRLTELDLSSNKLTGLVPKSLCLGRKLQILILRINFLFGPLPDDLGHCDTLWRVRLGQN  425

Query  1025  AFSGEIPESF  1054
               +G IP  F
Sbjct  426   YLTGSIPSGF  435


 Score = 92.0 bits (227),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 86/159 (54%), Gaps = 3/159 (2%)
 Frame = +2

Query  377  LSGVLSPDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            LSG +   + + P  L  +++A N+LSGP+P  I   S L+ L LS N F    P Q+ Q
Sbjct  451  LSGQVPQQISKTPSKLAQMNLADNRLSGPLPASIGNFSNLQILLLSGNRFTGEIPSQIGQ  510

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L N+  LD+  NNL+G++P E+    +L +L L  N  SG IP    +   L YL +S N
Sbjct  511  LKNVFTLDMSRNNLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWN  570

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLS  850
             L+  +P EIG++  L      + N FSG I PE G  S
Sbjct  571  HLNQSLPKEIGSMKSLTSADFSH-NNFSGSI-PEFGQYS  607



>ref|XP_007040964.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOX96795.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=986

 Score =   239 bits (611),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 143/283 (51%), Positives = 185/283 (65%), Gaps = 6/283 (2%)
 Frame = +2

Query  209   LGVTEQAALL-SIKAAFTADSQSSLTSWNIS--TSHCTWRRVTCdsllhvvsldlsg-lN  376
             L + +QA++L S+K  F  DS + L SWN+S   S C+W  V CD L   +        N
Sbjct  30    LSLEKQASILVSLKQEF--DSSTPLRSWNVSHHLSVCSWTGVQCDVLNRSIVSLDISNSN  87

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             +SG LSP + QL  L NLS++ N  SG  P EI  ++ L+FLN+SNN+F        +Q+
Sbjct  88    ISGSLSPVITQLRSLANLSVSGNSFSGDFPQEIHKLTRLQFLNISNNMFSGEPNWDFSQM  147

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L VLD Y+NN  G LP+ V K+  L HL+ GGNYFSG IP  YG    L+YL+++GN 
Sbjct  148   KELVVLDAYDNNFNGSLPLGVTKLPKLTHLNFGGNYFSGEIPKAYGSLEQLKYLSLAGND  207

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L G IP+E+GNLT LK+L++GY+N F GGIPPE G L  L+  D ANC L G +P E+G 
Sbjct  208   LGGSIPAELGNLTNLKQLFLGYYNEFDGGIPPEFGKLVNLVHLDLANCSLEGPIPPELGN  267

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             LK LDTLFLQ N++SGS+ P IG L NLKSLDLSNN  +G+IP
Sbjct  268   LKKLDTLFLQTNEISGSIPPHIGNLSNLKSLDLSNNMITGDIP  310


 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 78/224 (35%), Positives = 115/224 (51%), Gaps = 1/224 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
               G + P+ G+L  LV+L +A   L GP+PPE+  +  L  L L  N    + P  +  L
Sbjct  233   FDGGIPPEFGKLVNLVHLDLANCSLEGPIPPELGNLKKLDTLFLQTNEISGSIPPHIGNL  292

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             +NL+ LDL NN +TGD+P+E+  +  L  L+L  N F G IP      P LE L +  N 
Sbjct  293   SNLKSLDLSNNMITGDIPLELSGLCELILLNLFVNRFHGEIPQFIAELPKLEVLKLWHNN  352

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
              +G IPS++G   +L EL +   N  +G +P  +    +L      N  L G LP ++ K
Sbjct  353   FTGSIPSKLGANGRLVELDLST-NKLTGLVPKSLCFGRRLQILILFNNFLFGPLPEDLSK  411

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPE  1048
                L  + +  N L+GS+     YL  L  ++L NN  SG IP+
Sbjct  412   CDTLSRVRMGQNYLTGSIPNGFLYLPELSLVELQNNYLSGRIPQ  455


 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 85/249 (34%), Positives = 123/249 (49%), Gaps = 24/249 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             N +G +   +G    LV L ++ N+L+G VP  +     L+ L L NN      P  L++
Sbjct  352   NFTGSIPSKLGANGRLVELDLSTNKLTGLVPKSLCFGRRLQILILFNNFLFGPLPEDLSK  411

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFP-NLEYLAVSG  730
                L  + +  N LTG +P     +  L  + L  NY SGRIP + G  P  L  L +S 
Sbjct  412   CDTLSRVRMGQNYLTGSIPNGFLYLPELSLVELQNNYLSGRIPQDTGMVPTKLGQLNLSN  471

Query  731   NGLSGVIPSEIGNLTKLKEL------YIGYF-----------------NGFSGGIPPEMG  841
             N LSG +P+ IGN + L+ L      + G F                 N FSG IP ++G
Sbjct  472   NRLSGSLPASIGNFSSLQILLLSSNRFTGEFPSEIGRLKSVLKLDMSRNNFSGTIPSKIG  531

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
             N   L   D +   L+G +PV+I ++  L+ L +  N L+ SL  EIG +K+L S D S+
Sbjct  532   NCILLTYLDLSQNQLSGPIPVQIAQIHILNYLNVSWNHLNQSLPKEIGSIKSLTSADFSH  591

Query  1022  nAFSGEIPE  1048
             N FSG IP+
Sbjct  592   NNFSGSIPQ  600


 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/204 (33%), Positives = 105/204 (51%), Gaps = 3/204 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G + P++G L  L  L +  N++SG +PP I  +S L+ L+LSNN+     P +L+ L
Sbjct  257  LEGPIPPELGNLKKLDTLFLQTNEISGSIPPHIGNLSNLKSLDLSNNMITGDIPLELSGL  316

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              L +L+L+ N   G++P  + ++  L  L L  N F+G IP + G    L  L +S N 
Sbjct  317  CELILLNLFVNRFHGEIPQFIAELPKLEVLKLWHNNFTGSIPSKLGANGRLVELDLSTNK  376

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGF-SGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
            L+G++P  +    +L+ L +  FN F  G +P ++     L R       LTG +P    
Sbjct  377  LTGLVPKSLCFGRRLQILIL--FNNFLFGPLPEDLSKCDTLSRVRMGQNYLTGSIPNGFL  434

Query  914  KLKNLDTLFLQVNDLSGSLAPEIG  985
             L  L  + LQ N LSG +  + G
Sbjct  435  YLPELSLVELQNNYLSGRIPQDTG  458


 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 114/250 (46%), Gaps = 24/250 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              SG +    G L  L  LS+A N L G +P E+  ++ L+ L L   N F    P +  +
Sbjct  184   FSGEIPKAYGSLEQLKYLSLAGNDLGGSIPAELGNLTNLKQLFLGYYNEFDGGIPPEFGK  243

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL  LDL N +L G +P E+  +  L  L L  N  SG IPP  G   NL+ L +S N
Sbjct  244   LVNLVHLDLANCSLEGPIPPELGNLKKLDTLFLQTNEISGSIPPHIGNLSNLKSLDLSNN  303

Query  734   GLSGVIPSEIGNLTKLK--ELYIGYFNG---------------------FSGGIPPEMGN  844
              ++G IP E+  L +L    L++  F+G                     F+G IP ++G 
Sbjct  304   MITGDIPLELSGLCELILLNLFVNRFHGEIPQFIAELPKLEVLKLWHNNFTGSIPSKLGA  363

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
               +L+  D +   LTG +P  +   + L  L L  N L G L  ++     L  + +  N
Sbjct  364   NGRLVELDLSTNKLTGLVPKSLCFGRRLQILILFNNFLFGPLPEDLSKCDTLSRVRMGQN  423

Query  1025  AFSGEIPESF  1054
               +G IP  F
Sbjct  424   YLTGSIPNGF  433



>ref|XP_006448558.1| hypothetical protein CICLE_v10014145mg [Citrus clementina]
 gb|ESR61798.1| hypothetical protein CICLE_v10014145mg [Citrus clementina]
Length=987

 Score =   238 bits (607),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 133/279 (48%), Positives = 188/279 (67%), Gaps = 5/279 (2%)
 Frame = +2

Query  221   EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsld--lsglNLSGV  388
             + + L+S+K  F +    SL SWN+S   S C+W  + CD + +   +   +S  N+SG 
Sbjct  35    QASILVSLKRGFES-YDPSLESWNVSNFMSLCSWPGIKCDDIANTSVVSLDISSFNISGS  93

Query  389   LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  568
             L+P + QL  LV LS++ N  SG +P ++  ++ L+ LN+SNN+F        +QL  L 
Sbjct  94    LAPVITQLRSLVYLSVSDNGFSGELPRDMHRLTRLQVLNVSNNMFSGELNWDFSQLKELV  153

Query  569   VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  748
             VLD YNN   G LP+ + +++ L+HLHLGGNYFSG+IPP YG F  L YL + GN L+G+
Sbjct  154   VLDAYNNEFNGSLPLGLSQLSKLQHLHLGGNYFSGKIPPNYGDFEQLLYLHLGGNDLNGI  213

Query  749   IPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNL  928
             IP E+GNLT L++L++GYFN F GGIP E G L+ L+  D ANC L G +P E+GKL  L
Sbjct  214   IPGELGNLTTLEQLFLGYFNDFDGGIPAEFGKLTSLVHLDLANCSLEGSVPPELGKLNKL  273

Query  929   DTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             DTLFLQVN+L+GS+ P++G L +L++LDLS N+ +GEIP
Sbjct  274   DTLFLQVNELTGSIPPQLGNLSSLRTLDLSKNSLTGEIP  312


 Score = 95.5 bits (236),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 67/199 (34%), Positives = 104/199 (52%), Gaps = 1/199 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            +  G +  + G+L  LV+L +A   L G VPPE+  ++ L  L L  N    + P QL  
Sbjct  234  DFDGGIPAEFGKLTSLVHLDLANCSLEGSVPPELGKLNKLDTLFLQVNELTGSIPPQLGN  293

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L++L+ LDL  N+LTG++P+E+  +  L  L L  N F G IP       NLE L +  N
Sbjct  294  LSSLRTLDLSKNSLTGEIPLELSGLRQLTLLQLNINRFHGEIPRFIEELDNLEVLQLWQN  353

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              +G IPS++G   +LK L +   N  +G +P  +    QL+     N  L G LP ++ 
Sbjct  354  NFTGPIPSKLGANGRLKVLDLST-NKLTGLVPKSLCFGRQLLILILFNNFLFGPLPADLA  412

Query  914  KLKNLDTLFLQVNDLSGSL  970
            + + L  + +  N L+GS+
Sbjct  413  QCETLVKVRMWQNYLTGSI  431


 Score = 95.1 bits (235),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 83/251 (33%), Positives = 123/251 (49%), Gaps = 27/251 (11%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             N +G +   +G    L  L ++ N+L+G VP  +     L  L L NN      P  LAQ
Sbjct  354   NFTGPIPSKLGANGRLKVLDLSTNKLTGLVPKSLCFGRQLLILILFNNFLFGPLPADLAQ  413

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGR------------  697
                L  + ++ N LTG +P  +  +  L  L L  NY +G +P E G+            
Sbjct  414   CETLVKVRMWQNYLTGSIPYGLLYLPELSLLELQNNYLTGSVPAETGKVLPSKLSRLNLS  473

Query  698   --------------FPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPE  835
                           F +L+   +SGN L+G IPS+IG L  +  L +   N FSG IP E
Sbjct  474   NNRLTGPLPTSIGNFSSLQIFLLSGNKLTGEIPSQIGQLKNVLHLDMSR-NNFSGIIPVE  532

Query  836   MGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldl  1015
             +G+   L   D +   L+G +PV+I ++  L+ L +  N L+ SL  E+G +K+L + D 
Sbjct  533   IGHCLLLTYLDLSQNHLSGPIPVQITQIHILNYLNVSWNQLNASLPKEMGNMKSLTAADF  592

Query  1016  snnAFSGEIPE  1048
             S+N FSGEIPE
Sbjct  593   SHNNFSGEIPE  603


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 114/217 (53%), Gaps = 3/217 (1%)
 Frame = +2

Query  401   VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDL  580
             + +L  L  L +  N  +GP+P ++ A   L+ L+LS N      P  L     L +L L
Sbjct  339   IEELDNLEVLQLWQNNFTGPIPSKLGANGRLKVLDLSTNKLTGLVPKSLCFGRQLLILIL  398

Query  581   YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSE  760
             +NN L G LP ++ +  +L  + +  NY +G IP      P L  L +  N L+G +P+E
Sbjct  399   FNNFLFGPLPADLAQCETLVKVRMWQNYLTGSIPYGLLYLPELSLLELQNNYLTGSVPAE  458

Query  761   IGNL--TKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDT  934
              G +  +KL  L +   N  +G +P  +GN S L  F  +   LTGE+P +IG+LKN+  
Sbjct  459   TGKVLPSKLSRLNLSN-NRLTGPLPTSIGNFSSLQIFLLSGNKLTGEIPSQIGQLKNVLH  517

Query  935   LFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             L +  N+ SG +  EIG+   L  LDLS N  SG IP
Sbjct  518   LDMSRNNFSGIIPVEIGHCLLLTYLDLSQNHLSGPIP  554


 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 87/160 (54%), Gaps = 4/160 (3%)
 Frame = +2

Query  377  LSGVLSPDVGQ-LP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  550
            L+G +  + G+ LP  L  L+++ N+L+GP+P  I   S+L+   LS N      P Q+ 
Sbjct  451  LTGSVPAETGKVLPSKLSRLNLSNNRLTGPLPTSIGNFSSLQIFLLSGNKLTGEIPSQIG  510

Query  551  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
            QL N+  LD+  NN +G +PVE+     L +L L  N+ SG IP +  +   L YL VS 
Sbjct  511  QLKNVLHLDMSRNNFSGIIPVEIGHCLLLTYLDLSQNHLSGPIPVQITQIHILNYLNVSW  570

Query  731  NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLS  850
            N L+  +P E+GN+  L      + N FSG I PE G  S
Sbjct  571  NQLNASLPKEMGNMKSLTAADFSH-NNFSGEI-PEFGQYS  608


 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 69/225 (31%), Positives = 110/225 (49%), Gaps = 2/225 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  550
             +L+G++  ++G L  L  L +   N   G +P E   +++L  L+L+N     + P +L 
Sbjct  209   DLNGIIPGELGNLTTLEQLFLGYFNDFDGGIPAEFGKLTSLVHLDLANCSLEGSVPPELG  268

Query  551   QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
             +L  L  L L  N LTG +P ++  ++SLR L L  N  +G IP E      L  L ++ 
Sbjct  269   KLNKLDTLFLQVNELTGSIPPQLGNLSSLRTLDLSKNSLTGEIPLELSGLRQLTLLQLNI  328

Query  731   NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
             N   G IP  I  L  L+ L + + N F+G IP ++G   +L   D +   LTG +P  +
Sbjct  329   NRFHGEIPRFIEELDNLEVLQL-WQNNFTGPIPSKLGANGRLKVLDLSTNKLTGLVPKSL  387

Query  911   GKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
                + L  L L  N L G L  ++   + L  + +  N  +G IP
Sbjct  388   CFGRQLLILILFNNFLFGPLPADLAQCETLVKVRMWQNYLTGSIP  432



>emb|CDP04113.1| unnamed protein product [Coffea canephora]
Length=987

 Score =   238 bits (606),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 143/277 (52%), Positives = 183/277 (66%), Gaps = 3/277 (1%)
 Frame = +2

Query  221   EQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsglNLSGVLS  394
             + + L+S+K  F   S  SL SWN+S     C W  +TCD    VVSLD+S LNLSG LS
Sbjct  38    QASVLVSVKQKFQTSS-PSLDSWNMSNYMFLCMWNGITCDENRLVVSLDISNLNLSGSLS  96

Query  395   PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  574
             P + +L  L+N+S+A N   G   PEI     LR LNLSNN+F      + + L  L+VL
Sbjct  97    PAITELRSLINISVAGNGFFGVFLPEIHKFENLRILNLSNNVFSGNLSWEFSHLQELEVL  156

Query  575   DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  754
             D YNNN +G LP  + ++  L++L+LGGNYFSG+IP  YG    L +L+++GN  SG IP
Sbjct  157   DGYNNNFSGPLPFGISQLQKLQYLNLGGNYFSGQIPASYGGLNQLNFLSLAGNDFSGFIP  216

Query  755   SEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDT  934
              E GNLT L+ LY+GYFN F GGIP E+G L  L+  D ANCGL G +P E+G LK LDT
Sbjct  217   GEFGNLTSLQWLYLGYFNTFDGGIPSELGKLINLVHLDLANCGLVGPIPAELGHLKMLDT  276

Query  935   LFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             LFLQ N L+GS+ P++G L +LKSLDLSNN  +GEIP
Sbjct  277   LFLQTNQLNGSIPPQLGNLASLKSLDLSNNVLTGEIP  313


 Score =   106 bits (265),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 84/251 (33%), Positives = 125/251 (50%), Gaps = 26/251 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLS------------------------GPVPPEISA  481
             N +G +   +GQ   L+ L  + N+L+                        GP+P ++  
Sbjct  355   NFTGSIPQKLGQNGKLIELDFSTNKLTGLVPSTLCSGRRLRILILLNNFLLGPLPDDLGR  414

Query  482   ISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKM-TSLRHLHLGG  658
               +L  + L  N    + PH    L +L +++L NN L G L     ++ T L  L+L  
Sbjct  415   CKSLSRVRLGQNFLSGSIPHGFLYLPDLSLMELQNNLLAGQLEETNAQVSTKLEGLNLSN  474

Query  659   NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  838
             N  SG +P   G+F  L+ L ++GN  SG IPSEIG+L  +  L +   N FSG IPPE+
Sbjct  475   NRLSGPLPISIGKFSGLKILLLNGNHFSGNIPSEIGSLGNMLRLDMSK-NNFSGNIPPEI  533

Query  839   GNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldls  1018
             G    L   D +   L+G +PV+I ++  L+   +  N LS  L  EIG +K+L S D S
Sbjct  534   GKCLSLTYLDLSQNQLSGPIPVQIAQIHILNYFNISWNHLSQKLPKEIGSIKSLTSADFS  593

Query  1019  nnAFSGEIPES  1051
             +N FSG IPE+
Sbjct  594   HNNFSGSIPET  604


 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 86/272 (32%), Positives = 131/272 (48%), Gaps = 50/272 (18%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L G +  ++G L  L  L +  NQL+G +PP++  +++L+ L+LSNN+     P +L+ L
Sbjct  260   LVGPIPAELGHLKMLDTLFLQTNQLNGSIPPQLGNLASLKSLDLSNNVLTGEIPAELSPL  319

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L +L+L+ N L G++P  V ++  L  L L  N F+G IP + G+   L  L  S N 
Sbjct  320   QELTLLNLFMNRLHGEIPQFVEELPQLEVLKLWQNNFTGSIPQKLGQNGKLIELDFSTNK  379

Query  737   LSGVIPS------------------------EIGNLTKLKELYIGYFNGFSGGIP-----  829
             L+G++PS                        ++G    L  + +G  N  SG IP     
Sbjct  380   LTGLVPSTLCSGRRLRILILLNNFLLGPLPDDLGRCKSLSRVRLGQ-NFLSGSIPHGFLY  438

Query  830   -PEM-----------GNL--------SQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQV  949
              P++           G L        ++L   + +N  L+G LP+ IGK   L  L L  
Sbjct  439   LPDLSLMELQNNLLAGQLEETNAQVSTKLEGLNLSNNRLSGPLPISIGKFSGLKILLLNG  498

Query  950   NDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             N  SG++  EIG L N+  LD+S N FSG IP
Sbjct  499   NHFSGNIPSEIGSLGNMLRLDMSKNNFSGNIP  530


 Score = 95.1 bits (235),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 102/198 (52%), Gaps = 1/198 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
              G +  ++G+L  LV+L +A   L GP+P E+  +  L  L L  N    + P QL  L
Sbjct  236  FDGGIPSELGKLINLVHLDLANCGLVGPIPAELGHLKMLDTLFLQTNQLNGSIPPQLGNL  295

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
            A+L+ LDL NN LTG++P E+  +  L  L+L  N   G IP      P LE L +  N 
Sbjct  296  ASLKSLDLSNNVLTGEIPAELSPLQELTLLNLFMNRLHGEIPQFVEELPQLEVLKLWQNN  355

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             +G IP ++G   KL EL     N  +G +P  + +  +L      N  L G LP ++G+
Sbjct  356  FTGSIPQKLGQNGKLIELDFST-NKLTGLVPSTLCSGRRLRILILLNNFLLGPLPDDLGR  414

Query  917  LKNLDTLFLQVNDLSGSL  970
             K+L  + L  N LSGS+
Sbjct  415  CKSLSRVRLGQNFLSGSI  432


 Score = 92.0 bits (227),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 79/276 (29%), Positives = 114/276 (41%), Gaps = 74/276 (27%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L+G + P +G L  L +L ++ N L+G +P E+S +  L  LNL  N      P  + +L
Sbjct  284  LNGSIPPQLGNLASLKSLDLSNNVLTGEIPAELSPLQELTLLNLFMNRLHGEIPQFVEEL  343

Query  557  ANLQVLDLYNNNLTGD--------------------------------------------  604
              L+VL L+ NN TG                                             
Sbjct  344  PQLEVLKLWQNNFTGSIPQKLGQNGKLIELDFSTNKLTGLVPSTLCSGRRLRILILLNNF  403

Query  605  ----LPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNL---------------------  709
                LP ++ +  SL  + LG N+ SG IP  +   P+L                     
Sbjct  404  LLGPLPDDLGRCKSLSRVRLGQNFLSGSIPHGFLYLPDLSLMELQNNLLAGQLEETNAQV  463

Query  710  ----EYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAAN  877
                E L +S N LSG +P  IG  + LK L +   N FSG IP E+G+L  ++R D + 
Sbjct  464  STKLEGLNLSNNRLSGPLPISIGKFSGLKILLLNG-NHFSGNIPSEIGSLGNMLRLDMSK  522

Query  878  CGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIG  985
               +G +P EIGK  +L  L L  N LSG +  +I 
Sbjct  523  NNFSGNIPPEIGKCLSLTYLDLSQNQLSGPIPVQIA  558


 Score = 89.4 bits (220),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 98/197 (50%), Gaps = 2/197 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
             SG +    G L  L  LS+A N  SG +P E   +++L++L L   N F    P +L +
Sbjct  187  FSGQIPASYGGLNQLNFLSLAGNDFSGFIPGEFGNLTSLQWLYLGYFNTFDGGIPSELGK  246

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L NL  LDL N  L G +P E+  +  L  L L  N  +G IPP+ G   +L+ L +S N
Sbjct  247  LINLVHLDLANCGLVGPIPAELGHLKMLDTLFLQTNQLNGSIPPQLGNLASLKSLDLSNN  306

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
             L+G IP+E+  L +L  L + + N   G IP  +  L QL          TG +P ++G
Sbjct  307  VLTGEIPAELSPLQELTLLNL-FMNRLHGEIPQFVEELPQLEVLKLWQNNFTGSIPQKLG  365

Query  914  KLKNLDTLFLQVNDLSG  964
            +   L  L    N L+G
Sbjct  366  QNGKLIELDFSTNKLTG  382


 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 78/144 (54%), Gaps = 2/144 (1%)
 Frame = +2

Query  419  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  598
            L  L+++ N+LSGP+P  I   S L+ L L+ N F    P ++  L N+  LD+  NN +
Sbjct  467  LEGLNLSNNRLSGPLPISIGKFSGLKILLLNGNHFSGNIPSEIGSLGNMLRLDMSKNNFS  526

Query  599  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTK  778
            G++P E+ K  SL +L L  N  SG IP +  +   L Y  +S N LS  +P EIG++  
Sbjct  527  GNIPPEIGKCLSLTYLDLSQNQLSGPIPVQIAQIHILNYFNISWNHLSQKLPKEIGSIKS  586

Query  779  LKELYIGYFNGFSGGIPPEMGNLS  850
            L      + N FSG I PE G  S
Sbjct  587  LTSADFSH-NNFSGSI-PETGQYS  608



>ref|XP_008357152.1| PREDICTED: receptor protein kinase CLAVATA1-like [Malus domestica]
Length=837

 Score =   236 bits (603),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 136/275 (49%), Positives = 185/275 (67%), Gaps = 1/275 (0%)
 Frame = +2

Query  233   LLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQL  412
             LL +KAA     +S L  WN S+SHC++  V CD    VVSL++S L L G ++ ++G L
Sbjct  33    LLKLKAAMIGXKRSGLEDWNPSSSHCSFSGVLCDRDSRVVSLNVSNLPLYGTIAAEIGLL  92

Query  413   PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQVLDLYNN  589
               LVNL+IA N  +G +P E++ ++ L+ LN+S N+F  +FP ++   +  L+VLD YNN
Sbjct  93    DKLVNLTIAGNNFTGRLPAEMANLTALKHLNISGNLFHGSFPIEIVVGMTELEVLDAYNN  152

Query  590   NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  769
             N TG LPVE+  + +L+HL LGGN+ +G IP  Y    +LEYL V+GN LSG +P+ +  
Sbjct  153   NFTGTLPVELVSLKNLKHLQLGGNFITGEIPENYSEIQSLEYLGVNGNMLSGRVPASLSR  212

Query  770   LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQV  949
             L  L+ELY+GY+N +SGGIPPE+G+LS L   D  +C L G +P  +  LK+L TLFLQV
Sbjct  213   LKNLRELYVGYYNSYSGGIPPELGSLSSLQILDMGSCNLVGPIPTTLSLLKHLHTLFLQV  272

Query  950   NDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             N LSGS+ PE+  L  L SLDLS N  SGEIPESF
Sbjct  273   NRLSGSIPPELSALNRLMSLDLSINELSGEIPESF  307


 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 110/224 (49%), Gaps = 18/224 (8%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             NL G +   +  L  L  L +  N+LSG +PPE+SA++ L  L+LS N      P   ++
Sbjct  250   NLVGPIPTTLSLLKHLHTLFLQVNRLSGSIPPELSALNRLMSLDLSINELSGEIPESFSE  309

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L N+ +++LY NNL G +P  +     L  L +  N F+  +P   GR   L+ L V+G 
Sbjct  310   LKNITLINLYRNNLYGPIPKFIGDFPHLEVLQIWENNFTFELPENLGRNGRLKELDVTGX  369

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              L+G+IP +                     IP  +   S L   D +   L GE+P  I 
Sbjct  370   HLTGLIPRDFRK------------------IPDSISRCSSLTSADLSQNNLVGEIPKGIA  411

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             KLK L  L    N L+G +  EI Y+ +L +LDLS+N F G IP
Sbjct  412   KLKVLSILNFSRNQLTGEIPAEIRYMTSLTTLDLSDNNFVGRIP  455



>ref|XP_009393965.1| PREDICTED: leucine-rich repeat receptor-like kinase protein FLORAL 
ORGAN NUMBER1 [Musa acuminata subsp. malaccensis]
Length=632

 Score =   233 bits (594),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 136/283 (48%), Positives = 187/283 (66%), Gaps = 2/283 (1%)
 Frame = +2

Query  212   GVTEQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNLSGV  388
             G  +  AL+ +KAA      S L  W   S  HC++  VTCD   HVV+L++S ++L+G 
Sbjct  20    GDGDHGALVKLKAALVGPGGSGLGDWAAASPDHCSFSGVTCDEDSHVVALNVSFVHLNGS  79

Query  389   LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH-QLAQLANL  565
             L P++G L  LVNL+++   L G +P E++A+ +LR LN+SN+ F   FP  +      L
Sbjct  80    LPPEIGLLRHLVNLTVSCAGLGGSLPVELAALPSLRLLNISNSHFSGEFPKVEPGGFPAL  139

Query  566   QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  745
              V+D YNNN++G LP+ +     LR+LHLGGN+FSG IP  Y   PNLEYL ++GN L+G
Sbjct  140   DVIDAYNNNISGPLPLGLAAAPLLRYLHLGGNFFSGVIPEAYSDIPNLEYLGLNGNSLTG  199

Query  746   VIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKN  925
              +P  +  L+KLKE+YIGY+N + GGIP E G LS L+R D A C L+G LP  +G+LK 
Sbjct  200   RVPPSLSRLSKLKEMYIGYYNKYEGGIPWEFGRLSSLVRLDMAGCRLSGTLPASLGQLKR  259

Query  926   LDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             LD+LFLQ+N L+GS+ PE+G L  L+ LD S N  +GEIPESF
Sbjct  260   LDSLFLQINRLNGSIPPELGGLSQLEFLDFSINELTGEIPESF  302


 Score =   103 bits (258),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 78/224 (35%), Positives = 120/224 (54%), Gaps = 2/224 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             +L G++ P +G+LP LV L +  N  S  +P  +     L  L++++N    T P  L  
Sbjct  317   HLRGIIPPFIGELPSLVELKLFQNNFSSELPESLGMNGRLVTLDVASNRITGTIPRDLCA  376

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
                L++L L +N L G +P ++    SL  + LG N  +G IP      P+ + L ++ N
Sbjct  377   GGRLEMLVLMDNGLVGPIPEKLGGCKSLTRVRLGKNSLNGSIPAGLFDLPSNDMLELNDN  436

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
              LSG +P+ I    KL+ L +   N  +G IPP + NLS L R +     + GE+P EIG
Sbjct  437   NLSGELPTVIAG-DKLRLLILSN-NSITGSIPPAISNLSALERLELNINRMFGEIPPEIG  494

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             +LK L  + L  N+L+G    ++ +  +L SLDLS N  +GEIP
Sbjct  495   RLKALAMINLSGNELTGEFPIDLAHCASLVSLDLSRNRLTGEIP  538


 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/193 (35%), Positives = 98/193 (51%), Gaps = 5/193 (3%)
 Frame = +2

Query  404  GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLY  583
            G+L  LV   +  N L GP+P ++    +L  + L  N    + P  L  L +  +L+L 
Sbjct  378  GRLEMLV---LMDNGLVGPIPEKLGGCKSLTRVRLGKNSLNGSIPAGLFDLPSNDMLELN  434

Query  584  NNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEI  763
            +NNL+G+LP  V     LR L L  N  +G IPP       LE L ++ N + G IP EI
Sbjct  435  DNNLSGELPT-VIAGDKLRLLILSNNSITGSIPPAISNLSALERLELNINRMFGEIPPEI  493

Query  764  GNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFL  943
            G L  L  + +   N  +G  P ++ + + L+  D +   LTGE+PV+I  L  L+TL L
Sbjct  494  GRLKALAMINLSG-NELTGEFPIDLAHCASLVSLDLSRNRLTGEIPVQITALPILNTLKL  552

Query  944  QVNDLSGSLAPEI  982
              N   G + PEI
Sbjct  553  SSNRFWGEIPPEI  565


 Score = 89.7 bits (221),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 69/198 (35%), Positives = 103/198 (52%), Gaps = 1/198 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG L   +GQL  L +L +  N+L+G +PPE+  +S L FL+ S N      P   A+L
Sbjct  246  LSGTLPASLGQLKRLDSLFLQINRLNGSIPPELGGLSQLEFLDFSINELTGEIPESFAEL  305

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              L++L+L+ N+L G +P  + ++ SL  L L  N FS  +P   G    L  L V+ N 
Sbjct  306  KELKLLNLFMNHLRGIIPPFIGELPSLVELKLFQNNFSSELPESLGMNGRLVTLDVASNR  365

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            ++G IP ++    +L E+ +   NG  G IP ++G    L R       L G +P  +  
Sbjct  366  ITGTIPRDLCAGGRL-EMLVLMDNGLVGPIPEKLGGCKSLTRVRLGKNSLNGSIPAGLFD  424

Query  917  LKNLDTLFLQVNDLSGSL  970
            L + D L L  N+LSG L
Sbjct  425  LPSNDMLELNDNNLSGEL  442


 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 117/247 (47%), Gaps = 26/247 (11%)
 Frame = +2

Query  380   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQL  556
             SGV+      +P L  L +  N L+G VPP +S +S L+ + +   N +    P +  +L
Sbjct  174   SGVIPEAYSDIPNLEYLGLNGNSLTGRVPPSLSRLSKLKEMYIGYYNKYEGGIPWEFGRL  233

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             ++L  LD+    L+G LP  + ++  L  L L  N  +G IPPE G    LE+L  S N 
Sbjct  234   SSLVRLDMAGCRLSGTLPASLGQLKRLDSLFLQINRLNGSIPPELGGLSQLEFLDFSINE  293

Query  737   LS------------------------GVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGN  844
             L+                        G+IP  IG L  L EL + + N FS  +P  +G 
Sbjct  294   LTGEIPESFAELKELKLLNLFMNHLRGIIPPFIGELPSLVELKL-FQNNFSSELPESLGM  352

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
               +L+  D A+  +TG +P ++     L+ L L  N L G +  ++G  K+L  + L  N
Sbjct  353   NGRLVTLDVASNRITGTIPRDLCAGGRLEMLVLMDNGLVGPIPEKLGGCKSLTRVRLGKN  412

Query  1025  AFSGEIP  1045
             + +G IP
Sbjct  413   SLNGSIP  419


 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 70/129 (54%), Gaps = 0/129 (0%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            +++G + P +  L  L  L +  N++ G +PPEI  +  L  +NLS N     FP  LA 
Sbjct  460  SITGSIPPAISNLSALERLELNINRMFGEIPPEIGRLKALAMINLSGNELTGEFPIDLAH  519

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             A+L  LDL  N LTG++PV++  +  L  L L  N F G IPPE  + P+L  L +S N
Sbjct  520  CASLVSLDLSRNRLTGEIPVQITALPILNTLKLSSNRFWGEIPPEILKMPSLTTLDLSNN  579

Query  734  GLSGVIPSE  760
                ++ SE
Sbjct  580  CRPNLLSSE  588


 Score = 68.2 bits (165),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 70/139 (50%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            NLSG L P V     L  L ++ N ++G +PP IS +S L  L L+ N      P ++ +
Sbjct  437  NLSGEL-PTVIAGDKLRLLILSNNSITGSIPPAISNLSALERLELNINRMFGEIPPEIGR  495

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L  L +++L  N LTG+ P+++    SL  L L  N  +G IP +    P L  L +S N
Sbjct  496  LKALAMINLSGNELTGEFPIDLAHCASLVSLDLSRNRLTGEIPVQITALPILNTLKLSSN  555

Query  734  GLSGVIPSEIGNLTKLKEL  790
               G IP EI  +  L  L
Sbjct  556  RFWGEIPPEILKMPSLTTL  574



>ref|XP_002304615.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE79594.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=988

 Score =   237 bits (604),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 135/281 (48%), Positives = 178/281 (63%), Gaps = 4/281 (1%)
 Frame = +2

Query  221   EQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lNLSGVL  391
             + + L+S++ +F +    S  SWN+S     C+W  + CD     V        N+SG L
Sbjct  36    QASILVSVRQSFES-YDPSFDSWNVSNYPLLCSWTGIQCDDKNRSVVAIDISNSNISGTL  94

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  571
             SP + +L  LVNLS+  N  S   P EI  +  L+FLN+SNN+F      + +QL  LQV
Sbjct  95    SPAITELRSLVNLSLQGNSFSDGFPREIHRLIRLQFLNISNNLFSGQLDWEFSQLKELQV  154

Query  572   LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  751
             LD YNNNL G LP+ V ++  L+HL  GGNYF G IPP YG    L YL++ GN L G+I
Sbjct  155   LDGYNNNLNGTLPLGVTQLAKLKHLDFGGNYFQGTIPPSYGSMQQLNYLSLKGNDLRGLI  214

Query  752   PSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLD  931
             P E+GNLT L++LY+GY+N F GGIPPE G L  L+  D ANC L G +P E+G L  LD
Sbjct  215   PRELGNLTNLEQLYLGYYNEFDGGIPPEFGKLINLVHLDLANCSLRGLIPPELGNLNKLD  274

Query  932   TLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             TLFLQ N+L+G + PE+G L ++KSLDLSNNA +G+IP  F
Sbjct  275   TLFLQTNELTGPIPPELGNLSSIKSLDLSNNALTGDIPLEF  315


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 87/272 (32%), Positives = 131/272 (48%), Gaps = 50/272 (18%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G + P++G L  + +L ++ N L+G +P E S +  L  LNL  N      PH +A+L
Sbjct  283   LTGPIPPELGNLSSIKSLDLSNNALTGDIPLEFSGLHRLTLLNLFLNKLHGQIPHFIAEL  342

Query  557   ANLQVLDLYNNNLTGDLPVEV-------------YKMT----------------------  631
               L+VL L++NN TG +P ++              K+T                      
Sbjct  343   PELEVLKLWHNNFTGVIPAKLGENGRLIELDLSSNKLTGLVPKSLCLGKKLQILILRINF  402

Query  632   -------------SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNL  772
                          SLR + LG NY +G IP  +   P L  + +  N LS  +P + G +
Sbjct  403   LFGPLPDDLGHCDSLRRVRLGQNYLTGSIPSGFLYLPELSLMELQNNYLSEQVPQQTGKI  462

Query  773   -TKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQV  949
              +KL+++ +   N  SG +P  +GN S L     +    TGE+P +IG+LKN+ TL +  
Sbjct  463   PSKLEQMNLAD-NHLSGPLPASIGNFSDLQMLLLSGNRFTGEIPPQIGQLKNVLTLDMSR  521

Query  950   NDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             N+LSG++  EIG    L  LDLS N  SG IP
Sbjct  522   NNLSGNIPSEIGDCPTLTYLDLSQNQLSGPIP  553


 Score =   105 bits (262),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 83/250 (33%), Positives = 125/250 (50%), Gaps = 26/250 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             N +GV+   +G+   L+ L +++N+L+G VP  +     L+ L L  N      P  L  
Sbjct  354   NFTGVIPAKLGENGRLIELDLSSNKLTGLVPKSLCLGKKLQILILRINFLFGPLPDDLGH  413

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPN-LEYLAVSG  730
               +L+ + L  N LTG +P     +  L  + L  NY S ++P + G+ P+ LE + ++ 
Sbjct  414   CDSLRRVRLGQNYLTGSIPSGFLYLPELSLMELQNNYLSEQVPQQTGKIPSKLEQMNLAD  473

Query  731   NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
             N LSG +P+ IGN + L+ L +   N F+G IPP++G L  ++  D +   L+G +P EI
Sbjct  474   NHLSGPLPASIGNFSDLQMLLLSG-NRFTGEIPPQIGQLKNVLTLDMSRNNLSGNIPSEI  532

Query  911   GKLKNLDTLFLQVNDLSG------------------------SLAPEIGYlknlksldls  1018
             G    L  L L  N LSG                        SL  EIG +K+L S D S
Sbjct  533   GDCPTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWNHLNQSLPKEIGSMKSLTSADFS  592

Query  1019  nnAFSGEIPE  1048
             +N FSG IPE
Sbjct  593   HNNFSGSIPE  602


 Score =   101 bits (251),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 105/204 (51%), Gaps = 3/204 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G L  D+G    L  + +  N L+G +P     +  L  + L NN      P Q  ++
Sbjct  403  LFGPLPDDLGHCDSLRRVRLGQNYLTGSIPSGFLYLPELSLMELQNNYLSEQVPQQTGKI  462

Query  557  -ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             + L+ ++L +N+L+G LP  +   + L+ L L GN F+G IPP+ G+  N+  L +S N
Sbjct  463  PSKLEQMNLADNHLSGPLPASIGNFSDLQMLLLSGNRFTGEIPPQIGQLKNVLTLDMSRN  522

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
             LSG IPSEIG+   L  L +   N  SG IP  +  +  L   + +   L   LP EIG
Sbjct  523  NLSGNIPSEIGDCPTLTYLDLSQ-NQLSGPIPVHITQIHILNYLNISWNHLNQSLPKEIG  581

Query  914  KLKNLDTLFLQVNDLSGSLAPEIG  985
             +K+L +     N+ SGS+ PE G
Sbjct  582  SMKSLTSADFSHNNFSGSI-PEFG  604


 Score = 95.5 bits (236),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 117/250 (47%), Gaps = 24/250 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
               G + P  G +  L  LS+  N L G +P E+  ++ L  L L   N F    P +  +
Sbjct  186   FQGTIPPSYGSMQQLNYLSLKGNDLRGLIPRELGNLTNLEQLYLGYYNEFDGGIPPEFGK  245

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL  LDL N +L G +P E+  +  L  L L  N  +G IPPE G   +++ L +S N
Sbjct  246   LINLVHLDLANCSLRGLIPPELGNLNKLDTLFLQTNELTGPIPPELGNLSSIKSLDLSNN  305

Query  734   GLSGVIPSEIGNLTKLK-----------------------ELYIGYFNGFSGGIPPEMGN  844
              L+G IP E   L +L                        E+   + N F+G IP ++G 
Sbjct  306   ALTGDIPLEFSGLHRLTLLNLFLNKLHGQIPHFIAELPELEVLKLWHNNFTGVIPAKLGE  365

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
               +LI  D ++  LTG +P  +   K L  L L++N L G L  ++G+  +L+ + L  N
Sbjct  366   NGRLIELDLSSNKLTGLVPKSLCLGKKLQILILRINFLFGPLPDDLGHCDSLRRVRLGQN  425

Query  1025  AFSGEIPESF  1054
               +G IP  F
Sbjct  426   YLTGSIPSGF  435


 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 85/159 (53%), Gaps = 3/159 (2%)
 Frame = +2

Query  377  LSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            LS  +    G++P  L  +++A N LSGP+P  I   S L+ L LS N F    P Q+ Q
Sbjct  451  LSEQVPQQTGKIPSKLEQMNLADNHLSGPLPASIGNFSDLQMLLLSGNRFTGEIPPQIGQ  510

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L N+  LD+  NNL+G++P E+    +L +L L  N  SG IP    +   L YL +S N
Sbjct  511  LKNVLTLDMSRNNLSGNIPSEIGDCPTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWN  570

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLS  850
             L+  +P EIG++  L      + N FSG I PE G  S
Sbjct  571  HLNQSLPKEIGSMKSLTSADFSH-NNFSGSI-PEFGQYS  607



>ref|XP_011022287.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Populus euphratica]
Length=988

 Score =   236 bits (603),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 134/281 (48%), Positives = 179/281 (64%), Gaps = 4/281 (1%)
 Frame = +2

Query  221   EQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lNLSGVL  391
             + + L+S++ +F +    S  SWN++     C+W  + CD     V        N+SG L
Sbjct  36    QASILVSVRQSFES-YDPSFDSWNVANYSLLCSWTGIQCDDKNRSVVAIDISNSNISGTL  94

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  571
             SP + +L  LVNLS+  N  S   P EI  +  L+FLN+SNN+F      + +QL  LQV
Sbjct  95    SPAITELRSLVNLSLQGNSFSDRFPREIHRLIRLQFLNISNNLFSGQLNWEFSQLKELQV  154

Query  572   LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  751
             LD YNNNL G LP+ V ++  L+HL  GGNYF G IPP YG    L YL++ GN L G+I
Sbjct  155   LDGYNNNLNGTLPLGVTQLAKLKHLDFGGNYFQGTIPPSYGSMQQLNYLSLKGNDLRGLI  214

Query  752   PSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLD  931
             P E+GNLT L++LY+GY+N F GGIPPE G L  L+  D ANC L+G +P E+G L  LD
Sbjct  215   PGELGNLTNLEQLYLGYYNEFDGGIPPEFGKLINLVHLDLANCSLSGLIPPELGNLNKLD  274

Query  932   TLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             TLFLQ N+L+G + PE+G L ++KSLDLSNNA +G+IP  F
Sbjct  275   TLFLQTNELTGPIPPELGNLSSIKSLDLSNNALTGDIPLEF  315


 Score =   103 bits (258),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 83/250 (33%), Positives = 124/250 (50%), Gaps = 26/250 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             N +GV+   +G+   L+ L +++N+L+G VP  +     L+ L L  N      P  L  
Sbjct  354   NFTGVIPAKLGENGRLIELDLSSNKLTGLVPKSLCLGKKLQILILRINFLFGPLPDDLGH  413

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPN-LEYLAVSG  730
               +L  + L  N LTG +P     +  L  + L  NY S ++P + G+ P+ LE + ++ 
Sbjct  414   CDSLWRVRLGQNYLTGSIPSGFLYLPELSLMELQNNYLSEQVPQQTGKIPSKLEQMNLAD  473

Query  731   NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
             N LSG +P+ IGN + L+ L +   N F+G IPP++G L  ++  D +   L+G +P EI
Sbjct  474   NHLSGPLPASIGNFSNLQMLLLSG-NRFTGEIPPQIGQLKNVLTLDMSRNNLSGNIPSEI  532

Query  911   GKLKNLDTLFLQVNDLSG------------------------SLAPEIGYlknlksldls  1018
             G    L  L L  N LSG                        SL  EIG +K+L S D S
Sbjct  533   GDCPTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWNHLNQSLPKEIGSMKSLTSADFS  592

Query  1019  nnAFSGEIPE  1048
             +N FSG IPE
Sbjct  593   HNNFSGSIPE  602


 Score =   103 bits (257),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 90/296 (30%), Positives = 137/296 (46%), Gaps = 74/296 (25%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFG----------  526
             LSG++ P++G L  L  L +  N+L+GP+PPE+  +S+++ L+LSNN             
Sbjct  259   LSGLIPPELGNLNKLDTLFLQTNELTGPIPPELGNLSSIKSLDLSNNALTGDIPLEFSGL  318

Query  527   --------------STFPHQLAQLANLQVLDLYNNNLTGDLPVEV-------------YK  625
                              PH +A+L  L+VL L++NN TG +P ++              K
Sbjct  319   HRLTLLNLFLNKLHGQIPHFIAELPELEVLKLWHNNFTGVIPAKLGENGRLIELDLSSNK  378

Query  626   MT-----------------------------------SLRHLHLGGNYFSGRIPPEYGRF  700
             +T                                   SL  + LG NY +G IP  +   
Sbjct  379   LTGLVPKSLCLGKKLQILILRINFLFGPLPDDLGHCDSLWRVRLGQNYLTGSIPSGFLYL  438

Query  701   PNLEYLAVSGNGLSGVIPSEIGNL-TKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAAN  877
             P L  + +  N LS  +P + G + +KL+++ +   N  SG +P  +GN S L     + 
Sbjct  439   PELSLMELQNNYLSEQVPQQTGKIPSKLEQMNLAD-NHLSGPLPASIGNFSNLQMLLLSG  497

Query  878   CGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
                TGE+P +IG+LKN+ TL +  N+LSG++  EIG    L  LDLS N  SG IP
Sbjct  498   NRFTGEIPPQIGQLKNVLTLDMSRNNLSGNIPSEIGDCPTLTYLDLSQNQLSGPIP  553


 Score =   101 bits (251),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 106/204 (52%), Gaps = 3/204 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G L  D+G    L  + +  N L+G +P     +  L  + L NN      P Q  ++
Sbjct  403  LFGPLPDDLGHCDSLWRVRLGQNYLTGSIPSGFLYLPELSLMELQNNYLSEQVPQQTGKI  462

Query  557  -ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             + L+ ++L +N+L+G LP  +   ++L+ L L GN F+G IPP+ G+  N+  L +S N
Sbjct  463  PSKLEQMNLADNHLSGPLPASIGNFSNLQMLLLSGNRFTGEIPPQIGQLKNVLTLDMSRN  522

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
             LSG IPSEIG+   L  L +   N  SG IP  +  +  L   + +   L   LP EIG
Sbjct  523  NLSGNIPSEIGDCPTLTYLDLSQ-NQLSGPIPVHITQIHILNYLNISWNHLNQSLPKEIG  581

Query  914  KLKNLDTLFLQVNDLSGSLAPEIG  985
             +K+L +     N+ SGS+ PE G
Sbjct  582  SMKSLTSADFSHNNFSGSI-PEFG  604


 Score = 95.5 bits (236),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 117/250 (47%), Gaps = 24/250 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
               G + P  G +  L  LS+  N L G +P E+  ++ L  L L   N F    P +  +
Sbjct  186   FQGTIPPSYGSMQQLNYLSLKGNDLRGLIPGELGNLTNLEQLYLGYYNEFDGGIPPEFGK  245

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL  LDL N +L+G +P E+  +  L  L L  N  +G IPPE G   +++ L +S N
Sbjct  246   LINLVHLDLANCSLSGLIPPELGNLNKLDTLFLQTNELTGPIPPELGNLSSIKSLDLSNN  305

Query  734   GLSGVIPSEIGNLTKLK-----------------------ELYIGYFNGFSGGIPPEMGN  844
              L+G IP E   L +L                        E+   + N F+G IP ++G 
Sbjct  306   ALTGDIPLEFSGLHRLTLLNLFLNKLHGQIPHFIAELPELEVLKLWHNNFTGVIPAKLGE  365

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
               +LI  D ++  LTG +P  +   K L  L L++N L G L  ++G+  +L  + L  N
Sbjct  366   NGRLIELDLSSNKLTGLVPKSLCLGKKLQILILRINFLFGPLPDDLGHCDSLWRVRLGQN  425

Query  1025  AFSGEIPESF  1054
               +G IP  F
Sbjct  426   YLTGSIPSGF  435


 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 85/159 (53%), Gaps = 3/159 (2%)
 Frame = +2

Query  377  LSGVLSPDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            LS  +    G++P  L  +++A N LSGP+P  I   S L+ L LS N F    P Q+ Q
Sbjct  451  LSEQVPQQTGKIPSKLEQMNLADNHLSGPLPASIGNFSNLQMLLLSGNRFTGEIPPQIGQ  510

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L N+  LD+  NNL+G++P E+    +L +L L  N  SG IP    +   L YL +S N
Sbjct  511  LKNVLTLDMSRNNLSGNIPSEIGDCPTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWN  570

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLS  850
             L+  +P EIG++  L      + N FSG I PE G  S
Sbjct  571  HLNQSLPKEIGSMKSLTSADFSH-NNFSGSI-PEFGQYS  607



>ref|XP_008364929.1| PREDICTED: receptor protein kinase CLAVATA1-like [Malus domestica]
Length=973

 Score =   236 bits (603),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 136/275 (49%), Positives = 185/275 (67%), Gaps = 1/275 (0%)
 Frame = +2

Query  233   LLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQL  412
             LL +KAA     +S L  WN S+SHC++  V CD    VVSL++S L L G ++ ++G L
Sbjct  33    LLKLKAAMIGXKRSGLEDWNPSSSHCSFSGVLCDRDSRVVSLNVSNLPLYGTIAAEIGLL  92

Query  413   PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQVLDLYNN  589
               LVNL+IA N  +G +P E++ ++ L+ LN+S N+F  +FP ++   +  L+VLD YNN
Sbjct  93    DKLVNLTIAGNNFTGRLPAEMANLTALKHLNISGNLFHGSFPIEIVVGMTELEVLDAYNN  152

Query  590   NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN  769
             N TG LPVE+  + +L+HL LGGN+ +G IP  Y    +LEYL V+GN LSG +P+ +  
Sbjct  153   NFTGTLPVELVSLKNLKHLQLGGNFITGEIPENYSEIQSLEYLGVNGNMLSGRVPASLSR  212

Query  770   LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQV  949
             L  L+ELY+GY+N +SGGIPPE+G+LS L   D  +C L G +P  +  LK+L TLFLQV
Sbjct  213   LKNLRELYVGYYNSYSGGIPPELGSLSSLQILDMGSCNLVGPIPTTLSLLKHLHTLFLQV  272

Query  950   NDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             N LSGS+ PE+  L  L SLDLS N  SGEIPESF
Sbjct  273   NRLSGSIPPELSALNRLMSLDLSINELSGEIPESF  307


 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 116/224 (52%), Gaps = 2/224 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             +L+G++  D+     L    +  N   GP+P E+   ++L  + +  N    T P  +  
Sbjct  370   HLTGLIPRDLCTGGNLKTAILMENHFFGPIPEELGRCNSLTKIRMMKNSLSGTIPAGIFS  429

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL +++L +N L+G+LP E     ++  L L GN+ SG+IPP  G   +L+ L +  N
Sbjct  430   LPNLIMIELNDNFLSGELP-EQMSGGNIGILTLSGNHLSGKIPPAXGNLKSLQTLXLEMN  488

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
             G SG IPSEI +L  L  + I   N     IP  +   S L   D +   L GE+P  I 
Sbjct  489   GFSGEIPSEIFDLKLLSRINISA-NNJGRKIPDSISRCSSLTSADLSQNNLVGEIPKGIA  547

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             KLK L  L    N L+G +  EI Y+ +L +LDLS+N F G IP
Sbjct  548   KLKVLSILNFSRNQLTGEIPAEIRYMTSLTTLDLSDNNFVGRIP  591


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 104/203 (51%), Gaps = 1/203 (0%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            NL G +   +  L  L  L +  N+LSG +PPE+SA++ L  L+LS N      P   ++
Sbjct  250  NLVGPIPTTLSLLKHLHTLFLQVNRLSGSIPPELSALNRLMSLDLSINELSGEIPESFSE  309

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L N+ +++LY NNL G +P  +     L  L +  N F+  +P   GR   L+ L V+GN
Sbjct  310  LKNITLINLYRNNLYGPIPKFIGDFPHLEVLQIWENNFTFELPENLGRNGRLKELDVTGN  369

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
             L+G+IP ++     LK   I   N F G IP E+G  + L +       L+G +P  I 
Sbjct  370  HLTGLIPRDLCTGGNLKT-AILMENHFFGPIPEELGRCNSLTKIRMMKNSLSGTIPAGIF  428

Query  914  KLKNLDTLFLQVNDLSGSLAPEI  982
             L NL  + L  N LSG L  ++
Sbjct  429  SLPNLIMIELNDNFLSGELPEQM  451


 Score = 85.9 bits (211),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 117/228 (51%), Gaps = 7/228 (3%)
 Frame = +2

Query  380   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  559
             SG + P++G L  L  L + +  L GP+P  +S +  L  L L  N    + P +L+ L 
Sbjct  228   SGGIPPELGSLSSLQILDMGSCNLVGPIPTTLSLLKHLHTLFLQVNRLSGSIPPELSALN  287

Query  560   NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  739
              L  LDL  N L+G++P    ++ ++  ++L  N   G IP   G FP+LE L +  N  
Sbjct  288   RLMSLDLSINELSGEIPESFSELKNITLINLYRNNLYGPIPKFIGDFPHLEVLQIWENNF  347

Query  740   SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM---GNLSQLIRFDAANCGLTGELPVEI  910
             +  +P  +G   +LKEL +   N  +G IP ++   GNL   I  +       G +P E+
Sbjct  348   TFELPENLGRNGRLKELDV-TGNHLTGLIPRDLCTGGNLKTAILMENH---FFGPIPEEL  403

Query  911   GKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             G+  +L  + +  N LSG++   I  L NL  ++L++N  SGE+PE  
Sbjct  404   GRCNSLTKIRMMKNSLSGTIPAGIFSLPNLIMIELNDNFLSGELPEQM  451


 Score = 83.6 bits (205),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 78/248 (31%), Positives = 114/248 (46%), Gaps = 26/248 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
             ++G +  +  ++  L  L +  N LSG VP  +S +  LR L +   N +    P +L  
Sbjct  178   ITGEIPENYSEIQSLEYLGVNGNMLSGRVPASLSRLKNLRELYVGYYNSYSGGIPPELGS  237

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L++LQ+LD+ + NL G +P  +  +  L  L L  N  SG IPPE      L  L +S N
Sbjct  238   LSSLQILDMGSCNLVGPIPTTLSLLKHLHTLFLQVNRLSGSIPPELSALNRLMSLDLSIN  297

Query  734   GLSGVIP---SEIGNLTKLKELY-----------IGYF----------NGFSGGIPPEMG  841
              LSG IP   SE+ N+T L  LY           IG F          N F+  +P  +G
Sbjct  298   ELSGEIPESFSELKNIT-LINLYRNNLYGPIPKFIGDFPHLEVLQIWENNFTFELPENLG  356

Query  842   NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn  1021
                +L   D     LTG +P ++    NL T  L  N   G +  E+G   +L  + +  
Sbjct  357   RNGRLKELDVTGNHLTGLIPRDLCTGGNLKTAILMENHFFGPIPEELGRCNSLTKIRMMK  416

Query  1022  nAFSGEIP  1045
             N+ SG IP
Sbjct  417   NSLSGTIP  424


 Score = 71.2 bits (173),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 64/128 (50%), Gaps = 0/128 (0%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            +LSG + P  G L  L  L +  N  SG +P EI  +  L  +N+S N  G   P  +++
Sbjct  465  HLSGKIPPAXGNLKSLQTLXLEMNGFSGEIPSEIFDLKLLSRINISANNJGRKIPDSISR  524

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             ++L   DL  NNL G++P  + K+  L  L+   N  +G IP E     +L  L +S N
Sbjct  525  CSSLTSADLSQNNLVGEIPKGIAKLKVLSILNFSRNQLTGEIPAEIRYMTSLTTLDLSDN  584

Query  734  GLSGVIPS  757
               G IP+
Sbjct  585  NFVGRIPT  592



>ref|XP_004960969.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Setaria italica]
Length=1031

 Score =   236 bits (602),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 143/283 (51%), Positives = 192/283 (68%), Gaps = 6/283 (2%)
 Frame = +2

Query  215   VTEQAALLSIKAAFTADSQSSLTSWNI--STSHCT-WRRVTCds--llhvvsldlsglNL  379
              ++ A LLSIKAAF      +L +W +  + S C+ W  V C       VVSLD+SG NL
Sbjct  41    ASQAATLLSIKAAFAPPLPPTLRAWTLANTASLCSSWPGVACGGPGGRTVVSLDVSGFNL  100

Query  380   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIF-GSTFPHQLAQL  556
             SG LSP VG L  L  LS AAN LSG +PP ++++  LR LNLSNN F G+      + +
Sbjct  101   SGALSPAVGGLAGLRFLSAAANSLSGALPPAVASLRGLRHLNLSNNQFNGTLVGIDFSAM  160

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L+V +LY+N+L G LP  +  + SLRHL LGGN+FSG IPP +GRFP +E+L+++GN 
Sbjct  161   RGLEVFNLYDNDLAGPLPAGLSALPSLRHLDLGGNFFSGTIPPAFGRFPAIEFLSLAGNS  220

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             L+G IP ++GNLT ++ LY+GYFN F GGIPPE+G+L+ L+  D A+CGL G +P  +G 
Sbjct  221   LTGAIPPDLGNLTTIRHLYLGYFNRFDGGIPPELGSLASLVHLDLASCGLQGPIPASLGG  280

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
             L  LDTL+LQ N L+G+L P +G L  L+ LD+SNNA +GEIP
Sbjct  281   LTRLDTLYLQTNQLNGTLPPSLGNLTGLRFLDVSNNALTGEIP  323


 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 102/199 (51%), Gaps = 2/199 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
             SG + P  G+ P +  LS+A N L+G +PP++  ++T+R L L   N F    P +L  
Sbjct  197  FSGTIPPAFGRFPAIEFLSLAGNSLTGAIPPDLGNLTTIRHLYLGYFNRFDGGIPPELGS  256

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            LA+L  LDL +  L G +P  +  +T L  L+L  N  +G +PP  G    L +L VS N
Sbjct  257  LASLVHLDLASCGLQGPIPASLGGLTRLDTLYLQTNQLNGTLPPSLGNLTGLRFLDVSNN  316

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
             L+G IP E+  L  L+ L + + N F GG+P  +  L  L          TG +P  +G
Sbjct  317  ALTGEIPPELAALRGLRLLNM-FINRFRGGVPEFLAGLESLEVLKLWQNNFTGAIPAALG  375

Query  914  KLKNLDTLFLQVNDLSGSL  970
            +   L  + L  N L+G +
Sbjct  376  RAAPLREVDLSTNRLTGEV  394


 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 77/229 (34%), Positives = 117/229 (51%), Gaps = 3/229 (1%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             N +G +   +G+   L  + ++ N+L+G VP  + A   L  L L +N      P +L  
Sbjct  365   NFTGAIPAALGRAAPLREVDLSTNRLTGEVPRWLCARGRLEILILLDNFLFGPVPERLGA  424

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPE--YGRFPNLEYLAVS  727
                L  + L  N LTG LP     + +L  + L GNY +G    E   G    L  L +S
Sbjct  425   CPTLTRVRLGQNYLTGPLPRGFLYLPALTTVELQGNYLTGPALEEDDAGVPARLSLLNLS  484

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
             GN L+G +P+ IGN + L+ L +G  N   G IP ++G L +L++ D +   LTGE+P E
Sbjct  485   GNRLNGSLPASIGNFSALQTLLLGG-NQLRGEIPRQVGRLRRLLKLDLSGNNLTGEVPGE  543

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             +G   +L  L L  N LSG++   +  ++ L  L++S NA SG IP   
Sbjct  544   VGDCASLTYLDLSGNRLSGAIPGRLARIRILNYLNVSWNALSGGIPREL  592


 Score = 83.2 bits (204),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 79/250 (32%), Positives = 116/250 (46%), Gaps = 27/250 (11%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
              L+G L P +G L  L  L ++ N L+G +PPE++A+  LR LN+  N F    P  LA 
Sbjct  293   QLNGTLPPSLGNLTGLRFLDVSNNALTGEIPPELAALRGLRLLNMFINRFRGGVPEFLAG  352

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L +L+VL L+ NN TG +P  + +   LR + L  N  +G +P        LE L +  N
Sbjct  353   LESLEVLKLWQNNFTGAIPAALGRAAPLREVDLSTNRLTGEVPRWLCARGRLEILILLDN  412

Query  734   GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIP--------------------------PE  835
              L G +P  +G    L  + +G  N  +G +P                           +
Sbjct  413   FLFGPVPERLGACPTLTRVRLGQ-NYLTGPLPRGFLYLPALTTVELQGNYLTGPALEEDD  471

Query  836   MGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldl  1015
              G  ++L   + +   L G LP  IG    L TL L  N L G +  ++G L+ L  LDL
Sbjct  472   AGVPARLSLLNLSGNRLNGSLPASIGNFSALQTLLLGGNQLRGEIPRQVGRLRRLLKLDL  531

Query  1016  snnAFSGEIP  1045
             S N  +GE+P
Sbjct  532   SGNNLTGEVP  541


 Score = 83.2 bits (204),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 69/221 (31%), Positives = 97/221 (44%), Gaps = 25/221 (11%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
               G + P++G L  LV+L +A+  L GP+P  +  ++ L  L L  N    T P  L  
Sbjct  245  RFDGGIPPELGSLASLVHLDLASCGLQGPIPASLGGLTRLDTLYLQTNQLNGTLPPSLGN  304

Query  554  LANLQVLDLYNNNLTGDLPVE------------------------VYKMTSLRHLHLGGN  661
            L  L+ LD+ NN LTG++P E                        +  + SL  L L  N
Sbjct  305  LTGLRFLDVSNNALTGEIPPELAALRGLRLLNMFINRFRGGVPEFLAGLESLEVLKLWQN  364

Query  662  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
             F+G IP   GR   L  + +S N L+G +P  +    +L E+ I   N   G +P  +G
Sbjct  365  NFTGAIPAALGRAAPLREVDLSTNRLTGEVPRWLCARGRL-EILILLDNFLFGPVPERLG  423

Query  842  NLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSG  964
                L R       LTG LP     L  L T+ LQ N L+G
Sbjct  424  ACPTLTRVRLGQNYLTGPLPRGFLYLPALTTVELQGNYLTG  464


 Score = 76.6 bits (187),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 74/144 (51%), Gaps = 1/144 (1%)
 Frame = +2

Query  398  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  577
            D G    L  L+++ N+L+G +P  I   S L+ L L  N      P Q+ +L  L  LD
Sbjct  471  DAGVPARLSLLNLSGNRLNGSLPASIGNFSALQTLLLGGNQLRGEIPRQVGRLRRLLKLD  530

Query  578  LYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPS  757
            L  NNLTG++P EV    SL +L L GN  SG IP    R   L YL VS N LSG IP 
Sbjct  531  LSGNNLTGEVPGEVGDCASLTYLDLSGNRLSGAIPGRLARIRILNYLNVSWNALSGGIPR  590

Query  758  EIGNLTKLKELYIGYFNGFSGGIP  829
            E+G +  L      + N  SG +P
Sbjct  591  ELGAMKSLTAADFSH-NDLSGRVP  613


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            NL+G +  +VG    L  L ++ N+LSG +P  ++ I  L +LN+S N      P +L  
Sbjct  535  NLTGEVPGEVGDCASLTYLDLSGNRLSGAIPGRLARIRILNYLNVSWNALSGGIPRELGA  594

Query  554  LANLQVLDLYNNNLTGDLP  610
            + +L   D  +N+L+G +P
Sbjct  595  MKSLTAADFSHNDLSGRVP  613



>ref|XP_002297907.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE82712.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=988

 Score =   235 bits (600),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 133/281 (47%), Positives = 178/281 (63%), Gaps = 4/281 (1%)
 Frame = +2

Query  221   EQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lNLSGVL  391
             + + L+S+K +  +    SL SWN+      C+W  + CD +   V        N+SG L
Sbjct  36    QASILVSLKQSLES-YDPSLDSWNVPNYQLLCSWTGIQCDDMNRSVVALDISNSNISGTL  94

Query  392   SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  571
             SP + +L  LVNLSI  N  S   P EI  +  L+FLN+SNN+F      + +QL  LQV
Sbjct  95    SPAITELRSLVNLSIQGNSFSDEFPREIHKLIRLQFLNISNNLFSGELAWEFSQLKELQV  154

Query  572   LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  751
             LD+YNNN  G LP+ V ++  L++L  GGNYF G IPP YG    L YL++ GN L G+I
Sbjct  155   LDVYNNNFNGTLPLGVTQLAKLKYLDFGGNYFQGTIPPSYGSMQQLNYLSLKGNDLRGLI  214

Query  752   PSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLD  931
             P E+GNLT L++LY+GY+N F GGIPPE G L  L+  D ANC L+G +P E+G L  LD
Sbjct  215   PGELGNLTSLEQLYLGYYNEFDGGIPPEFGKLINLVHIDLANCSLSGPIPPELGGLSKLD  274

Query  932   TLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             TLFLQ N+L+G + PE+G L ++ SLDLSNNA +G+IP  F
Sbjct  275   TLFLQTNELTGPIPPELGNLSSIISLDLSNNALTGDIPLEF  315


 Score =   101 bits (252),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 82/250 (33%), Positives = 120/250 (48%), Gaps = 26/250 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             N +G +   +G+   L  L +++N+L+G VP  +     L+ L L  N      P  L  
Sbjct  354   NFTGAIPAKLGENGRLTELDLSSNKLTGLVPKSLCLGRKLQILILRINFLFGPLPDDLGH  413

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPE---------------  688
                L  + L  N LTG +P     +  L  + L  NY SG++P +               
Sbjct  414   CDTLWRVRLGQNYLTGSIPSGFLYLPELSLMELQNNYLSGQVPQQISKTPSKLAQMNLAD  473

Query  689   ----------YGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  838
                        G F NL+ L +SGN  +G IPS+IG L  +  L +   N  SG IPPE+
Sbjct  474   NRLSGPLPASIGNFSNLQILLLSGNRFTGEIPSQIGQLNNVFTLDMSR-NNLSGNIPPEI  532

Query  839   GNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldls  1018
             G+   L   D +   L+G +PV+I ++  L+ L +  N L+ SL  EIG +K+L S D S
Sbjct  533   GDCRTLTYLDLSQNQLSGPIPVQITQIHILNYLNISWNHLNQSLPKEIGSMKSLTSADFS  592

Query  1019  nnAFSGEIPE  1048
             +N FSG IPE
Sbjct  593   HNNFSGSIPE  602


 Score = 98.6 bits (244),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 106/202 (52%), Gaps = 1/202 (0%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            LSG + P++G L  L  L +  N+L+GP+PPE+  +S++  L+LSNN      P +   L
Sbjct  259  LSGPIPPELGGLSKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNNALTGDIPLEFYGL  318

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              L +L+L+ N L G++P  + ++  L  L L  N F+G IP + G    L  L +S N 
Sbjct  319  RRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHNNFTGAIPAKLGENGRLTELDLSSNK  378

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G++P  +    KL ++ I   N   G +P ++G+   L R       LTG +P     
Sbjct  379  LTGLVPKSLCLGRKL-QILILRINFLFGPLPDDLGHCDTLWRVRLGQNYLTGSIPSGFLY  437

Query  917  LKNLDTLFLQVNDLSGSLAPEI  982
            L  L  + LQ N LSG +  +I
Sbjct  438  LPELSLMELQNNYLSGQVPQQI  459


 Score = 92.8 bits (229),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 87/159 (55%), Gaps = 3/159 (2%)
 Frame = +2

Query  377  LSGVLSPDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            LSG +   + + P  L  +++A N+LSGP+P  I   S L+ L LS N F    P Q+ Q
Sbjct  451  LSGQVPQQISKTPSKLAQMNLADNRLSGPLPASIGNFSNLQILLLSGNRFTGEIPSQIGQ  510

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L N+  LD+  NNL+G++P E+    +L +L L  N  SG IP +  +   L YL +S N
Sbjct  511  LNNVFTLDMSRNNLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVQITQIHILNYLNISWN  570

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLS  850
             L+  +P EIG++  L      + N FSG I PE G  S
Sbjct  571  HLNQSLPKEIGSMKSLTSADFSH-NNFSGSI-PEFGQYS  607


 Score = 92.4 bits (228),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 117/250 (47%), Gaps = 24/250 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
               G + P  G +  L  LS+  N L G +P E+  +++L  L L   N F    P +  +
Sbjct  186   FQGTIPPSYGSMQQLNYLSLKGNDLRGLIPGELGNLTSLEQLYLGYYNEFDGGIPPEFGK  245

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL  +DL N +L+G +P E+  ++ L  L L  N  +G IPPE G   ++  L +S N
Sbjct  246   LINLVHIDLANCSLSGPIPPELGGLSKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNN  305

Query  734   GLSGVIPSEIGNLTKLKEL---------YIGYF--------------NGFSGGIPPEMGN  844
              L+G IP E   L +L  L          I YF              N F+G IP ++G 
Sbjct  306   ALTGDIPLEFYGLRRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHNNFTGAIPAKLGE  365

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
               +L   D ++  LTG +P  +   + L  L L++N L G L  ++G+   L  + L  N
Sbjct  366   NGRLTELDLSSNKLTGLVPKSLCLGRKLQILILRINFLFGPLPDDLGHCDTLWRVRLGQN  425

Query  1025  AFSGEIPESF  1054
               +G IP  F
Sbjct  426   YLTGSIPSGF  435



>ref|XP_001754727.1| CLL1A clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ80697.1| CLL1A clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
Length=1017

 Score =   235 bits (600),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 123/257 (48%), Positives = 174/257 (68%), Gaps = 3/257 (1%)
 Frame = +2

Query  221  EQAALLSIKAAFTADSQSSLTSWNI--STSHCTWRRVTCdsllhvvsldlsglNLSGVLS  394
            E+ AL+++KA    D +S L  W +  ++S C W  V C++   VV L LSG+NLSG +S
Sbjct  34   ERLALIALKATID-DPESHLADWEVNGTSSPCLWTGVDCNNSSSVVGLYLSGMNLSGTIS  92

Query  395  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  574
             ++G L  LVNLS+  N  +  +P +I  ++ L++LN+S N FG   P   +QL  LQVL
Sbjct  93   SELGNLKNLVNLSLDRNNFTEDLPADIVTLTQLKYLNVSTNSFGGALPSNFSQLQLLQVL  152

Query  575  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  754
            D +NN  +G LP +++K+++L H+ LGGNYF G IPPEYG+FPNL+Y  ++GN L+G IP
Sbjct  153  DCFNNFFSGPLPPDLWKISTLEHVSLGGNYFEGSIPPEYGKFPNLKYFGLNGNSLTGPIP  212

Query  755  SEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDT  934
            +E+GNLT L+ELY+GY+N FS  IP   GNL+ L+R D A+CGL G +P E+G L  LDT
Sbjct  213  AELGNLTGLQELYMGYYNNFSSSIPATFGNLTNLVRLDMASCGLVGAIPHELGNLGQLDT  272

Query  935  LFLQVNDLSGSLAPEIG  985
            LFL +N L G +   +G
Sbjct  273  LFLMLNSLEGPIPASLG  289


 Score = 90.5 bits (223),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 120/247 (49%), Gaps = 23/247 (9%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             +L G +   +G L  L +L ++ N+L+G +P  +  +  L  ++L NN    T P  LA 
Sbjct  279   SLEGPIPASLGNLVNLRSLDLSYNRLTGILPNTLIYLQKLELMSLMNNHLEGTVPDFLAD  338

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL+VL L+ N LTG +P  + +  +L  L L  N+ +G IPP+      L+++ +  N
Sbjct  339   LPNLEVLYLWKNQLTGPIPENLGQNMNLTLLDLSSNHLNGSIPPDLCAGQKLQWVILLEN  398

Query  734   GLSGVIPSEIGNLTKLKELYIGY-----------------------FNGFSGGIPPEMGN  844
              L+G IP  +G+   L +L +G                         N  +G IP E+ N
Sbjct  399   QLTGSIPESLGHCQSLTKLRLGINSLNGSIPQGLLGLPLLAMVEIQDNQVNGPIPSEIIN  458

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
                L   D +   L+  +P  IG L ++ + F+  N  +G + P+I  + NL  LD+S N
Sbjct  459   APLLSYLDFSKNNLSSSIPESIGNLPSIMSFFISDNHFTGPIPPQICDMPNLNKLDMSGN  518

Query  1025  AFSGEIP  1045
               SG IP
Sbjct  519   NLSGSIP  525


 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/196 (30%), Positives = 96/196 (49%), Gaps = 1/196 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L+G +   +G    L  L +  N L+G +P  +  +  L  + + +N      P ++   
Sbjct  400  LTGSIPESLGHCQSLTKLRLGINSLNGSIPQGLLGLPLLAMVEIQDNQVNGPIPSEIINA  459

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              L  LD   NNL+  +P  +  + S+    +  N+F+G IPP+    PNL  L +SGN 
Sbjct  460  PLLSYLDFSKNNLSSSIPESIGNLPSIMSFFISDNHFTGPIPPQICDMPNLNKLDMSGNN  519

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            LSG IP+E+ N  KL  L + + N  +G IP +M  +  L   + ++  L+G +P ++  
Sbjct  520  LSGSIPAEMSNCKKLGLLDVSH-NSLTGVIPVQMQFIPDLYYLNLSHNELSGAIPSKLAD  578

Query  917  LKNLDTLFLQVNDLSG  964
            L  L       N+LSG
Sbjct  579  LPTLSIFDFSYNNLSG  594


 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 84/159 (53%), Gaps = 1/159 (1%)
 Frame = +2

Query  428  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  607
            + I  NQ++GP+P EI     L +L+ S N   S+ P  +  L ++    + +N+ TG +
Sbjct  441  VEIQDNQVNGPIPSEIINAPLLSYLDFSKNNLSSSIPESIGNLPSIMSFFISDNHFTGPI  500

Query  608  PVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKE  787
            P ++  M +L  L + GN  SG IP E      L  L VS N L+GVIP ++  +  L  
Sbjct  501  PPQICDMPNLNKLDMSGNNLSGSIPAEMSNCKKLGLLDVSHNSLTGVIPVQMQFIPDLYY  560

Query  788  LYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPV  904
            L + + N  SG IP ++ +L  L  FD +   L+G +P+
Sbjct  561  LNLSH-NELSGAIPSKLADLPTLSIFDFSYNNLSGPIPL  598


 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 93/199 (47%), Gaps = 1/199 (1%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            N S  +    G L  LV L +A+  L G +P E+  +  L  L L  N      P  L  
Sbjct  231  NFSSSIPATFGNLTNLVRLDMASCGLVGAIPHELGNLGQLDTLFLMLNSLEGPIPASLGN  290

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            L NL+ LDL  N LTG LP  +  +  L  + L  N+  G +P      PNLE L +  N
Sbjct  291  LVNLRSLDLSYNRLTGILPNTLIYLQKLELMSLMNNHLEGTVPDFLADLPNLEVLYLWKN  350

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
             L+G IP  +G    L  L +   N  +G IPP++    +L         LTG +P  +G
Sbjct  351  QLTGPIPENLGQNMNLTLLDLSS-NHLNGSIPPDLCAGQKLQWVILLENQLTGSIPESLG  409

Query  914  KLKNLDTLFLQVNDLSGSL  970
              ++L  L L +N L+GS+
Sbjct  410  HCQSLTKLRLGINSLNGSI  428


 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/227 (28%), Positives = 106/227 (47%), Gaps = 26/227 (11%)
 Frame = +2

Query  383  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL------NLSNNI---FGS--  529
            G + P+ G+ P L    +  N L+GP+P E+  ++ L+ L      N S++I   FG+  
Sbjct  185  GSIPPEYGKFPNLKYFGLNGNSLTGPIPAELGNLTGLQELYMGYYNNFSSSIPATFGNLT  244

Query  530  --------------TFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYF  667
                            PH+L  L  L  L L  N+L G +P  +  + +LR L L  N  
Sbjct  245  NLVRLDMASCGLVGAIPHELGNLGQLDTLFLMLNSLEGPIPASLGNLVNLRSLDLSYNRL  304

Query  668  SGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNL  847
            +G +P        LE +++  N L G +P  + +L  L+ LY+ + N  +G IP  +G  
Sbjct  305  TGILPNTLIYLQKLELMSLMNNHLEGTVPDFLADLPNLEVLYL-WKNQLTGPIPENLGQN  363

Query  848  SQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGY  988
              L   D ++  L G +P ++   + L  + L  N L+GS+   +G+
Sbjct  364  MNLTLLDLSSNHLNGSIPPDLCAGQKLQWVILLENQLTGSIPESLGH  410


 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 71/127 (56%), Gaps = 0/127 (0%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            NLS  +   +G LP +++  I+ N  +GP+PP+I  +  L  L++S N    + P +++ 
Sbjct  471  NLSSSIPESIGNLPSIMSFFISDNHFTGPIPPQICDMPNLNKLDMSGNNLSGSIPAEMSN  530

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
               L +LD+ +N+LTG +PV++  +  L +L+L  N  SG IP +    P L     S N
Sbjct  531  CKKLGLLDVSHNSLTGVIPVQMQFIPDLYYLNLSHNELSGAIPSKLADLPTLSIFDFSYN  590

Query  734  GLSGVIP  754
             LSG IP
Sbjct  591  NLSGPIP  597



>ref|XP_003530709.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Glycine max]
Length=994

 Score =   235 bits (600),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 140/289 (48%), Positives = 185/289 (64%), Gaps = 7/289 (2%)
 Frame = +2

Query  206   PLGVTEQAALL-SIKAAFTADSQSSLTSWNIST--SHC-TWRRVTCdsllhvvsldlsgl  373
             PL +  QA++L S+K  F   + SSL SW++S   S C TW  + CD   ++  + L   
Sbjct  32    PLSLRRQASILVSMKQDFGV-ANSSLRSWDMSNYMSLCSTWYGIECDHHDNMSVVSLDIS  90

Query  374   NL--SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  547
             NL  SG LSP +  L  LV++S+  N  SG  P +I  +  LRFLN+SNN+F      + 
Sbjct  91    NLNASGSLSPSITGLLSLVSVSLQGNGFSGEFPRDIHKLPMLRFLNMSNNMFSGNLSWKF  150

Query  548   AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  727
             +QL  L+VLD+Y+N   G LP  V  +  ++HL+ GGNYFSG IPP YG    L +L+++
Sbjct  151   SQLKELEVLDVYDNAFNGSLPEGVISLPKIKHLNFGGNYFSGEIPPSYGAMWQLNFLSLA  210

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
             GN L G IPSE+GNLT L  LY+GY+N F GGIPP+ G L+ L+  D ANCGLTG +PVE
Sbjct  211   GNDLRGFIPSELGNLTNLTHLYLGYYNQFDGGIPPQFGKLTNLVHLDIANCGLTGPIPVE  270

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             +G L  LDTLFLQ N LSGS+ P++G L  LK+LDLS N  +G IP  F
Sbjct  271   LGNLYKLDTLFLQTNQLSGSIPPQLGNLTMLKALDLSFNMLTGGIPYEF  319


 Score =   107 bits (268),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 86/252 (34%), Positives = 122/252 (48%), Gaps = 28/252 (11%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             N +G +  ++GQ   L+ L ++ N+L+G VP  +     L+ L L  N    + P  L Q
Sbjct  358   NFTGEIPSNLGQNGRLIELDLSTNKLTGLVPKSLCLGKRLKILILLKNFLFGSLPDDLGQ  417

Query  554   LANLQVLDLYNNNLTGDLPVEVYKM---------------------------TSLRHLHL  652
                LQ + L  N LTG LP E   +                           + L  L+L
Sbjct  418   CYTLQRVRLGQNYLTGPLPHEFLYLPELLLVELQNNYLSGGFPQSITSSNTSSKLAQLNL  477

Query  653   GGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPP  832
               N F G +P     FP+L+ L +SGN  SG IP +IG L  + +L I   N FSG IPP
Sbjct  478   SNNRFLGSLPASIANFPDLQILLLSGNRFSGEIPPDIGRLKSILKLDISA-NNFSGTIPP  536

Query  833   EMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksld  1012
             E+GN   L   D +   L+G +PV+  ++  L+ L +  N L+ SL  E+  +K L S D
Sbjct  537   EIGNCVLLTYLDLSQNQLSGPIPVQFSQIHILNYLNVSWNHLNQSLPKELRAMKGLTSAD  596

Query  1013  lsnnAFSGEIPE  1048
              S+N FSG IPE
Sbjct  597   FSHNNFSGSIPE  608


 Score = 98.2 bits (243),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 85/277 (31%), Positives = 124/277 (45%), Gaps = 52/277 (19%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             LSG + P +G L  L  L ++ N L+G +P E SA+  L  LNL  N      PH +A+L
Sbjct  287   LSGSIPPQLGNLTMLKALDLSFNMLTGGIPYEFSALKELTLLNLFINKLHGEIPHFIAEL  346

Query  557   ANLQVLDLYNNNLTGDLP-------------VEVYKMT----------------------  631
               L+ L L+ NN TG++P             +   K+T                      
Sbjct  347   PRLETLKLWQNNFTGEIPSNLGQNGRLIELDLSTNKLTGLVPKSLCLGKRLKILILLKNF  406

Query  632   -------------SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEI---  763
                          +L+ + LG NY +G +P E+   P L  + +  N LSG  P  I   
Sbjct  407   LFGSLPDDLGQCYTLQRVRLGQNYLTGPLPHEFLYLPELLLVELQNNYLSGGFPQSITSS  466

Query  764   GNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFL  943
                +KL +L +   N F G +P  + N   L     +    +GE+P +IG+LK++  L +
Sbjct  467   NTSSKLAQLNLSN-NRFLGSLPASIANFPDLQILLLSGNRFSGEIPPDIGRLKSILKLDI  525

Query  944   QVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
               N+ SG++ PEIG    L  LDLS N  SG IP  F
Sbjct  526   SANNFSGTIPPEIGNCVLLTYLDLSQNQLSGPIPVQF  562


 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 84/250 (34%), Positives = 115/250 (46%), Gaps = 24/250 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              SG + P  G +  L  LS+A N L G +P E+  ++ L  L L   N F    P Q  +
Sbjct  190   FSGEIPPSYGAMWQLNFLSLAGNDLRGFIPSELGNLTNLTHLYLGYYNQFDGGIPPQFGK  249

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL  LD+ N  LTG +PVE+  +  L  L L  N  SG IPP+ G    L+ L +S N
Sbjct  250   LTNLVHLDIANCGLTGPIPVELGNLYKLDTLFLQTNQLSGSIPPQLGNLTMLKALDLSFN  309

Query  734   GLSGVIPSEIGNLTKLK--ELYIGYFNG---------------------FSGGIPPEMGN  844
              L+G IP E   L +L    L+I   +G                     F+G IP  +G 
Sbjct  310   MLTGGIPYEFSALKELTLLNLFINKLHGEIPHFIAELPRLETLKLWQNNFTGEIPSNLGQ  369

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
               +LI  D +   LTG +P  +   K L  L L  N L GSL  ++G    L+ + L  N
Sbjct  370   NGRLIELDLSTNKLTGLVPKSLCLGKRLKILILLKNFLFGSLPDDLGQCYTLQRVRLGQN  429

Query  1025  AFSGEIPESF  1054
               +G +P  F
Sbjct  430   YLTGPLPHEF  439


 Score = 92.8 bits (229),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 104/202 (51%), Gaps = 1/202 (0%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L+G +  ++G L  L  L +  NQLSG +PP++  ++ L+ L+LS N+     P++ + L
Sbjct  263  LTGPIPVELGNLYKLDTLFLQTNQLSGSIPPQLGNLTMLKALDLSFNMLTGGIPYEFSAL  322

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              L +L+L+ N L G++P  + ++  L  L L  N F+G IP   G+   L  L +S N 
Sbjct  323  KELTLLNLFINKLHGEIPHFIAELPRLETLKLWQNNFTGEIPSNLGQNGRLIELDLSTNK  382

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G++P  +  L K  ++ I   N   G +P ++G    L R       LTG LP E   
Sbjct  383  LTGLVPKSLC-LGKRLKILILLKNFLFGSLPDDLGQCYTLQRVRLGQNYLTGPLPHEFLY  441

Query  917  LKNLDTLFLQVNDLSGSLAPEI  982
            L  L  + LQ N LSG     I
Sbjct  442  LPELLLVELQNNYLSGGFPQSI  463


 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 78/225 (35%), Positives = 107/225 (48%), Gaps = 1/225 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
               G + P  G+L  LV+L IA   L+GP+P E+  +  L  L L  N    + P QL  L
Sbjct  239   FDGGIPPQFGKLTNLVHLDIANCGLTGPIPVELGNLYKLDTLFLQTNQLSGSIPPQLGNL  298

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L+ LDL  N LTG +P E   +  L  L+L  N   G IP      P LE L +  N 
Sbjct  299   TMLKALDLSFNMLTGGIPYEFSALKELTLLNLFINKLHGEIPHFIAELPRLETLKLWQNN  358

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
              +G IPS +G   +L EL +   N  +G +P  +    +L         L G LP ++G+
Sbjct  359   FTGEIPSNLGQNGRLIELDLST-NKLTGLVPKSLCLGKRLKILILLKNFLFGSLPDDLGQ  417

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPES  1051
                L  + L  N L+G L  E  YL  L  ++L NN  SG  P+S
Sbjct  418   CYTLQRVRLGQNYLTGPLPHEFLYLPELLLVELQNNYLSGGFPQS  462



>ref|XP_008793129.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Phoenix dactylifera]
Length=988

 Score =   234 bits (597),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 132/285 (46%), Positives = 184/285 (65%), Gaps = 3/285 (1%)
 Frame = +2

Query  209   LGVTEQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsg-lNL  379
             L + +QA++L         S   L SWN+S+  + C+W  V CD    +V        N+
Sbjct  30    LSLRKQASILVALKQSLYTSDHLLQSWNMSSHAALCSWACVRCDDTKRLVVEVNISNSNI  89

Query  380   SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  559
             SG +SP++ QL  L  LS+A N LSG  PP I+ +S LR LN+S+N F  T     + + 
Sbjct  90    SGFISPEIAQLGSLRYLSVAGNSLSGEFPPIITKLSGLRHLNISDNQFNGTLAWNFSTMV  149

Query  560   NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  739
              L+V D YNN+  G LP+ +  +  L+HL LGGNYFSG IP  YG F  L YL+++GN L
Sbjct  150   ELEVFDAYNNDFFGSLPLGLSMLPKLQHLDLGGNYFSGAIPASYGDFKALSYLSLAGNNL  209

Query  740   SGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKL  919
             SG IP+E+GNL+ LK+LY+GY+N F GGIP E+GNL+ L+  D ++CGL GE+P ++G L
Sbjct  210   SGSIPAELGNLSSLKQLYLGYYNEFDGGIPAELGNLASLVHLDLSSCGLEGEIPPQLGNL  269

Query  920   KNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             + LDTLFL  N L G++ P +G L +L+ LD+SNNA +GEIP+ F
Sbjct  270   EKLDTLFLHANQLGGTIPPHLGNLSSLRYLDVSNNALTGEIPKEF  314


 Score =   108 bits (271),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/201 (35%), Positives = 108/201 (54%), Gaps = 1/201 (0%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G + P +G L  L  L + ANQL G +PP +  +S+LR+L++SNN      P + ++L
Sbjct  258  LEGEIPPQLGNLEKLDTLFLHANQLGGTIPPHLGNLSSLRYLDVSNNALTGEIPKEFSKL  317

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
              L +L ++ N   G++P  + ++ +L  L L  N F+G IPPE GR   L  L +S N 
Sbjct  318  RELVLLHMFFNRFHGEIPELIAELPNLEALMLWQNNFTGAIPPELGRNGKLRELDLSTNK  377

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
            L+G++P  +    +L E+ I   N   G +P ++G  S L R       L+G +P  I  
Sbjct  378  LTGLVPKALCFGRRL-EILILLNNFLFGPLPDDLGECSTLSRVRMGQNYLSGSIPRGILY  436

Query  917  LKNLDTLFLQVNDLSGSLAPE  979
            L  L  + LQ N L+G +A E
Sbjct  437  LPELSLMELQNNYLTGVIAEE  457


 Score =   103 bits (258),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 105/204 (51%), Gaps = 1/204 (0%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
              G +  ++G L  LV+L +++  L G +PP++  +  L  L L  N  G T P  L  L
Sbjct  234  FDGGIPAELGNLASLVHLDLSSCGLEGEIPPQLGNLEKLDTLFLHANQLGGTIPPHLGNL  293

Query  557  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
            ++L+ LD+ NN LTG++P E  K+  L  LH+  N F G IP      PNLE L +  N 
Sbjct  294  SSLRYLDVSNNALTGEIPKEFSKLRELVLLHMFFNRFHGEIPELIAELPNLEALMLWQNN  353

Query  737  LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
             +G IP E+G   KL+EL +   N  +G +P  +    +L      N  L G LP ++G+
Sbjct  354  FTGAIPPELGRNGKLRELDLST-NKLTGLVPKALCFGRRLEILILLNNFLFGPLPDDLGE  412

Query  917  LKNLDTLFLQVNDLSGSLAPEIGY  988
               L  + +  N LSGS+   I Y
Sbjct  413  CSTLSRVRMGQNYLSGSIPRGILY  436


 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 74/202 (37%), Positives = 101/202 (50%), Gaps = 3/202 (1%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
             SG +    G    L  LS+A N LSG +P E+  +S+L+ L L   N F    P +L  
Sbjct  185  FSGAIPASYGDFKALSYLSLAGNNLSGSIPAELGNLSSLKQLYLGYYNEFDGGIPAELGN  244

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
            LA+L  LDL +  L G++P ++  +  L  L L  N   G IPP  G   +L YL VS N
Sbjct  245  LASLVHLDLSSCGLEGEIPPQLGNLEKLDTLFLHANQLGGTIPPHLGNLSSLRYLDVSNN  304

Query  734  GLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
             L+G IP E   L +L  L++ +FN F G IP  +  L  L          TG +P E+G
Sbjct  305  ALTGEIPKEFSKLRELVLLHM-FFNRFHGEIPELIAELPNLEALMLWQNNFTGAIPPELG  363

Query  914  KLKNLDTLFLQVNDLSGSLAPE  979
            +   L  L L  N L+G L P+
Sbjct  364  RNGKLRELDLSTNKLTG-LVPK  384


 Score = 98.2 bits (243),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 80/251 (32%), Positives = 125/251 (50%), Gaps = 26/251 (10%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSG------------------------PVPPEISA  481
             N +G + P++G+   L  L ++ N+L+G                        P+P ++  
Sbjct  353   NFTGAIPPELGRNGKLRELDLSTNKLTGLVPKALCFGRRLEILILLNNFLFGPLPDDLGE  412

Query  482   ISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVE-VYKMTSLRHLHLGG  658
              STL  + +  N    + P  +  L  L +++L NN LTG +  E   K   L  L+L  
Sbjct  413   CSTLSRVRMGQNYLSGSIPRGILYLPELSLMELQNNYLTGVIAEEPTRKPGKLGQLNLSN  472

Query  659   NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEM  838
             N   G +P   G F  LE L + GN  +G +P +IG L  L ++ +   N FSG IPPE+
Sbjct  473   NRLFGPLPSSIGNFSALEILLLGGNQFTGPMPPQIGLLKHLLKMDMSR-NNFSGRIPPEI  531

Query  839   GNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldls  1018
             G+   L   D +   LTG +P ++ +++ L+ L +  N L+ S+  EIG LK+L S D S
Sbjct  532   GDCLLLTYLDLSQNQLTGPIPAQVSQIRILNYLNVSWNHLNQSIPKEIGGLKSLTSADFS  591

Query  1019  nnAFSGEIPES  1051
             +N  SG IPE+
Sbjct  592   HNDLSGRIPET  602


 Score = 82.8 bits (203),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 69/225 (31%), Positives = 105/225 (47%), Gaps = 28/225 (12%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVP------PEISAIS-----------------  487
            L G L  D+G+   L  + +  N LSG +P      PE+S +                  
Sbjct  402  LFGPLPDDLGECSTLSRVRMGQNYLSGSIPRGILYLPELSLMELQNNYLTGVIAEEPTRK  461

Query  488  --TLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  661
               L  LNLSNN      P  +   + L++L L  N  TG +P ++  +  L  + +  N
Sbjct  462  PGKLGQLNLSNNRLFGPLPSSIGNFSALEILLLGGNQFTGPMPPQIGLLKHLLKMDMSRN  521

Query  662  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMG  841
             FSGRIPPE G    L YL +S N L+G IP+++  +  L  L + + N  +  IP E+G
Sbjct  522  NFSGRIPPEIGDCLLLTYLDLSQNQLTGPIPAQVSQIRILNYLNVSW-NHLNQSIPKEIG  580

Query  842  NLSQLIRFDAANCGLTGELPVEIGKLKNLD-TLFLQVNDLSGSLA  973
             L  L   D ++  L+G +P E G+    + + FL    L GS++
Sbjct  581  GLKSLTSADFSHNDLSGRIP-ETGQFAYFNASSFLANPQLCGSVS  624



>ref|XP_004499483.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Cicer arietinum]
Length=987

 Score =   234 bits (597),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 146/289 (51%), Positives = 192/289 (66%), Gaps = 7/289 (2%)
 Frame = +2

Query  206   PLGVTEQAALL-SIKAAFTADSQSSLTSWNIST--SHCT-WRRVTCdsllh-vvsldlsg  370
             PL +  QA++L S+K  F A S SSL++WNIS   S CT W  + CD     V+SLD+S 
Sbjct  24    PLSLKNQASILVSMKQDFEA-SNSSLSTWNISNYMSLCTNWYGIQCDHNKIFVMSLDISN  82

Query  371   lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIF-GSTFPHQL  547
             LN+SG LSP + +L  LVN+SI  N   G  P  I  +  L+FLN+SNN+F G+    + 
Sbjct  83    LNISGSLSPLITKLTTLVNVSIQGNSFCGEFPINIHNLQNLKFLNISNNMFSGNLSSMEF  142

Query  548   AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  727
              +L  L+VLD+YNN   G LP  V ++ +L+HL+ GGNYF GRIPP YG+  NL++L+++
Sbjct  143   NKLKELEVLDVYNNAFNGSLPHGVTQLLNLKHLNFGGNYFYGRIPPSYGKMKNLKFLSLA  202

Query  728   GNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVE  907
             GN LSG +PSE+GNLT L+ LY+GY+N F GGIP E G L  L+  D ANC L G +P E
Sbjct  203   GNDLSGFLPSELGNLTNLEYLYLGYYNQFEGGIPHEFGKLENLVHLDLANCLLKGSIPNE  262

Query  908   IGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             +GKL  LDTLFLQ N L+G + PE+G L  L +LDLS N  +G IP  F
Sbjct  263   LGKLYKLDTLFLQTNQLTGFIPPELGNLSRLNALDLSLNNLTGGIPNEF  311


 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 108/207 (52%), Gaps = 5/207 (2%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            N +GV+ P +G+   +  L ++ N+L+G VP  +   + L+ L L NN      P++L Q
Sbjct  350  NFTGVIPPKLGRNGKITELDLSTNKLTGLVPKSLCFGNRLKILILLNNFLFGNLPYELGQ  409

Query  554  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPN----LEYLA  721
               LQ + +  N LTG +P     + +L  L L  NY SG IP + G+  N    LE   
Sbjct  410  CYTLQRVRIGQNYLTGSIPHGFLYLPNLSLLELQNNYLSGLIPQQKGQKENTTSKLEQCN  469

Query  722  VSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELP  901
            +S N  SG +P+ IGN   L+ L + Y N FSG IP ++G L  +++ D  +   +G +P
Sbjct  470  LSNNRFSGSLPNSIGNFPNLQILQL-YGNRFSGEIPSDIGRLKNILKLDFNSNNFSGTIP  528

Query  902  VEIGKLKNLDTLFLQVNDLSGSLAPEI  982
             EIGK   L  L L  N  SG +  ++
Sbjct  529  NEIGKCNLLTYLDLSQNQFSGPIPIQV  555


 Score =   101 bits (252),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 118/248 (48%), Gaps = 24/248 (10%)
 Frame = +2

Query  383   GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQLA  559
             G + P  G++  L  LS+A N LSG +P E+  ++ L +L L   N F    PH+  +L 
Sbjct  184   GRIPPSYGKMKNLKFLSLAGNDLSGFLPSELGNLTNLEYLYLGYYNQFEGGIPHEFGKLE  243

Query  560   NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  739
             NL  LDL N  L G +P E+ K+  L  L L  N  +G IPPE G    L  L +S N L
Sbjct  244   NLVHLDLANCLLKGSIPNELGKLYKLDTLFLQTNQLTGFIPPELGNLSRLNALDLSLNNL  303

Query  740   SGVIPSEIGNLTKLKEL-------------YIGYF----------NGFSGGIPPEMGNLS  850
             +G IP+E  NL +L  L             ++  F          N F+G IPP++G   
Sbjct  304   TGGIPNEFSNLHQLSLLNLFINRLHGEIPEFVSEFPNLEVLKLWRNNFTGVIPPKLGRNG  363

Query  851   QLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAF  1030
             ++   D +   LTG +P  +     L  L L  N L G+L  E+G    L+ + +  N  
Sbjct  364   KITELDLSTNKLTGLVPKSLCFGNRLKILILLNNFLFGNLPYELGQCYTLQRVRIGQNYL  423

Query  1031  SGEIPESF  1054
             +G IP  F
Sbjct  424   TGSIPHGF  431


 Score = 97.8 bits (242),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 86/275 (31%), Positives = 125/275 (45%), Gaps = 53/275 (19%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G + P++G L  L  L ++ N L+G +P E S +  L  LNL  N      P  +++ 
Sbjct  279   LTGFIPPELGNLSRLNALDLSLNNLTGGIPNEFSNLHQLSLLNLFINRLHGEIPEFVSEF  338

Query  557   ANLQVL------------------------DLYNNNLT----------------------  598
              NL+VL                        DL  N LT                      
Sbjct  339   PNLEVLKLWRNNFTGVIPPKLGRNGKITELDLSTNKLTGLVPKSLCFGNRLKILILLNNF  398

Query  599   --GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEIGN-  769
               G+LP E+ +  +L+ + +G NY +G IP  +   PNL  L +  N LSG+IP + G  
Sbjct  399   LFGNLPYELGQCYTLQRVRIGQNYLTGSIPHGFLYLPNLSLLELQNNYLSGLIPQQKGQK  458

Query  770   ---LTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLF  940
                 +KL++  +   N FSG +P  +GN   L          +GE+P +IG+LKN+  L 
Sbjct  459   ENTTSKLEQCNLSN-NRFSGSLPNSIGNFPNLQILQLYGNRFSGEIPSDIGRLKNILKLD  517

Query  941   LQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
                N+ SG++  EIG    L  LDLS N FSG IP
Sbjct  518   FNSNNFSGTIPNEIGKCNLLTYLDLSQNQFSGPIP  552


 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 100/207 (48%), Gaps = 6/207 (3%)
 Frame = +2

Query  377  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
            L G L  ++GQ   L  + I  N L+G +P     +  L  L L NN      P Q  Q 
Sbjct  399  LFGNLPYELGQCYTLQRVRIGQNYLTGSIPHGFLYLPNLSLLELQNNYLSGLIPQQKGQK  458

Query  557  AN----LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  724
             N    L+  +L NN  +G LP  +    +L+ L L GN FSG IP + GR  N+  L  
Sbjct  459  ENTTSKLEQCNLSNNRFSGSLPNSIGNFPNLQILQLYGNRFSGEIPSDIGRLKNILKLDF  518

Query  725  SGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPV  904
            + N  SG IP+EIG    L  L +   N FSG IP ++  +  L  F+ +   L   +P 
Sbjct  519  NSNNFSGTIPNEIGKCNLLTYLDLSQ-NQFSGPIPIQVSQIHILNHFNVSWNHLNQTIPK  577

Query  905  EIGKLKNLDTLFLQVNDLSGSLAPEIG  985
            E+G LK L +     N+ SGS+ PE G
Sbjct  578  ELGNLKGLTSADFSHNNFSGSI-PEGG  603


 Score = 95.5 bits (236),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 80/230 (35%), Positives = 117/230 (51%), Gaps = 7/230 (3%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L G +  ++G+L  L  L +  NQL+G +PPE+  +S L  L+LS N      P++ + L
Sbjct  255   LKGSIPNELGKLYKLDTLFLQTNQLTGFIPPELGNLSRLNALDLSLNNLTGGIPNEFSNL  314

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
               L +L+L+ N L G++P  V +  +L  L L  N F+G IPP+ GR   +  L +S N 
Sbjct  315   HQLSLLNLFINRLHGEIPEFVSEFPNLEVLKLWRNNFTGVIPPKLGRNGKITELDLSTNK  374

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGF-SGGIPPEMGNLSQLIRFDAANCGLTGELPVEIG  913
             L+G++P  +    +LK L +   N F  G +P E+G    L R       LTG +P    
Sbjct  375   LTGLVPKSLCFGNRLKILIL--LNNFLFGNLPYELGQCYTLQRVRIGQNYLTGSIPHGFL  432

Query  914   KLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsn----nAFSGEIPES  1051
              L NL  L LQ N LSG +  + G  +N  S         N FSG +P S
Sbjct  433   YLPNLSLLELQNNYLSGLIPQQKGQKENTTSKLEQCNLSNNRFSGSLPNS  482


 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 111/224 (50%), Gaps = 1/224 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
               G +  + G+L  LV+L +A   L G +P E+  +  L  L L  N      P +L  L
Sbjct  231   FEGGIPHEFGKLENLVHLDLANCLLKGSIPNELGKLYKLDTLFLQTNQLTGFIPPELGNL  290

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             + L  LDL  NNLTG +P E   +  L  L+L  N   G IP     FPNLE L +  N 
Sbjct  291   SRLNALDLSLNNLTGGIPNEFSNLHQLSLLNLFINRLHGEIPEFVSEFPNLEVLKLWRNN  350

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
              +GVIP ++G   K+ EL +   N  +G +P  +   ++L      N  L G LP E+G+
Sbjct  351   FTGVIPPKLGRNGKITELDLST-NKLTGLVPKSLCFGNRLKILILLNNFLFGNLPYELGQ  409

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPE  1048
                L  + +  N L+GS+     YL NL  L+L NN  SG IP+
Sbjct  410   CYTLQRVRIGQNYLTGSIPHGFLYLPNLSLLELQNNYLSGLIPQ  453


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 0/79 (0%)
 Frame = +2

Query  374  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
            N SG +  ++G+   L  L ++ NQ SGP+P ++S I  L   N+S N    T P +L  
Sbjct  522  NFSGTIPNEIGKCNLLTYLDLSQNQFSGPIPIQVSQIHILNHFNVSWNHLNQTIPKELGN  581

Query  554  LANLQVLDLYNNNLTGDLP  610
            L  L   D  +NN +G +P
Sbjct  582  LKGLTSADFSHNNFSGSIP  600



>gb|KEH33614.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=985

 Score =   234 bits (596),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 135/288 (47%), Positives = 184/288 (64%), Gaps = 6/288 (2%)
 Frame = +2

Query  209   LGVTEQAALL-SIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldl---sg  370
             L +  QA++L S+K  F   S +SL+SWN+S   S CTW  + CD  +  +S+     S 
Sbjct  25    LSLKNQASILVSMKQDFEPSSNTSLSSWNMSNYMSLCTWYGIQCDHTITNMSIVSLDISN  84

Query  371   lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  550
             LN+SG  SP + +L  LVN+SI  N   G  P EI  +  L+ LN+SNN+F      +  
Sbjct  85    LNISGSFSPQITKLYNLVNVSIQGNSFYGEFPTEIHKLQRLKCLNISNNMFSGNLSWEFN  144

Query  551   QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  730
             +L  L+VLD+YNN   G LP  V +++SL+HL+ GGNYFSG+IP  YG    L +L+++G
Sbjct  145   KLKELEVLDIYNNGFNGSLPRGVTQVSSLKHLNFGGNYFSGKIPTSYGEMKQLNFLSLAG  204

Query  731   NGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEI  910
             N LSG +PSE+GNLT L+ LY+GYFN F GG+P E G L  L+  D A+C L G +P+E+
Sbjct  205   NDLSGFLPSELGNLTSLENLYLGYFNQFDGGVPKEFGKLINLVHLDLASCFLKGSIPLEL  264

Query  911   GKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPESF  1054
             G+L  LDTLFLQ N L+G + PE+G L  L +LDLS N  +G IP  F
Sbjct  265   GQLNKLDTLFLQKNQLTGFIPPELGNLSRLNALDLSLNNLTGGIPNEF  312


 Score =   110 bits (274),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 85/251 (34%), Positives = 125/251 (50%), Gaps = 27/251 (11%)
 Frame = +2

Query  374   NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  553
             N +GV+   +GQ   L  + ++ N+L+G +P  +     L+ L L NN    + P+ L Q
Sbjct  351   NFTGVIPSKLGQNGRLTEVDLSTNKLTGILPKSLCFGKRLKILILLNNFLFGSLPNDLGQ  410

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPE---------------  688
                LQ + +  N  TG +P     + +L  L L  NY SG IP +               
Sbjct  411   CYTLQRVRIGQNYFTGSIPHGFLYLPNLSLLELQNNYLSGVIPQQTHKNKTSKLEQCNLS  470

Query  689   -----------YGRFPNLEYLAVSGNGLSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPE  835
                         G FPNL+ L +SGN  SG IPS+IG L K+ +L I   N FSG IP E
Sbjct  471   NNRLSGSLPTSIGNFPNLQTLQLSGNRFSGQIPSDIGKLKKILKLDISS-NNFSGTIPSE  529

Query  836   MGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldl  1015
             +G  + L   D +    +G +P+++ ++  L+ L +  N L+ S+  E+G LK L S D 
Sbjct  530   IGKCTLLTYLDLSQNQFSGPIPIQLAQIHILNHLNVSWNHLNQSIPKELGALKGLTSADF  589

Query  1016  snnAFSGEIPE  1048
             S+N FSG IPE
Sbjct  590   SHNNFSGSIPE  600


 Score =   104 bits (260),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 85/273 (31%), Positives = 126/273 (46%), Gaps = 51/273 (19%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
             L+G + P++G L  L  L ++ N L+G +P E S +  L  LNL  N F S  P  +++L
Sbjct  280   LTGFIPPELGNLSRLNALDLSLNNLTGGIPNEFSNLRELSLLNLFINKFHSEIPDFISEL  339

Query  557   ANLQVLDLYNNNLT----------------------------------------------  598
               L+VL L+ NN T                                              
Sbjct  340   PKLEVLKLWRNNFTGVIPSKLGQNGRLTEVDLSTNKLTGILPKSLCFGKRLKILILLNNF  399

Query  599   --GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIPSEI--G  766
               G LP ++ +  +L+ + +G NYF+G IP  +   PNL  L +  N LSGVIP +    
Sbjct  400   LFGSLPNDLGQCYTLQRVRIGQNYFTGSIPHGFLYLPNLSLLELQNNYLSGVIPQQTHKN  459

Query  767   NLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQ  946
               +KL++  +   N  SG +P  +GN   L     +    +G++P +IGKLK +  L + 
Sbjct  460   KTSKLEQCNLSN-NRLSGSLPTSIGNFPNLQTLQLSGNRFSGQIPSDIGKLKKILKLDIS  518

Query  947   VNDLSGSLAPEIGYlknlksldlsnnAFSGEIP  1045
              N+ SG++  EIG    L  LDLS N FSG IP
Sbjct  519   SNNFSGTIPSEIGKCTLLTYLDLSQNQFSGPIP  551


 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 84/250 (34%), Positives = 119/250 (48%), Gaps = 24/250 (10%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  553
              SG +    G++  L  LS+A N LSG +P E+  +++L  L L   N F    P +  +
Sbjct  183   FSGKIPTSYGEMKQLNFLSLAGNDLSGFLPSELGNLTSLENLYLGYFNQFDGGVPKEFGK  242

Query  554   LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  733
             L NL  LDL +  L G +P+E+ ++  L  L L  N  +G IPPE G    L  L +S N
Sbjct  243   LINLVHLDLASCFLKGSIPLELGQLNKLDTLFLQKNQLTGFIPPELGNLSRLNALDLSLN  302

Query  734   GLSGVIPSEIGNLTKLK--ELYIGYF---------------------NGFSGGIPPEMGN  844
              L+G IP+E  NL +L    L+I  F                     N F+G IP ++G 
Sbjct  303   NLTGGIPNEFSNLRELSLLNLFINKFHSEIPDFISELPKLEVLKLWRNNFTGVIPSKLGQ  362

Query  845   LSQLIRFDAANCGLTGELPVEIGKLKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnn  1024
               +L   D +   LTG LP  +   K L  L L  N L GSL  ++G    L+ + +  N
Sbjct  363   NGRLTEVDLSTNKLTGILPKSLCFGKRLKILILLNNFLFGSLPNDLGQCYTLQRVRIGQN  422

Query  1025  AFSGEIPESF  1054
              F+G IP  F
Sbjct  423   YFTGSIPHGF  432


 Score = 84.0 bits (206),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 110/224 (49%), Gaps = 1/224 (0%)
 Frame = +2

Query  377   LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  556
               G +  + G+L  LV+L +A+  L G +P E+  ++ L  L L  N      P +L  L
Sbjct  232   FDGGVPKEFGKLINLVHLDLASCFLKGSIPLELGQLNKLDTLFLQKNQLTGFIPPELGNL  291

Query  557   ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  736
             + L  LDL  NNLTG +P E   +  L  L+L  N F   IP      P LE L +  N 
Sbjct  292   SRLNALDLSLNNLTGGIPNEFSNLRELSLLNLFINKFHSEIPDFISELPKLEVLKLWRNN  351

Query  737   LSGVIPSEIGNLTKLKELYIGYFNGFSGGIPPEMGNLSQLIRFDAANCGLTGELPVEIGK  916
              +GVIPS++G   +L E+ +   N  +G +P  +    +L      N  L G LP ++G+
Sbjct  352   FTGVIPSKLGQNGRLTEVDLST-NKLTGILPKSLCFGKRLKILILLNNFLFGSLPNDLGQ  410

Query  917   LKNLDTLFLQVNDLSGSLAPEIGYlknlksldlsnnAFSGEIPE  1048
                L  + +  N  +GS+     YL NL  L+L NN  SG IP+
Sbjct  411   CYTLQRVRIGQNYFTGSIPHGFLYLPNLSLLELQNNYLSGVIPQ  454


 Score = 77.0 bits (188),  Expect = 7e-12, Method: Comp