BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3730

Length=661
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009802424.1|  PREDICTED: ABC transporter G family member 1...    260   1e-78   Nicotiana sylvestris
ref|XP_010324495.1|  PREDICTED: ABC transporter G family member 1...    256   5e-77   Solanum lycopersicum
ref|XP_009631041.1|  PREDICTED: ABC transporter G family member 1...    255   7e-77   Nicotiana tomentosiformis
ref|XP_011071699.1|  PREDICTED: ABC transporter G family member 1...    254   1e-76   Sesamum indicum [beniseed]
ref|XP_006361227.1|  PREDICTED: ABC transporter G family member 1...    253   4e-76   Solanum tuberosum [potatoes]
ref|XP_006361228.1|  PREDICTED: ABC transporter G family member 1...    253   4e-76   Solanum tuberosum [potatoes]
ref|XP_004246010.1|  PREDICTED: ABC transporter G family member 14      250   7e-75   
ref|XP_006359961.1|  PREDICTED: ABC transporter G family member 1...    247   7e-74   Solanum tuberosum [potatoes]
ref|XP_002270533.2|  PREDICTED: ABC transporter G family member 14      244   8e-73   Vitis vinifera
emb|CDP07185.1|  unnamed protein product                                242   5e-72   Coffea canephora [robusta coffee]
ref|XP_006385164.1|  ABC transporter family protein                     240   3e-71   Populus trichocarpa [western balsam poplar]
ref|XP_011082193.1|  PREDICTED: ABC transporter G family member 1...    240   4e-71   Sesamum indicum [beniseed]
ref|XP_011028515.1|  PREDICTED: ABC transporter G family member 1...    239   1e-70   Populus euphratica
ref|XP_003548769.1|  PREDICTED: ABC transporter G family member 1...    236   1e-69   Glycine max [soybeans]
ref|XP_012072650.1|  PREDICTED: ABC transporter G family member 1...    234   8e-69   Jatropha curcas
ref|XP_002519942.1|  ATP-binding cassette transporter, putative         233   1e-68   Ricinus communis
gb|KDP37810.1|  hypothetical protein JCGZ_06712                         234   1e-68   Jatropha curcas
ref|XP_012072651.1|  PREDICTED: ABC transporter G family member 1...    234   1e-68   Jatropha curcas
ref|XP_011013139.1|  PREDICTED: ABC transporter G family member 1...    233   2e-68   Populus euphratica
ref|XP_010275138.1|  PREDICTED: ABC transporter G family member 14      232   3e-68   Nelumbo nucifera [Indian lotus]
emb|CAN70956.1|  hypothetical protein VITISV_028138                     232   5e-68   Vitis vinifera
ref|XP_007158067.1|  hypothetical protein PHAVU_002G121200g             231   7e-68   Phaseolus vulgaris [French bean]
ref|XP_002304113.2|  hypothetical protein POPTR_0003s03650g             231   7e-68   Populus trichocarpa [western balsam poplar]
ref|XP_007156346.1|  hypothetical protein PHAVU_003G278800g             231   9e-68   Phaseolus vulgaris [French bean]
ref|XP_007040852.1|  ATP-binding cassette 14                            230   3e-67   Theobroma cacao [chocolate]
ref|XP_010540713.1|  PREDICTED: ABC transporter G family member 14      229   4e-67   Tarenaya hassleriana [spider flower]
ref|XP_003537708.1|  PREDICTED: ABC transporter G family member 1...    229   7e-67   Glycine max [soybeans]
ref|XP_003547739.1|  PREDICTED: ABC transporter G family member 1...    228   8e-67   Glycine max [soybeans]
gb|KJB25133.1|  hypothetical protein B456_004G178100                    228   2e-66   Gossypium raimondii
ref|XP_004512314.1|  PREDICTED: ABC transporter G family member 1...    228   2e-66   Cicer arietinum [garbanzo]
gb|KJB25132.1|  hypothetical protein B456_004G178100                    227   2e-66   Gossypium raimondii
ref|XP_003517105.2|  PREDICTED: ABC transporter G family member 1...    226   5e-66   Glycine max [soybeans]
gb|KHN28317.1|  ABC transporter G family member 14                      226   6e-66   Glycine soja [wild soybean]
gb|KHG16348.1|  ABC transporter G family member 14                      225   1e-65   Gossypium arboreum [tree cotton]
ref|XP_010251517.1|  PREDICTED: ABC transporter G family member 1...    224   4e-65   Nelumbo nucifera [Indian lotus]
ref|XP_010111780.1|  ABC transporter G family member 14                 223   1e-64   Morus notabilis
ref|XP_009605917.1|  PREDICTED: ABC transporter G family member 1...    221   4e-64   Nicotiana tomentosiformis
ref|XP_009757349.1|  PREDICTED: ABC transporter G family member 1...    219   1e-63   Nicotiana sylvestris
gb|KHG20314.1|  ABC transporter G family member 14                      220   1e-63   Gossypium arboreum [tree cotton]
gb|KJB51502.1|  hypothetical protein B456_008G219500                    219   2e-63   Gossypium raimondii
ref|XP_010463057.1|  PREDICTED: ABC transporter G family member 1...    215   2e-62   
ref|XP_010478591.1|  PREDICTED: ABC transporter G family member 14      215   8e-62   Camelina sativa [gold-of-pleasure]
ref|XP_004291249.1|  PREDICTED: ABC transporter G family member 14      215   1e-61   Fragaria vesca subsp. vesca
ref|XP_010499718.1|  PREDICTED: ABC transporter G family member 1...    214   1e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010518955.1|  PREDICTED: ABC transporter G family member 14      213   3e-61   Tarenaya hassleriana [spider flower]
ref|XP_009114967.1|  PREDICTED: ABC transporter G family member 14      213   4e-61   Brassica rapa
emb|CDY12299.1|  BnaA09g24990D                                          214   6e-61   Brassica napus [oilseed rape]
ref|XP_006303926.1|  hypothetical protein CARUB_v10008545mg             211   4e-60   Capsella rubella
ref|XP_008387860.1|  PREDICTED: ABC transporter G family member 14      210   8e-60   Malus domestica [apple tree]
ref|XP_006415305.1|  hypothetical protein EUTSA_v10007027mg             209   9e-60   Eutrema salsugineum [saltwater cress]
ref|NP_564383.1|  ABC transporter G family member 14                    209   2e-59   Arabidopsis thaliana [mouse-ear cress]
gb|EYU29117.1|  hypothetical protein MIMGU_mgv1a002688mg                208   2e-59   Erythranthe guttata [common monkey flower]
emb|CDY47690.1|  BnaCnng15320D                                          206   1e-58   Brassica napus [oilseed rape]
ref|XP_009145231.1|  PREDICTED: ABC transporter G family member 1...    206   1e-58   Brassica rapa
ref|XP_010324496.1|  PREDICTED: ABC transporter G family member 1...    206   2e-58   Solanum lycopersicum
gb|ABB97034.1|  ABC transporter-like protein                            201   4e-58   Brassica rapa
ref|XP_008221126.1|  PREDICTED: ABC transporter G family member 14      204   8e-58   Prunus mume [ume]
ref|XP_006430907.1|  hypothetical protein CICLE_v10011273mg             203   2e-57   Citrus clementina [clementine]
ref|XP_002893685.1|  abc transporter family protein                     203   2e-57   
ref|XP_007226971.1|  hypothetical protein PRUPE_ppa002442mg             203   2e-57   
ref|XP_010054006.1|  PREDICTED: ABC transporter G family member 14      202   4e-57   Eucalyptus grandis [rose gum]
gb|AES95438.2|  white-brown-complex ABC transporter family protein      202   6e-57   Medicago truncatula
gb|KDO72270.1|  hypothetical protein CISIN_1g039221mg                   201   8e-57   Citrus sinensis [apfelsine]
ref|XP_003612480.1|  ABC transporter-like protein                       201   8e-57   
ref|XP_006482405.1|  PREDICTED: ABC transporter G family member 1...    201   8e-57   Citrus sinensis [apfelsine]
gb|KFK44944.1|  hypothetical protein AALP_AA1G323000                    201   1e-56   Arabis alpina [alpine rockcress]
gb|AAG50724.1|AC079041_17  ABC transporter, putative                    199   6e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008347335.1|  PREDICTED: ABC transporter G family member 1...    200   8e-56   
ref|XP_008347334.1|  PREDICTED: ABC transporter G family member 1...    200   8e-56   
ref|XP_009397435.1|  PREDICTED: ABC transporter G family member 14      194   5e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384518.1|  PREDICTED: ABC transporter G family member 1...    191   4e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004147769.1|  PREDICTED: ABC transporter G family member 14      186   3e-51   Cucumis sativus [cucumbers]
ref|XP_008451875.1|  PREDICTED: ABC transporter G family member 14      186   3e-51   Cucumis melo [Oriental melon]
ref|XP_010910173.1|  PREDICTED: ABC transporter G family member 1...    185   7e-51   
ref|XP_010910172.1|  PREDICTED: ABC transporter G family member 1...    185   7e-51   
ref|XP_010324497.1|  PREDICTED: ABC transporter G family member 1...    184   9e-51   
gb|EPS63929.1|  hypothetical protein M569_10851                         182   1e-49   Genlisea aurea
ref|XP_003520157.2|  PREDICTED: ABC transporter G family member 2...    182   1e-49   
ref|XP_010265331.1|  PREDICTED: ABC transporter G family member 2...    181   4e-49   Nelumbo nucifera [Indian lotus]
ref|XP_010918656.1|  PREDICTED: ABC transporter G family member 1...    179   1e-48   
ref|XP_006573283.1|  PREDICTED: ABC transporter G family member 2...    179   1e-48   Glycine max [soybeans]
ref|XP_010943389.1|  PREDICTED: ABC transporter G family member 1...    178   2e-48   Elaeis guineensis
ref|XP_010066762.1|  PREDICTED: ABC transporter G family member 21      177   7e-48   Eucalyptus grandis [rose gum]
ref|XP_004293103.1|  PREDICTED: ABC transporter G family member 9       177   7e-48   Fragaria vesca subsp. vesca
ref|XP_010918655.1|  PREDICTED: ABC transporter G family member 1...    177   7e-48   Elaeis guineensis
ref|XP_010943390.1|  PREDICTED: ABC transporter G family member 1...    176   1e-47   Elaeis guineensis
ref|XP_007153314.1|  hypothetical protein PHAVU_003G024700g             176   2e-47   Phaseolus vulgaris [French bean]
ref|XP_007225163.1|  hypothetical protein PRUPE_ppa002351mg             176   3e-47   
ref|XP_010425210.1|  PREDICTED: ABC transporter G family member 2...    172   4e-47   
ref|XP_010556399.1|  PREDICTED: ABC transporter G family member 2...    175   4e-47   Tarenaya hassleriana [spider flower]
gb|AIU41651.1|  ABC transporter family protein                          174   6e-47   Hevea brasiliensis [jebe]
ref|XP_010668407.1|  PREDICTED: ABC transporter G family member 2...    168   2e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002876921.1|  hypothetical protein ARALYDRAFT_904727             172   2e-46   Arabidopsis lyrata subsp. lyrata
ref|XP_009605775.1|  PREDICTED: ABC transporter G family member 9       172   2e-46   Nicotiana tomentosiformis
ref|XP_010648137.1|  PREDICTED: ABC transporter G family member 21      172   2e-46   Vitis vinifera
emb|CAN62390.1|  hypothetical protein VITISV_039480                     172   3e-46   Vitis vinifera
ref|XP_010502440.1|  PREDICTED: ABC transporter G family member 2...    170   3e-46   
ref|XP_008805673.1|  PREDICTED: ABC transporter G family member 1...    172   3e-46   Phoenix dactylifera
ref|XP_009792869.1|  PREDICTED: ABC transporter G family member 9...    172   3e-46   Nicotiana sylvestris
ref|XP_011098341.1|  PREDICTED: ABC transporter G family member 9       172   3e-46   Sesamum indicum [beniseed]
ref|XP_008797958.1|  PREDICTED: ABC transporter G family member 1...    172   4e-46   Phoenix dactylifera
ref|XP_008243143.1|  PREDICTED: ABC transporter G family member 21      172   4e-46   Prunus mume [ume]
ref|XP_004297158.1|  PREDICTED: ABC transporter G family member 21      172   5e-46   Fragaria vesca subsp. vesca
ref|XP_010514180.1|  PREDICTED: ABC transporter G family member 2...    171   6e-46   Camelina sativa [gold-of-pleasure]
ref|XP_006484387.1|  PREDICTED: ABC transporter G family member 2...    171   6e-46   Citrus sinensis [apfelsine]
gb|KDO70136.1|  hypothetical protein CISIN_1g005545mg                   171   6e-46   Citrus sinensis [apfelsine]
ref|XP_010425209.1|  PREDICTED: ABC transporter G family member 2...    171   6e-46   Camelina sativa [gold-of-pleasure]
ref|XP_006395639.1|  hypothetical protein EUTSA_v10003766mg             171   7e-46   Eutrema salsugineum [saltwater cress]
gb|KEH19433.1|  white-brown-complex ABC transporter family protein      171   1e-45   Medicago truncatula
gb|KJB13426.1|  hypothetical protein B456_002G073600                    171   1e-45   Gossypium raimondii
emb|CDY46506.1|  BnaA02g27560D                                          171   1e-45   Brassica napus [oilseed rape]
ref|NP_189190.2|  ABC transporter G family member 21                    168   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007046353.1|  ABC-2 type transporter family protein              171   1e-45   
gb|KDP27020.1|  hypothetical protein JCGZ_20955                         170   1e-45   Jatropha curcas
ref|XP_009129040.1|  PREDICTED: ABC transporter G family member 2...    170   1e-45   Brassica rapa
ref|XP_004244204.1|  PREDICTED: ABC transporter G family member 9       170   2e-45   Solanum lycopersicum
ref|XP_010262410.1|  PREDICTED: ABC transporter G family member 2...    170   2e-45   Nelumbo nucifera [Indian lotus]
ref|XP_008361741.1|  PREDICTED: ABC transporter G family member 2...    170   2e-45   
ref|XP_008339724.1|  PREDICTED: ABC transporter G family member 2...    170   2e-45   
ref|XP_012084914.1|  PREDICTED: ABC transporter G family member 9...    169   3e-45   Jatropha curcas
ref|XP_008389338.1|  PREDICTED: ABC transporter G family member 2...    167   3e-45   
ref|XP_006437762.1|  hypothetical protein CICLE_v10030868mg             169   3e-45   Citrus clementina [clementine]
ref|XP_009336649.1|  PREDICTED: ABC transporter G family member 2...    169   3e-45   Pyrus x bretschneideri [bai li]
gb|KEH38788.1|  white-brown-complex ABC transporter family protein      169   3e-45   Medicago truncatula
ref|XP_008389337.1|  PREDICTED: ABC transporter G family member 2...    167   3e-45   
ref|XP_010502439.1|  PREDICTED: ABC transporter G family member 2...    169   4e-45   Camelina sativa [gold-of-pleasure]
ref|XP_009356025.1|  PREDICTED: ABC transporter G family member 2...    169   6e-45   Pyrus x bretschneideri [bai li]
ref|XP_010528033.1|  PREDICTED: ABC transporter G family member 2...    169   7e-45   Tarenaya hassleriana [spider flower]
ref|XP_002524381.1|  ATP-binding cassette transporter, putative         169   7e-45   
emb|CDP08055.1|  unnamed protein product                                168   7e-45   Coffea canephora [robusta coffee]
gb|KFK39853.1|  hypothetical protein AALP_AA3G297000                    168   1e-44   Arabis alpina [alpine rockcress]
ref|XP_009152126.1|  PREDICTED: ABC transporter G family member 21      168   1e-44   Brassica rapa
ref|NP_001189973.1|  ABC transporter G family member 21                 168   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009766511.1|  PREDICTED: ABC transporter G family member 9...    167   1e-44   Nicotiana sylvestris
ref|XP_006290691.1|  hypothetical protein CARUB_v10016784mg             168   1e-44   Capsella rubella
ref|XP_012082004.1|  PREDICTED: ABC transporter G family member 21      167   1e-44   Jatropha curcas
emb|CDX99764.1|  BnaC02g35560D                                          167   1e-44   
ref|XP_008237669.1|  PREDICTED: ABC transporter G family member 9...    167   1e-44   Prunus mume [ume]
gb|EMT29518.1|  hypothetical protein F775_52365                         166   3e-44   
ref|XP_009607601.1|  PREDICTED: ABC transporter G family member 9...    166   4e-44   Nicotiana tomentosiformis
emb|CDY51602.1|  BnaCnng21050D                                          166   4e-44   Brassica napus [oilseed rape]
ref|XP_008389336.1|  PREDICTED: ABC transporter G family member 2...    166   4e-44   
ref|XP_006286036.1|  hypothetical protein CARUB_v10007565mg             166   4e-44   Capsella rubella
gb|KJB50814.1|  hypothetical protein B456_008G188000                    166   6e-44   Gossypium raimondii
ref|XP_003541854.2|  PREDICTED: ABC transporter G family member 9...    166   7e-44   Glycine max [soybeans]
emb|CDY48079.1|  BnaA06g33490D                                          165   9e-44   Brassica napus [oilseed rape]
ref|XP_006878615.1|  PREDICTED: ABC transporter G family member 14      165   1e-43   Amborella trichopoda
emb|CDP00551.1|  unnamed protein product                                165   1e-43   Coffea canephora [robusta coffee]
ref|XP_002314895.1|  hypothetical protein POPTR_0010s14180g             165   1e-43   Populus trichocarpa [western balsam poplar]
ref|XP_004487681.1|  PREDICTED: ABC transporter G family member 9...    164   2e-43   Cicer arietinum [garbanzo]
gb|KHN07718.1|  ABC transporter G family member 21                      164   2e-43   Glycine soja [wild soybean]
ref|XP_011008785.1|  PREDICTED: ABC transporter G family member 21      164   2e-43   Populus euphratica
gb|KJB62742.1|  hypothetical protein B456_009G433300                    164   3e-43   Gossypium raimondii
ref|XP_010096709.1|  ABC transporter G family member 14                 164   3e-43   
ref|XP_009768130.1|  PREDICTED: ABC transporter G family member 2...    164   4e-43   Nicotiana sylvestris
ref|XP_006413078.1|  hypothetical protein EUTSA_v10024656mg             163   4e-43   Eutrema salsugineum [saltwater cress]
ref|XP_004972751.1|  PREDICTED: ABC transporter G family member 1...    164   4e-43   Setaria italica
gb|KHG01243.1|  ABC transporter G family member 9                       163   6e-43   Gossypium arboreum [tree cotton]
ref|XP_008457190.1|  PREDICTED: ABC transporter G family member 21      163   7e-43   Cucumis melo [Oriental melon]
ref|XP_010676724.1|  PREDICTED: ABC transporter G family member 14      162   7e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009395262.1|  PREDICTED: ABC transporter G family member 9...    162   8e-43   
ref|XP_004236984.1|  PREDICTED: ABC transporter G family member 21      162   9e-43   Solanum lycopersicum
ref|XP_011077437.1|  PREDICTED: ABC transporter G family member 21      162   1e-42   Sesamum indicum [beniseed]
ref|XP_003591854.1|  ABC transporter G family member                    162   1e-42   
ref|XP_007149612.1|  hypothetical protein PHAVU_005G084300g             162   1e-42   Phaseolus vulgaris [French bean]
ref|XP_003526081.1|  PREDICTED: ABC transporter G family member 9...    161   2e-42   Glycine max [soybeans]
ref|XP_011095242.1|  PREDICTED: ABC transporter G family member 9...    161   2e-42   
ref|XP_010921129.1|  PREDICTED: ABC transporter G family member 9       161   2e-42   Elaeis guineensis
ref|XP_011095241.1|  PREDICTED: ABC transporter G family member 9...    161   2e-42   Sesamum indicum [beniseed]
ref|XP_009586692.1|  PREDICTED: ABC transporter G family member 2...    161   3e-42   Nicotiana tomentosiformis
ref|XP_009383080.1|  PREDICTED: ABC transporter G family member 9       161   3e-42   
emb|CDP05875.1|  unnamed protein product                                160   3e-42   Coffea canephora [robusta coffee]
ref|XP_010675645.1|  PREDICTED: ABC transporter G family member 9       160   4e-42   
emb|CAB43874.1|  putative protei                                        160   5e-42   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194472.3|  ABC transporter G family member 9                     160   5e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011649112.1|  PREDICTED: ABC transporter G family member 21      160   6e-42   Cucumis sativus [cucumbers]
emb|CDY29304.1|  BnaC01g19560D                                          160   6e-42   Brassica napus [oilseed rape]
ref|XP_004252105.1|  PREDICTED: ABC transporter G family member 9...    160   6e-42   Solanum lycopersicum
ref|XP_009143407.1|  PREDICTED: ABC transporter G family member 9       160   7e-42   Brassica rapa
emb|CDX92829.1|  BnaC07g40870D                                          160   8e-42   
gb|EYU28941.1|  hypothetical protein MIMGU_mgv1a002356mg                159   2e-41   Erythranthe guttata [common monkey flower]
ref|XP_012084971.1|  PREDICTED: ABC transporter G family member 9...    159   2e-41   Jatropha curcas
ref|XP_010448138.1|  PREDICTED: ABC transporter G family member 9       158   3e-41   Camelina sativa [gold-of-pleasure]
ref|XP_006359003.1|  PREDICTED: ABC transporter G family member 9...    158   3e-41   Solanum tuberosum [potatoes]
ref|XP_003573439.1|  PREDICTED: ABC transporter G family member 14      158   3e-41   Brachypodium distachyon [annual false brome]
ref|XP_010433373.1|  PREDICTED: ABC transporter G family member 9...    158   3e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010438619.1|  PREDICTED: ABC transporter G family member 9...    158   4e-41   Camelina sativa [gold-of-pleasure]
ref|XP_009137658.1|  PREDICTED: ABC transporter G family member 9...    157   6e-41   Brassica rapa
ref|XP_004496215.1|  PREDICTED: ABC transporter G family member 2...    157   6e-41   Cicer arietinum [garbanzo]
emb|CDY29837.1|  BnaA03g48580D                                          157   6e-41   Brassica napus [oilseed rape]
ref|XP_009139468.1|  PREDICTED: ABC transporter G family member 27      158   7e-41   Brassica rapa
gb|KHN16959.1|  ABC transporter G family member 14                      156   8e-41   Glycine soja [wild soybean]
ref|XP_008775311.1|  PREDICTED: ABC transporter G family member 9...    156   1e-40   
ref|XP_008799253.1|  PREDICTED: ABC transporter G family member 9...    156   1e-40   Phoenix dactylifera
ref|XP_009593646.1|  PREDICTED: ABC transporter G family member 21      156   1e-40   Nicotiana tomentosiformis
ref|XP_006366061.1|  PREDICTED: ABC transporter G family member 2...    156   2e-40   Solanum tuberosum [potatoes]
dbj|BAJ97566.1|  predicted protein                                      156   2e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ95904.1|  predicted protein                                      156   2e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK29257.1|  hypothetical protein AALP_AA7G109600                    154   5e-40   Arabis alpina [alpine rockcress]
gb|KHN08925.1|  ABC transporter G family member 9                       154   5e-40   Glycine soja [wild soybean]
ref|XP_008452272.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    154   6e-40   Cucumis melo [Oriental melon]
ref|XP_007143780.1|  hypothetical protein PHAVU_007G100900g             154   8e-40   Phaseolus vulgaris [French bean]
ref|XP_006464709.1|  PREDICTED: ABC transporter G family member 9...    154   9e-40   
gb|KDO74147.1|  hypothetical protein CISIN_1g010509mg                   153   9e-40   Citrus sinensis [apfelsine]
ref|XP_004252106.1|  PREDICTED: ABC transporter G family member 9...    156   1e-39   
emb|CDX95330.1|  BnaC04g28280D                                          154   1e-39   
emb|CDY23205.1|  BnaA04g05540D                                          154   1e-39   Brassica napus [oilseed rape]
ref|XP_009793168.1|  PREDICTED: ABC transporter G family member 2...    154   1e-39   Nicotiana sylvestris
ref|XP_002533914.1|  ATP-binding cassette transporter, putative         153   1e-39   Ricinus communis
ref|XP_006359002.1|  PREDICTED: ABC transporter G family member 9...    153   1e-39   Solanum tuberosum [potatoes]
ref|XP_006589394.1|  PREDICTED: ABC transporter G family member 2...    154   1e-39   Glycine max [soybeans]
ref|XP_012084913.1|  PREDICTED: ABC transporter G family member 9...    153   2e-39   
ref|XP_002443920.1|  hypothetical protein SORBIDRAFT_07g004390          153   3e-39   Sorghum bicolor [broomcorn]
gb|KHN00888.1|  ABC transporter G family member 21                      152   3e-39   Glycine soja [wild soybean]
ref|XP_004134252.1|  PREDICTED: ABC transporter G family member 9...    152   4e-39   Cucumis sativus [cucumbers]
ref|XP_006451938.1|  hypothetical protein CICLE_v10007744mg             152   4e-39   Citrus clementina [clementine]
ref|XP_006493205.1|  PREDICTED: ABC transporter G family member 9...    152   5e-39   Citrus sinensis [apfelsine]
emb|CAN77762.1|  hypothetical protein VITISV_026760                     147   8e-39   Vitis vinifera
ref|XP_006855537.2|  PREDICTED: ABC transporter G family member 14      151   1e-38   
gb|ERN17004.1|  hypothetical protein AMTR_s00057p00214480               151   1e-38   Amborella trichopoda
ref|XP_003556255.1|  PREDICTED: ABC transporter G family member 2...    151   1e-38   Glycine max [soybeans]
ref|XP_002867504.1|  abc transporter family protein                     149   5e-38   
gb|KHN37813.1|  ABC transporter G family member 21                      149   7e-38   Glycine soja [wild soybean]
gb|EEC82957.1|  hypothetical protein OsI_27950                          149   1e-37   Oryza sativa Indica Group [Indian rice]
dbj|BAC99536.1|  putative ABC transporter AbcG1                         149   1e-37   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ41641.1|  hypothetical protein OsJ_26175                          149   1e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010036577.1|  PREDICTED: ABC transporter G family member 2...    149   2e-37   Eucalyptus grandis [rose gum]
ref|XP_007199008.1|  hypothetical protein PRUPE_ppa017466mg             147   2e-37   
ref|XP_010110448.1|  ABC transporter G family member 22                 149   2e-37   
emb|CBI18157.3|  unnamed protein product                                147   3e-37   Vitis vinifera
ref|XP_002268373.1|  PREDICTED: ABC transporter G family member 25      147   4e-37   Vitis vinifera
gb|KJB14995.1|  hypothetical protein B456_002G153900                    145   7e-37   Gossypium raimondii
sp|Q9FT51.1|AB27G_ARATH  RecName: Full=ABC transporter G family m...    146   1e-36   Arabidopsis thaliana [mouse-ear cress]
gb|ABR17189.1|  unknown                                                 147   1e-36   Picea sitchensis
emb|CBI20349.3|  unnamed protein product                                144   1e-36   Vitis vinifera
ref|XP_002876135.1|  abc transporter family protein                     146   2e-36   
ref|XP_008237152.1|  PREDICTED: ABC transporter G family member 25      145   2e-36   Prunus mume [ume]
ref|XP_009796796.1|  PREDICTED: ABC transporter G family member 2...    144   2e-36   Nicotiana sylvestris
ref|NP_190799.2|  ABC transporter G family member 27                    145   2e-36   
ref|XP_002281949.1|  PREDICTED: ABC transporter G family member 9       144   2e-36   Vitis vinifera
ref|NP_001061077.2|  Os08g0167000                                       141   2e-36   
emb|CAN62144.1|  hypothetical protein VITISV_007841                     144   2e-36   Vitis vinifera
gb|KDO70711.1|  hypothetical protein CISIN_1g0045372mg                  142   3e-36   Citrus sinensis [apfelsine]
ref|XP_004228604.1|  PREDICTED: ABC transporter G family member 2...    145   3e-36   Solanum lycopersicum
ref|XP_006348422.1|  PREDICTED: ABC transporter G family member 2...    145   3e-36   Solanum tuberosum [potatoes]
ref|XP_009796795.1|  PREDICTED: ABC transporter G family member 2...    145   3e-36   Nicotiana sylvestris
ref|XP_010557969.1|  PREDICTED: ABC transporter G family member 2...    145   4e-36   Tarenaya hassleriana [spider flower]
gb|KJB16510.1|  hypothetical protein B456_002G233500                    144   4e-36   Gossypium raimondii
gb|KJB14994.1|  hypothetical protein B456_002G153900                    145   4e-36   Gossypium raimondii
gb|KJB14993.1|  hypothetical protein B456_002G153900                    145   4e-36   Gossypium raimondii
gb|KDO70708.1|  hypothetical protein CISIN_1g0045372mg                  143   5e-36   Citrus sinensis [apfelsine]
gb|KJB16511.1|  hypothetical protein B456_002G233500                    143   6e-36   Gossypium raimondii
gb|KDO70709.1|  hypothetical protein CISIN_1g0045372mg                  142   6e-36   Citrus sinensis [apfelsine]
gb|KHG09828.1|  ABC transporter G family member 22                      143   6e-36   Gossypium arboreum [tree cotton]
gb|KJB16514.1|  hypothetical protein B456_002G233500                    143   6e-36   Gossypium raimondii
ref|XP_008797781.1|  PREDICTED: ABC transporter G family member 26      143   7e-36   
gb|KDO70707.1|  hypothetical protein CISIN_1g0045372mg                  142   8e-36   Citrus sinensis [apfelsine]
ref|XP_006430002.1|  hypothetical protein CICLE_v10011143mg             143   8e-36   
ref|XP_010034170.1|  PREDICTED: ABC transporter G family member 9       143   8e-36   Eucalyptus grandis [rose gum]
ref|XP_008226675.1|  PREDICTED: ABC transporter G family member 9       142   9e-36   Prunus mume [ume]
ref|XP_011094211.1|  PREDICTED: ABC transporter G family member 2...    142   1e-35   
ref|XP_009414356.1|  PREDICTED: ABC transporter G family member 26      143   1e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011094213.1|  PREDICTED: ABC transporter G family member 2...    143   1e-35   
gb|KDO70704.1|  hypothetical protein CISIN_1g0045372mg                  142   1e-35   Citrus sinensis [apfelsine]
ref|XP_010277245.1|  PREDICTED: ABC transporter G family member 9...    144   1e-35   Nelumbo nucifera [Indian lotus]
gb|KJB16512.1|  hypothetical protein B456_002G233500                    143   1e-35   Gossypium raimondii
ref|XP_010917904.1|  PREDICTED: ABC transporter G family member 2...    142   2e-35   
ref|XP_009345933.1|  PREDICTED: ABC transporter G family member 2...    142   2e-35   Pyrus x bretschneideri [bai li]
ref|XP_006481645.1|  PREDICTED: ABC transporter G family member 2...    143   2e-35   Citrus sinensis [apfelsine]
ref|XP_009412322.1|  PREDICTED: ABC transporter G family member 2...    142   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008790010.1|  PREDICTED: ABC transporter G family member 2...    143   2e-35   Phoenix dactylifera
ref|XP_006300374.1|  hypothetical protein CARUB_v10022459mg             138   2e-35   
ref|XP_002888855.1|  hypothetical protein ARALYDRAFT_476326             142   2e-35   
ref|XP_010917903.1|  PREDICTED: ABC transporter G family member 2...    143   2e-35   Elaeis guineensis
ref|XP_008790027.1|  PREDICTED: ABC transporter G family member 2...    142   2e-35   
ref|XP_006376281.1|  hypothetical protein POPTR_0013s11630g             137   2e-35   
ref|XP_006430003.1|  hypothetical protein CICLE_v10011143mg             143   2e-35   Citrus clementina [clementine]
ref|XP_008790019.1|  PREDICTED: ABC transporter G family member 2...    142   2e-35   Phoenix dactylifera
gb|KCW50637.1|  hypothetical protein EUGRSUZ_J00337                     141   2e-35   Eucalyptus grandis [rose gum]
ref|XP_007214012.1|  hypothetical protein PRUPE_ppa014861mg             141   2e-35   
ref|XP_010521140.1|  PREDICTED: ABC transporter G family member 2...    142   2e-35   
ref|XP_008359521.1|  PREDICTED: ABC transporter G family member 2...    142   3e-35   
ref|XP_010064794.1|  PREDICTED: ABC transporter G family member 25      142   3e-35   
ref|XP_009412321.1|  PREDICTED: ABC transporter G family member 2...    142   3e-35   
gb|AAK92745.1|  putative ABC transporter protein                        141   3e-35   
ref|XP_011042541.1|  PREDICTED: ABC transporter G family member 2...    142   3e-35   
gb|KHG30511.1|  ABC transporter G family member 22                      141   3e-35   
gb|AIU41652.1|  ABC transporter family protein                          142   3e-35   
ref|NP_565030.1|  ABC transporter G family member 25                    141   3e-35   
ref|XP_006594328.1|  PREDICTED: ABC transporter G family member 9...    140   4e-35   
ref|XP_010535206.1|  PREDICTED: ABC transporter G family member 2...    140   5e-35   
ref|XP_004497624.1|  PREDICTED: ABC transporter G family member 2...    142   5e-35   
gb|KHN10345.1|  ABC transporter G family member 27                      141   5e-35   
gb|EPS69022.1|  hypothetical protein M569_05746                         140   5e-35   
ref|XP_008386302.1|  PREDICTED: ABC transporter G family member 9...    140   6e-35   
ref|XP_011042537.1|  PREDICTED: ABC transporter G family member 2...    141   6e-35   
ref|XP_003541547.2|  PREDICTED: ABC transporter G family member 9...    140   7e-35   
ref|XP_006588894.1|  PREDICTED: ABC transporter G family member 2...    141   7e-35   
gb|KJB36225.1|  hypothetical protein B456_006G147000                    141   7e-35   
ref|XP_010520902.1|  PREDICTED: ABC transporter G family member 9...    140   8e-35   
ref|XP_010912511.1|  PREDICTED: ABC transporter G family member 2...    140   8e-35   
ref|XP_003519092.1|  PREDICTED: ABC transporter G family member 2...    141   8e-35   
ref|XP_002263430.1|  PREDICTED: ABC transporter G family member 2...    141   8e-35   
ref|XP_009405790.1|  PREDICTED: ABC transporter G family member 2...    141   8e-35   
ref|XP_010471215.1|  PREDICTED: ABC transporter G family member 2...    140   9e-35   
ref|XP_006351917.1|  PREDICTED: ABC transporter G family member 2...    140   9e-35   
ref|XP_003535833.2|  PREDICTED: ABC transporter G family member 2...    141   1e-34   
ref|XP_006390723.1|  hypothetical protein EUTSA_v10018591mg             138   1e-34   
ref|XP_006441201.1|  hypothetical protein CICLE_v10023692mg             139   1e-34   
ref|XP_006575266.1|  PREDICTED: ABC transporter G family member 2...    141   1e-34   
ref|XP_007145759.1|  hypothetical protein PHAVU_007G265300g             140   1e-34   
ref|XP_009622617.1|  PREDICTED: ABC transporter G family member 2...    140   1e-34   
ref|XP_010942700.1|  PREDICTED: ABC transporter G family member 26      140   1e-34   
ref|XP_007143640.1|  hypothetical protein PHAVU_007G088800g             139   1e-34   
ref|XP_011467164.1|  PREDICTED: ABC transporter G family member 2...    140   2e-34   
ref|XP_004136536.1|  PREDICTED: ABC transporter G family member 22      140   2e-34   
gb|KDO40886.1|  hypothetical protein CISIN_1g046786mg                   139   2e-34   
ref|XP_007221425.1|  hypothetical protein PRUPE_ppa016652mg             134   2e-34   
gb|EYU38702.1|  hypothetical protein MIMGU_mgv1a001826mg                140   2e-34   
ref|XP_004303381.2|  PREDICTED: ABC transporter G family member 2...    140   3e-34   
ref|XP_006857737.1|  PREDICTED: ABC transporter G family member 26      139   3e-34   
gb|KHN46331.1|  ABC transporter G family member 9                       138   3e-34   
ref|XP_010428049.1|  PREDICTED: ABC transporter G family member 25      139   3e-34   
gb|KGN56224.1|  hypothetical protein Csa_3G102320                       138   3e-34   
ref|XP_010930786.1|  PREDICTED: ABC transporter G family member 25      138   3e-34   
ref|XP_010677592.1|  PREDICTED: ABC transporter G family member 22      139   3e-34   
emb|CDP16843.1|  unnamed protein product                                139   4e-34   
ref|XP_007140113.1|  hypothetical protein PHAVU_008G085200g             139   4e-34   
ref|XP_009125649.1|  PREDICTED: ABC transporter G family member 2...    139   4e-34   
ref|XP_009378509.1|  PREDICTED: ABC transporter G family member 9       138   4e-34   
ref|XP_010515694.1|  PREDICTED: ABC transporter G family member 27      139   4e-34   
ref|XP_004250400.1|  PREDICTED: ABC transporter G family member 25      138   4e-34   
ref|XP_006604670.1|  PREDICTED: ABC transporter G family member 2...    139   4e-34   
ref|XP_010415916.1|  PREDICTED: ABC transporter G family member 2...    138   5e-34   
ref|XP_011077784.1|  PREDICTED: ABC transporter G family member 22      139   5e-34   
gb|KHN43592.1|  ABC transporter G family member 22                      139   5e-34   
emb|CDX68292.1|  BnaA07g23320D                                          138   5e-34   
ref|XP_003552990.1|  PREDICTED: ABC transporter G family member 2...    138   5e-34   
ref|XP_006403815.1|  hypothetical protein EUTSA_v10010138mg             139   5e-34   
ref|XP_002322764.1|  ABC transporter family protein                     139   5e-34   
ref|XP_003553629.1|  PREDICTED: ABC transporter G family member 2...    139   5e-34   
emb|CDY04991.1|  BnaAnng01730D                                          139   5e-34   
ref|XP_006665124.1|  PREDICTED: ABC transporter G family member 1...    134   5e-34   
emb|CDY14079.1|  BnaC02g01960D                                          139   5e-34   
ref|XP_008380991.1|  PREDICTED: ABC transporter G family member 25      138   6e-34   
ref|XP_008461920.1|  PREDICTED: ABC transporter G family member 25      138   6e-34   
ref|XP_009127887.1|  PREDICTED: ABC transporter G family member 2...    138   7e-34   
ref|XP_010256405.1|  PREDICTED: ABC transporter G family member 25      137   8e-34   
emb|CDY03668.1|  BnaA02g15690D                                          138   8e-34   
ref|XP_006373817.1|  hypothetical protein POPTR_0016s06620g             138   9e-34   
ref|XP_012074259.1|  PREDICTED: ABC transporter G family member 22      138   9e-34   
ref|XP_006399125.1|  hypothetical protein EUTSA_v10012760mg             138   9e-34   
ref|XP_007163009.1|  hypothetical protein PHAVU_001G198400g             138   9e-34   
emb|CDX96366.1|  BnaA07g29770D                                          134   1e-33   
ref|XP_007019433.1|  White-brown-complex ABC transporter family         138   1e-33   
ref|XP_009362642.1|  PREDICTED: ABC transporter G family member 2...    138   1e-33   
ref|XP_004139680.2|  PREDICTED: ABC transporter G family member 2...    137   1e-33   
emb|CDX82199.1|  BnaC02g20910D                                          137   1e-33   
ref|XP_003521505.1|  PREDICTED: ABC transporter G family member 2...    137   2e-33   
gb|ERN02964.1|  hypothetical protein AMTR_s00134p00069640               136   2e-33   
gb|KJB16513.1|  hypothetical protein B456_002G233500                    136   2e-33   
gb|KEH43567.1|  white-brown-complex ABC transporter family protein      137   2e-33   
ref|XP_007021331.1|  White-brown-complex ABC transporter family         136   2e-33   
gb|KFK41612.1|  hypothetical protein AALP_AA2G151000                    136   2e-33   
ref|XP_002524100.1|  ATP-binding cassette transporter, putative         137   2e-33   
ref|XP_009104883.1|  PREDICTED: ABC transporter G family member 2...    136   2e-33   
ref|XP_010244004.1|  PREDICTED: ABC transporter G family member 2...    137   2e-33   
ref|XP_009383524.1|  PREDICTED: ABC transporter G family member 2...    136   2e-33   
ref|XP_010244001.1|  PREDICTED: ABC transporter G family member 2...    137   2e-33   
ref|XP_010244002.1|  PREDICTED: ABC transporter G family member 2...    137   2e-33   
ref|XP_007204637.1|  hypothetical protein PRUPE_ppa001882mg             137   3e-33   
ref|XP_010519981.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    137   3e-33   
ref|XP_009362643.1|  PREDICTED: ABC transporter G family member 2...    137   3e-33   
ref|XP_008382026.1|  PREDICTED: ABC transporter G family member 2...    136   3e-33   
ref|XP_011094212.1|  PREDICTED: ABC transporter G family member 2...    135   3e-33   
emb|CBI35490.3|  unnamed protein product                                137   3e-33   
ref|XP_008442969.1|  PREDICTED: ABC transporter G family member 2...    137   3e-33   
ref|XP_008442971.1|  PREDICTED: ABC transporter G family member 2...    137   3e-33   
ref|XP_011005152.1|  PREDICTED: ABC transporter G family member 2...    135   3e-33   
ref|XP_007142441.1|  hypothetical protein PHAVU_008G280800g             136   4e-33   
ref|XP_007133073.1|  hypothetical protein PHAVU_011G149300g             135   4e-33   
gb|KHN17077.1|  ABC transporter G family member 25                      135   4e-33   
ref|XP_009604112.1|  PREDICTED: ABC transporter G family member 25      135   4e-33   
ref|XP_004294923.1|  PREDICTED: ABC transporter G family member 26      136   4e-33   
ref|XP_008241114.1|  PREDICTED: ABC transporter G family member 2...    136   4e-33   
ref|XP_008241111.1|  PREDICTED: ABC transporter G family member 2...    136   4e-33   
emb|CDX70095.1|  BnaA10g24440D                                          136   5e-33   
ref|XP_008349497.1|  PREDICTED: ABC transporter G family member 2...    135   6e-33   
ref|XP_010426848.1|  PREDICTED: ABC transporter G family member 2...    136   6e-33   
ref|XP_010503972.1|  PREDICTED: ABC transporter G family member 2...    136   6e-33   
ref|XP_012065776.1|  PREDICTED: ABC transporter G family member 25      135   6e-33   
gb|KHN07535.1|  ABC transporter G family member 21                      134   7e-33   
ref|XP_010491223.1|  PREDICTED: ABC transporter G family member 2...    135   8e-33   
gb|KJB19215.1|  hypothetical protein B456_003G089800                    134   8e-33   
ref|XP_009105860.1|  PREDICTED: ABC transporter G family member 25      135   8e-33   
ref|XP_009122262.1|  PREDICTED: ABC transporter G family member 2...    135   8e-33   
gb|KJB36224.1|  hypothetical protein B456_006G147000                    134   9e-33   
ref|XP_006287123.1|  hypothetical protein CARUB_v10000295mg             135   9e-33   
ref|XP_002873263.1|  abc transporter family protein                     135   9e-33   
ref|XP_010491222.1|  PREDICTED: ABC transporter G family member 2...    135   1e-32   
ref|XP_010680137.1|  PREDICTED: ABC transporter G family member 2...    135   1e-32   
ref|XP_009122263.1|  PREDICTED: ABC transporter G family member 2...    135   1e-32   
ref|XP_009799082.1|  PREDICTED: ABC transporter G family member 2...    135   1e-32   
ref|XP_002884953.1|  abc transporter family protein                     134   1e-32   
gb|KDO83898.1|  hypothetical protein CISIN_1g0057542mg                  131   1e-32   
ref|XP_004965922.1|  PREDICTED: ABC transporter G family member 2...    134   1e-32   
ref|XP_006656226.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    134   1e-32   
dbj|BAB01414.1|  ABC transporter-like protein                           134   1e-32   
ref|NP_001031843.1|  ABC transporter G family member 22                 134   1e-32   
ref|NP_187928.2|  ABC transporter G family member 26                    134   1e-32   
ref|XP_003563648.1|  PREDICTED: ABC transporter G family member 2...    134   1e-32   
gb|KJB19216.1|  hypothetical protein B456_003G089800                    134   1e-32   
ref|XP_007207412.1|  hypothetical protein PRUPE_ppa014606mg             134   2e-32   
ref|XP_004496375.1|  PREDICTED: ABC transporter G family member 2...    134   2e-32   
gb|AET00827.2|  white-brown-complex ABC transporter family protein      134   2e-32   
ref|XP_010247278.1|  PREDICTED: ABC transporter G family member 2...    135   2e-32   
ref|XP_011622191.1|  PREDICTED: ABC transporter G family member 21      133   2e-32   
ref|XP_007200734.1|  hypothetical protein PRUPE_ppa021401mg             134   2e-32   
ref|XP_006370303.1|  hypothetical protein POPTR_0001s41450g             133   2e-32   
ref|XP_009348549.1|  PREDICTED: ABC transporter G family member 2...    134   2e-32   
ref|NP_568169.1|  ABC transporter G family member 22                    134   2e-32   
ref|XP_010465139.1|  PREDICTED: ABC transporter G family member 26      134   2e-32   
ref|XP_010423326.1|  PREDICTED: ABC transporter G family member 2...    134   2e-32   
ref|XP_009799080.1|  PREDICTED: ABC transporter G family member 2...    134   2e-32   
ref|XP_002522797.1|  ATP-binding cassette transporter, putative         134   2e-32   
gb|KEH41805.1|  white-brown-complex ABC transporter family protein      134   2e-32   
ref|NP_001058033.1|  Os06g0607700                                       134   2e-32   
ref|XP_002465834.1|  hypothetical protein SORBIDRAFT_01g046620          134   2e-32   
ref|XP_010452592.1|  PREDICTED: ABC transporter G family member 22      134   2e-32   
emb|CDX72849.1|  BnaC06g32970D                                          134   2e-32   
emb|CDP13689.1|  unnamed protein product                                134   2e-32   
ref|XP_010542511.1|  PREDICTED: ABC transporter G family member 2...    134   2e-32   
ref|XP_010542512.1|  PREDICTED: ABC transporter G family member 2...    134   3e-32   
dbj|BAB11402.1|  ABC transporter-like protein                           132   3e-32   
ref|XP_006292375.1|  hypothetical protein CARUB_v10018588mg             134   3e-32   
ref|XP_008791161.1|  PREDICTED: ABC transporter G family member 2...    133   3e-32   
ref|XP_009406088.1|  PREDICTED: ABC transporter G family member 2...    133   3e-32   
ref|XP_002325552.2|  ABC transporter family protein                     133   3e-32   
ref|XP_009769371.1|  PREDICTED: ABC transporter G family member 25      133   3e-32   
ref|XP_010227525.1|  PREDICTED: ABC transporter G family member 2...    134   3e-32   
emb|CDX98933.1|  BnaC09g49020D                                          134   3e-32   
gb|KJB19217.1|  hypothetical protein B456_003G089800                    134   3e-32   
ref|XP_011042498.1|  PREDICTED: ABC transporter G family member 9...    133   3e-32   
ref|XP_002300394.2|  ABC transporter family protein                     133   3e-32   
ref|XP_003555426.1|  PREDICTED: ABC transporter G family member 2...    133   3e-32   
ref|XP_010487069.1|  PREDICTED: ABC transporter G family member 2...    133   4e-32   
ref|XP_008781545.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    133   4e-32   
ref|XP_006407250.1|  hypothetical protein EUTSA_v10020198mg             133   4e-32   
gb|AFW65418.1|  hypothetical protein ZEAMMB73_370543                    130   4e-32   
dbj|BAK06297.1|  predicted protein                                      134   5e-32   
ref|XP_011038858.1|  PREDICTED: ABC transporter G family member 26      133   5e-32   
ref|XP_006300234.1|  hypothetical protein CARUB_v10016471mg             133   5e-32   
gb|KJB35860.1|  hypothetical protein B456_006G130900                    129   5e-32   
ref|XP_009406087.1|  PREDICTED: ABC transporter G family member 2...    132   5e-32   
emb|CDY36670.1|  BnaCnng07720D                                          130   6e-32   
gb|EMS65761.1|  ABC transporter G family member 22                      132   6e-32   
ref|XP_008237629.1|  PREDICTED: ABC transporter G family member 2...    133   6e-32   
ref|XP_011659121.1|  PREDICTED: ABC transporter G family member 2...    132   6e-32   
gb|KEH24294.1|  white-brown-complex ABC transporter family protein      133   6e-32   
ref|XP_010500190.1|  PREDICTED: ABC transporter G family member 2...    132   7e-32   
ref|XP_011101660.1|  PREDICTED: ABC transporter G family member 2...    133   7e-32   
ref|XP_003535544.1|  PREDICTED: ABC transporter G family member 2...    132   8e-32   
ref|XP_008218542.1|  PREDICTED: ABC transporter G family member 26      132   8e-32   
dbj|BAJ88390.1|  predicted protein                                      132   9e-32   
ref|XP_006434601.1|  hypothetical protein CICLE_v10003388mg             129   9e-32   
ref|XP_004498150.1|  PREDICTED: ABC transporter G family member 2...    132   1e-31   
emb|CAN66426.1|  hypothetical protein VITISV_029010                     132   1e-31   
ref|XP_011029437.1|  PREDICTED: ABC transporter G family member 9...    131   1e-31   
ref|XP_008392009.1|  PREDICTED: ABC transporter G family member 2...    132   1e-31   
ref|XP_006604672.1|  PREDICTED: ABC transporter G family member 2...    131   1e-31   
gb|KFK38655.1|  hypothetical protein AALP_AA3G143100                    131   1e-31   
tpg|DAA38970.1|  TPA: hypothetical protein ZEAMMB73_453991              128   2e-31   
ref|XP_010676075.1|  PREDICTED: ABC transporter G family member 26      131   2e-31   
ref|XP_011001789.1|  PREDICTED: ABC transporter G family member 2...    131   2e-31   
ref|XP_006649428.1|  PREDICTED: ABC transporter G family member 2...    131   2e-31   
gb|KHG09588.1|  ABC transporter G family member 25                      131   2e-31   
gb|KDO59196.1|  hypothetical protein CISIN_1g044602mg                   131   2e-31   
gb|AAM51832.1|AC105730_6  Putative ABC transporter                      131   2e-31   
ref|XP_006473186.1|  PREDICTED: ABC transporter G family member 2...    131   2e-31   
ref|XP_006430004.1|  hypothetical protein CICLE_v10011143mg             130   2e-31   
gb|KDO70706.1|  hypothetical protein CISIN_1g0045372mg                  130   2e-31   
ref|XP_009362644.1|  PREDICTED: ABC transporter G family member 2...    130   2e-31   
ref|XP_006452648.1|  hypothetical protein CICLE_v10010223mg             131   2e-31   
ref|XP_012071074.1|  PREDICTED: ABC transporter G family member 26      131   2e-31   
ref|XP_006474829.1|  PREDICTED: ABC transporter G family member 2...    131   2e-31   
ref|XP_009367249.1|  PREDICTED: ABC transporter G family member 26      131   2e-31   
gb|KHN36795.1|  ABC transporter G family member 9                       130   2e-31   
ref|XP_002526137.1|  ATP-binding cassette transporter, putative         131   2e-31   
ref|XP_004494279.1|  PREDICTED: ABC transporter G family member 2...    131   2e-31   
ref|XP_009388615.1|  PREDICTED: ABC transporter G family member 2...    131   3e-31   
ref|XP_002438658.1|  hypothetical protein SORBIDRAFT_10g023750          130   3e-31   
ref|XP_010265777.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    131   3e-31   
ref|XP_008662280.1|  PREDICTED: hypothetical protein isoform X1         131   3e-31   
gb|EEC74548.1|  hypothetical protein OsI_10084                          131   3e-31   
ref|NP_001049014.1|  Os03g0157400                                       131   3e-31   
ref|XP_009388622.1|  PREDICTED: ABC transporter G family member 2...    131   3e-31   
gb|ACN85155.1|  ABC transporter-like protein                            130   3e-31   
ref|XP_004494278.1|  PREDICTED: ABC transporter G family member 2...    131   3e-31   
gb|AFK44306.1|  unknown                                                 127   3e-31   
ref|XP_002316916.1|  ABC transporter family protein                     130   4e-31   



>ref|XP_009802424.1| PREDICTED: ABC transporter G family member 14-like [Nicotiana 
sylvestris]
Length=658

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 150/182 (82%), Gaps = 5/182 (3%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAA-PDKPCLAYPLQTNTQSFLQRALYPIV  292
            MP ++ +APKPEN   +     AA TN P  +   D  CLA+P+Q N+QSF QRALYPI 
Sbjct  1    MP-VNCIAPKPENSGTEVM---AAPTNLPNPSELHDMSCLAFPVQINSQSFSQRALYPIT  56

Query  293  LKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            LKFEEIVYK+  E +G CC G S+ +EKTILNGVTG+VCPGE+LAMLGPSGSGKTTLLTA
Sbjct  57   LKFEEIVYKIRQETQGMCCGGTSNTKEKTILNGVTGIVCPGEMLAMLGPSGSGKTTLLTA  116

Query  473  LGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLT  652
            LGGRL GKLSGK+TYNSQPFSGSIKR TGFVAQDDVLYPHLTV ETLLFTALLRLPQSL+
Sbjct  117  LGGRLSGKLSGKITYNSQPFSGSIKRRTGFVAQDDVLYPHLTVIETLLFTALLRLPQSLS  176

Query  653  RE  658
            +E
Sbjct  177  KE  178



>ref|XP_010324495.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Solanum lycopersicum]
Length=671

 Score =   256 bits (653),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 147/180 (82%), Gaps = 3/180 (2%)
 Frame = +2

Query  125  LHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQ-SFLQRALYPIVLKF  301
            LH V PKPEN   D  + +A+T +  +    DK CLA P+Q  +Q S+LQ+A+YPI LKF
Sbjct  3    LHGVTPKPENGGTD--LMEASTNSPNSSKQYDKSCLALPVQIKSQQSYLQKAMYPITLKF  60

Query  302  EEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGG  481
            EEIVYK+  E+KG CC G S+ +EKTILNGVTG V PGE+LAMLGPSGSGKTTLLTALGG
Sbjct  61   EEIVYKISQENKGMCCGGSSNTKEKTILNGVTGTVYPGEMLAMLGPSGSGKTTLLTALGG  120

Query  482  RLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            RL GKLSGK+TYNSQPFSGSIKR TGFV+QDDVLYPHLTV ETLLFTALLRLPQ+L R+E
Sbjct  121  RLSGKLSGKITYNSQPFSGSIKRRTGFVSQDDVLYPHLTVIETLLFTALLRLPQNLERDE  180



>ref|XP_009631041.1| PREDICTED: ABC transporter G family member 14-like [Nicotiana 
tomentosiformis]
Length=660

 Score =   255 bits (652),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 150/183 (82%), Gaps = 6/183 (3%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQP-ADAAPDKPCLAYPLQTNTQSFLQRALYPIV  292
            MP ++ V+PKPEN   +     AA TN P +    D  CLA+P+Q N+QSF QRALYPI 
Sbjct  1    MP-VNCVSPKPENGGTELM---AAPTNLPDSSELHDMSCLAFPVQFNSQSFAQRALYPIT  56

Query  293  LKFEEIVYKVGGEDKGSCC-TGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLT  469
            LKFEEIVYK+  E +G CC  G S+ +EKTILNGVTG+VCPGE+LAMLGPSGSGKTTLLT
Sbjct  57   LKFEEIVYKIRQETQGMCCGDGASNTKEKTILNGVTGIVCPGEMLAMLGPSGSGKTTLLT  116

Query  470  ALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSL  649
            ALGGRL GKLSGK+TYNSQPFSGSIKR TGFVAQDDVLYPHLTV ETLLFTALLRLPQSL
Sbjct  117  ALGGRLSGKLSGKITYNSQPFSGSIKRKTGFVAQDDVLYPHLTVIETLLFTALLRLPQSL  176

Query  650  TRE  658
            ++E
Sbjct  177  SKE  179



>ref|XP_011071699.1| PREDICTED: ABC transporter G family member 14-like [Sesamum indicum]
Length=653

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 143/177 (81%), Gaps = 6/177 (3%)
 Frame = +2

Query  131  SVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEI  310
            SVAPK EN +           N+P   A +   LAYP+Q N+QSFLQR LYPI LKFEEI
Sbjct  5    SVAPKLENGTELV----TGLPNRPE--ACNTAYLAYPIQRNSQSFLQRILYPITLKFEEI  58

Query  311  VYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLY  490
            VYKV  E KG+CC G SS +EKTILNG+TGMVCPGEILAMLGPSGSGKTTLLTALGGRL 
Sbjct  59   VYKVNSERKGTCCGGTSSTKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLTALGGRLS  118

Query  491  GKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            G+LSGK+TYN QPFSGSIKR TGFVAQDDVLYPHLTV ETL+FTALLRLP SLT+EE
Sbjct  119  GRLSGKITYNGQPFSGSIKRRTGFVAQDDVLYPHLTVFETLVFTALLRLPNSLTKEE  175



>ref|XP_006361227.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Solanum tuberosum]
Length=662

 Score =   253 bits (647),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 145/180 (81%), Gaps = 3/180 (2%)
 Frame = +2

Query  125  LHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQ-SFLQRALYPIVLKF  301
            LH VAP PE    D  + +A+T +  +    DK CL +P+Q  +Q SFLQ+A+YPI LKF
Sbjct  3    LHCVAPNPEKGGTD--LMEASTNSPNSSKQYDKSCLGFPVQIKSQQSFLQKAMYPITLKF  60

Query  302  EEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGG  481
            EEIVYK+  E+KG CC G S+ +EKTILNGVTG V PGE+LAMLGPSGSGKTTLLTALGG
Sbjct  61   EEIVYKISQENKGMCCGGPSNTKEKTILNGVTGTVYPGEMLAMLGPSGSGKTTLLTALGG  120

Query  482  RLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            RL GKLSGK+TYNSQPFSGSIKR TGFV+QDDVLYPHLTV ETLLFTALLRLPQSL R E
Sbjct  121  RLSGKLSGKITYNSQPFSGSIKRRTGFVSQDDVLYPHLTVIETLLFTALLRLPQSLDRVE  180



>ref|XP_006361228.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Solanum tuberosum]
Length=659

 Score =   253 bits (646),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 145/180 (81%), Gaps = 3/180 (2%)
 Frame = +2

Query  125  LHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQ-SFLQRALYPIVLKF  301
            LH VAP PE    D  + +A+T +  +    DK CL +P+Q  +Q SFLQ+A+YPI LKF
Sbjct  3    LHCVAPNPEKGGTD--LMEASTNSPNSSKQYDKSCLGFPVQIKSQQSFLQKAMYPITLKF  60

Query  302  EEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGG  481
            EEIVYK+  E+KG CC G S+ +EKTILNGVTG V PGE+LAMLGPSGSGKTTLLTALGG
Sbjct  61   EEIVYKISQENKGMCCGGPSNTKEKTILNGVTGTVYPGEMLAMLGPSGSGKTTLLTALGG  120

Query  482  RLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            RL GKLSGK+TYNSQPFSGSIKR TGFV+QDDVLYPHLTV ETLLFTALLRLPQSL R E
Sbjct  121  RLSGKLSGKITYNSQPFSGSIKRRTGFVSQDDVLYPHLTVIETLLFTALLRLPQSLDRVE  180



>ref|XP_004246010.1| PREDICTED: ABC transporter G family member 14 [Solanum lycopersicum]
Length=646

 Score =   250 bits (638),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 144/182 (79%), Gaps = 15/182 (8%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVL  295
            MP LH VAPKPEN   +              AAP  P  + P   N++SF+QRAL+PI L
Sbjct  1    MP-LHCVAPKPENFGTELM------------AAP--PNSSKPEMNNSESFIQRALFPITL  45

Query  296  KFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTAL  475
            KFEE+VYK+  E KG CC G SS +EKTILNGVTG+VCPGE+LAMLGPSGSGKTTLLTAL
Sbjct  46   KFEEVVYKIKQETKGMCCGGPSSTKEKTILNGVTGIVCPGEMLAMLGPSGSGKTTLLTAL  105

Query  476  GGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTR  655
            GGRL GKLSGK+TYNSQPFSG+IKR TGFVAQDDVLYPHLTV ETLLFTALLRLPQSL+R
Sbjct  106  GGRLSGKLSGKITYNSQPFSGAIKRRTGFVAQDDVLYPHLTVTETLLFTALLRLPQSLSR  165

Query  656  EE  661
            EE
Sbjct  166  EE  167



>ref|XP_006359961.1| PREDICTED: ABC transporter G family member 14-like [Solanum tuberosum]
Length=646

 Score =   247 bits (631),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 143/182 (79%), Gaps = 15/182 (8%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVL  295
            MP LH VAPKPEN   +               AP  P  + P   N++SF+QRAL+PI L
Sbjct  1    MP-LHCVAPKPENFGTEL-------------MAPP-PNSSKPEMKNSESFIQRALFPITL  45

Query  296  KFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTAL  475
            KFEE+VYK+  E KG CC G SS +EKTILNGVTG+VCPGE+LAMLGPSGSGKTTLLTAL
Sbjct  46   KFEEVVYKIKQETKGMCCGGPSSTKEKTILNGVTGIVCPGEMLAMLGPSGSGKTTLLTAL  105

Query  476  GGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTR  655
            GGRL GKLSGK+TYNSQPFSG+IKR TGFVAQDDVLYPHLTV ETLLFTALLRLPQSL+R
Sbjct  106  GGRLSGKLSGKITYNSQPFSGAIKRRTGFVAQDDVLYPHLTVTETLLFTALLRLPQSLSR  165

Query  656  EE  661
            EE
Sbjct  166  EE  167



>ref|XP_002270533.2| PREDICTED: ABC transporter G family member 14 [Vitis vinifera]
 emb|CBI29188.3| unnamed protein product [Vitis vinifera]
Length=657

 Score =   244 bits (624),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 144/182 (79%), Gaps = 6/182 (3%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVL  295
            MP L+ +APKPEN   +  M+  + T++  ++A     L YP+QTN+QS LQ  LY I L
Sbjct  1    MP-LNCIAPKPEN-QGNIPMEGLSRTSESDNSA----VLTYPMQTNSQSILQHTLYSINL  54

Query  296  KFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTAL  475
            KFEE+VYKV  E KG C  G  S R+KTILNG+TGMVCPGEILAMLGPSGSGKTTLLTAL
Sbjct  55   KFEEVVYKVKLEQKGFCWGGAWSTRDKTILNGITGMVCPGEILAMLGPSGSGKTTLLTAL  114

Query  476  GGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTR  655
            GGRL GKLSGK+TYN QPFSG++KR TGFVAQDDVLYPHLTV ETLLFTALLRLP+SL R
Sbjct  115  GGRLNGKLSGKITYNGQPFSGAVKRRTGFVAQDDVLYPHLTVTETLLFTALLRLPKSLAR  174

Query  656  EE  661
             E
Sbjct  175  NE  176



>emb|CDP07185.1| unnamed protein product [Coffea canephora]
Length=655

 Score =   242 bits (618),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 143/182 (79%), Gaps = 6/182 (3%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVL  295
            MP L+SVAPKPEN S  Q M     +++  D     P LAYP+Q  TQSFLQ    PI L
Sbjct  1    MP-LNSVAPKPENPSI-QLMGGLPISSESCD----NPYLAYPIQARTQSFLQMTSNPITL  54

Query  296  KFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTAL  475
            KFEEIVYKV  E KG CC    S++EKTILNG+TGMVCPGEILAMLGPSGSGKTTLLTAL
Sbjct  55   KFEEIVYKVRIETKGMCCGQTLSSKEKTILNGLTGMVCPGEILAMLGPSGSGKTTLLTAL  114

Query  476  GGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTR  655
            GGRL  KLSGK+TYN+QP SG I+R TGFVAQDDVLYPHLTV ETLLFTALLRLP++LT+
Sbjct  115  GGRLTSKLSGKITYNTQPISGHIRRQTGFVAQDDVLYPHLTVFETLLFTALLRLPKTLTK  174

Query  656  EE  661
            EE
Sbjct  175  EE  176



>ref|XP_006385164.1| ABC transporter family protein [Populus trichocarpa]
 gb|ERP62961.1| ABC transporter family protein [Populus trichocarpa]
Length=656

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 143/183 (78%), Gaps = 9/183 (5%)
 Frame = +2

Query  116  MPALHSVAPKPE-NCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIV  292
            MP L+ V PKP+ N +P + +     TN       ++  L+YP Q N+QS LQ  +YP  
Sbjct  1    MP-LNYVVPKPDHNSAPTEGLPRMPETN-------NRAVLSYPGQANSQSVLQLTIYPTT  52

Query  293  LKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            LKFEE+VYKV  + KG C  G  S+REKTILNG+TGMVCPGEILAMLGPSGSGKTTLLTA
Sbjct  53   LKFEEVVYKVKLDQKGLCWGGTWSSREKTILNGITGMVCPGEILAMLGPSGSGKTTLLTA  112

Query  473  LGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLT  652
            LGGRL GKLSGK+TYN QPFSG++KR TGFVAQDD+LYPHLTV ETLLFTALLRLP++LT
Sbjct  113  LGGRLSGKLSGKITYNGQPFSGTMKRRTGFVAQDDILYPHLTVSETLLFTALLRLPKTLT  172

Query  653  REE  661
            REE
Sbjct  173  REE  175



>ref|XP_011082193.1| PREDICTED: ABC transporter G family member 14-like [Sesamum indicum]
Length=653

 Score =   240 bits (612),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 146/187 (78%), Gaps = 15/187 (8%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKP-----CLAYPLQTNTQSFLQRAL  280
            MP L SVAPK EN       D   T    A++ P +P      LAYP+Q +++SFLQR L
Sbjct  1    MP-LGSVAPKLEN-------DVDGTV--LANSTPHRPESCDTALAYPVQNSSRSFLQRTL  50

Query  281  YPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTT  460
            YPI LKFEEIVYKV  E K SC    +SA+EKTILNG+TGMV PGEILAMLGPSGSGKTT
Sbjct  51   YPITLKFEEIVYKVYYERKRSCGGTSTSAKEKTILNGITGMVSPGEILAMLGPSGSGKTT  110

Query  461  LLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLP  640
            LLTALGGRL GKLSGK+TYN QPFSGSIKR TGFVAQDDVLYPHLTV ETLLFTALLRLP
Sbjct  111  LLTALGGRLSGKLSGKITYNGQPFSGSIKRRTGFVAQDDVLYPHLTVFETLLFTALLRLP  170

Query  641  QSLTREE  661
            +SL+++E
Sbjct  171  KSLSKDE  177



>ref|XP_011028515.1| PREDICTED: ABC transporter G family member 14-like [Populus euphratica]
Length=656

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 140/183 (77%), Gaps = 9/183 (5%)
 Frame = +2

Query  116  MPALHSVAPKPE-NCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIV  292
            MP L  V PKP+ N +P + +     TN       ++  L+YP Q N+QS LQ  +YP  
Sbjct  1    MP-LSYVVPKPDHNSAPTEGLPKMPETN-------NRAVLSYPGQANSQSVLQLTIYPTT  52

Query  293  LKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            LKFEE+VYKV    KG C  G  S REKTILNG+TGMVCPGEILAMLGPSGSGKTTLLTA
Sbjct  53   LKFEEVVYKVKLNQKGLCWGGAWSTREKTILNGITGMVCPGEILAMLGPSGSGKTTLLTA  112

Query  473  LGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLT  652
            LGGRL GKLSGK+TYN QPFSG++KR TGFVAQDD+LYPHLTV ETLLFTALLRLP++LT
Sbjct  113  LGGRLSGKLSGKITYNGQPFSGTMKRRTGFVAQDDILYPHLTVSETLLFTALLRLPKTLT  172

Query  653  REE  661
            REE
Sbjct  173  REE  175



>ref|XP_003548769.1| PREDICTED: ABC transporter G family member 14-like [Glycine max]
 gb|KHN30742.1| ABC transporter G family member 14 [Glycine soja]
Length=651

 Score =   236 bits (602),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 134/172 (78%), Gaps = 2/172 (1%)
 Frame = +2

Query  146  PENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVG  325
            PENC   +   + + T  P +  P+      P+QTN QSF + A+YPI LKFEE+VYKV 
Sbjct  2    PENCIAPK--SEHSNTTHPEEGPPEMTQTVLPIQTNKQSFPKLAMYPITLKFEELVYKVK  59

Query  326  GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSG  505
             E KG C     S +EKTIL GVTGMVCPGEI+AMLGPSGSGKTTLLTALGGRL GKLSG
Sbjct  60   IEQKGVCWGSTRSCKEKTILKGVTGMVCPGEIMAMLGPSGSGKTTLLTALGGRLSGKLSG  119

Query  506  KVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            KVTYN+QPFSG++KR TGFVAQDDVLYPHLTV ETLLFTALLRLP +LT+EE
Sbjct  120  KVTYNNQPFSGAMKRRTGFVAQDDVLYPHLTVTETLLFTALLRLPNTLTKEE  171



>ref|XP_012072650.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Jatropha curcas]
Length=681

 Score =   234 bits (597),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 134/167 (80%), Gaps = 6/167 (4%)
 Frame = +2

Query  167  QRMDDAATTN--QPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKG  340
            Q++  A   N  +P D A     LAYP+Q N+QS L+ ++YPI LKFEE+VYKV  E KG
Sbjct  41   QQVQSARQRNMSEPNDGA----VLAYPVQPNSQSVLRLSIYPITLKFEEVVYKVKLEQKG  96

Query  341  SCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYN  520
             C  G    +EKTILNG+TGMVCPGEILAMLGPSGSGKTTLLTALGGR+ GKLSGKVTYN
Sbjct  97   VCWGGTWGTKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLTALGGRINGKLSGKVTYN  156

Query  521  SQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
             QPFSG+IKR TGFVAQDDVLYPHLTV ETL+FTALLRLP++LT EE
Sbjct  157  GQPFSGTIKRRTGFVAQDDVLYPHLTVTETLVFTALLRLPKTLTNEE  203



>ref|XP_002519942.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF42546.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=634

 Score =   233 bits (595),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = +2

Query  221  KPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTG  400
            +  LAYP+Q N QS LQ  +YPI LKFEE+VYKV  E KGSCC G  + +EKTILNG+TG
Sbjct  7    ETVLAYPVQPNQQSVLQLTVYPITLKFEEVVYKVKLEQKGSCCGGTWATKEKTILNGITG  66

Query  401  MVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDV  580
            MVCPGEILAMLGPSGSGKTTLLTALGGRL GKLSGK+TYN QPFSG+ KR TGFV QDD+
Sbjct  67   MVCPGEILAMLGPSGSGKTTLLTALGGRLNGKLSGKITYNGQPFSGATKRRTGFVPQDDI  126

Query  581  LYPHLTVKETLLFTALLRLPQSLTREE  661
            LYPHLTV ETLLFTALLRLP++LT++E
Sbjct  127  LYPHLTVTETLLFTALLRLPKTLTKDE  153



>gb|KDP37810.1| hypothetical protein JCGZ_06712 [Jatropha curcas]
Length=669

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 134/167 (80%), Gaps = 6/167 (4%)
 Frame = +2

Query  167  QRMDDAATTN--QPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKG  340
            Q++  A   N  +P D A     LAYP+Q N+QS L+ ++YPI LKFEE+VYKV  E KG
Sbjct  41   QQVQSARQRNMSEPNDGA----VLAYPVQPNSQSVLRLSIYPITLKFEEVVYKVKLEQKG  96

Query  341  SCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYN  520
             C  G    +EKTILNG+TGMVCPGEILAMLGPSGSGKTTLLTALGGR+ GKLSGKVTYN
Sbjct  97   VCWGGTWGTKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLTALGGRINGKLSGKVTYN  156

Query  521  SQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
             QPFSG+IKR TGFVAQDDVLYPHLTV ETL+FTALLRLP++LT EE
Sbjct  157  GQPFSGTIKRRTGFVAQDDVLYPHLTVTETLVFTALLRLPKTLTNEE  203



>ref|XP_012072651.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Jatropha curcas]
Length=681

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 134/167 (80%), Gaps = 6/167 (4%)
 Frame = +2

Query  167  QRMDDAATTN--QPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKG  340
            Q++  A   N  +P D A     LAYP+Q N+QS L+ ++YPI LKFEE+VYKV  E KG
Sbjct  41   QQVQSARQRNMSEPNDGA----VLAYPVQPNSQSVLRLSIYPITLKFEEVVYKVKLEQKG  96

Query  341  SCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYN  520
             C  G    +EKTILNG+TGMVCPGEILAMLGPSGSGKTTLLTALGGR+ GKLSGKVTYN
Sbjct  97   VCWGGTWGTKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLTALGGRINGKLSGKVTYN  156

Query  521  SQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
             QPFSG+IKR TGFVAQDDVLYPHLTV ETL+FTALLRLP++LT EE
Sbjct  157  GQPFSGTIKRRTGFVAQDDVLYPHLTVTETLVFTALLRLPKTLTNEE  203



>ref|XP_011013139.1| PREDICTED: ABC transporter G family member 14-like [Populus euphratica]
 ref|XP_011015812.1| PREDICTED: ABC transporter G family member 14-like [Populus euphratica]
Length=656

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 141/183 (77%), Gaps = 9/183 (5%)
 Frame = +2

Query  116  MPALHSVAPKPENCS-PDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIV  292
            MP L+S+ PKP++ S P + +   +  N       ++  +AYP Q N+QS  Q  +YP  
Sbjct  1    MP-LNSIVPKPDHKSAPVEGLRKMSEIN-------NRAVVAYPGQANSQSVHQLTIYPTT  52

Query  293  LKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            LKFEE+VYKV  + KG C  G  + REKTILN VTGMVCPGEILAMLGPSGSGKTTLLTA
Sbjct  53   LKFEEVVYKVKQDQKGLCWGGTWTTREKTILNEVTGMVCPGEILAMLGPSGSGKTTLLTA  112

Query  473  LGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLT  652
            LGGRL GKLSGK+TYN QPFSG++KR TGFVAQDD+LYPHLTV ETLLFTALLRLP++LT
Sbjct  113  LGGRLSGKLSGKITYNGQPFSGAMKRRTGFVAQDDILYPHLTVTETLLFTALLRLPKTLT  172

Query  653  REE  661
            R+E
Sbjct  173  RDE  175



>ref|XP_010275138.1| PREDICTED: ABC transporter G family member 14 [Nelumbo nucifera]
Length=654

 Score =   232 bits (592),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 135/176 (77%), Gaps = 9/176 (5%)
 Frame = +2

Query  140  PKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNT-QSFLQRALYPIVLKFEEIVY  316
            P+ +  S    M D   TN       +   +AYP+  N  +S L+ AL+PI LKFEE+VY
Sbjct  2    PENQQQSASSNMSDQQQTN-------NTTVVAYPVHPNNPRSVLRLALFPITLKFEEVVY  54

Query  317  KVGGEDKGSCCTG-KSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYG  493
            KV  E K SCC G K S+REKTILNG+TGMVCPGEILAMLGPSGSGKTTLLTALGGRL G
Sbjct  55   KVKLEQKESCCWGGKWSSREKTILNGITGMVCPGEILAMLGPSGSGKTTLLTALGGRLNG  114

Query  494  KLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            KLSGK+TYN QPFSG IKR TGFVAQDDVLYPHLTV ETL+FTALLRLP +LTR+E
Sbjct  115  KLSGKITYNGQPFSGVIKRRTGFVAQDDVLYPHLTVTETLVFTALLRLPNTLTRDE  170



>emb|CAN70956.1| hypothetical protein VITISV_028138 [Vitis vinifera]
Length=677

 Score =   232 bits (592),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 144/202 (71%), Gaps = 26/202 (13%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVL  295
            MP L+ +APKPEN   +  M+  + T++  ++A     L YP+QTN+QS LQ  LY I L
Sbjct  1    MP-LNCIAPKPEN-QGNIPMEGLSRTSESDNSA----VLTYPMQTNSQSILQHTLYSINL  54

Query  296  K--------------------FEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPG  415
            K                    FEE+VYKV  E KG C  G  S R+KTILNG+TGMVCPG
Sbjct  55   KVCLLFILGPVPYIIFTHYNMFEEVVYKVKLEQKGFCWGGAWSTRDKTILNGITGMVCPG  114

Query  416  EILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHL  595
            EILAMLGPSGSGKTTLLTALGGRL GKLSGK+TYN QPFSG++KR TGFVAQDDVLYPHL
Sbjct  115  EILAMLGPSGSGKTTLLTALGGRLNGKLSGKITYNGQPFSGAVKRRTGFVAQDDVLYPHL  174

Query  596  TVKETLLFTALLRLPQSLTREE  661
            TV ETLLFTALLRLP+SL R E
Sbjct  175  TVTETLLFTALLRLPKSLARNE  196



>ref|XP_007158067.1| hypothetical protein PHAVU_002G121200g [Phaseolus vulgaris]
 gb|ESW30061.1| hypothetical protein PHAVU_002G121200g [Phaseolus vulgaris]
Length=658

 Score =   231 bits (590),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 137/178 (77%), Gaps = 6/178 (3%)
 Frame = +2

Query  134  VAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQS--FLQRALYPIVLKFEE  307
            +APKPE C+    ++      +P ++      L++P+QTN Q   F +  +YPI LKFEE
Sbjct  6    IAPKPEYCNSHHSVEGPQEMTEPHNST----VLSHPMQTNEQQQPFPKLIMYPITLKFEE  61

Query  308  IVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRL  487
            +VYKV  E KG C     + +EKTILNG+TG+VCPGEILAMLGPSGSGKTTLLTALGGRL
Sbjct  62   LVYKVKLEQKGGCWGSTWTCKEKTILNGITGVVCPGEILAMLGPSGSGKTTLLTALGGRL  121

Query  488  YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
             GKLSGK+TYN QPFSG++KR TGFVAQDDVLYPHLTV ETL+FTALLRLP SLTR+E
Sbjct  122  SGKLSGKITYNGQPFSGAMKRRTGFVAQDDVLYPHLTVTETLVFTALLRLPNSLTRDE  179



>ref|XP_002304113.2| hypothetical protein POPTR_0003s03650g [Populus trichocarpa]
 gb|EEE79092.2| hypothetical protein POPTR_0003s03650g [Populus trichocarpa]
Length=656

 Score =   231 bits (590),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 141/183 (77%), Gaps = 9/183 (5%)
 Frame = +2

Query  116  MPALHSVAPKPENCS-PDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIV  292
            MP L+S+ PKP++ S P + +   +  N+ A        +AYP Q N+QS  Q  +YP  
Sbjct  1    MP-LNSIVPKPDHKSVPMEGLPKMSEINKRA-------VVAYPGQANSQSVHQLTIYPTT  52

Query  293  LKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            LKFEE+VYKV  + KG C  G  + REKTILN +TGMVCPGEILAMLGPSGSGKTTLLTA
Sbjct  53   LKFEEVVYKVKQDQKGLCWGGTWTTREKTILNEITGMVCPGEILAMLGPSGSGKTTLLTA  112

Query  473  LGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLT  652
            LGGRL GKLSGK+TYN QPFSG++KR TGFVAQDD+LYPHLTV ETLLFTALLRLP++LT
Sbjct  113  LGGRLTGKLSGKITYNGQPFSGAMKRRTGFVAQDDILYPHLTVTETLLFTALLRLPKTLT  172

Query  653  REE  661
            R+E
Sbjct  173  RDE  175



>ref|XP_007156346.1| hypothetical protein PHAVU_003G278800g [Phaseolus vulgaris]
 gb|ESW28340.1| hypothetical protein PHAVU_003G278800g [Phaseolus vulgaris]
Length=648

 Score =   231 bits (589),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 133/174 (76%), Gaps = 11/174 (6%)
 Frame = +2

Query  149  ENC---SPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYK  319
            ENC    PD       + + P +  P        LQTN QSFL+ A+YPI LKFEE+VYK
Sbjct  3    ENCIAFKPDH------SNSHPQEGPPKMTETV--LQTNEQSFLKLAVYPITLKFEELVYK  54

Query  320  VGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKL  499
            V  E KG C     S+REKTIL GVTGMVCPGEI+AMLGPSGSGKTTLLTALGGRL GKL
Sbjct  55   VKVEQKGMCWGSTGSSREKTILKGVTGMVCPGEIMAMLGPSGSGKTTLLTALGGRLSGKL  114

Query  500  SGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            SGKVTYN+QPFSG++KR TGFVAQDDVLYPHLTV ETLLFTALLRLP SLT+EE
Sbjct  115  SGKVTYNNQPFSGAMKRRTGFVAQDDVLYPHLTVTETLLFTALLRLPSSLTKEE  168



>ref|XP_007040852.1| ATP-binding cassette 14 [Theobroma cacao]
 gb|EOY25353.1| ATP-binding cassette 14 [Theobroma cacao]
Length=656

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 144/184 (78%), Gaps = 10/184 (5%)
 Frame = +2

Query  116  MPALHSVAPKPENCS--PDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPI  289
            MP L+ +APKPE+ S  P + + + ++ +       ++  LA+P+Q N+Q  ++  LYPI
Sbjct  1    MP-LNCIAPKPEHGSSGPVEALSETSSESH------NRAVLAFPIQHNSQPPVRVTLYPI  53

Query  290  VLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLT  469
             LKFE++VYKV  E KGSC  G    REKTILNG+TG+VCPGEILAMLGPSGSGKTTLLT
Sbjct  54   TLKFEKVVYKVKLEQKGSCW-GAWITREKTILNGITGVVCPGEILAMLGPSGSGKTTLLT  112

Query  470  ALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSL  649
            ALGGRL GKLSG +TYN QPFSG +KR TGFVAQDDVLYPHLTV ETLLFTALLRLP+SL
Sbjct  113  ALGGRLTGKLSGNITYNGQPFSGGVKRRTGFVAQDDVLYPHLTVTETLLFTALLRLPKSL  172

Query  650  TREE  661
            +R+E
Sbjct  173  SRDE  176



>ref|XP_010540713.1| PREDICTED: ABC transporter G family member 14 [Tarenaya hassleriana]
Length=649

 Score =   229 bits (584),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 130/175 (74%), Gaps = 4/175 (2%)
 Frame = +2

Query  146  PENC---SPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVY  316
            P+NC    P++     A          DK  LA+P+  N+Q   Q+ LYPI LKFEEIVY
Sbjct  2    PQNCIAPRPEENGGGLAQGQADKSEMQDKAVLAFPIMANSQPGFQQTLYPITLKFEEIVY  61

Query  317  KVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGK  496
            KV  E KGSC  G  S++EK ILNG+TGMVCPGEILAMLGPSGSGKTTLL+ALGGRL G 
Sbjct  62   KVKIEQKGSCW-GTWSSKEKRILNGITGMVCPGEILAMLGPSGSGKTTLLSALGGRLSGT  120

Query  497  LSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
             SGK+TYN  PFSGSIKR TGFVAQDD+LYPHLTV ETL FTALLRLP SLTR+E
Sbjct  121  FSGKITYNGLPFSGSIKRRTGFVAQDDILYPHLTVWETLFFTALLRLPSSLTRDE  175



>ref|XP_003537708.1| PREDICTED: ABC transporter G family member 14-like [Glycine max]
 gb|KHN41781.1| ABC transporter G family member 14 [Glycine soja]
Length=660

 Score =   229 bits (583),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 137/180 (76%), Gaps = 8/180 (4%)
 Frame = +2

Query  134  VAPKPENC-SPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQS---FLQRALYPIVLKF  301
            +APKPE C S    +++     +P D+      ++YP+QTN Q    F +  +YPI LKF
Sbjct  6    IAPKPEYCNSTHHSVEEPPEMTEPHDST----VISYPMQTNEQQQQPFPKLIMYPITLKF  61

Query  302  EEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGG  481
            EE+VYKV  E KG C     + +EKTILNG+TG+VCPGEILAMLGPSGSGKTTLLTALGG
Sbjct  62   EELVYKVKLEQKGGCWGSTWTCKEKTILNGITGVVCPGEILAMLGPSGSGKTTLLTALGG  121

Query  482  RLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            RL GKLSGK+TYN QPFSG++KR TGFVAQDDVLYPHLTV ETL+FTALLRLP SL R+E
Sbjct  122  RLSGKLSGKITYNGQPFSGAMKRRTGFVAQDDVLYPHLTVTETLVFTALLRLPNSLCRDE  181



>ref|XP_003547739.1| PREDICTED: ABC transporter G family member 14-like [Glycine max]
Length=656

 Score =   228 bits (582),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 133/173 (77%), Gaps = 1/173 (1%)
 Frame = +2

Query  146  PENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVG  325
            PENC   +   +   T  P +  P+      P++TN QSF + A++PI LKFEE+VY V 
Sbjct  2    PENCIAPKPEHNNNNTTHPEEGPPEMTETVLPIKTNEQSFPKLAMFPITLKFEELVYNVK  61

Query  326  GEDKGSCCTGKS-SAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLS  502
             E KG  C G + S +EKTIL GVTGMV PGEI+AMLGPSGSGKTTLLTALGGRL GKLS
Sbjct  62   IEHKGGLCWGSTRSCKEKTILKGVTGMVSPGEIMAMLGPSGSGKTTLLTALGGRLSGKLS  121

Query  503  GKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            GKVTYN+QPFSG++KR TGFVAQDDVLYPHLTV ETLLFTALLRLP SLT+EE
Sbjct  122  GKVTYNNQPFSGAMKRRTGFVAQDDVLYPHLTVFETLLFTALLRLPNSLTKEE  174



>gb|KJB25133.1| hypothetical protein B456_004G178100 [Gossypium raimondii]
Length=644

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 142/182 (78%), Gaps = 9/182 (5%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVL  295
            MP L+ VAPKPE+   + R++   + +Q       K  LA+P+Q N+Q   +  L+ I L
Sbjct  1    MP-LNCVAPKPEHAC-NGRVESETSKSQ------KKAALAFPIQHNSQPPPRLTLFHITL  52

Query  296  KFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTAL  475
            KFEE+VYKV  E+KG+C  G    REKT+LNG+TG+VCPGEILAMLGPSGSGKTTLLTAL
Sbjct  53   KFEEVVYKVKLEEKGTCW-GSWITREKTVLNGITGVVCPGEILAMLGPSGSGKTTLLTAL  111

Query  476  GGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTR  655
            GGRL GKLSGK+TYN QPFSG++KR TGFVAQDDVLYPHLTV ETLLFTALLRLP SLTR
Sbjct  112  GGRLTGKLSGKITYNGQPFSGALKRRTGFVAQDDVLYPHLTVTETLLFTALLRLPNSLTR  171

Query  656  EE  661
            +E
Sbjct  172  DE  173



>ref|XP_004512314.1| PREDICTED: ABC transporter G family member 14-like [Cicer arietinum]
Length=661

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 138/180 (77%), Gaps = 8/180 (4%)
 Frame = +2

Query  146  PENC---SPDQRMDDAATTNQP---ADAAPDKPCLAYPLQTNTQSFLQR-ALYPIVLKFE  304
            P+NC    P++ +   +    P   AD       L YP+ TN QS + +  +YPI LKFE
Sbjct  2    PQNCIAPKPEEYLSSLSVEASPPNMADTQTTSTVLTYPISTNEQSLVPKLIMYPITLKFE  61

Query  305  EIVYKVGGEDKGSCCTG-KSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGG  481
            +++YKV  E KG  C G K S +EKTILNG+TG+VCPGEILAMLGPSGSGKTTLLTALGG
Sbjct  62   DLIYKVKLEQKGGTCWGSKWSYKEKTILNGITGVVCPGEILAMLGPSGSGKTTLLTALGG  121

Query  482  RLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            RL GKLSGK+TYN+QPFSGS+KR TGFVAQDDVLYPHLTV ETL+FTALLRLP++LTR+E
Sbjct  122  RLNGKLSGKITYNNQPFSGSMKRRTGFVAQDDVLYPHLTVTETLVFTALLRLPKTLTRDE  181



>gb|KJB25132.1| hypothetical protein B456_004G178100 [Gossypium raimondii]
Length=653

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 142/182 (78%), Gaps = 9/182 (5%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVL  295
            MP L+ VAPKPE+   + R++   + +Q       K  LA+P+Q N+Q   +  L+ I L
Sbjct  1    MP-LNCVAPKPEHAC-NGRVESETSKSQ------KKAALAFPIQHNSQPPPRLTLFHITL  52

Query  296  KFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTAL  475
            KFEE+VYKV  E+KG+C  G    REKT+LNG+TG+VCPGEILAMLGPSGSGKTTLLTAL
Sbjct  53   KFEEVVYKVKLEEKGTCW-GSWITREKTVLNGITGVVCPGEILAMLGPSGSGKTTLLTAL  111

Query  476  GGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTR  655
            GGRL GKLSGK+TYN QPFSG++KR TGFVAQDDVLYPHLTV ETLLFTALLRLP SLTR
Sbjct  112  GGRLTGKLSGKITYNGQPFSGALKRRTGFVAQDDVLYPHLTVTETLLFTALLRLPNSLTR  171

Query  656  EE  661
            +E
Sbjct  172  DE  173



>ref|XP_003517105.2| PREDICTED: ABC transporter G family member 14-like [Glycine max]
Length=659

 Score =   226 bits (577),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 135/179 (75%), Gaps = 7/179 (4%)
 Frame = +2

Query  134  VAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQS---FLQRALYPIVLKFE  304
            +APKPE C+    ++      +P ++      L+YP+Q N Q    F +  +YPI LKFE
Sbjct  6    IAPKPEFCNSHNSVEGPPEMTEPHNST----VLSYPMQANEQQQQPFPKLIMYPITLKFE  61

Query  305  EIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGR  484
            E+VYKV  E KG C     + +EKTILNG+TG+VCPGEILAMLGPSGSGKTTLLTALGGR
Sbjct  62   ELVYKVKLEQKGGCWGSTWTCKEKTILNGITGVVCPGEILAMLGPSGSGKTTLLTALGGR  121

Query  485  LYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            L GKLSGK+TYN QPFSG++KR TGFVAQDDVLYPHLTV ETL+FTALLRLP +L R+E
Sbjct  122  LNGKLSGKITYNGQPFSGAMKRRTGFVAQDDVLYPHLTVTETLVFTALLRLPNTLKRDE  180



>gb|KHN28317.1| ABC transporter G family member 14 [Glycine soja]
Length=659

 Score =   226 bits (576),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 135/179 (75%), Gaps = 7/179 (4%)
 Frame = +2

Query  134  VAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQS---FLQRALYPIVLKFE  304
            +APKPE C+    ++      +P ++      L+YP+Q N Q    F +  +YPI LKFE
Sbjct  6    IAPKPEFCNSHNSVEGPPEMTEPHNST----VLSYPMQANEQQQQPFPKLIMYPITLKFE  61

Query  305  EIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGR  484
            E+VYKV  E KG C     + +EKTILNG+TG+VCPGEILAMLGPSGSGKTTLLTALGGR
Sbjct  62   ELVYKVKLEQKGGCWGSTWTCKEKTILNGITGVVCPGEILAMLGPSGSGKTTLLTALGGR  121

Query  485  LYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            L GKLSGK+TYN QPFSG++KR TGFVAQDDVLYPHLTV ETL+FTALLRLP +L R+E
Sbjct  122  LNGKLSGKITYNGQPFSGAMKRRTGFVAQDDVLYPHLTVTETLVFTALLRLPNTLKRDE  180



>gb|KHG16348.1| ABC transporter G family member 14 [Gossypium arboreum]
Length=653

 Score =   225 bits (574),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 141/182 (77%), Gaps = 9/182 (5%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVL  295
            MP L+ VAPKPE+      + ++ T+     AA     LA+P+Q N+Q   +  L+ I L
Sbjct  1    MP-LNCVAPKPEHAC--NGLVESETSKSQKKAA-----LAFPIQHNSQPPPRLTLFHITL  52

Query  296  KFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTAL  475
            KFEE+VYKV  E+KGSC  G    REKTILNG+TG+VCPGEILAMLGPSGSGKTTLL+AL
Sbjct  53   KFEEVVYKVKLEEKGSCW-GSWITREKTILNGITGVVCPGEILAMLGPSGSGKTTLLSAL  111

Query  476  GGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTR  655
            GGRL GKLSGK+TYN QPFSG++KR TGFVAQDDVLYPHLTV ETLLFTALLRLP SLTR
Sbjct  112  GGRLTGKLSGKITYNGQPFSGALKRRTGFVAQDDVLYPHLTVTETLLFTALLRLPNSLTR  171

Query  656  EE  661
            +E
Sbjct  172  DE  173



>ref|XP_010251517.1| PREDICTED: ABC transporter G family member 14-like [Nelumbo nucifera]
Length=650

 Score =   224 bits (570),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 131/172 (76%), Gaps = 7/172 (4%)
 Frame = +2

Query  146  PENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVG  325
            PEN    Q+      + QP +       +AYP+  N  S LQ A++PI LKFEE+VYKV 
Sbjct  2    PEN---PQQFASLNMSEQPNNTT----IVAYPVHPNPPSVLQLAVFPITLKFEEVVYKVK  54

Query  326  GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSG  505
             E+KG    G  + +EKTILNG+TGMVCPGEILAMLGPSGSGKTTLLTALGGRL GKLSG
Sbjct  55   LEEKGFWWGGTWNTKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLTALGGRLNGKLSG  114

Query  506  KVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            K+TYN QPFSG+IKR TGFVAQDDVLYPHLTV ETL+FTALLRLP +LTR E
Sbjct  115  KITYNGQPFSGAIKRRTGFVAQDDVLYPHLTVTETLVFTALLRLPDTLTRAE  166



>ref|XP_010111780.1| ABC transporter G family member 14 [Morus notabilis]
 gb|EXC31694.1| ABC transporter G family member 14 [Morus notabilis]
Length=666

 Score =   223 bits (568),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 128/160 (80%), Gaps = 14/160 (9%)
 Frame = +2

Query  224  PCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGED---KGSCCTGKSS----------  364
            P LAYPLQ N+ S LQ +L+PI LKFEE+VYKV  ++   KG  C G +S          
Sbjct  17   PVLAYPLQLNSPSLLQLSLFPITLKFEEVVYKVKVDELHEKGGWCWGNNSSTSASSSSWP  76

Query  365  -AREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGS  541
              REK+ILNG+TGMVCPGEILAMLGPSGSGKTTLLTALGGRL GKLSGK+TYN  PFSG+
Sbjct  77   STREKSILNGITGMVCPGEILAMLGPSGSGKTTLLTALGGRLSGKLSGKITYNGHPFSGT  136

Query  542  IKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            IKR TGFVAQDDVLYPHLTV ETLLFTA+LRLP+SL+R+E
Sbjct  137  IKRRTGFVAQDDVLYPHLTVTETLLFTAMLRLPESLSRDE  176



>ref|XP_009605917.1| PREDICTED: ABC transporter G family member 14-like [Nicotiana 
tomentosiformis]
Length=633

 Score =   221 bits (562),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 137/182 (75%), Gaps = 28/182 (15%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVL  295
            MP LH VAPKPEN   +              AAP  P  + P + N++SF QRAL+PI L
Sbjct  1    MP-LHCVAPKPENFGTELM------------AAP--PNSSMP-EMNSESFTQRALFPITL  44

Query  296  KFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTAL  475
            KFEEIVYK+            +S +EKTILNGVTG+VCPGE+LAMLGPSGSGKTTLLTAL
Sbjct  45   KFEEIVYKI------------TSTKEKTILNGVTGIVCPGEMLAMLGPSGSGKTTLLTAL  92

Query  476  GGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTR  655
            GGRL GKLSGK+ YN+QPFSG+IKR TGFVAQDD+LYPHLTV ETLLFTALLRLPQSL++
Sbjct  93   GGRLSGKLSGKIAYNNQPFSGAIKRSTGFVAQDDILYPHLTVTETLLFTALLRLPQSLSK  152

Query  656  EE  661
            EE
Sbjct  153  EE  154



>ref|XP_009757349.1| PREDICTED: ABC transporter G family member 14-like [Nicotiana 
sylvestris]
Length=630

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 135/182 (74%), Gaps = 31/182 (17%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVL  295
            MP LH VAPK EN   +  +D           +P+          N++SF QRAL+PI L
Sbjct  1    MP-LHCVAPKAENFGTELMVD-----------SPNS-------SMNSESFTQRALFPITL  41

Query  296  KFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTAL  475
            KFEEIVYK+            +S +EKTILNGVTG+VCPGE+LAMLGPSGSGKTTLLTAL
Sbjct  42   KFEEIVYKI------------TSTKEKTILNGVTGIVCPGEMLAMLGPSGSGKTTLLTAL  89

Query  476  GGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTR  655
            GGRL GKLSGK+TYNSQPFSG+IKR TGFVAQDD+LYPHLTV ETLLFTALLRLPQSL++
Sbjct  90   GGRLSGKLSGKITYNSQPFSGAIKRSTGFVAQDDILYPHLTVTETLLFTALLRLPQSLSK  149

Query  656  EE  661
            +E
Sbjct  150  QE  151



>gb|KHG20314.1| ABC transporter G family member 14 [Gossypium arboreum]
Length=657

 Score =   220 bits (560),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 141/183 (77%), Gaps = 7/183 (4%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQ-RALYPIV  292
            MP L+ +A KPE+      ++  + T +P ++A     LA+P+Q N+Q  ++   LYPI 
Sbjct  1    MP-LNLIATKPEHGMSSGPLEALSETPEPHNSA----MLAFPIQRNSQPPVRLTTLYPIT  55

Query  293  LKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            LKFEEIVYKV  E KGSC  G  + REKTILNG++G+V PGEILAMLGPSGSGKTTLLTA
Sbjct  56   LKFEEIVYKVKLEQKGSCWGGWIT-REKTILNGISGVVYPGEILAMLGPSGSGKTTLLTA  114

Query  473  LGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLT  652
            LGGRL GKLSGK+TYN QPF G+IKR  GFVAQDDVLYPHLTV ETLLFTALLRLP SL+
Sbjct  115  LGGRLTGKLSGKITYNGQPFCGAIKRRAGFVAQDDVLYPHLTVTETLLFTALLRLPNSLS  174

Query  653  REE  661
            R+E
Sbjct  175  RDE  177



>gb|KJB51502.1| hypothetical protein B456_008G219500 [Gossypium raimondii]
Length=657

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 141/183 (77%), Gaps = 7/183 (4%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQ-RALYPIV  292
            MP L+ +A KPE+      ++  + T +P ++A     LA+P+Q N+Q  ++   LYPI 
Sbjct  1    MP-LNLIATKPEHGISSGPLEALSETPEPHNSA----MLAFPIQRNSQPPVRLTTLYPIT  55

Query  293  LKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            +KFEEIVYKV  E KGSC  G  + REKTILNG++G+V PGEILAMLGPSGSGKTTLLTA
Sbjct  56   MKFEEIVYKVKLEQKGSCWGGWIT-REKTILNGISGVVYPGEILAMLGPSGSGKTTLLTA  114

Query  473  LGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLT  652
            LGGRL GKLSGK+TYN QPF G+IKR  GFVAQDDVLYPHLTV ETLLFTALLRLP SL+
Sbjct  115  LGGRLTGKLSGKITYNGQPFCGAIKRRAGFVAQDDVLYPHLTVTETLLFTALLRLPNSLS  174

Query  653  REE  661
            R+E
Sbjct  175  RDE  177



>ref|XP_010463057.1| PREDICTED: ABC transporter G family member 14-like [Camelina 
sativa]
Length=574

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 127/175 (73%), Gaps = 4/175 (2%)
 Frame = +2

Query  146  PENC-SPDQRMDDAATTNQPADAAP--DKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVY  316
            P+NC +P    D         D +    K  LA+P+ T +Q  LQ ++YPI LKFEE+VY
Sbjct  2    PQNCIAPRPEEDGGGMVQGLRDMSETQSKSVLAFPIVT-SQPGLQMSMYPITLKFEEVVY  60

Query  317  KVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGK  496
            KV  E   S C G   ++EKTILNG+TGMVCPGEILAMLGPSGSGKTTLL+ALGGRL   
Sbjct  61   KVKIEQTSSQCLGSWKSKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLSALGGRLSKT  120

Query  497  LSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
             SGKV YN QPFSG IKR TGFVAQDDVLYPHLTV ETL FTALLRLP SLTR+E
Sbjct  121  FSGKVMYNGQPFSGCIKRRTGFVAQDDVLYPHLTVWETLFFTALLRLPSSLTRDE  175



>ref|XP_010478591.1| PREDICTED: ABC transporter G family member 14 [Camelina sativa]
Length=649

 Score =   215 bits (547),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 127/175 (73%), Gaps = 4/175 (2%)
 Frame = +2

Query  146  PENC-SPDQRMDDAATTNQPADAAP--DKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVY  316
            P+NC +P    D         D +    K  LA+P+ T +Q  LQ ++YPI LKFEE+VY
Sbjct  2    PQNCIAPRPEEDGGGMVQGLPDMSETQSKSVLAFPMVT-SQPGLQMSMYPITLKFEEVVY  60

Query  317  KVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGK  496
            KV  E   S C G   ++EKTILNG+TGMVCPGEILAMLGPSGSGKTTLL+ALGGRL   
Sbjct  61   KVKIEQTSSQCLGSWKSKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLSALGGRLSKT  120

Query  497  LSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
             SGKV YN QPFSG IKR TGFVAQDDVLYPHLTV ETL FTALLRLP SLTR+E
Sbjct  121  FSGKVMYNGQPFSGCIKRRTGFVAQDDVLYPHLTVWETLFFTALLRLPSSLTRDE  175



>ref|XP_004291249.1| PREDICTED: ABC transporter G family member 14 [Fragaria vesca 
subsp. vesca]
Length=660

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 123/153 (80%), Gaps = 8/153 (5%)
 Frame = +2

Query  227  CLAYP---LQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAR-----EKTI  382
             LAYP    Q N QSFLQ A+YPI LKFEE+ YKV  + K       SS+      EK+I
Sbjct  19   VLAYPSAAAQVNAQSFLQLAMYPITLKFEEVFYKVKMDHKAGLVPWPSSSSNKLTSEKSI  78

Query  383  LNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGF  562
            LNG++G+VCPGEILAMLGPSGSGKTTLLTALGGRL+GKLSGK+TYNSQPF GSIKR TGF
Sbjct  79   LNGISGVVCPGEILAMLGPSGSGKTTLLTALGGRLHGKLSGKITYNSQPFCGSIKRRTGF  138

Query  563  VAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            V+QDDVLYPHLTV ETL+FTALLRLP +LTR+E
Sbjct  139  VSQDDVLYPHLTVTETLVFTALLRLPNTLTRDE  171



>ref|XP_010499718.1| PREDICTED: ABC transporter G family member 14-like [Camelina 
sativa]
Length=649

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 127/175 (73%), Gaps = 4/175 (2%)
 Frame = +2

Query  146  PENC-SPDQRMDDAATTNQPADAAP--DKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVY  316
            P+NC +P    D         D +    K  LA+P+ T +Q  LQ ++YPI LKFEE+VY
Sbjct  2    PQNCIAPRPEEDGGGMVQGLPDMSETQSKSVLAFPIVT-SQPGLQMSMYPITLKFEEVVY  60

Query  317  KVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGK  496
            KV  E   S C G   ++EKTILNG+TGMVCPGEILAMLGPSGSGKTTLL+ALGGRL   
Sbjct  61   KVKIEQTSSQCLGSWKSKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLSALGGRLSKT  120

Query  497  LSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
             SGKV YN QPFSG IKR TGFVAQDDVLYPHLTV ETL FTALLRLP SLTR+E
Sbjct  121  FSGKVMYNGQPFSGCIKRRTGFVAQDDVLYPHLTVWETLFFTALLRLPSSLTRDE  175



>ref|XP_010518955.1| PREDICTED: ABC transporter G family member 14 [Tarenaya hassleriana]
Length=631

 Score =   213 bits (543),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +2

Query  266  LQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSG  445
            +Q+ALY I LKFEEIVYKV  E KGSC  G  S++EKTILNGVTGMVCPGEILAMLGPSG
Sbjct  27   MQKALYSITLKFEEIVYKVKIEQKGSCW-GTWSSKEKTILNGVTGMVCPGEILAMLGPSG  85

Query  446  SGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTA  625
            SGKTTLL+ALGGRL G  SGK+TYN  PFSGSIKR TGFVAQDDVLYPHLTV ETL FTA
Sbjct  86   SGKTTLLSALGGRLSGTFSGKITYNGSPFSGSIKRRTGFVAQDDVLYPHLTVWETLFFTA  145

Query  626  LLRLPQSLTREE  661
            LLRLP S+TR+E
Sbjct  146  LLRLPGSMTRDE  157



>ref|XP_009114967.1| PREDICTED: ABC transporter G family member 14 [Brassica rapa]
 emb|CDY49155.1| BnaA09g25160D [Brassica napus]
Length=649

 Score =   213 bits (542),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 129/178 (72%), Gaps = 11/178 (6%)
 Frame = +2

Query  134  VAPKPENCSPDQRMDDAATTNQPADAAPD--KPCLAYPLQTNTQSFLQRALYPIVLKFEE  307
            +AP+PE        +  AT     D +    KP LA+P+ T +Q  LQ ++YPI LKFEE
Sbjct  6    IAPRPEE-------NGEATVQGLTDMSETQGKPVLAFPVAT-SQPGLQLSMYPITLKFEE  57

Query  308  IVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRL  487
            + YKV  E  G C  G  S +EKTILNG+TGMVCPGEILAMLGPSGSGKTTLL+ALGGRL
Sbjct  58   VEYKVKIEHTGQCL-GSWSCKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLSALGGRL  116

Query  488  YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
                SGKV YN QPFSG IKR TGFVAQDDVLYPHLTV ETL FTALLRLP SLTR+E
Sbjct  117  SKTFSGKVIYNGQPFSGCIKRRTGFVAQDDVLYPHLTVWETLFFTALLRLPSSLTRDE  174



>emb|CDY12299.1| BnaA09g24990D [Brassica napus]
Length=712

 Score =   214 bits (544),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 129/178 (72%), Gaps = 11/178 (6%)
 Frame = +2

Query  134  VAPKPENCSPDQRMDDAATTNQPADAAPD--KPCLAYPLQTNTQSFLQRALYPIVLKFEE  307
            +AP+PE        +  AT     D +    KP LA+P+ T +Q  LQ ++Y I LKFEE
Sbjct  6    IAPRPEE-------NGEATVQGLTDMSETQGKPVLAFPVAT-SQPGLQLSMYSITLKFEE  57

Query  308  IVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRL  487
            +VYKV  E  G C  G  S +EKTILNG+TGMVCPGEILAMLGPSGSGKTTLL+ALGGRL
Sbjct  58   VVYKVKIEQTGQCL-GSWSCKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLSALGGRL  116

Query  488  YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
                SGKV YN QPFSG IKR TGFVAQDDVLYPHLTV ETL FTALLRLP SLTR+E
Sbjct  117  SKTFSGKVIYNGQPFSGCIKRRTGFVAQDDVLYPHLTVWETLFFTALLRLPSSLTRDE  174



>ref|XP_006303926.1| hypothetical protein CARUB_v10008545mg [Capsella rubella]
 gb|EOA36824.1| hypothetical protein CARUB_v10008545mg [Capsella rubella]
Length=648

 Score =   211 bits (536),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 128/175 (73%), Gaps = 5/175 (3%)
 Frame = +2

Query  146  PENC-SPDQRMDDAATTNQPADAAP--DKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVY  316
            P+NC +P    D         D +    K  LA+P+ T +Q  LQ ++YPI LKFEE+VY
Sbjct  2    PQNCIAPRPEEDGGGMVQGLTDMSETQSKSVLAFPIVT-SQPGLQLSMYPITLKFEEVVY  60

Query  317  KVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGK  496
            KV  E + S C G   ++EKTILNG+TGMVCPGEILAMLGPSGSGKTTLL+ALGGRL   
Sbjct  61   KVKIE-QTSQCLGSWKSKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLSALGGRLSKT  119

Query  497  LSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
             SGKV YN QPFSG IKR TGFVAQDDVLYPHLTV ETL FTALLRLP SLTR+E
Sbjct  120  FSGKVMYNGQPFSGCIKRRTGFVAQDDVLYPHLTVWETLFFTALLRLPSSLTRDE  174



>ref|XP_008387860.1| PREDICTED: ABC transporter G family member 14 [Malus domestica]
Length=668

 Score =   210 bits (534),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 137/190 (72%), Gaps = 17/190 (9%)
 Frame = +2

Query  122  ALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPC-----LAYPLQTNTQSFLQRALYP  286
            +L S+ PKP         D + TT    + +P+ P       A   Q N+Q+FLQ  LYP
Sbjct  2    SLSSIVPKPAEYGGS---DSSCTTT--VEVSPEMPAGTQNKAAPATQVNSQAFLQLTLYP  56

Query  287  IVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLL  466
            I LKFEE+ YKV  E KGS   G+S +REK+IL+G+TGMVCPGEILAMLGPSGSGKTTLL
Sbjct  57   ITLKFEEVFYKVKVEQKGS--RGRSRSREKSILSGITGMVCPGEILAMLGPSGSGKTTLL  114

Query  467  TALGGRLYGK-----LSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALL  631
            T+LGGRL  +     +SGK++YN QPF G+IKR TGFVAQDDVLYPHLTV ETL+FTALL
Sbjct  115  TSLGGRLNHQNNVKFMSGKISYNGQPFCGAIKRRTGFVAQDDVLYPHLTVTETLVFTALL  174

Query  632  RLPQSLTREE  661
            RLP SL+R+E
Sbjct  175  RLPNSLSRDE  184



>ref|XP_006415305.1| hypothetical protein EUTSA_v10007027mg [Eutrema salsugineum]
 gb|ESQ33658.1| hypothetical protein EUTSA_v10007027mg [Eutrema salsugineum]
Length=648

 Score =   209 bits (533),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 128/178 (72%), Gaps = 11/178 (6%)
 Frame = +2

Query  134  VAPKPENCSPD--QRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEE  307
            +AP+PE       Q + D + T         K  +A+P+ T +Q  LQ ++YPI LKFEE
Sbjct  6    IAPRPEENGQVMVQGLTDMSETQ-------SKSVIAFPVVT-SQPGLQLSMYPITLKFEE  57

Query  308  IVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRL  487
            +VYKV  E    C  G  S +EKTILNG+TGMVCPGEILAMLGPSGSGKTTLL+ALGGRL
Sbjct  58   VVYKVKIEQTNQCL-GSWSCKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLSALGGRL  116

Query  488  YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
                SGKV YN QPFSG IKR TGFVAQDDVLYPHLTV ETL FTALLRLP SLTR+E
Sbjct  117  AKSFSGKVMYNGQPFSGCIKRRTGFVAQDDVLYPHLTVWETLFFTALLRLPSSLTRDE  174



>ref|NP_564383.1| ABC transporter G family member 14 [Arabidopsis thaliana]
 sp|Q9C6W5.1|AB14G_ARATH RecName: Full=ABC transporter G family member 14; Short=ABC transporter 
ABCG.14; Short=AtABCG14; AltName: Full=White-brown 
complex homolog protein 14; Short=AtWBC14 [Arabidopsis thaliana]
 gb|AAG60152.1|AC074360_17 hypothetical protein [Arabidopsis thaliana]
 gb|AAM67104.1| ABC transporter, putative [Arabidopsis thaliana]
 dbj|BAC42192.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31390.1| ABC transporter G family member 14 [Arabidopsis thaliana]
Length=648

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 126/175 (72%), Gaps = 5/175 (3%)
 Frame = +2

Query  146  PENCSPDQRMDDAATTNQPADAAPD---KPCLAYPLQTNTQSFLQRALYPIVLKFEEIVY  316
            P+NC   +  +D     Q      D   K  LA+P  T +Q  LQ ++YPI LKFEE+VY
Sbjct  2    PQNCIAPRPEEDGGVMVQGLPDMSDTQSKSVLAFPTIT-SQPGLQMSMYPITLKFEEVVY  60

Query  317  KVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGK  496
            KV  E + S C G   ++EKTILNG+TGMVCPGE LAMLGPSGSGKTTLL+ALGGRL   
Sbjct  61   KVKIE-QTSQCMGSWKSKEKTILNGITGMVCPGEFLAMLGPSGSGKTTLLSALGGRLSKT  119

Query  497  LSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
             SGKV YN QPFSG IKR TGFVAQDDVLYPHLTV ETL FTALLRLP SLTR+E
Sbjct  120  FSGKVMYNGQPFSGCIKRRTGFVAQDDVLYPHLTVWETLFFTALLRLPSSLTRDE  174



>gb|EYU29117.1| hypothetical protein MIMGU_mgv1a002688mg [Erythranthe guttata]
Length=646

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 134/185 (72%), Gaps = 21/185 (11%)
 Frame = +2

Query  116  MPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVL  295
            MP L SVAPKPEN                 D       L  P    +QSF QRALYPI L
Sbjct  1    MP-LCSVAPKPEN-----------------DGTELAIGLPNPAHKISQSFRQRALYPITL  42

Query  296  KFEEIVYKVGGEDKGSCCTGKSSAR---EKTILNGVTGMVCPGEILAMLGPSGSGKTTLL  466
            KFEEIVYKV G  +GSCC G  ++    EKTILNGVTGMVCPGE+LAMLGPSGSGKTTLL
Sbjct  43   KFEEIVYKVNGGREGSCCGGGGASTATGEKTILNGVTGMVCPGELLAMLGPSGSGKTTLL  102

Query  467  TALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQS  646
            TALGGRL GKLSGK+TYN  PFS SIKR TGFVAQDDVLY HLTV ETLLFTALLRLP+S
Sbjct  103  TALGGRLTGKLSGKITYNGHPFSSSIKRKTGFVAQDDVLYQHLTVFETLLFTALLRLPKS  162

Query  647  LTREE  661
            LT+EE
Sbjct  163  LTKEE  167



>emb|CDY47690.1| BnaCnng15320D [Brassica napus]
Length=641

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 121/176 (69%), Gaps = 14/176 (8%)
 Frame = +2

Query  134  VAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIV  313
            +AP+PE     + M    T                  Q+ +   LQ ++YPI LKFEE+V
Sbjct  6    IAPRPEESGSGEAMVQGLTDMSET-------------QSKSVQGLQLSMYPITLKFEEVV  52

Query  314  YKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYG  493
            YKV  E  G C  G  S +EKTILNG+TGMVCPGEILAMLGPSGSGKTTLL+ALGGRL  
Sbjct  53   YKVKIEQTGQCL-GSWSCKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLSALGGRLSK  111

Query  494  KLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
              SGKV YN QPFSG IKR TGFVAQDD+LYPHLTV ETL FTALLRLP SLTR+E
Sbjct  112  TFSGKVMYNGQPFSGCIKRRTGFVAQDDILYPHLTVWETLFFTALLRLPSSLTRDE  167



>ref|XP_009145231.1| PREDICTED: ABC transporter G family member 14-like [Brassica 
rapa]
 emb|CDY50951.1| BnaA05g36020D [Brassica napus]
Length=641

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 121/176 (69%), Gaps = 14/176 (8%)
 Frame = +2

Query  134  VAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIV  313
            +AP+PE     + M    T                  Q+ +   LQ ++YPI LKFEE+V
Sbjct  6    IAPRPEESGSGEAMVQGLTDMSET-------------QSKSVQGLQLSMYPITLKFEEVV  52

Query  314  YKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYG  493
            YKV  E  G C  G  S +EKTILNG+TGMVCPGEILAMLGPSGSGKTTLL+ALGGRL  
Sbjct  53   YKVKIEQTGQCL-GSWSCKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLSALGGRLSK  111

Query  494  KLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
              SGKV YN QPFSG IKR TGFVAQDD+LYPHLTV ETL FTALLRLP SLTR+E
Sbjct  112  TFSGKVMYNGQPFSGCIKRRTGFVAQDDILYPHLTVWETLFFTALLRLPSSLTRDE  167



>ref|XP_010324496.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Solanum lycopersicum]
Length=639

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +2

Query  296  KFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTAL  475
            +FEEIVYK+  E+KG CC G S+ +EKTILNGVTG V PGE+LAMLGPSGSGKTTLLTAL
Sbjct  27   EFEEIVYKISQENKGMCCGGSSNTKEKTILNGVTGTVYPGEMLAMLGPSGSGKTTLLTAL  86

Query  476  GGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTR  655
            GGRL GKLSGK+TYNSQPFSGSIKR TGFV+QDDVLYPHLTV ETLLFTALLRLPQ+L R
Sbjct  87   GGRLSGKLSGKITYNSQPFSGSIKRRTGFVSQDDVLYPHLTVIETLLFTALLRLPQNLER  146

Query  656  EE  661
            +E
Sbjct  147  DE  148



>gb|ABB97034.1| ABC transporter-like protein [Brassica rapa]
Length=450

 Score =   201 bits (512),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 106/128 (83%), Gaps = 1/128 (1%)
 Frame = +2

Query  278  LYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKT  457
            +YPI LKFEE+VYKV  E  G C  G  S +EKTILNG+TGMVCPGEILAMLGPSGSGKT
Sbjct  1    MYPITLKFEEVVYKVKIEQTGQCL-GSWSCKEKTILNGITGMVCPGEILAMLGPSGSGKT  59

Query  458  TLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRL  637
            TLL+ALGGRL    SGKV YN QPFSG IKR TGFVAQDD+LYPHLTV ETL FTALLRL
Sbjct  60   TLLSALGGRLSKTFSGKVMYNGQPFSGCIKRRTGFVAQDDILYPHLTVWETLFFTALLRL  119

Query  638  PQSLTREE  661
            P SLTR+E
Sbjct  120  PSSLTRDE  127



>ref|XP_008221126.1| PREDICTED: ABC transporter G family member 14 [Prunus mume]
Length=675

 Score =   204 bits (520),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 132/190 (69%), Gaps = 10/190 (5%)
 Frame = +2

Query  122  ALHSVAPKP-ENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLK  298
            +L S+ PKP E    D    +        D+       A   Q N+QSFLQ  +YPI LK
Sbjct  2    SLSSIVPKPAEYGGSDSATVEGTPEMSETDSKAVVAYPAAAAQVNSQSFLQLTMYPITLK  61

Query  299  FEEIVYKVGGEDKG----SCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLL  466
            FEE+ YKV  E KG    S     +S+REK+IL+G+TG VCPGEILAMLGPSGSGKTTLL
Sbjct  62   FEEVFYKVKMEQKGGGGVSWWGTNTSSREKSILSGITGTVCPGEILAMLGPSGSGKTTLL  121

Query  467  TALGGRLYGK-----LSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALL  631
            TALGGRL  +     +SGK+TYN QPF GSIKR TGFVAQDDVLYPHLTV ETL+FTALL
Sbjct  122  TALGGRLNHQNNCKFMSGKITYNGQPFCGSIKRRTGFVAQDDVLYPHLTVTETLVFTALL  181

Query  632  RLPQSLTREE  661
            RLP+SL+R+E
Sbjct  182  RLPRSLSRDE  191



>ref|XP_006430907.1| hypothetical protein CICLE_v10011273mg [Citrus clementina]
 gb|ESR44147.1| hypothetical protein CICLE_v10011273mg [Citrus clementina]
Length=637

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 120/152 (79%), Gaps = 4/152 (3%)
 Frame = +2

Query  218  DKPCLAYPLQTNTQ--SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSS--AREKTIL  385
            +KP LA  +Q  +Q     Q  L PI LKFE++VYKV  E     CTG  +  A+EKTIL
Sbjct  7    NKPALAVAVQPKSQLAGLHQLILSPITLKFEDVVYKVKLEQPIGFCTGTGTWGAKEKTIL  66

Query  386  NGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFV  565
             G+TGMVCPGE+LAMLGPSGSGKTTLL+ALGGRL+GKL+GK+TYN QPFSGSIKR TGFV
Sbjct  67   KGITGMVCPGELLAMLGPSGSGKTTLLSALGGRLHGKLTGKITYNDQPFSGSIKRRTGFV  126

Query  566  AQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            AQ+D+LYPHLTV ETLLFTALLRLP SLT  E
Sbjct  127  AQNDILYPHLTVTETLLFTALLRLPNSLTYTE  158



>ref|XP_002893685.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69944.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=640

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 123/172 (72%), Gaps = 7/172 (4%)
 Frame = +2

Query  146  PENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVG  325
            P+NC   +  +D     Q     PD   ++     + Q  LQ ++YPI LKFEE+VYKV 
Sbjct  2    PQNCIAPRPEEDGGVMVQ---GLPD---MSETQSKSVQPGLQMSMYPITLKFEEVVYKVK  55

Query  326  GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSG  505
             E + S C G   ++EKTILNG+TGMVCPGE LAMLGPSGSGKTTLL+ALGGRL    SG
Sbjct  56   IE-QTSQCMGSWKSKEKTILNGITGMVCPGEFLAMLGPSGSGKTTLLSALGGRLSKTFSG  114

Query  506  KVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            KV YN QPFSG IKR TGFVAQDDVLYPHLTV ETL FTALLRLP SLTR+E
Sbjct  115  KVMYNGQPFSGCIKRRTGFVAQDDVLYPHLTVWETLFFTALLRLPSSLTRDE  166



>ref|XP_007226971.1| hypothetical protein PRUPE_ppa002442mg [Prunus persica]
 gb|EMJ28170.1| hypothetical protein PRUPE_ppa002442mg [Prunus persica]
Length=672

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 132/191 (69%), Gaps = 11/191 (6%)
 Frame = +2

Query  122  ALHSVAPKP-ENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLK  298
            +L S+ PKP E    D    +         +       A   Q N+QSFLQ A+YPI LK
Sbjct  2    SLSSIVPKPAEYGGSDSATVEGTPEMSETHSKAVVAYPAAAAQVNSQSFLQLAMYPITLK  61

Query  299  FEEIVYKVGGEDKG-----SCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            FEE+ YKV  E KG     S     +S+REK+IL+G+TG VCPGEILAMLGPSGSGKTTL
Sbjct  62   FEEVFYKVKMEQKGGRGGVSWWGTNTSSREKSILSGITGTVCPGEILAMLGPSGSGKTTL  121

Query  464  LTALGGRLYGK-----LSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTAL  628
            LTALGGRL  +     +SGK+TYN QPF GSIKR TGFVAQDDVLYPHLTV ETL+FTAL
Sbjct  122  LTALGGRLNHQNNCKFMSGKITYNGQPFCGSIKRRTGFVAQDDVLYPHLTVTETLVFTAL  181

Query  629  LRLPQSLTREE  661
            LRLP+SL+R+E
Sbjct  182  LRLPKSLSRDE  192



>ref|XP_010054006.1| PREDICTED: ABC transporter G family member 14 [Eucalyptus grandis]
 gb|KCW78389.1| hypothetical protein EUGRSUZ_D02559 [Eucalyptus grandis]
Length=653

 Score =   202 bits (514),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 121/156 (78%), Gaps = 13/156 (8%)
 Frame = +2

Query  200  PADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCC--TGKSSARE  373
            P D+  ++  LAYP+Q          L+PI LKFEE+VYK+  + K SC   T  SS RE
Sbjct  33   PCDS--NEAVLAYPVQVT--------LFPITLKFEEVVYKIKLDQKQSCWGGTWTSSTRE  82

Query  374  KTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRL  553
            KTILNGV+G+VCPGEILAMLGPSGSGKTTLLTALGGRL GKLSGK+ YN QPFSG++KR 
Sbjct  83   KTILNGVSGVVCPGEILAMLGPSGSGKTTLLTALGGRL-GKLSGKIMYNGQPFSGAVKRR  141

Query  554  TGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            TGFVAQDDVLYPHLTV ETLLFTALLRLP +L   E
Sbjct  142  TGFVAQDDVLYPHLTVTETLLFTALLRLPNTLALAE  177



>gb|AES95438.2| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=638

 Score =   202 bits (513),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 126/176 (72%), Gaps = 23/176 (13%)
 Frame = +2

Query  134  VAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIV  313
            +APKPE  +    ++ +     P  +             N QS  +  +YPI LKFE++V
Sbjct  6    IAPKPEYFNSTLSLEGSPHMTDPHSS------------NNEQSLPKLIMYPITLKFEDLV  53

Query  314  YKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYG  493
            YKV           K + +EKTILNG+TG+VCPGEILAMLGPSGSGKTTLLTALGGRL G
Sbjct  54   YKV-----------KVNQKEKTILNGITGVVCPGEILAMLGPSGSGKTTLLTALGGRLNG  102

Query  494  KLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            KL+GK TYN+QPFSGSIKR TGFVAQDDVLYPHLTV ETL+FTALLRLP++LTR+E
Sbjct  103  KLTGKTTYNNQPFSGSIKRRTGFVAQDDVLYPHLTVTETLVFTALLRLPKTLTRDE  158



>gb|KDO72270.1| hypothetical protein CISIN_1g039221mg [Citrus sinensis]
Length=637

 Score =   201 bits (512),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 119/152 (78%), Gaps = 4/152 (3%)
 Frame = +2

Query  218  DKPCLAYPLQTNTQ--SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSA--REKTIL  385
            +KP LA  +Q  +Q     Q  L PI LKFE++VYKV  E     CTG  +   +EKTIL
Sbjct  7    NKPALAVAVQPKSQLAGLHQLILSPITLKFEDVVYKVKLEQPIGFCTGTGTWGDKEKTIL  66

Query  386  NGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFV  565
             G+TGMVCPGE+LAMLGPSGSGKTTLL+ALGGRL+GKL+GK+TYN QPFSGSIKR TGFV
Sbjct  67   KGITGMVCPGELLAMLGPSGSGKTTLLSALGGRLHGKLTGKITYNDQPFSGSIKRRTGFV  126

Query  566  AQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            AQ+D+LYPHLTV ETLLFTALLRLP SLT  E
Sbjct  127  AQNDILYPHLTVTETLLFTALLRLPNSLTYTE  158



>ref|XP_003612480.1| ABC transporter-like protein [Medicago truncatula]
Length=652

 Score =   201 bits (512),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 126/176 (72%), Gaps = 23/176 (13%)
 Frame = +2

Query  134  VAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIV  313
            +APKPE  +    ++ +     P  +             N QS  +  +YPI LKFE++V
Sbjct  6    IAPKPEYFNSTLSLEGSPHMTDPHSS------------NNEQSLPKLIMYPITLKFEDLV  53

Query  314  YKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYG  493
            YKV           K + +EKTILNG+TG+VCPGEILAMLGPSGSGKTTLLTALGGRL G
Sbjct  54   YKV-----------KVNQKEKTILNGITGVVCPGEILAMLGPSGSGKTTLLTALGGRLNG  102

Query  494  KLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            KL+GK TYN+QPFSGSIKR TGFVAQDDVLYPHLTV ETL+FTALLRLP++LTR+E
Sbjct  103  KLTGKTTYNNQPFSGSIKRRTGFVAQDDVLYPHLTVTETLVFTALLRLPKTLTRDE  158



>ref|XP_006482405.1| PREDICTED: ABC transporter G family member 14-like [Citrus sinensis]
Length=637

 Score =   201 bits (512),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 119/152 (78%), Gaps = 4/152 (3%)
 Frame = +2

Query  218  DKPCLAYPLQTNTQ--SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSA--REKTIL  385
            +KP LA  +Q  +Q     Q  L PI LKFE++VYKV  E     CTG  +   +EKTIL
Sbjct  7    NKPALAVAVQPKSQLAGLHQLILSPITLKFEDVVYKVKLEQPIGFCTGTGTWGDKEKTIL  66

Query  386  NGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFV  565
             G+TGMVCPGE+LAMLGPSGSGKTTLL+ALGGRL+GKL+GK+TYN QPFSGSIKR TGFV
Sbjct  67   KGITGMVCPGELLAMLGPSGSGKTTLLSALGGRLHGKLTGKITYNDQPFSGSIKRRTGFV  126

Query  566  AQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            AQ+D+LYPHLTV ETLLFTALLRLP SLT  E
Sbjct  127  AQNDILYPHLTVTETLLFTALLRLPNSLTYTE  158



>gb|KFK44944.1| hypothetical protein AALP_AA1G323000 [Arabis alpina]
Length=640

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 124/172 (72%), Gaps = 7/172 (4%)
 Frame = +2

Query  146  PENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVG  325
            P+NC   +  ++     Q       +  L       +QS  Q ++YPI LKFEE++YKV 
Sbjct  2    PQNCIAPRPEENGEVLVQDLSETQSRSVL------TSQSGFQLSMYPITLKFEEVMYKVK  55

Query  326  GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSG  505
             + + S C G  S++EKTILNG++GM+CPGEILAMLGPSGSGKTTLL+ALGGRL    +G
Sbjct  56   IK-QTSQCFGSWSSKEKTILNGISGMICPGEILAMLGPSGSGKTTLLSALGGRLSKTFTG  114

Query  506  KVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            KV YN QPFSG+IKR TGFVAQDDVLYPHLTV ETL FTALLRLP +LTR+E
Sbjct  115  KVMYNGQPFSGNIKRRTGFVAQDDVLYPHLTVWETLFFTALLRLPSTLTRDE  166



>gb|AAG50724.1|AC079041_17 ABC transporter, putative [Arabidopsis thaliana]
Length=646

 Score =   199 bits (506),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 124/175 (71%), Gaps = 7/175 (4%)
 Frame = +2

Query  146  PENCSPDQRMDDAATTNQPADAAPD---KPCLAYPLQTNTQSFLQRALYPIVLKFEEIVY  316
            P+NC   +  +D     Q      D   K  LA+P  T +Q  LQ ++YPI LK  E+VY
Sbjct  2    PQNCIAPRPEEDGGVMVQGLPDMSDTQSKSVLAFPTIT-SQPGLQMSMYPITLK--EVVY  58

Query  317  KVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGK  496
            KV  E + S C G   ++EKTILNG+TGMVCPGE LAMLGPSGSGKTTLL+ALGGRL   
Sbjct  59   KVKIE-QTSQCMGSWKSKEKTILNGITGMVCPGEFLAMLGPSGSGKTTLLSALGGRLSKT  117

Query  497  LSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
             SGKV YN QPFSG IKR TGFVAQDDVLYPHLTV ETL FTALLRLP SLTR+E
Sbjct  118  FSGKVMYNGQPFSGCIKRRTGFVAQDDVLYPHLTVWETLFFTALLRLPSSLTRDE  172



>ref|XP_008347335.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Malus domestica]
Length=755

 Score =   200 bits (508),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 134/197 (68%), Gaps = 11/197 (6%)
 Frame = +2

Query  86   TQTFLRFSLAMPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSF  265
            TQTF   + AM +L S+ PKP                 P   A ++   A   Q N+Q+F
Sbjct  81   TQTF---NFAM-SLSSIVPKPAEYGGSDSTCATTVEGSPEMPAGNQNKAAPATQVNSQAF  136

Query  266  LQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSG  445
            LQ  LYPI LKFEE+ YKV  + KGS     S +REK+IL+G+TGMV PGEILAMLGPSG
Sbjct  137  LQLTLYPITLKFEEVFYKVKVDQKGS--RDSSRSREKSILSGITGMVXPGEILAMLGPSG  194

Query  446  SGKTTLLTALGGRLYGK-----LSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKET  610
            SGKTTLLTALGGRL  +     +SGK++YN Q F G+IKR TGFVAQDDVLYPHLTV ET
Sbjct  195  SGKTTLLTALGGRLNHQNNSKFMSGKISYNGQSFCGAIKRRTGFVAQDDVLYPHLTVTET  254

Query  611  LLFTALLRLPQSLTREE  661
            L+FTA+LRLP SL R+E
Sbjct  255  LVFTAMLRLPNSLGRDE  271



>ref|XP_008347334.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Malus domestica]
Length=771

 Score =   200 bits (508),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 134/197 (68%), Gaps = 11/197 (6%)
 Frame = +2

Query  86   TQTFLRFSLAMPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSF  265
            TQTF   + AM +L S+ PKP                 P   A ++   A   Q N+Q+F
Sbjct  81   TQTF---NFAM-SLSSIVPKPAEYGGSDSTCATTVEGSPEMPAGNQNKAAPATQVNSQAF  136

Query  266  LQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSG  445
            LQ  LYPI LKFEE+ YKV  + KGS     S +REK+IL+G+TGMV PGEILAMLGPSG
Sbjct  137  LQLTLYPITLKFEEVFYKVKVDQKGS--RDSSRSREKSILSGITGMVXPGEILAMLGPSG  194

Query  446  SGKTTLLTALGGRLYGK-----LSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKET  610
            SGKTTLLTALGGRL  +     +SGK++YN Q F G+IKR TGFVAQDDVLYPHLTV ET
Sbjct  195  SGKTTLLTALGGRLNHQNNSKFMSGKISYNGQSFCGAIKRRTGFVAQDDVLYPHLTVTET  254

Query  611  LLFTALLRLPQSLTREE  661
            L+FTA+LRLP SL R+E
Sbjct  255  LVFTAMLRLPNSLGRDE  271



>ref|XP_009397435.1| PREDICTED: ABC transporter G family member 14 [Musa acuminata 
subsp. malaccensis]
Length=656

 Score =   194 bits (493),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 109/131 (83%), Gaps = 5/131 (4%)
 Frame = +2

Query  275  ALYPIVLKFEEIVYKV--GGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGS  448
            A++PI LKFEE+VYKV  GG   G      SS  EKTILNG+TG+VCPGE+LAMLGPSGS
Sbjct  44   AVFPITLKFEEVVYKVKVGG---GGWWRRSSSPAEKTILNGITGVVCPGEMLAMLGPSGS  100

Query  449  GKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTAL  628
            GKTTLLTALGGRL GKLSGK+TYN  PFSG+IKR TGFVAQDDVLYPHLTV ETL FTAL
Sbjct  101  GKTTLLTALGGRLGGKLSGKITYNGHPFSGAIKRRTGFVAQDDVLYPHLTVTETLTFTAL  160

Query  629  LRLPQSLTREE  661
            LRLP +LTR E
Sbjct  161  LRLPGTLTRAE  171



>ref|XP_009384518.1| PREDICTED: ABC transporter G family member 14-like [Musa acuminata 
subsp. malaccensis]
Length=643

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 119/172 (69%), Gaps = 14/172 (8%)
 Frame = +2

Query  146  PENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVG  325
            P    PD         N+P     +   +AYP Q         A+ PI LKFEE+VYKV 
Sbjct  3    PRETEPD---SGGGHANRPIG---NSTVVAYPSQAA-------AVLPITLKFEEVVYKVK  49

Query  326  GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSG  505
               KG   +  S A EKTIL+G+TG+VCPGE+LAMLGPSGSGKTTLLTALGGRL GKLSG
Sbjct  50   RGAKGWWPSSSSPA-EKTILDGITGVVCPGELLAMLGPSGSGKTTLLTALGGRLRGKLSG  108

Query  506  KVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            K+TYN  PF+G +KR TGFVAQDDVLYPHLTV ETL FTALLRLP SL+R E
Sbjct  109  KITYNGHPFTGVVKRRTGFVAQDDVLYPHLTVTETLTFTALLRLPGSLSRAE  160



>ref|XP_004147769.1| PREDICTED: ABC transporter G family member 14 [Cucumis sativus]
 gb|KGN53471.1| hypothetical protein Csa_4G056620 [Cucumis sativus]
Length=655

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 118/172 (69%), Gaps = 19/172 (11%)
 Frame = +2

Query  203  ADAAPDKPCLAYPLQT---NTQS--------FLQRALYPIVLKFEEIVYKVGGEDKGSCC  349
            +D A +    AYP      NTQ           Q  L  + LKFEEIVYKV  E KG  C
Sbjct  2    SDVAQNDAVFAYPFHVDSHNTQDNNNNNNNNLHQLPLLTVTLKFEEIVYKVKLEGKGGSC  61

Query  350  TGKSSA--------REKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSG  505
             G            REKTILNG++G+V PGEILAMLGPSGSGKTTLLTALGGRL GKLSG
Sbjct  62   WGGGGGSSWGAAANREKTILNGLSGVVFPGEILAMLGPSGSGKTTLLTALGGRLSGKLSG  121

Query  506  KVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            K+TYN QPFSG+ KR TGFVAQDDVLYPHLTV ETLLFTALLRLP SLT +E
Sbjct  122  KITYNGQPFSGATKRRTGFVAQDDVLYPHLTVAETLLFTALLRLPSSLTADE  173



>ref|XP_008451875.1| PREDICTED: ABC transporter G family member 14 [Cucumis melo]
Length=655

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 118/172 (69%), Gaps = 19/172 (11%)
 Frame = +2

Query  203  ADAAPDKPCLAYPLQTNTQS-----------FLQRALYPIVLKFEEIVYKVGGEDKGSCC  349
            +D A +   LAYP   ++ +             Q  L  + LKFEEIVYKV  E KG  C
Sbjct  2    SDVAQNDAVLAYPFHVDSHNTRANNNNSNNNLHQLPLLTVTLKFEEIVYKVKLEGKGGSC  61

Query  350  TGKSS--------AREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSG  505
             G            REKTILNG++G+V PGEILAMLGPSGSGKTTLLTALGGRL GKLSG
Sbjct  62   WGGGGGSSWGAAATREKTILNGLSGVVFPGEILAMLGPSGSGKTTLLTALGGRLSGKLSG  121

Query  506  KVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            K+TYN QPF G+ KR TGFVAQDDVLYPHLTV ETLLFTALLRLP SLT EE
Sbjct  122  KITYNGQPFCGATKRRTGFVAQDDVLYPHLTVAETLLFTALLRLPSSLTAEE  173



>ref|XP_010910173.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Elaeis guineensis]
Length=653

 Score =   185 bits (470),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 109/133 (82%), Gaps = 4/133 (3%)
 Frame = +2

Query  275  ALYPIVLKFEEIVYKV--GGEDKGSCCTGKSSAR-EKTILNGVTGMVCPGEILAMLGPSG  445
            AL P+ L+FEE+ YKV  G     S C G ++A  EK ILNG+TGMV PGEILAMLGPSG
Sbjct  36   ALSPVTLRFEEVAYKVKLGQPMWWSSCHGSAAAAAEKVILNGITGMVPPGEILAMLGPSG  95

Query  446  SGKTTLLTALGGRLY-GKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFT  622
            SGKTTLLTALGGRL  GKLSG +TYN QPFSG++KR TGFVAQDDVLYPHLTV ETL+FT
Sbjct  96   SGKTTLLTALGGRLVTGKLSGTITYNGQPFSGAMKRRTGFVAQDDVLYPHLTVHETLVFT  155

Query  623  ALLRLPQSLTREE  661
            ALLRLP+SL+R E
Sbjct  156  ALLRLPRSLSRAE  168



>ref|XP_010910172.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Elaeis guineensis]
Length=668

 Score =   185 bits (470),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 109/133 (82%), Gaps = 4/133 (3%)
 Frame = +2

Query  275  ALYPIVLKFEEIVYKV--GGEDKGSCCTGKSSAR-EKTILNGVTGMVCPGEILAMLGPSG  445
            AL P+ L+FEE+ YKV  G     S C G ++A  EK ILNG+TGMV PGEILAMLGPSG
Sbjct  36   ALSPVTLRFEEVAYKVKLGQPMWWSSCHGSAAAAAEKVILNGITGMVPPGEILAMLGPSG  95

Query  446  SGKTTLLTALGGRLY-GKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFT  622
            SGKTTLLTALGGRL  GKLSG +TYN QPFSG++KR TGFVAQDDVLYPHLTV ETL+FT
Sbjct  96   SGKTTLLTALGGRLVTGKLSGTITYNGQPFSGAMKRRTGFVAQDDVLYPHLTVHETLVFT  155

Query  623  ALLRLPQSLTREE  661
            ALLRLP+SL+R E
Sbjct  156  ALLRLPRSLSRAE  168



>ref|XP_010324497.1| PREDICTED: ABC transporter G family member 14-like isoform X3 
[Solanum lycopersicum]
 ref|XP_010324498.1| PREDICTED: ABC transporter G family member 14-like isoform X3 
[Solanum lycopersicum]
Length=598

 Score =   184 bits (468),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +2

Query  344  CCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNS  523
            CC G S+ +EKTILNGVTG V PGE+LAMLGPSGSGKTTLLTALGGRL GKLSGK+TYNS
Sbjct  2    CCGGSSNTKEKTILNGVTGTVYPGEMLAMLGPSGSGKTTLLTALGGRLSGKLSGKITYNS  61

Query  524  QPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            QPFSGSIKR TGFV+QDDVLYPHLTV ETLLFTALLRLPQ+L R+E
Sbjct  62   QPFSGSIKRRTGFVSQDDVLYPHLTVIETLLFTALLRLPQNLERDE  107



>gb|EPS63929.1| hypothetical protein M569_10851 [Genlisea aurea]
Length=634

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 122/177 (69%), Gaps = 19/177 (11%)
 Frame = +2

Query  131  SVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEI  310
            SVAPKP   S           ++     PD+   A+   T + S +QR L+P+ LKFE+I
Sbjct  5    SVAPKPGPGS-----------SETGAVQPDE-LPAFTALTGSNSIVQRTLFPVTLKFEDI  52

Query  311  VYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLY  490
              KVG +         S  ++KTILNG+TG V PGE+LAMLGPSGSGKTTLLTALGGRL 
Sbjct  53   GCKVGSKSD-------SVLKQKTILNGITGTVSPGEVLAMLGPSGSGKTTLLTALGGRLA  105

Query  491  GKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            GKLSG++TYN +PFSG+I+R TGFV+QDDVLY HLTV ETLLFTALLRLP SL   +
Sbjct  106  GKLSGRITYNGEPFSGTIRRKTGFVSQDDVLYQHLTVFETLLFTALLRLPDSLKEHD  162



>ref|XP_003520157.2| PREDICTED: ABC transporter G family member 21-like [Glycine max]
Length=680

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 119/174 (68%), Gaps = 13/174 (7%)
 Frame = +2

Query  143  KPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKV  322
            KP   S D   ++++  +Q A +AP              S LQ++L P+ LKFE++ Y +
Sbjct  39   KPTFTSNDIHNNNSSQHHQAAPSAPRF------------SVLQQSLRPVTLKFEDVSYSI  86

Query  323  G-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKL  499
              G DK  C + +     KT+LNGVTGMV P E++AMLGPSGSGKTTLLTAL GRL GKL
Sbjct  87   TFGRDKNGCVSSQKPKHTKTVLNGVTGMVGPREVMAMLGPSGSGKTTLLTALAGRLAGKL  146

Query  500  SGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            SG +TYN  PFS S+KR  GFV+QDDVLYPHLTV ETL + A+L+LP+SLTRE+
Sbjct  147  SGAITYNGHPFSSSMKRNIGFVSQDDVLYPHLTVLETLTYAAMLKLPKSLTRED  200



>ref|XP_010265331.1| PREDICTED: ABC transporter G family member 21-like [Nelumbo nucifera]
Length=666

 Score =   181 bits (458),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 114/161 (71%), Gaps = 7/161 (4%)
 Frame = +2

Query  200  PADAAPDKPCLAYPLQTNTQ------SFLQRALYPIVLKFEEIVYKVG-GEDKGSCCTGK  358
            PA ++   PCL   +    +      S L+R+L P+ LKFE++VY +   +  G C +  
Sbjct  22   PALSSNVSPCLEDRMAEQLKARMGECSILRRSLRPVTLKFEDVVYSIKLKKSDGYCFSSP  81

Query  359  SSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSG  538
                E+TILNGVTG+V PGE+LAMLGPSGSGKTTLLTAL GRL GK SG +TYN +PFSG
Sbjct  82   DPKPERTILNGVTGIVRPGELLAMLGPSGSGKTTLLTALAGRLPGKFSGSITYNGRPFSG  141

Query  539  SIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            SIKR TGFV QDDVLYPHLTV ETL + ALLRLP  LTREE
Sbjct  142  SIKRKTGFVTQDDVLYPHLTVLETLTYAALLRLPNKLTREE  182



>ref|XP_010918656.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Elaeis guineensis]
Length=648

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 106/129 (82%), Gaps = 7/129 (5%)
 Frame = +2

Query  278  LYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKT  457
            ++P++LKFEE+VYKV          G +   EKTILNG++G+VCPGEILAMLGPSGSGKT
Sbjct  41   VFPVILKFEEVVYKV------KVGGGGAGLAEKTILNGISGVVCPGEILAMLGPSGSGKT  94

Query  458  TLLTALGGR-LYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLR  634
            TLLTALGGR L GKLSGK+TYN  PFSG +KR TGFVAQDDVLYPHLTV ETL+FTALLR
Sbjct  95   TLLTALGGRRLPGKLSGKITYNGLPFSGPMKRRTGFVAQDDVLYPHLTVAETLVFTALLR  154

Query  635  LPQSLTREE  661
            LP+SL R E
Sbjct  155  LPRSLGRAE  163



>ref|XP_006573283.1| PREDICTED: ABC transporter G family member 21-like [Glycine max]
Length=678

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 112/163 (69%), Gaps = 10/163 (6%)
 Frame = +2

Query  176  DDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVG-GEDKGSCCT  352
            D    T+Q    AP  P           S LQ++L P+ LKFE++ Y +  G D   C +
Sbjct  46   DIHNHTSQNHQVAPSAPRF---------SILQQSLRPVTLKFEDVSYSITFGRDNNGCVS  96

Query  353  GKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPF  532
             +     +T+LNGVTGMV PGE++AMLGPSGSGKTTLLTAL GRL GKLSG +TYN  PF
Sbjct  97   PQKPKHTRTVLNGVTGMVGPGEVMAMLGPSGSGKTTLLTALAGRLDGKLSGAITYNGHPF  156

Query  533  SGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            S S+KR  GFV+QDDVLYPHLTV E+L + A+L+LP+SLTREE
Sbjct  157  SSSMKRNIGFVSQDDVLYPHLTVLESLTYAAMLKLPKSLTREE  199



>ref|XP_010943389.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Elaeis guineensis]
Length=661

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 116/166 (70%), Gaps = 11/166 (7%)
 Frame = +2

Query  197  QPADAAPDKPCLAYPLQTNTQ--SFLQRALYPIVLKFEEIVYKVGGEDKGS--------C  346
             P   A +   +AYP   +    + L  A++P++LKFEE+ YKV     GS         
Sbjct  12   HPNGPAANPTVVAYPTPHSYPCCTLLATAVFPVLLKFEEVEYKVKVSHHGSKGPGLCCCG  71

Query  347  CTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGR-LYGKLSGKVTYNS  523
              G     EKTIL G+TG+VCPGE+LAMLGPSGSGKTTLLTALGGR L GKLSGK+TYN 
Sbjct  72   RGGGGGQAEKTILKGITGVVCPGEMLAMLGPSGSGKTTLLTALGGRCLAGKLSGKITYNG  131

Query  524  QPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
             PFSG +KR TGFVAQDDVLYPHLTV ETL+FTALLRLP+SL R E
Sbjct  132  LPFSGPMKRRTGFVAQDDVLYPHLTVAETLVFTALLRLPRSLDRAE  177



>ref|XP_010066762.1| PREDICTED: ABC transporter G family member 21 [Eucalyptus grandis]
 gb|KCW64799.1| hypothetical protein EUGRSUZ_G02369 [Eucalyptus grandis]
Length=679

 Score =   177 bits (449),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 104/135 (77%), Gaps = 1/135 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVG-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            SFL+R+LYPI LKFE++ Y +    ++ SCC        + +LNGVTGM  PGE+LAMLG
Sbjct  59   SFLRRSLYPITLKFEDVGYNIKLRTNRNSCCAPNEPKLTRNVLNGVTGMARPGELLAMLG  118

Query  437  PSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLL  616
            PSGSGKTTLLTAL GRL GK++G +TYN  PFS S+KR  GFV+QDDVLYPHLTV ETL 
Sbjct  119  PSGSGKTTLLTALAGRLPGKVTGAITYNGHPFSSSVKRKIGFVSQDDVLYPHLTVLETLT  178

Query  617  FTALLRLPQSLTREE  661
            + ALLRLP+ LTR+E
Sbjct  179  YAALLRLPKELTRQE  193



>ref|XP_004293103.1| PREDICTED: ABC transporter G family member 9 [Fragaria vesca 
subsp. vesca]
Length=633

 Score =   177 bits (448),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 117/169 (69%), Gaps = 15/169 (9%)
 Frame = +2

Query  164  DQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGS  343
            DQ+M D  + N+  +   + P +            ++A+ P+ LKFE++ Y +  E  G 
Sbjct  2    DQQMVDLES-NRRTNIDEESPAI-----------FKKAIRPVTLKFEDVAYTIKAETDGM  49

Query  344  CC---TGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVT  514
                   K+S  EK ILNG++G+V PGEILAMLGPSGSGKTTLLTALGGRL GKLSG +T
Sbjct  50   SWLRKKDKNSDSEKHILNGISGVVKPGEILAMLGPSGSGKTTLLTALGGRLGGKLSGSIT  109

Query  515  YNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            YN++PFS ++KR TGFV QDD LYPHLTV ETL+FTALLRLP +LT+ E
Sbjct  110  YNNKPFSNTMKRNTGFVTQDDFLYPHLTVAETLVFTALLRLPNTLTKAE  158



>ref|XP_010918655.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Elaeis guineensis]
Length=666

 Score =   177 bits (448),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 107/141 (76%), Gaps = 13/141 (9%)
 Frame = +2

Query  278  LYPIVLKFEEIVYKVGGEDKGSCCTG------------KSSAREKTILNGVTGMVCPGEI  421
            ++P++LKFEE+VYKV      S   G             +   EKTILNG++G+VCPGEI
Sbjct  41   VFPVILKFEEVVYKVKVGHHSSKSPGLFCCCCGGGGGGGAGLAEKTILNGISGVVCPGEI  100

Query  422  LAMLGPSGSGKTTLLTALGGR-LYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLT  598
            LAMLGPSGSGKTTLLTALGGR L GKLSGK+TYN  PFSG +KR TGFVAQDDVLYPHLT
Sbjct  101  LAMLGPSGSGKTTLLTALGGRRLPGKLSGKITYNGLPFSGPMKRRTGFVAQDDVLYPHLT  160

Query  599  VKETLLFTALLRLPQSLTREE  661
            V ETL+FTALLRLP+SL R E
Sbjct  161  VAETLVFTALLRLPRSLGRAE  181



>ref|XP_010943390.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Elaeis guineensis]
Length=660

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 105/137 (77%), Gaps = 9/137 (7%)
 Frame = +2

Query  278  LYPIVLKFEEIVYKVGGEDKGS--------CCTGKSSAREKTILNGVTGMVCPGEILAML  433
            ++P+VLKFEE+ YKV     GS           G     EKTIL G+TG+VCPGE+LAML
Sbjct  40   VFPVVLKFEEVEYKVKVSHHGSKGPGLCCCGRGGGGGQAEKTILKGITGVVCPGEMLAML  99

Query  434  GPSGSGKTTLLTALGGR-LYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKET  610
            GPSGSGKTTLLTALGGR L GKLSGK+TYN  PFSG +KR TGFVAQDDVLYPHLTV ET
Sbjct  100  GPSGSGKTTLLTALGGRCLAGKLSGKITYNGLPFSGPMKRRTGFVAQDDVLYPHLTVAET  159

Query  611  LLFTALLRLPQSLTREE  661
            L+FTALLRLP+SL R E
Sbjct  160  LVFTALLRLPRSLDRAE  176



>ref|XP_007153314.1| hypothetical protein PHAVU_003G024700g [Phaseolus vulgaris]
 gb|ESW25308.1| hypothetical protein PHAVU_003G024700g [Phaseolus vulgaris]
Length=671

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 107/135 (79%), Gaps = 1/135 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVG-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            S L+++L P+ LKFE++ Y +  G +K  C + +     +T+LNGV+GMV PGE++AMLG
Sbjct  58   SVLRQSLRPVTLKFEDVSYSITFGREKNGCVSSQKPKHTRTVLNGVSGMVGPGEVMAMLG  117

Query  437  PSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLL  616
            PSGSGKTTLLTAL GRL GKLSG VTYN+ PFS S++R  GFV+QDDVLYPHLTV ETL 
Sbjct  118  PSGSGKTTLLTALAGRLAGKLSGAVTYNNHPFSSSMRRNIGFVSQDDVLYPHLTVIETLG  177

Query  617  FTALLRLPQSLTREE  661
            + A+L+LP+SLTREE
Sbjct  178  YAAMLKLPKSLTREE  192



>ref|XP_007225163.1| hypothetical protein PRUPE_ppa002351mg [Prunus persica]
 gb|EMJ26362.1| hypothetical protein PRUPE_ppa002351mg [Prunus persica]
Length=683

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 120/173 (69%), Gaps = 7/173 (4%)
 Frame = +2

Query  161  PDQRMDDAATTNQPADAAPDKPCLAYPL-----QTNTQSFLQRALYPIVLKFEEIVYKVG  325
            PDQ     A  + P  +  + PCL   +      ++  S L+++L P+ LKFE++ Y + 
Sbjct  25   PDQNGSVHAERSTPPSSNVN-PCLGDDMPADRPTSHRTSILRQSLRPVTLKFEDVTYSIK  83

Query  326  GED-KGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLS  502
             +  +G C       + +TILNGV+G+V PGE+LAMLGPSGSGKTTLLTALGGRL GK+S
Sbjct  84   LQTTRGGCVASHEPKQTRTILNGVSGIVRPGELLAMLGPSGSGKTTLLTALGGRLPGKIS  143

Query  503  GKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            GK+TYN Q FS S+K  TGFV QDDVLYPHLTV ETL +TALLRLP+ LT+EE
Sbjct  144  GKITYNGQHFSSSMKHNTGFVTQDDVLYPHLTVLETLTYTALLRLPKQLTKEE  196



>ref|XP_010425210.1| PREDICTED: ABC transporter G family member 21 isoform X2 [Camelina 
sativa]
Length=468

 Score =   172 bits (437),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 108/141 (77%), Gaps = 2/141 (1%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSAR-EKTILNGVTGMVCPGE  418
            Q+   S L+++L PI LKFEE+ Y +  + +KGS   G    +  + ILNGV+G+V PGE
Sbjct  51   QSRQSSVLRQSLRPITLKFEELTYSIKSQTEKGSYWFGSQEPKPNRLILNGVSGIVKPGE  110

Query  419  ILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLT  598
            +LAMLGPSGSGKTTL+TAL GRL GKLSG V+YN  PF+ S+KR TGFV QDDVLYPHLT
Sbjct  111  LLAMLGPSGSGKTTLVTALAGRLQGKLSGTVSYNGTPFTSSVKRKTGFVTQDDVLYPHLT  170

Query  599  VKETLLFTALLRLPQSLTREE  661
            V ETL +TALLRLP+ LTR+E
Sbjct  171  VMETLTYTALLRLPKELTRKE  191



>ref|XP_010556399.1| PREDICTED: ABC transporter G family member 21-like [Tarenaya 
hassleriana]
Length=685

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 113/166 (68%), Gaps = 6/166 (4%)
 Frame = +2

Query  182  AATTNQPADAAP----DKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVG-GEDKGSC  346
            A  ++ P+   P    + P      Q    S L+R+L P++LKFE++ Y +     KGS 
Sbjct  33   ADRSSSPSHVIPCPDEENPSPHQDHQLRKSSVLRRSLRPVILKFEDLTYSINLRTGKGSF  92

Query  347  CTGKSSARE-KTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNS  523
              G    +  + ILNGVTG+V PGE+LAMLGPSGSGKTTLLTAL GRL GKLSG VTYN 
Sbjct  93   WFGSHEPKSTRLILNGVTGIVKPGELLAMLGPSGSGKTTLLTALAGRLNGKLSGSVTYNG  152

Query  524  QPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            QPFS S+KR  GFV QDDVLYPHLTV ETL FTA+LRLP+ LTR E
Sbjct  153  QPFSSSVKRKIGFVTQDDVLYPHLTVTETLTFTAMLRLPKELTRLE  198



>gb|AIU41651.1| ABC transporter family protein [Hevea brasiliensis]
Length=680

 Score =   174 bits (442),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGP  439
            S L+ +L P+ L F ++ Y +    KGSCC+   S   + +LNGV+G+V PGE++AMLGP
Sbjct  61   SILRASLRPVTLMFVDVAYSIDLSTKGSCCSPNGSKSTRIVLNGVSGIVRPGELVAMLGP  120

Query  440  SGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLF  619
            SGSGKTTLLTAL GRL GK+SG +TYN  PFS S+KR TGFVAQDDV YPHLTV ETL F
Sbjct  121  SGSGKTTLLTALAGRLPGKVSGTITYNGLPFSSSVKRKTGFVAQDDVFYPHLTVIETLTF  180

Query  620  TALLRLPQSLTREE  661
             ALLRLP+ LTREE
Sbjct  181  AALLRLPKMLTREE  194



>ref|XP_010668407.1| PREDICTED: ABC transporter G family member 21-like, partial [Beta 
vulgaris subsp. vulgaris]
Length=344

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 126/193 (65%), Gaps = 19/193 (10%)
 Frame = +2

Query  140  PKPENCSPDQRMDDAATTNQPADAAPDKPCLAY----PLQTNTQSFLQRA----------  277
            P   + SP  ++ +AA TN    +   +P L+     P   + + F Q++          
Sbjct  8    PTSNSSSPSIKIHNAANTNPEEFSVHMEPSLSNRAISPCLEDLEPFHQQSVPPQFSTLHG  67

Query  278  -LYPIVLKFEEIVYKVGGE--DKGSCCTGKSSAR-EKTILNGVTGMVCPGEILAMLGPSG  445
             L PI+LKFE++ Y +      + +CC G +S +  + IL+GVTG+V  GE+LAMLGPSG
Sbjct  68   SLRPIILKFEDVTYNITLHPTQESACCLGNTSPKLNRVILDGVTGIVRSGELLAMLGPSG  127

Query  446  SGKTTLLTALGGRLYGKLSG-KVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFT  622
            SGKTTLLTALGGRL GK+SG  +TYN  PFSGS+KR  GFV QDDVLYPHLTV ETL +T
Sbjct  128  SGKTTLLTALGGRLPGKISGGSITYNQHPFSGSVKRKIGFVTQDDVLYPHLTVLETLTYT  187

Query  623  ALLRLPQSLTREE  661
            ALLRLP+ LT+++
Sbjct  188  ALLRLPKKLTKQD  200



>ref|XP_002876921.1| hypothetical protein ARALYDRAFT_904727 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53180.1| hypothetical protein ARALYDRAFT_904727 [Arabidopsis lyrata subsp. 
lyrata]
Length=671

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 109/141 (77%), Gaps = 2/141 (1%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGED-KGSCCTGKSSAR-EKTILNGVTGMVCPGE  418
            Q+   S L+++L PI+LKFEE+ Y +  +  KGS   G    +  + ILNGV+G+V PGE
Sbjct  50   QSRQSSVLRQSLRPIILKFEELSYSIKSQTGKGSYWFGSQEPKPNRLILNGVSGIVKPGE  109

Query  419  ILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLT  598
            +LAMLGPSGSGKTTL+TAL GRL GKLSG V+YN +PF+ S+KR TGFV QDDVLYPHLT
Sbjct  110  LLAMLGPSGSGKTTLVTALAGRLQGKLSGTVSYNGEPFTSSVKRKTGFVTQDDVLYPHLT  169

Query  599  VKETLLFTALLRLPQSLTREE  661
            V ETL +TALLRLP+ LTR+E
Sbjct  170  VMETLTYTALLRLPKELTRKE  190



>ref|XP_009605775.1| PREDICTED: ABC transporter G family member 9 [Nicotiana tomentosiformis]
Length=616

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 105/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEIL  424
            Q  + +  ++   P+ LKFE +VYK+  + +G   +      EK IL G+TG+V PGE+L
Sbjct  12   QLESAAIFKKTNLPVTLKFENVVYKIKPKKEGLFNSSSKLEEEKIILKGITGIVFPGEML  71

Query  425  AMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVK  604
            AMLGPSGSGKTTLLT LGGRL G+L+G +TYN +PF+ ++KR TGFV QDD+LYPHLTV 
Sbjct  72   AMLGPSGSGKTTLLTGLGGRLSGRLAGSITYNGKPFTNAMKRYTGFVTQDDILYPHLTVT  131

Query  605  ETLLFTALLRLPQSLTREE  661
            ETLLFTALLRLP++L+ EE
Sbjct  132  ETLLFTALLRLPKTLSHEE  150



>ref|XP_010648137.1| PREDICTED: ABC transporter G family member 21 [Vitis vinifera]
 emb|CBI27088.3| unnamed protein product [Vitis vinifera]
Length=676

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 118/179 (66%), Gaps = 8/179 (4%)
 Frame = +2

Query  146  PENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQ------SFLQRALYPIVLKFEE  307
            P N     R+++  T +    A+   PCL        Q      S L+ +L P+ LKFE+
Sbjct  14   PANVLGANRIENV-TIHAAEPASNVSPCLEDQTPDGQQTTRPQFSILRESLRPVTLKFED  72

Query  308  IVYKVG-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGR  484
            +VY +     +GSC       + +T+LNGV+G+  PGE+LAMLGPSGSGKTTLLTAL GR
Sbjct  73   VVYVIKLRSTEGSCFGSPEPKQSRTVLNGVSGIARPGELLAMLGPSGSGKTTLLTALAGR  132

Query  485  LYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            L GK+SG +TYN QPFS S+KR TGFV QDDVLYPHLTV ETL + ALLRLP+ LTREE
Sbjct  133  LPGKVSGNITYNGQPFSSSMKRKTGFVTQDDVLYPHLTVLETLTYAALLRLPKKLTREE  191



>emb|CAN62390.1| hypothetical protein VITISV_039480 [Vitis vinifera]
Length=696

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 119/183 (65%), Gaps = 8/183 (4%)
 Frame = +2

Query  134  VAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQ------SFLQRALYPIVL  295
            +   P N     R+++  T +    A+   PCL        Q      S L+ +L P+ L
Sbjct  30   ITGDPANVLGANRIENV-TIHAAEPASNVSPCLEDQTPDGQQTTRPQFSILRESLRPVTL  88

Query  296  KFEEIVYKVG-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            KFE++VY +     +GSC       + +T+LNGV+G+  PGE+LAMLGPSGSGKTTLLTA
Sbjct  89   KFEDVVYVIKLRSTEGSCFGSPEPKQSRTVLNGVSGIARPGELLAMLGPSGSGKTTLLTA  148

Query  473  LGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLT  652
            L GRL GK+SG +TYN QPFS S+KR TGFV QDDVLYPHLTV ETL + ALLRLP+ LT
Sbjct  149  LAGRLPGKVSGNITYNGQPFSSSMKRKTGFVTQDDVLYPHLTVLETLTYAALLRLPKKLT  208

Query  653  REE  661
            REE
Sbjct  209  REE  211



>ref|XP_010502440.1| PREDICTED: ABC transporter G family member 21-like isoform X2 
[Camelina sativa]
Length=468

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 107/141 (76%), Gaps = 2/141 (1%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSAR-EKTILNGVTGMVCPGE  418
            Q+   S L+++L PI LKFEE+ Y +  + +KGS   G    +  + ILNGV+G+V PGE
Sbjct  51   QSRQSSVLRQSLRPITLKFEELTYSIKSQTEKGSYWFGSQEPKPNRLILNGVSGIVKPGE  110

Query  419  ILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLT  598
            +LAMLGPSGSGKTTL+TAL GRL GKLSG V+YN  PF+  +KR TGFV QDDVLYPHLT
Sbjct  111  LLAMLGPSGSGKTTLVTALAGRLQGKLSGTVSYNGTPFTSYVKRKTGFVTQDDVLYPHLT  170

Query  599  VKETLLFTALLRLPQSLTREE  661
            V ETL +TALLRLP+ LTR+E
Sbjct  171  VMETLTYTALLRLPKELTRKE  191



>ref|XP_008805673.1| PREDICTED: ABC transporter G family member 14-like [Phoenix dactylifera]
Length=666

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 116/177 (66%), Gaps = 31/177 (18%)
 Frame = +2

Query  200  PADAAPDKPCLAYPLQTNTQSFLQRA--LYPIVLKFEEIVYKVGGEDKGSCCTGKSSAR-  370
            P + A +   +A P   +    L  A  ++P++LKFEE+VYKV          G+ S++ 
Sbjct  13   PNEPAVNTTVVACPTPHSNPRHLPHAGVVFPVILKFEEVVYKVK--------VGRHSSKG  64

Query  371  -------------------EKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGR-LY  490
                               EK ILNG+TG+VCPGEILAMLGPSGSGKTTLLTA GGR L 
Sbjct  65   PGLCCCCGRGGGGGGGGPAEKMILNGITGVVCPGEILAMLGPSGSGKTTLLTAFGGRRLS  124

Query  491  GKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            GKLSGK+TYN  PFSG +KR TGFVAQDDVLYPHLTV ETL FTALLRLP+SL R E
Sbjct  125  GKLSGKITYNGLPFSGPMKRRTGFVAQDDVLYPHLTVAETLAFTALLRLPRSLDRTE  181



>ref|XP_009792869.1| PREDICTED: ABC transporter G family member 9-like [Nicotiana 
sylvestris]
Length=616

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 105/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEIL  424
            Q  T +  ++   P+ LKFE +VYK+  + +G   +      EK IL G+TG+V PGE+L
Sbjct  12   QLETAAIFKKTNLPVTLKFENVVYKIKPKKEGLFNSSSKPEEEKIILKGITGIVFPGEML  71

Query  425  AMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVK  604
            AMLGPSGSGKTTLLT LGGRL G+++G +TYN +PF+ ++KR TGFV QDD+LYPHLTV 
Sbjct  72   AMLGPSGSGKTTLLTGLGGRLNGRIAGSITYNGKPFTNAMKRYTGFVTQDDILYPHLTVT  131

Query  605  ETLLFTALLRLPQSLTREE  661
            ETL+FTALLRLP++L+ EE
Sbjct  132  ETLVFTALLRLPKTLSHEE  150



>ref|XP_011098341.1| PREDICTED: ABC transporter G family member 9 [Sesamum indicum]
Length=619

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 106/135 (79%), Gaps = 1/135 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGP  439
            +  ++A  P+ LKFE++VYK+  E  G      + ++EK IL G++GMV PGE+LAMLGP
Sbjct  18   AIFKKANLPVTLKFEDVVYKIKTEQSGKFFKKTAKSQEKLILKGISGMVLPGEMLAMLGP  77

Query  440  SGSGKTTLLTALGGRL-YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLL  616
            SGSGKTTLLT LGGRL  G+LSG +TYN +PFS ++KR TGFV QDDVLYPHLTV ETL+
Sbjct  78   SGSGKTTLLTGLGGRLTSGRLSGNITYNGKPFSNAMKRNTGFVTQDDVLYPHLTVTETLV  137

Query  617  FTALLRLPQSLTREE  661
            +TALLRLP++LT+ E
Sbjct  138  YTALLRLPRTLTKAE  152



>ref|XP_008797958.1| PREDICTED: ABC transporter G family member 14-like [Phoenix dactylifera]
Length=649

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 114/158 (72%), Gaps = 7/158 (4%)
 Frame = +2

Query  209  AAPDKPCLAYPLQTNTQSFLQRA---LYPIVLKFEEIVYKVG-GEDKG--SCCTGKSSAR  370
            AAPD+P  A          L RA   L P+ LKFEE+VYK+  G       CC   +   
Sbjct  11   AAPDEPAPADATSHPNPRPLPRATTPLDPVTLKFEEVVYKLKIGRPMWWSGCCGSGAGGA  70

Query  371  EKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLY-GKLSGKVTYNSQPFSGSIK  547
            EK ILNG+TGMV PGE+LAMLGPSGSGKTTLLTALGGRL  GKLSG +TYN QPFS  +K
Sbjct  71   EKVILNGITGMVGPGEMLAMLGPSGSGKTTLLTALGGRLVAGKLSGTITYNGQPFSRGMK  130

Query  548  RLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            R TGFVAQDDVLYPHLTV+ETL FTALLRLP+SL+R E
Sbjct  131  RRTGFVAQDDVLYPHLTVRETLAFTALLRLPRSLSRAE  168



>ref|XP_008243143.1| PREDICTED: ABC transporter G family member 21 [Prunus mume]
Length=683

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 133/211 (63%), Gaps = 21/211 (10%)
 Frame = +2

Query  44   LPPH--SSTTKTPISITQTFLRFSLAMPALHS--VAPKPENCSPDQRMDDAATTNQPADA  211
            +PP   +S T TP +I  + L       ++H+   AP   N SP          + PAD 
Sbjct  2    IPPEQETSMTNTPANILLSNLNRPDQNGSVHAERSAPPSSNVSP------CLGDDMPAD-  54

Query  212  APDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGED-KGSCCTGKSSAREKTILN  388
               +P       ++  S L+R+L P+ LKFE++ Y +  +  KG         + +TILN
Sbjct  55   ---RPT------SHRSSILRRSLRPVTLKFEDVTYSIKLQTTKGGWVASHEPKQTRTILN  105

Query  389  GVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVA  568
            GV+G+V PGE+LAMLGPSGSGKTTLLTAL GRL GK+SGK+TYN Q FS S+K  TGFV 
Sbjct  106  GVSGIVRPGELLAMLGPSGSGKTTLLTALSGRLPGKISGKITYNGQHFSSSMKHNTGFVT  165

Query  569  QDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            QDDVLYPHLTV ETL +TALLRLP+ LT+EE
Sbjct  166  QDDVLYPHLTVLETLTYTALLRLPKQLTKEE  196



>ref|XP_004297158.1| PREDICTED: ABC transporter G family member 21 [Fragaria vesca 
subsp. vesca]
Length=694

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 137/207 (66%), Gaps = 19/207 (9%)
 Frame = +2

Query  47   PPHSSTTKTPISITQTFLRFSLAMPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKP  226
            PP+ S+  + +S ++ +         +H+  P P + +  QR+          D  P++P
Sbjct  17   PPNKSSMLSNVSRSENY-----QTGWVHA-EPSPGSINGSQRL--------APDDMPEQP  62

Query  227  CLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSARE-KTILNGVTG  400
               +P   +  S L+ +L P+ LKFE++ Y +  E  KGSC +  +  ++ + +LNGV+G
Sbjct  63   ---HPGTPHRASVLRESLRPVTLKFEDVTYSIKLEPTKGSCVSSYNEPKQTRNLLNGVSG  119

Query  401  MVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDV  580
            +V PGE+LAMLGPSGSGKTTLLTALGGRL GK++GKVTYN Q FS S+K  TGFV QDDV
Sbjct  120  IVRPGELLAMLGPSGSGKTTLLTALGGRLPGKITGKVTYNGQHFSSSMKHNTGFVTQDDV  179

Query  581  LYPHLTVKETLLFTALLRLPQSLTREE  661
            LYPHLTV ETL +TALLRLP+ L+++E
Sbjct  180  LYPHLTVLETLTYTALLRLPKQLSKQE  206



>ref|XP_010514180.1| PREDICTED: ABC transporter G family member 21-like [Camelina 
sativa]
Length=673

 Score =   171 bits (434),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 108/141 (77%), Gaps = 2/141 (1%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSAR-EKTILNGVTGMVCPGE  418
            Q+   S L+++L PI LKFEE+ Y +  + +KGS   G    +  + ILNGV+G+V PGE
Sbjct  52   QSRQSSVLRQSLRPITLKFEELAYSIKSQTEKGSYWFGSQEPKLNRLILNGVSGIVKPGE  111

Query  419  ILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLT  598
            +LAMLGPSGSGKTTL+TAL GRL GKLSG V+YN  PF+ S+KR TGFV QDDVLYPHLT
Sbjct  112  LLAMLGPSGSGKTTLVTALAGRLQGKLSGTVSYNGTPFTSSVKRKTGFVTQDDVLYPHLT  171

Query  599  VKETLLFTALLRLPQSLTREE  661
            V ETL +TALLRLP+ LTR+E
Sbjct  172  VMETLTYTALLRLPKELTRKE  192



>ref|XP_006484387.1| PREDICTED: ABC transporter G family member 21-like [Citrus sinensis]
Length=691

 Score =   171 bits (434),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 118/191 (62%), Gaps = 16/191 (8%)
 Frame = +2

Query  137  APKPENCSPDQRMDDAATTNQPADAAPD-KPC---------LAYPLQTNTQSFLQRALYP  286
             P   N     R D      QP+ +A +  PC         +  P      S L+ +L+P
Sbjct  18   GPPAANTILSNRTDTVLVHAQPSVSANNVSPCSDDDGISVQIQEPPLVIRFSILRESLHP  77

Query  287  IVLKFEEIVYKVG-GEDKGSCCTG-----KSSAREKTILNGVTGMVCPGEILAMLGPSGS  448
            ++L+FE++ Y +     KGSC            R  ++LNGV+GMV PGE+LAMLGPSGS
Sbjct  78   VMLQFEDVAYSINLHTSKGSCFAASHDEPNKQTRTVSVLNGVSGMVKPGELLAMLGPSGS  137

Query  449  GKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTAL  628
            GKTTLLTAL GRL GK SGK+TYN + FS S+KR TGFV QDDVLYPHLTV ETL + AL
Sbjct  138  GKTTLLTALAGRLRGKFSGKITYNGRQFSSSLKRKTGFVTQDDVLYPHLTVLETLSYAAL  197

Query  629  LRLPQSLTREE  661
            LRLP+ LTREE
Sbjct  198  LRLPKKLTREE  208



>gb|KDO70136.1| hypothetical protein CISIN_1g005545mg [Citrus sinensis]
Length=691

 Score =   171 bits (434),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 117/191 (61%), Gaps = 16/191 (8%)
 Frame = +2

Query  137  APKPENCSPDQRMDDAATTNQPADAAPD-KPC---------LAYPLQTNTQSFLQRALYP  286
             P   N     R D      QP+ +A +  PC         +  P      S L+ +L+P
Sbjct  18   GPPAANTILSNRTDTVLVHAQPSVSANNVSPCSDDDGISVQIQEPPLVIRFSILRESLHP  77

Query  287  IVLKFEEIVYKVG-GEDKGSCCTG-----KSSAREKTILNGVTGMVCPGEILAMLGPSGS  448
            + LKFE++ Y +     KGSC            R  ++LNGV+GMV PGE+LAMLGPSGS
Sbjct  78   VTLKFEDVAYSINLHTSKGSCFATSHGEPNKQTRTVSVLNGVSGMVKPGELLAMLGPSGS  137

Query  449  GKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTAL  628
            GKTTLLTAL GRL GK SGK+TYN + FS S+KR TGFV QDDVLYPHLTV ETL + AL
Sbjct  138  GKTTLLTALAGRLRGKFSGKITYNGRQFSSSLKRKTGFVTQDDVLYPHLTVLETLSYAAL  197

Query  629  LRLPQSLTREE  661
            LRLP+ LTREE
Sbjct  198  LRLPKKLTREE  208



>ref|XP_010425209.1| PREDICTED: ABC transporter G family member 21 isoform X1 [Camelina 
sativa]
Length=672

 Score =   171 bits (434),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 108/141 (77%), Gaps = 2/141 (1%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSAR-EKTILNGVTGMVCPGE  418
            Q+   S L+++L PI LKFEE+ Y +  + +KGS   G    +  + ILNGV+G+V PGE
Sbjct  51   QSRQSSVLRQSLRPITLKFEELTYSIKSQTEKGSYWFGSQEPKPNRLILNGVSGIVKPGE  110

Query  419  ILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLT  598
            +LAMLGPSGSGKTTL+TAL GRL GKLSG V+YN  PF+ S+KR TGFV QDDVLYPHLT
Sbjct  111  LLAMLGPSGSGKTTLVTALAGRLQGKLSGTVSYNGTPFTSSVKRKTGFVTQDDVLYPHLT  170

Query  599  VKETLLFTALLRLPQSLTREE  661
            V ETL +TALLRLP+ LTR+E
Sbjct  171  VMETLTYTALLRLPKELTRKE  191



>ref|XP_006395639.1| hypothetical protein EUTSA_v10003766mg [Eutrema salsugineum]
 gb|ESQ32925.1| hypothetical protein EUTSA_v10003766mg [Eutrema salsugineum]
Length=670

 Score =   171 bits (434),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 109/141 (77%), Gaps = 2/141 (1%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGED-KGSCCTGKSSAR-EKTILNGVTGMVCPGE  418
            Q+   S L+++L PI+LKFEE+ Y +  +  KGS   G    +  + +LNGV+G+V PGE
Sbjct  50   QSRQSSVLRQSLRPIILKFEELTYSIKSQTGKGSYWFGSQEPKPNRLVLNGVSGIVKPGE  109

Query  419  ILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLT  598
            +LAMLGPSGSGKTTL+TAL GRL GKL+G V+YN +PF+ S+KR TGFV QDDVLYPHLT
Sbjct  110  LLAMLGPSGSGKTTLVTALAGRLQGKLTGTVSYNGEPFTSSVKRKTGFVTQDDVLYPHLT  169

Query  599  VKETLLFTALLRLPQSLTREE  661
            V ETL +TALLRLP+ LTR+E
Sbjct  170  VTETLTYTALLRLPKELTRKE  190



>gb|KEH19433.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=635

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            P+ LKF ++VYK+    K      K+   EK ILNGVTGMV PGEILA+LGPSGSGKTTL
Sbjct  34   PVTLKFHDVVYKINKTKKWKLLERKTKVEEKVILNGVTGMVRPGEILAILGPSGSGKTTL  93

Query  464  LTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQ  643
            LTALGGRL GKLSG +TYN + FS S+K+  GFV Q+D+LYPHLTV ETL+FT+LLRLP 
Sbjct  94   LTALGGRLGGKLSGTITYNGKIFSNSMKKSIGFVTQEDILYPHLTVTETLVFTSLLRLPN  153

Query  644  SLTREE  661
            S T +E
Sbjct  154  SFTEKE  159



>gb|KJB13426.1| hypothetical protein B456_002G073600 [Gossypium raimondii]
Length=627

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  IVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLL  466
            +VLKF ++VY +     G     KS + EK ILNG+TG+V PGE+LAMLGPSGSGKTTLL
Sbjct  30   VVLKFVDVVYSIKFGKSGHYFQKKSGSGEKVILNGITGVVEPGEMLAMLGPSGSGKTTLL  89

Query  467  TALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQS  646
            TALGGRL G LSG VTYN +PFS S+KR TGFV QDDVLYPHLTV ETL+FTALLRLP S
Sbjct  90   TALGGRLGGCLSGTVTYNGKPFSNSVKRNTGFVTQDDVLYPHLTVTETLVFTALLRLPNS  149

Query  647  LTREE  661
             +++E
Sbjct  150  FSKQE  154



>emb|CDY46506.1| BnaA02g27560D [Brassica napus]
Length=668

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 121/174 (70%), Gaps = 7/174 (4%)
 Frame = +2

Query  161  PDQRMDDAATTNQPADAAPDK--PCL---AYPLQTNTQSFLQRALYPIVLKFEEIVYKVG  325
            P +  ++     +   ++P+   PCL       Q+   S L+++L PI+LKFEE+ Y + 
Sbjct  14   PGESRNETIPVQETWFSSPNHVIPCLDDDGPSHQSCQSSVLRQSLRPIILKFEELTYTIK  73

Query  326  GED-KGSCCTGKSSARE-KTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKL  499
             +  KGS   G    ++ + ILNGV+G+V PGE+LAMLGPSGSGKTTL+TAL GRL GKL
Sbjct  74   IQSGKGSYWFGSQEPKQNRLILNGVSGIVKPGELLAMLGPSGSGKTTLVTALAGRLQGKL  133

Query  500  SGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            SG V+YN  PF+ S+KR TGFV QDDVLYPHLTV ETL +TALLRLP+ LTR+E
Sbjct  134  SGTVSYNGAPFTSSVKRRTGFVTQDDVLYPHLTVMETLTYTALLRLPKELTRKE  187



>ref|NP_189190.2| ABC transporter G family member 21 [Arabidopsis thaliana]
 gb|AAQ22642.1| At3g25620/T5M7_4 [Arabidopsis thaliana]
 gb|AEE77043.1| ABC transporter G family member 21 [Arabidopsis thaliana]
Length=467

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 119/180 (66%), Gaps = 9/180 (5%)
 Frame = +2

Query  128  HSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEE  307
            H  +P  EN     R    +  N   D   D    ++  Q+   S L+++L PI+LKFEE
Sbjct  20   HETSPVQEN-----RFSSPSHVNPCLDDDNDHDGPSH--QSRQSSVLRQSLRPIILKFEE  72

Query  308  IVYKVGGED-KGSCCTGKSSAR-EKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGG  481
            + Y +  +  KGS   G    +  + +L  V+G+V PGE+LAMLGPSGSGKTTL+TAL G
Sbjct  73   LTYSIKSQTGKGSYWFGSQEPKPNRLVLKCVSGIVKPGELLAMLGPSGSGKTTLVTALAG  132

Query  482  RLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            RL GKLSG V+YN +PF+ S+KR TGFV QDDVLYPHLTV ETL +TALLRLP+ LTR+E
Sbjct  133  RLQGKLSGTVSYNGEPFTSSVKRKTGFVTQDDVLYPHLTVMETLTYTALLRLPKELTRKE  192



>ref|XP_007046353.1| ABC-2 type transporter family protein [Theobroma cacao]
 gb|EOY02185.1| ABC-2 type transporter family protein [Theobroma cacao]
Length=684

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 110/156 (71%), Gaps = 10/156 (6%)
 Frame = +2

Query  224  PCLAYPLQTNTQ---------SFLQRALYPIVLKFEEIVYKVGGEDKGS-CCTGKSSARE  373
            PC   P+  + Q         S L+ +L P+ LKFEE+ Y +        C + +     
Sbjct  45   PCSQEPIPAHQQQEQQTPLRISVLRESLRPVTLKFEEVAYSIYSNTTARRCLSSQEPKPR  104

Query  374  KTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRL  553
            +++LNGV+G+V PGE+LAMLGPSGSGKTTLLTALGGRL GKLSG +TYN +PFS S+KR 
Sbjct  105  RSVLNGVSGVVRPGELLAMLGPSGSGKTTLLTALGGRLTGKLSGTITYNGRPFSSSMKRK  164

Query  554  TGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            TGFV+QDDVLYPHLTV ETL + ALL+LP+ LTREE
Sbjct  165  TGFVSQDDVLYPHLTVLETLTYAALLKLPKELTREE  200



>gb|KDP27020.1| hypothetical protein JCGZ_20955 [Jatropha curcas]
Length=568

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 101/135 (75%), Gaps = 1/135 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGP  439
            + L++A  P+ LKFE++VYKV    KG C  G     EK IL G+TG V PGE+LAMLGP
Sbjct  18   TILKKANSPVTLKFEDVVYKVEPTKKGLCQKGIIKKEEKVILKGITGFVLPGEMLAMLGP  77

Query  440  SGSGKTTLLTALGGRLY-GKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLL  616
            SG GKTTLLTALGG+L  GKL G +TYN +PFS  +KR +GFV Q D+LYPHLTV ETL+
Sbjct  78   SGCGKTTLLTALGGKLIDGKLEGTITYNGKPFSNVMKRNSGFVTQHDILYPHLTVTETLV  137

Query  617  FTALLRLPQSLTREE  661
            FTA LRLP SLT+EE
Sbjct  138  FTAFLRLPNSLTKEE  152



>ref|XP_009129040.1| PREDICTED: ABC transporter G family member 21-like [Brassica 
rapa]
Length=669

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 109/141 (77%), Gaps = 2/141 (1%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGED-KGSCCTGKSSARE-KTILNGVTGMVCPGE  418
            Q+   S L+++L PI+LKFEE+ Y +  +  KGS   G    ++ + ILNGV+G+V PGE
Sbjct  48   QSCQSSVLRQSLRPIILKFEELTYTIKIQSGKGSYWFGSQEPKQNRLILNGVSGIVKPGE  107

Query  419  ILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLT  598
            +LAMLGPSGSGKTTL+TAL GRL GKLSG V+YN  PF+ S+KR TGFV QDDVLYPHLT
Sbjct  108  LLAMLGPSGSGKTTLVTALAGRLQGKLSGTVSYNGAPFTSSVKRRTGFVTQDDVLYPHLT  167

Query  599  VKETLLFTALLRLPQSLTREE  661
            V ETL +TALLRLP+ LTR+E
Sbjct  168  VMETLTYTALLRLPKELTRKE  188



>ref|XP_004244204.1| PREDICTED: ABC transporter G family member 9 [Solanum lycopersicum]
Length=613

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 103/139 (74%), Gaps = 0/139 (0%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEIL  424
            Q  + +  ++  +P+ LKF+ +VYK+  + +G   +   S  EK IL GVTG+V PGE+L
Sbjct  8    QLESAAIFKKTNFPVTLKFDNVVYKIKAKTEGMFKSSSKSQEEKIILKGVTGIVFPGEML  67

Query  425  AMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVK  604
            AMLGPSGSGKTTLLT LGGRL G+L G +TYN  PF  ++KR TGFV QDDVLYPHLTV 
Sbjct  68   AMLGPSGSGKTTLLTGLGGRLSGRLEGTITYNGMPFKNAMKRYTGFVTQDDVLYPHLTVT  127

Query  605  ETLLFTALLRLPQSLTREE  661
            ETL++TALLRLP++L+  +
Sbjct  128  ETLVYTALLRLPKTLSHMD  146



>ref|XP_010262410.1| PREDICTED: ABC transporter G family member 21-like [Nelumbo nucifera]
Length=685

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 117/185 (63%), Gaps = 24/185 (13%)
 Frame = +2

Query  116  MPALHS-VAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIV  292
            +PAL S V+P  E+  P+Q             AA    C          S L+ +L PI 
Sbjct  38   LPALSSNVSPSLEDQMPEQ-----------LQAAMGGQC----------SLLRGSLRPIT  76

Query  293  LKFEEIVYKVGGEDKGSCCTGKSSAR--EKTILNGVTGMVCPGEILAMLGPSGSGKTTLL  466
            LKFE++ Y +  +  G C       +  E+TILNGVTG+V PG++LAMLGPSGSGKTTLL
Sbjct  77   LKFEDVSYSIKIKKSGGCWFSAPEPKPSERTILNGVTGVVQPGDLLAMLGPSGSGKTTLL  136

Query  467  TALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQS  646
            TAL GRL GK SG +TYN   FSGSIKR  GFV+QDDVLYPHLTV ETL + ALLRLP  
Sbjct  137  TALAGRLPGKFSGSITYNGHTFSGSIKRKIGFVSQDDVLYPHLTVLETLTYAALLRLPNK  196

Query  647  LTREE  661
            LTREE
Sbjct  197  LTREE  201



>ref|XP_008361741.1| PREDICTED: ABC transporter G family member 21-like [Malus domestica]
Length=683

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 110/153 (72%), Gaps = 7/153 (5%)
 Frame = +2

Query  224  PCLAYPLQTNTQ------SFLQRALYPIVLKFEEIVYKVGGED-KGSCCTGKSSAREKTI  382
            PCL   +    Q      S L+++L P+ LKFE++ Y +  +  KG C     +   +T+
Sbjct  45   PCLGDDMTDQPQPTSHRASILRQSLRPVTLKFEDVGYSIKLQTPKGGCVXSHEATPTRTV  104

Query  383  LNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGF  562
            LNGV+G+V PGE+LAMLGPSGSGKTTLLTALGGRL  K+SGK+TYN Q FS S+K  TGF
Sbjct  105  LNGVSGIVRPGELLAMLGPSGSGKTTLLTALGGRLPNKISGKITYNGQNFSSSMKHNTGF  164

Query  563  VAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            V QDDVLYPHLTV ETL +TALLRLP+ LT+EE
Sbjct  165  VTQDDVLYPHLTVLETLTYTALLRLPKQLTKEE  197



>ref|XP_008339724.1| PREDICTED: ABC transporter G family member 21-like [Malus domestica]
Length=683

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 110/153 (72%), Gaps = 7/153 (5%)
 Frame = +2

Query  224  PCLAYPLQTNTQ------SFLQRALYPIVLKFEEIVYKVGGED-KGSCCTGKSSAREKTI  382
            PCL   +    Q      S L+++L P+ LKFE++ Y +  +  KG C     +   +T+
Sbjct  45   PCLGDDMTDQPQPTSHRASILRQSLRPVTLKFEDVGYSIKLQTPKGGCVXSHEATPTRTV  104

Query  383  LNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGF  562
            LNGV+G+V PGE+LAMLGPSGSGKTTLLTALGGRL  K+SGK+TYN Q FS S+K  TGF
Sbjct  105  LNGVSGIVRPGELLAMLGPSGSGKTTLLTALGGRLPNKISGKITYNGQNFSSSMKHNTGF  164

Query  563  VAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            V QDDVLYPHLTV ETL +TALLRLP+ LT+EE
Sbjct  165  VTQDDVLYPHLTVLETLTYTALLRLPKQLTKEE  197



>ref|XP_012084914.1| PREDICTED: ABC transporter G family member 9-like [Jatropha curcas]
Length=621

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 101/135 (75%), Gaps = 1/135 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGP  439
            + L++A  P+ LKFE++VYKV    KG C  G     EK IL G+TG V PGE+LAMLGP
Sbjct  18   TILKKANSPVTLKFEDVVYKVEPTKKGLCQKGIIKKEEKVILKGITGFVLPGEMLAMLGP  77

Query  440  SGSGKTTLLTALGGRLY-GKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLL  616
            SG GKTTLLTALGG+L  GKL G +TYN +PFS  +KR +GFV Q D+LYPHLTV ETL+
Sbjct  78   SGCGKTTLLTALGGKLIDGKLEGTITYNGKPFSNVMKRNSGFVTQHDILYPHLTVTETLV  137

Query  617  FTALLRLPQSLTREE  661
            FTA LRLP SLT+EE
Sbjct  138  FTAFLRLPNSLTKEE  152



>ref|XP_008389338.1| PREDICTED: ABC transporter G family member 21-like isoform X3 
[Malus domestica]
 ref|XP_008367028.1| PREDICTED: ABC transporter G family member 21-like isoform X3 
[Malus domestica]
Length=471

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 103/135 (76%), Gaps = 1/135 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            S L ++L+P+ LKFE++ Y +  +   G C         +T+LNGV+G+V PGE+LAMLG
Sbjct  63   SILHQSLHPVTLKFEDVGYSIKLQATNGGCVASHKXKPTRTVLNGVSGIVLPGELLAMLG  122

Query  437  PSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLL  616
            PSGSGKTTLLTALG RL GK+SGK+TYN Q FS S+K   GFV+QDDVLYPHL+V ETL 
Sbjct  123  PSGSGKTTLLTALGXRLPGKISGKITYNGQNFSSSMKHNIGFVSQDDVLYPHLSVLETLT  182

Query  617  FTALLRLPQSLTREE  661
            +TALLRLP+ LT+EE
Sbjct  183  YTALLRLPKQLTKEE  197



>ref|XP_006437762.1| hypothetical protein CICLE_v10030868mg [Citrus clementina]
 gb|ESR51002.1| hypothetical protein CICLE_v10030868mg [Citrus clementina]
Length=691

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 117/191 (61%), Gaps = 16/191 (8%)
 Frame = +2

Query  137  APKPENCSPDQRMDDAATTNQPADAAPD-KPC---------LAYPLQTNTQSFLQRALYP  286
             P   N     R D      QP+ +A +  PC         +  P      S L+ +L+P
Sbjct  18   GPPAANTILSNRTDTVLVHAQPSVSANNVSPCSDDDGISVQIQEPPLVIRFSILRESLHP  77

Query  287  IVLKFEEIVYKVG-GEDKGSCCTG-----KSSAREKTILNGVTGMVCPGEILAMLGPSGS  448
            + LKFE++ Y +     KGSC            R  ++LNGV+G+V PGE+LAMLGPSGS
Sbjct  78   VTLKFEDVAYSINLHTSKGSCFATSHDEPNKQTRTVSVLNGVSGVVKPGELLAMLGPSGS  137

Query  449  GKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTAL  628
            GKTTLLTAL GRL GK SGK+TYN + FS S+KR TGFV QDDVLYPHLTV ETL + AL
Sbjct  138  GKTTLLTALAGRLRGKFSGKITYNGRQFSSSLKRKTGFVTQDDVLYPHLTVLETLSYAAL  197

Query  629  LRLPQSLTREE  661
            LRLP+ LTREE
Sbjct  198  LRLPKKLTREE  208



>ref|XP_009336649.1| PREDICTED: ABC transporter G family member 21-like [Pyrus x bretschneideri]
Length=683

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 114/172 (66%), Gaps = 2/172 (1%)
 Frame = +2

Query  149  ENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGG  328
            +NCS       ++ TN       D P    P  ++  S L ++L PI LKFE++ Y +  
Sbjct  27   QNCSVQPEPSASSRTNVSPCLGDDMPGQPRP-TSHRASILHQSLRPITLKFEDVGYSIKL  85

Query  329  E-DKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSG  505
            +   G C         +T+LNGV+G+  PGE+LAMLGPSGSGKTT LTALGGRL GK+SG
Sbjct  86   QATNGGCVASHKPKPTRTVLNGVSGIALPGELLAMLGPSGSGKTTFLTALGGRLPGKISG  145

Query  506  KVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            K+TYN Q FS S+K   GFV+QDDVLYPHLTV ETL +TALLRLP+ LT+EE
Sbjct  146  KITYNGQNFSSSMKHNIGFVSQDDVLYPHLTVLETLTYTALLRLPKQLTKEE  197



>gb|KEH38788.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=597

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 99/125 (79%), Gaps = 1/125 (1%)
 Frame = +2

Query  287  IVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLL  466
            + ++F+++VYK+  + KG          EKTIL GVTG+V PGE+LAMLGPSGSGKTTLL
Sbjct  1    MTMQFDDVVYKIKAK-KGGLFKKNIEVEEKTILKGVTGIVQPGEMLAMLGPSGSGKTTLL  59

Query  467  TALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQS  646
            TALGGRL GKL G +TYN +PFS  IKR TGFV QDDVLYPHLTV ETL+FTALLRLP S
Sbjct  60   TALGGRLGGKLYGSITYNEKPFSNVIKRNTGFVTQDDVLYPHLTVTETLVFTALLRLPNS  119

Query  647  LTREE  661
            +T+EE
Sbjct  120  VTKEE  124



>ref|XP_008389337.1| PREDICTED: ABC transporter G family member 21-like isoform X2 
[Malus domestica]
 ref|XP_008367027.1| PREDICTED: ABC transporter G family member 21-like isoform X2 
[Malus domestica]
Length=478

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 103/135 (76%), Gaps = 1/135 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            S L ++L+P+ LKFE++ Y +  +   G C         +T+LNGV+G+V PGE+LAMLG
Sbjct  63   SILHQSLHPVTLKFEDVGYSIKLQATNGGCVASHKXKPTRTVLNGVSGIVLPGELLAMLG  122

Query  437  PSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLL  616
            PSGSGKTTLLTALG RL GK+SGK+TYN Q FS S+K   GFV+QDDVLYPHL+V ETL 
Sbjct  123  PSGSGKTTLLTALGXRLPGKISGKITYNGQNFSSSMKHNIGFVSQDDVLYPHLSVLETLT  182

Query  617  FTALLRLPQSLTREE  661
            +TALLRLP+ LT+EE
Sbjct  183  YTALLRLPKQLTKEE  197



>ref|XP_010502439.1| PREDICTED: ABC transporter G family member 21-like isoform X1 
[Camelina sativa]
Length=672

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 107/141 (76%), Gaps = 2/141 (1%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSAR-EKTILNGVTGMVCPGE  418
            Q+   S L+++L PI LKFEE+ Y +  + +KGS   G    +  + ILNGV+G+V PGE
Sbjct  51   QSRQSSVLRQSLRPITLKFEELTYSIKSQTEKGSYWFGSQEPKPNRLILNGVSGIVKPGE  110

Query  419  ILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLT  598
            +LAMLGPSGSGKTTL+TAL GRL GKLSG V+YN  PF+  +KR TGFV QDDVLYPHLT
Sbjct  111  LLAMLGPSGSGKTTLVTALAGRLQGKLSGTVSYNGTPFTSYVKRKTGFVTQDDVLYPHLT  170

Query  599  VKETLLFTALLRLPQSLTREE  661
            V ETL +TALLRLP+ LTR+E
Sbjct  171  VMETLTYTALLRLPKELTRKE  191



>ref|XP_009356025.1| PREDICTED: ABC transporter G family member 21-like [Pyrus x bretschneideri]
Length=683

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 108/154 (70%), Gaps = 7/154 (5%)
 Frame = +2

Query  221  KPCLAYPLQTNTQ------SFLQRALYPIVLKFEEIVYKVGGED-KGSCCTGKSSAREKT  379
             PCL   +    Q      S L ++L P+ LKFE++ Y +  +  KG C         +T
Sbjct  44   NPCLGDDMTDQPQPTSHRASILHQSLRPVTLKFEDVGYSIKLQTAKGGCVASHEPKPTRT  103

Query  380  ILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTG  559
            +LNGV+G+V PGE+LAMLGPSGSGKTTLLTALGGRL  K+SGK+TYN Q FS S+K  TG
Sbjct  104  VLNGVSGIVRPGELLAMLGPSGSGKTTLLTALGGRLPNKISGKITYNGQNFSSSMKHNTG  163

Query  560  FVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            FV QDDVLYPHLTV ETL +TALLRLP+ LT+EE
Sbjct  164  FVTQDDVLYPHLTVLETLTYTALLRLPKQLTKEE  197



>ref|XP_010528033.1| PREDICTED: ABC transporter G family member 21-like [Tarenaya 
hassleriana]
Length=684

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 104/142 (73%), Gaps = 4/142 (3%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVG---GEDKGSCCTGKSSAREKTILNGVTGMVCPG  415
            Q+   S L R+L P++L FE++ Y +    G+     C+ + S   + ILNGVTG+V PG
Sbjct  59   QSRKYSILCRSLCPLILNFEDLTYSINLQTGKASYWFCS-QESKPTRLILNGVTGLVKPG  117

Query  416  EILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHL  595
            E+LAMLGPSGSGKTTLLTAL GRL GKLSG VTYN  PFS S+KR  GFV QDDVLYPHL
Sbjct  118  ELLAMLGPSGSGKTTLLTALAGRLNGKLSGSVTYNGHPFSSSVKRKIGFVTQDDVLYPHL  177

Query  596  TVKETLLFTALLRLPQSLTREE  661
            TV ETL FTALLRLP+ LTR E
Sbjct  178  TVTETLTFTALLRLPKELTRLE  199



>ref|XP_002524381.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF37992.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=709

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 121/185 (65%), Gaps = 14/185 (8%)
 Frame = +2

Query  149  ENCSPDQRMDDAATTNQPADAAPD------KPC-LAYPL-----QTNTQ-SFLQRALYPI  289
             NC P+    +  T   P  A P        PC   + L     QT ++ S L+ +L PI
Sbjct  39   NNCPPNHIALNNWTETVPVYAEPSVSSINLNPCSQEHQLPDEEEQTQSRFSILRESLRPI  98

Query  290  VLKFEEIVYKVGGEDKGS-CCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLL  466
             LKFE++ Y V     GS CC+      ++T+LNGV+G+V PGE+LAMLGPSGSGKTTLL
Sbjct  99   TLKFEDVEYSVNFSTNGSSCCSRNEPKSKRTVLNGVSGIVRPGELLAMLGPSGSGKTTLL  158

Query  467  TALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQS  646
            TAL GRL  K+SG +TYN  P+S S+KR TGFVAQDD+LYPHLTV ETL + ALLRLP+ 
Sbjct  159  TALSGRLPVKVSGTITYNGLPYSSSMKRNTGFVAQDDILYPHLTVIETLTYAALLRLPKK  218

Query  647  LTREE  661
            L+++E
Sbjct  219  LSKQE  223



>emb|CDP08055.1| unnamed protein product [Coffea canephora]
Length=641

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 109/144 (76%), Gaps = 3/144 (2%)
 Frame = +2

Query  233  AYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAR-EKTILNGVTGMVC  409
            A  L+  + +  ++A  P+ LKF ++VYK+  +++G     K+  R EKTIL GV+G+  
Sbjct  43   ASALEQKSCTLFEKAYRPVALKFVDVVYKIKVKNEG--WFKKNIERSEKTILRGVSGLAM  100

Query  410  PGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYP  589
            PGE+LAMLGPSGSGKTTLLTALGG+L G L+G +TYN Q FS  +KR TGFV QDD+LYP
Sbjct  101  PGEMLAMLGPSGSGKTTLLTALGGQLGGSLTGSITYNGQSFSHVMKRNTGFVTQDDILYP  160

Query  590  HLTVKETLLFTALLRLPQSLTREE  661
            HLTV ETL+FTALLRLP SLT+EE
Sbjct  161  HLTVNETLVFTALLRLPNSLTKEE  184



>gb|KFK39853.1| hypothetical protein AALP_AA3G297000 [Arabis alpina]
Length=672

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 104/141 (74%), Gaps = 2/141 (1%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGE--DKGSCCTGKSSAREKTILNGVTGMVCPGE  418
            Q+   S L+++L PI+LKFEE+ Y +  +   K      K     + ILNGV+G+V PGE
Sbjct  52   QSRQSSVLRQSLRPIILKFEELTYSIKSQTGKKNYWFGSKEPKPNRLILNGVSGIVKPGE  111

Query  419  ILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLT  598
            +LAMLGPSGSGKTTL+TAL GRL GKLSG V+YN  PF+  IKR TGFV QDDVLYPHLT
Sbjct  112  LLAMLGPSGSGKTTLVTALAGRLNGKLSGTVSYNGDPFTSYIKRKTGFVTQDDVLYPHLT  171

Query  599  VKETLLFTALLRLPQSLTREE  661
            V ETL +TALLRLP+ LTR+E
Sbjct  172  VMETLTYTALLRLPKELTRKE  192



>ref|XP_009152126.1| PREDICTED: ABC transporter G family member 21 [Brassica rapa]
Length=666

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 109/141 (77%), Gaps = 2/141 (1%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSAR-EKTILNGVTGMVCPGE  418
            Q+   S L+++L PI+LKFEE+ Y +  +  K S   G    +  + +LNGV+G+V PGE
Sbjct  46   QSRQSSVLRQSLRPIILKFEELTYSITSQTGKRSYWFGSQEPKPNRFVLNGVSGIVKPGE  105

Query  419  ILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLT  598
            +LAMLGPSGSGKTTL+TAL GRL+GKLSG V+YN +PF+ ++KR TGFV Q+DVLYPHLT
Sbjct  106  LLAMLGPSGSGKTTLVTALAGRLHGKLSGTVSYNGEPFTSAVKRKTGFVTQEDVLYPHLT  165

Query  599  VKETLLFTALLRLPQSLTREE  661
            V ETL +TALLRLP+ LTR+E
Sbjct  166  VMETLTYTALLRLPKELTRKE  186



>ref|NP_001189973.1| ABC transporter G family member 21 [Arabidopsis thaliana]
 sp|Q7XA72.2|AB21G_ARATH RecName: Full=ABC transporter G family member 21; Short=ABC transporter 
ABCG.21; Short=AtABCG21; AltName: Full=White-brown 
complex homolog protein 21; Short=AtWBC21 [Arabidopsis thaliana]
 dbj|BAB03081.1| ABC transporter-like protein [Arabidopsis thaliana]
 gb|AEE77044.1| ABC transporter G family member 21 [Arabidopsis thaliana]
Length=672

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 119/180 (66%), Gaps = 9/180 (5%)
 Frame = +2

Query  128  HSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEE  307
            H  +P  EN     R    +  N   D   D    ++  Q+   S L+++L PI+LKFEE
Sbjct  20   HETSPVQEN-----RFSSPSHVNPCLDDDNDHDGPSH--QSRQSSVLRQSLRPIILKFEE  72

Query  308  IVYKVGGED-KGSCCTGKSSAR-EKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGG  481
            + Y +  +  KGS   G    +  + +L  V+G+V PGE+LAMLGPSGSGKTTL+TAL G
Sbjct  73   LTYSIKSQTGKGSYWFGSQEPKPNRLVLKCVSGIVKPGELLAMLGPSGSGKTTLVTALAG  132

Query  482  RLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            RL GKLSG V+YN +PF+ S+KR TGFV QDDVLYPHLTV ETL +TALLRLP+ LTR+E
Sbjct  133  RLQGKLSGTVSYNGEPFTSSVKRKTGFVTQDDVLYPHLTVMETLTYTALLRLPKELTRKE  192



>ref|XP_009766511.1| PREDICTED: ABC transporter G family member 9-like [Nicotiana 
sylvestris]
Length=637

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 115/173 (66%), Gaps = 12/173 (7%)
 Frame = +2

Query  146  PENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVG  325
            P   + +Q M +     Q   +A          Q+ + +  +++  P+ LKFE +VYK+ 
Sbjct  2    PRTLNMEQEMANIPFHQQNLHSA----------QSKSSAIFRKSNRPVTLKFENVVYKIK  51

Query  326  GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRL-YGKLS  502
               +G C     S  EK IL GV+G+V PGE+LA+LGPSGSGKTTLLT LGGRL +G L 
Sbjct  52   LVKEG-CINSSKSVEEKIILKGVSGIVSPGEMLAILGPSGSGKTTLLTGLGGRLVHGHLD  110

Query  503  GKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            G +TYN++PFS ++KR TGFV QDDVLYPHLTV ETL+FTALLRLP +LT +E
Sbjct  111  GAITYNNKPFSNAMKRNTGFVTQDDVLYPHLTVTETLVFTALLRLPGTLTVQE  163



>ref|XP_006290691.1| hypothetical protein CARUB_v10016784mg [Capsella rubella]
 gb|EOA23589.1| hypothetical protein CARUB_v10016784mg [Capsella rubella]
Length=673

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 106/141 (75%), Gaps = 2/141 (1%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGED-KGSCCTGKSSAR-EKTILNGVTGMVCPGE  418
            Q+   S L+++L PI+LKFEE+ Y +  +  KG    G    +  + ILN V+G+V PGE
Sbjct  51   QSRQSSVLRQSLRPIILKFEELTYSIKSQTGKGRNWFGSQEPKPNRLILNSVSGIVKPGE  110

Query  419  ILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLT  598
            +LAMLGPSGSGKTTL+TAL GRL GKLSG V+YN  PF+ S+KR TGFV QDDVLYPHLT
Sbjct  111  LLAMLGPSGSGKTTLVTALAGRLQGKLSGTVSYNGAPFTSSVKRKTGFVTQDDVLYPHLT  170

Query  599  VKETLLFTALLRLPQSLTREE  661
            V ETL +TALLRLP+ LTR+E
Sbjct  171  VMETLTYTALLRLPKELTRKE  191



>ref|XP_012082004.1| PREDICTED: ABC transporter G family member 21 [Jatropha curcas]
 gb|KDP29341.1| hypothetical protein JCGZ_18262 [Jatropha curcas]
Length=682

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 107/141 (76%), Gaps = 2/141 (1%)
 Frame = +2

Query  245  QTNTQSFL--QRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGE  418
            + NT  FL  + + +P+ LKFE++ Y +    K SC   +  +  KT+LN V+G+V PGE
Sbjct  58   ELNTSRFLILRESSHPVTLKFEDVSYSINLSAKRSCYLNEPKSTTKTVLNCVSGIVRPGE  117

Query  419  ILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLT  598
            +LAMLGPSGSGKTTLLTAL GRL GK+SG ++YN  PFS S+KR TGFV+QDDVLYPHLT
Sbjct  118  LLAMLGPSGSGKTTLLTALAGRLPGKVSGTISYNGMPFSSSMKRKTGFVSQDDVLYPHLT  177

Query  599  VKETLLFTALLRLPQSLTREE  661
            V ETL +TALLRLP+ L++EE
Sbjct  178  VIETLTYTALLRLPKKLSKEE  198



>emb|CDX99764.1| BnaC02g35560D [Brassica napus]
Length=685

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 109/141 (77%), Gaps = 2/141 (1%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGED-KGSCCTGKSSARE-KTILNGVTGMVCPGE  418
            Q+   S L+++L PI+LKFEE+ Y +  +  KGS   G    ++ + ILNGV+G+V PG+
Sbjct  47   QSRQSSVLRQSLRPIILKFEELTYTIKIQSGKGSYWFGSQEPKQNRLILNGVSGIVKPGD  106

Query  419  ILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLT  598
            +LAMLGPSGSGKTTL+TAL GRL GKLSG V+YN  PF+ S+KR TGFV Q+DVLYPHLT
Sbjct  107  LLAMLGPSGSGKTTLVTALAGRLQGKLSGTVSYNGAPFTSSMKRRTGFVTQEDVLYPHLT  166

Query  599  VKETLLFTALLRLPQSLTREE  661
            V ETL +TALLRLP+ LTR+E
Sbjct  167  VMETLTYTALLRLPKELTRKE  187



>ref|XP_008237669.1| PREDICTED: ABC transporter G family member 9-like [Prunus mume]
Length=614

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 109/148 (74%), Gaps = 9/148 (6%)
 Frame = +2

Query  218  DKPCLAYPLQTNTQS--FLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNG  391
            +K  L   +QT T++    + A+ P+ LKFE+++YK+   +        +   EK ILNG
Sbjct  2    EKEMLDIEIQTATEAPAIFKEAIRPVTLKFEDVIYKIKQNNS-------TKNEEKVILNG  54

Query  392  VTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQ  571
            ++G+V PGEILAMLGPSGSGKTTLLTAL GRL G+LSG +TYN++PFS ++KR TGFV Q
Sbjct  55   ISGLVQPGEILAMLGPSGSGKTTLLTALAGRLGGRLSGAITYNNKPFSNAMKRNTGFVTQ  114

Query  572  DDVLYPHLTVKETLLFTALLRLPQSLTR  655
            DD LYPHLTV ETL +TAL+RLP +L++
Sbjct  115  DDFLYPHLTVIETLFYTALIRLPNTLSK  142



>gb|EMT29518.1| hypothetical protein F775_52365 [Aegilops tauschii]
Length=571

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 120/178 (67%), Gaps = 33/178 (19%)
 Frame = +2

Query  188  TTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKV--GGEDKGSCCTGKS  361
            T++ P+DA+  +P  A     N+        +P+VLKFEE+VYKV  G   +G C    S
Sbjct  37   TSSPPSDASGHRPAAA-----NS--------FPLVLKFEEVVYKVKVGQATEGWCTRVVS  83

Query  362  SA-----------------REKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGR-L  487
            SA                 REKTI++G++G+V PGE+LAMLGPSGSGKTTLLTALGGR  
Sbjct  84   SACGGGAVTKKNKAAALPPREKTIISGMSGVVRPGEMLAMLGPSGSGKTTLLTALGGRHR  143

Query  488  YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            +  LSGK+TYN QPFSG++KR TGFV Q DVLYPHLTV ETL +TALLRLP++L+  E
Sbjct  144  HALLSGKITYNGQPFSGAVKRRTGFVTQHDVLYPHLTVSETLWYTALLRLPRALSAGE  201



>ref|XP_009607601.1| PREDICTED: ABC transporter G family member 9-like [Nicotiana 
tomentosiformis]
Length=631

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 106/140 (76%), Gaps = 2/140 (1%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEIL  424
            Q+ + +  +++  P+ LKFE +VYK+    +G C     S  EK IL GV+G+V PGE+L
Sbjct  19   QSKSAAIFKKSNRPVTLKFENVVYKIKLVKEG-CIKSSKSEEEKIILKGVSGIVSPGEML  77

Query  425  AMLGPSGSGKTTLLTALGGRL-YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTV  601
            A+LGPSGSGKTTLLT LGGRL +G L G +TYN++PFS ++KR TGFV QDDVLYPHLTV
Sbjct  78   AILGPSGSGKTTLLTGLGGRLVHGNLDGAITYNNKPFSNAMKRNTGFVTQDDVLYPHLTV  137

Query  602  KETLLFTALLRLPQSLTREE  661
             ETL+FTALLRLP +LT +E
Sbjct  138  TETLVFTALLRLPGTLTVQE  157



>emb|CDY51602.1| BnaCnng21050D [Brassica napus]
Length=666

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 109/138 (79%), Gaps = 3/138 (2%)
 Frame = +2

Query  257  QSF-LQRALYPIVLKFEEIVYKVGGED-KGSCCTGKSSAR-EKTILNGVTGMVCPGEILA  427
            QSF L+++L PI+LKFEE+ Y +  +  K S   G    +  + +LNGV+G+V PGE+LA
Sbjct  49   QSFVLRQSLRPIILKFEELTYSITSQTGKRSYWFGSQEPKPNRFVLNGVSGIVKPGELLA  108

Query  428  MLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKE  607
            MLGPSGSGKTTL+TAL GRL+GKLSG V+YN +PFS ++KR TGFV Q+DV+YPHLTV E
Sbjct  109  MLGPSGSGKTTLVTALAGRLHGKLSGTVSYNEEPFSSAVKRKTGFVTQEDVIYPHLTVLE  168

Query  608  TLLFTALLRLPQSLTREE  661
            TL +TALLRLP+ LTR+E
Sbjct  169  TLTYTALLRLPKELTRKE  186



>ref|XP_008389336.1| PREDICTED: ABC transporter G family member 21-like isoform X1 
[Malus domestica]
 ref|XP_008367026.1| PREDICTED: ABC transporter G family member 21-like isoform X1 
[Malus domestica]
Length=683

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 116/175 (66%), Gaps = 8/175 (5%)
 Frame = +2

Query  149  ENCSPDQRMDDAATTNQP---ADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYK  319
            +NCS       ++ TN      D   D+P    P      S L ++L+P+ LKFE++ Y 
Sbjct  27   QNCSVHAEPSASSRTNVSPCLGDDMADQP---RPTSARA-SILHQSLHPVTLKFEDVGYS  82

Query  320  VGGE-DKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGK  496
            +  +   G C         +T+LNGV+G+V PGE+LAMLGPSGSGKTTLLTALG RL GK
Sbjct  83   IKLQATNGGCVASHKXKPTRTVLNGVSGIVLPGELLAMLGPSGSGKTTLLTALGXRLPGK  142

Query  497  LSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            +SGK+TYN Q FS S+K   GFV+QDDVLYPHL+V ETL +TALLRLP+ LT+EE
Sbjct  143  ISGKITYNGQNFSSSMKHNIGFVSQDDVLYPHLSVLETLTYTALLRLPKQLTKEE  197



>ref|XP_006286036.1| hypothetical protein CARUB_v10007565mg [Capsella rubella]
 gb|EOA18934.1| hypothetical protein CARUB_v10007565mg [Capsella rubella]
Length=638

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 105/157 (67%), Gaps = 10/157 (6%)
 Frame = +2

Query  200  PADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKT  379
            P D   D   L +       S  ++A  P+ LKFE +VY V  ED   C        E+T
Sbjct  13   PIDKTNDDRSLPF-------SIFKKANNPVTLKFENLVYTVKLEDPNGCFRTNHKTEERT  65

Query  380  ILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRL---YGKLSGKVTYNSQPFSGSIKR  550
            IL G+TG V PGEILAMLGPSGSGKT+LLTALGGRL    GKL+G ++YN++P S ++KR
Sbjct  66   ILKGLTGFVKPGEILAMLGPSGSGKTSLLTALGGRLGEGKGKLTGNISYNNKPLSKAVKR  125

Query  551  LTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
             TGFV QDD LYPHLTV ETL+FTALLRLP S  ++E
Sbjct  126  TTGFVTQDDALYPHLTVTETLVFTALLRLPNSFKKQE  162



>gb|KJB50814.1| hypothetical protein B456_008G188000 [Gossypium raimondii]
Length=690

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 102/131 (78%), Gaps = 1/131 (1%)
 Frame = +2

Query  272  RALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKT-ILNGVTGMVCPGEILAMLGPSGS  448
            ++L P+ LKFEE+ Y +      + C      +++T +LNGV+G+V PGE+LAMLGPSGS
Sbjct  72   QSLRPVTLKFEEVAYTIHSSVTSASCFSSHKPKQRTNVLNGVSGVVRPGELLAMLGPSGS  131

Query  449  GKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTAL  628
            GKTTLLTALGGRL GKLSG +TYN +PFS S+KR TGFV+QDDVLYPHLTV ETL + AL
Sbjct  132  GKTTLLTALGGRLTGKLSGTITYNGRPFSSSMKRKTGFVSQDDVLYPHLTVLETLAYAAL  191

Query  629  LRLPQSLTREE  661
            L+LP+ LT +E
Sbjct  192  LKLPKKLTSQE  202



>ref|XP_003541854.2| PREDICTED: ABC transporter G family member 9-like [Glycine max]
Length=627

 Score =   166 bits (419),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = +2

Query  266  LQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSG  445
            L +    ++LKF+ +VYK+  + KG          EK IL GV G+V PGE+LAMLGPSG
Sbjct  23   LHKGKRQVILKFDNVVYKIKTK-KGGVFVKNKETEEKEILKGVKGVVEPGEMLAMLGPSG  81

Query  446  SGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTA  625
            SGKTTLLTALGGRL GKL G +TYN + FS S+KR TGFV QDDVLYPHLTV ETL+FTA
Sbjct  82   SGKTTLLTALGGRLRGKLYGSITYNGEAFSNSMKRNTGFVTQDDVLYPHLTVTETLVFTA  141

Query  626  LLRLPQSLTREE  661
            LLRLP ++++EE
Sbjct  142  LLRLPNTISKEE  153



>emb|CDY48079.1| BnaA06g33490D [Brassica napus]
Length=665

 Score =   165 bits (418),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 110/149 (74%), Gaps = 3/149 (2%)
 Frame = +2

Query  224  PCLAYP-LQTNTQSFLQRALYPIVLKFEEIVYKVGG-EDKGSCCTGKSSAR-EKTILNGV  394
            PC   P  Q+   S L ++L PI+LKFEE+ Y +     K S   G    +  + +LNGV
Sbjct  37   PCHGGPSHQSRQSSVLCQSLRPIILKFEELTYSITSPTGKRSYWFGSQEPKPNRFVLNGV  96

Query  395  TGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQD  574
            +G+V PGE+LAMLGPSGSGKTTL+TAL GRL+GKLSG V+YN +PF+ ++KR TGFV Q+
Sbjct  97   SGIVKPGELLAMLGPSGSGKTTLVTALAGRLHGKLSGTVSYNGEPFTSAVKRKTGFVTQE  156

Query  575  DVLYPHLTVKETLLFTALLRLPQSLTREE  661
            DVLYPHLTV ETL +TALLRLP+ LTR+E
Sbjct  157  DVLYPHLTVMETLTYTALLRLPKELTRKE  185



>ref|XP_006878615.1| PREDICTED: ABC transporter G family member 14 [Amborella trichopoda]
 gb|ERM94760.1| hypothetical protein AMTR_s00011p00258490 [Amborella trichopoda]
Length=648

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 102/139 (73%), Gaps = 1/139 (1%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEIL  424
            Q+   S L  AL P+ LKFE++ YKV    +G C   +    EKTIL G+TG+V PGEIL
Sbjct  30   QSGASSPLGLALCPVTLKFEDVGYKVK-LAQGECLPTRKLIVEKTILTGLTGIVSPGEIL  88

Query  425  AMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVK  604
            AMLGPSGSGKTTLLTALGGRL GK SG VTYN+ PFS S+KR  GFV QDDVLY HLTV 
Sbjct  89   AMLGPSGSGKTTLLTALGGRLPGKHSGFVTYNNHPFSSSMKRRIGFVTQDDVLYAHLTVS  148

Query  605  ETLLFTALLRLPQSLTREE  661
            ETL F ALLRLP S+TR +
Sbjct  149  ETLTFAALLRLPDSITRAK  167



>emb|CDP00551.1| unnamed protein product [Coffea canephora]
Length=678

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 112/175 (64%), Gaps = 10/175 (6%)
 Frame = +2

Query  143  KPENCSPD-QRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYK  319
            + EN S   + ++ A   NQ  D     P           S L+++L P+ LKFE++ Y 
Sbjct  28   RAENNSVHVEPLNSATNVNQSPDENQTSPV--------RYSILRQSLRPVTLKFEDVAYT  79

Query  320  VGGEDKGSCCTGKSSAR-EKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGK  496
            +     G  C   S  +  + ILNGV+G+V PGE+LAMLGPSGSGKTTLLTAL GRL GK
Sbjct  80   LSLRGTGGGCFSSSHPKPTRAILNGVSGIVRPGELLAMLGPSGSGKTTLLTALAGRLSGK  139

Query  497  LSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            +SG +TYN  PFS S+KR TGFV+QDDVLY HLTV ETL +TA LRLP  L+R E
Sbjct  140  VSGTITYNGLPFSSSMKRKTGFVSQDDVLYAHLTVLETLTYTAFLRLPNKLSRNE  194



>ref|XP_002314895.1| hypothetical protein POPTR_0010s14180g [Populus trichocarpa]
 gb|EEF01066.1| hypothetical protein POPTR_0010s14180g [Populus trichocarpa]
Length=683

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 115/183 (63%), Gaps = 17/183 (9%)
 Frame = +2

Query  113  AMPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIV  292
            A P++ S      +CS DQ +               +P L+        + L+ +L P+ 
Sbjct  35   AEPSVSSSINNTSSCSQDQVLQ-----------GQQEPALS------RFTILRASLRPVT  77

Query  293  LKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTA  472
            L+F ++ Y V    KG+  T       +T+LNG +G+V PGE+LAMLGPSGSGKTTLLTA
Sbjct  78   LEFADVAYSVSLSTKGTWFTSSEPKSTRTVLNGASGIVRPGELLAMLGPSGSGKTTLLTA  137

Query  473  LGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLT  652
            L GRL GK+SG +TYN Q FS S+KR TGFV QDDVLYPHLTV ETL + ALLRLP+ LT
Sbjct  138  LAGRLPGKVSGTITYNGQAFSSSMKRRTGFVTQDDVLYPHLTVLETLTYAALLRLPKKLT  197

Query  653  REE  661
            R+E
Sbjct  198  RQE  200



>ref|XP_004487681.1| PREDICTED: ABC transporter G family member 9-like [Cicer arietinum]
Length=630

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 99/126 (79%), Gaps = 1/126 (1%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            P++LKF+++VYK+   +KG          EK IL GVTG+V PGE+LAMLGPSGSGKTTL
Sbjct  33   PVILKFDDVVYKIKA-NKGGLFKKNKKVEEKVILKGVTGIVKPGEMLAMLGPSGSGKTTL  91

Query  464  LTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQ  643
            LTALGGRL GKL G +TYN + FS  IKR TGFV QDDVLYPHLTV ETL+FTALLRLP 
Sbjct  92   LTALGGRLGGKLYGNITYNGKTFSNVIKRNTGFVTQDDVLYPHLTVTETLVFTALLRLPN  151

Query  644  SLTREE  661
            S+T++E
Sbjct  152  SVTKDE  157



>gb|KHN07718.1| ABC transporter G family member 21, partial [Glycine soja]
Length=602

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 95/122 (78%), Gaps = 1/122 (1%)
 Frame = +2

Query  299  FEEIVYKVG-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTAL  475
            FE++ Y +  G DK  C + +     KT+LNGVTGMV P E++AMLGPSGSGKTTLLTAL
Sbjct  1    FEDVSYSITFGRDKNGCVSSQKPKHTKTVLNGVTGMVGPREVMAMLGPSGSGKTTLLTAL  60

Query  476  GGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTR  655
             GRL GKLSG +TYN  PFS S+KR  GFV+QDDVLYPHLTV ETL + A+L+LP+SLTR
Sbjct  61   AGRLAGKLSGAITYNGHPFSSSMKRNIGFVSQDDVLYPHLTVLETLTYAAMLKLPKSLTR  120

Query  656  EE  661
            E+
Sbjct  121  ED  122



>ref|XP_011008785.1| PREDICTED: ABC transporter G family member 21 [Populus euphratica]
 ref|XP_011008793.1| PREDICTED: ABC transporter G family member 21 [Populus euphratica]
Length=684

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 99/134 (74%), Gaps = 0/134 (0%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGP  439
            + L+ +L P+ L+F ++ Y V    KG+          +T+LNGV+G+V PGE+LAMLGP
Sbjct  68   TILRASLRPVTLEFADVAYSVSLSTKGTWFASSEPKSTRTVLNGVSGIVRPGELLAMLGP  127

Query  440  SGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLF  619
            SGSGKTTLLTAL GRL GK+SG + YN Q FS S+KR TGFV QDDVLYPHLTV ETL +
Sbjct  128  SGSGKTTLLTALAGRLPGKVSGTIAYNGQAFSSSMKRRTGFVTQDDVLYPHLTVLETLTY  187

Query  620  TALLRLPQSLTREE  661
             ALLRLP+ LTREE
Sbjct  188  AALLRLPKKLTREE  201



>gb|KJB62742.1| hypothetical protein B456_009G433300 [Gossypium raimondii]
Length=629

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 97/126 (77%), Gaps = 1/126 (1%)
 Frame = +2

Query  287  IVLKFEEIVYKVGGEDKGSCCTGK-SSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            +VLKF ++VY +     G       SS   K ILNG++GMV PGE+LAMLGPSGSGKTTL
Sbjct  31   VVLKFIDVVYTIKLRKVGKLFEKNPSSDDNKVILNGISGMVQPGEMLAMLGPSGSGKTTL  90

Query  464  LTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQ  643
            LTALGGRL G L+G +TYN +PFS S+KR TGFV QDDVLYPHLTV ETL+FTALLRLP 
Sbjct  91   LTALGGRLGGHLNGTITYNGKPFSNSMKRKTGFVTQDDVLYPHLTVTETLIFTALLRLPN  150

Query  644  SLTREE  661
            S T+++
Sbjct  151  SFTKQD  156



>ref|XP_010096709.1| ABC transporter G family member 14 [Morus notabilis]
 gb|EXB65561.1| ABC transporter G family member 14 [Morus notabilis]
Length=634

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 103/136 (76%), Gaps = 2/136 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKG--SCCTGKSSAREKTILNGVTGMVCPGEILAML  433
            S  + +L P+ LKFE++ Y V  + +   +C +       + +LNGV+G+V PGE+LAML
Sbjct  85   SIFRESLRPVTLKFEDVAYTVNLKPRNGMNCFSTHVPKPTRAVLNGVSGLVRPGELLAML  144

Query  434  GPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETL  613
            GPSGSGKTTLLTAL GRL GK+SG ++YN QPFS S+KR TGFV+QDDVLYPHLTV ETL
Sbjct  145  GPSGSGKTTLLTALAGRLPGKISGNISYNGQPFSSSMKRKTGFVSQDDVLYPHLTVLETL  204

Query  614  LFTALLRLPQSLTREE  661
             + ALLRLP+ LTREE
Sbjct  205  TYAALLRLPKKLTREE  220



>ref|XP_009768130.1| PREDICTED: ABC transporter G family member 21-like [Nicotiana 
sylvestris]
Length=674

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 112/178 (63%), Gaps = 19/178 (11%)
 Frame = +2

Query  170  RMDDAATTNQPA-----------DAAPDKPCLAYPLQTNTQ--SFLQRALYPIVLKFEEI  310
            RMD  +   +P            D  PD     +  Q+N    S L+ +L P+ LKFE++
Sbjct  22   RMDSISLQIEPTGPTSNVSPRVNDEVPD-----HQQQSNHAKLSVLRESLRPVTLKFEDV  76

Query  311  VYKVGGE-DKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRL  487
             Y +  E +KG C +     + + +L GVTG+V PGEILAMLGPSGSGKTTLLTAL GRL
Sbjct  77   SYTIKLESNKGGCFSSTQQKQTRMLLQGVTGIVKPGEILAMLGPSGSGKTTLLTALSGRL  136

Query  488  YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
             GK SG +TYN Q FS S+KR  GFV QDDVLYPHLTV ETL + ALLRLP  LT +E
Sbjct  137  PGKFSGTITYNGQQFSSSMKRKIGFVTQDDVLYPHLTVLETLTYAALLRLPNKLTNQE  194



>ref|XP_006413078.1| hypothetical protein EUTSA_v10024656mg [Eutrema salsugineum]
 gb|ESQ54531.1| hypothetical protein EUTSA_v10024656mg [Eutrema salsugineum]
Length=640

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 102/138 (74%), Gaps = 4/138 (3%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVG-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            S  ++A  PI LKFE +VY V   E K   C  K   +E+TIL G+TG+V PGEILAMLG
Sbjct  27   SNFKKANLPITLKFENVVYTVKVKEPKSWLCQTKGKTKERTILKGLTGIVKPGEILAMLG  86

Query  437  PSGSGKTTLLTALGGRL---YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKE  607
            PSGSGKT+ LTALGGR+    GKL+G ++YN++PFS  +KR TGFV QDD LYPHLTV E
Sbjct  87   PSGSGKTSFLTALGGRVSEGKGKLTGNISYNNKPFSKGVKRATGFVTQDDALYPHLTVTE  146

Query  608  TLLFTALLRLPQSLTREE  661
            TL+FTALLRLP S+ + E
Sbjct  147  TLVFTALLRLPNSIKQRE  164



>ref|XP_004972751.1| PREDICTED: ABC transporter G family member 14-like [Setaria italica]
Length=747

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 107/152 (70%), Gaps = 25/152 (16%)
 Frame = +2

Query  281  YPIVLKFEEIVYKV---------------------GGED--KGSCCTGKSSAREKTILNG  391
            +P+VLKFEE+VYKV                     GG D  K       SSAREKTI++G
Sbjct  92   FPLVLKFEEVVYKVKLGQPTAGWCDKLSAAASMAVGGGDGRKKKAAAPGSSAREKTIISG  151

Query  392  VTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGK--LSGKVTYNSQPFSGSIKRLTGFV  565
            ++G+V PGE+LAMLGPSGSGKTTLLTALGGR  G+  LSGK+TYN  PFSG++KR TGFV
Sbjct  152  MSGVVRPGEMLAMLGPSGSGKTTLLTALGGRHGGRALLSGKITYNGLPFSGAVKRRTGFV  211

Query  566  AQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
             Q DVLYPHLTV ETL +TALLRLP++L+  E
Sbjct  212  TQHDVLYPHLTVAETLWYTALLRLPRALSAGE  243



>gb|KHG01243.1| ABC transporter G family member 9 [Gossypium arboreum]
Length=629

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 96/126 (76%), Gaps = 1/126 (1%)
 Frame = +2

Query  287  IVLKFEEIVYKVGGEDKGSCCTGK-SSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            +VLKF ++VY +     G       SS   K ILNG+ GMV PGE+LAMLGPSGSGKTTL
Sbjct  31   VVLKFIDVVYTIKLRKVGKLFEKNPSSDDNKVILNGIRGMVQPGEMLAMLGPSGSGKTTL  90

Query  464  LTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQ  643
            LTALGGRL G L+G +TYN +PFS S+KR TGFV QDDVLYPHLTV ETL+FTALLRLP 
Sbjct  91   LTALGGRLGGHLNGTITYNGKPFSNSMKRKTGFVTQDDVLYPHLTVTETLIFTALLRLPN  150

Query  644  SLTREE  661
            S T+++
Sbjct  151  SFTKQD  156



>ref|XP_008457190.1| PREDICTED: ABC transporter G family member 21 [Cucumis melo]
 ref|XP_008457191.1| PREDICTED: ABC transporter G family member 21 [Cucumis melo]
Length=673

 Score =   163 bits (412),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 112/154 (73%), Gaps = 5/154 (3%)
 Frame = +2

Query  215  PDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSARE----KT  379
            PD    A P   +T S L+++L+P+ LKFE++ Y +  + +K  C + +++  +    +T
Sbjct  28   PDLLIHAVPSAPDTFSILRQSLFPLTLKFEDVSYSIKIQTNKRRCLSLRNNESQSNTTRT  87

Query  380  ILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTG  559
            ILNGV+G+V PGE+LAMLG SGSGKTTLLTAL  RL GK+SG +TYN +PFS SIKR  G
Sbjct  88   ILNGVSGVVRPGELLAMLGTSGSGKTTLLTALAARLPGKISGTITYNDKPFSSSIKRKVG  147

Query  560  FVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            FV+QDDVLYPHLTV ETL + A+LRLP  LT +E
Sbjct  148  FVSQDDVLYPHLTVLETLTYAAMLRLPNKLTYDE  181



>ref|XP_010676724.1| PREDICTED: ABC transporter G family member 14 [Beta vulgaris 
subsp. vulgaris]
Length=634

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 117/179 (65%), Gaps = 34/179 (19%)
 Frame = +2

Query  125  LHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFE  304
            ++ + PKPEN   +  + D  T  +P                         ++PI LKFE
Sbjct  3    INCIMPKPENQGCNNTLQDLPTMLEP-------------------------IFPITLKFE  37

Query  305  EIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGR  484
            E+VYKV  ED           +EKTILNGV+GMV PGEILAMLGPSGSGKTTLL+ALGGR
Sbjct  38   EVVYKVKLED--------IKCKEKTILNGVSGMVFPGEILAMLGPSGSGKTTLLSALGGR  89

Query  485  LYGKLSG-KVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTRE  658
            L GKL   K+TYNS PFSG+IKR TGFVAQDDVLYPHLTV ETLLFTALLRLP +L  E
Sbjct  90   LGGKLLCGKITYNSLPFSGTIKRRTGFVAQDDVLYPHLTVFETLLFTALLRLPSTLAHE  148



>ref|XP_009395262.1| PREDICTED: ABC transporter G family member 9-like [Musa acuminata 
subsp. malaccensis]
Length=622

 Score =   162 bits (411),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 103/137 (75%), Gaps = 4/137 (3%)
 Frame = +2

Query  257  QSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            QS   +A  PI LKFE++VYK+  ++K     GK   RE+ ILNG++G V PGE++AMLG
Sbjct  20   QSIFAKAHRPIDLKFEDVVYKIKTKEKRGENKGKQ--RERVILNGISGTVYPGEMMAMLG  77

Query  437  PSGSGKTTLLTALGGRLY--GKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKET  610
            PSGSGKTTLLT L GR+    +L+G VTYN +PFS S++R  GFV QDDVLYPHLTV ET
Sbjct  78   PSGSGKTTLLTVLAGRVARTQRLTGSVTYNGKPFSSSLRRRMGFVMQDDVLYPHLTVTET  137

Query  611  LLFTALLRLPQSLTREE  661
            L+FTALLRLP +L+R E
Sbjct  138  LVFTALLRLPGTLSRRE  154



>ref|XP_004236984.1| PREDICTED: ABC transporter G family member 21 [Solanum lycopersicum]
Length=675

 Score =   162 bits (411),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 110/178 (62%), Gaps = 15/178 (8%)
 Frame = +2

Query  134  VAPKPENCSPDQRM-DDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEI  310
            + P    C    R+ DD  + +Q +  A               S L+ +L+P+ LKFE++
Sbjct  32   IEPNGPTCDVSPRVNDDRISNHQQSHHAK-------------LSILRESLHPVTLKFEDV  78

Query  311  VYKVG-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRL  487
             Y +    +KG         + + IL  V G+V PGE+LAMLGPSGSGKTTLLT+L GRL
Sbjct  79   SYTIKLKSNKGGYFFSHQQKQNRVILQNVMGIVKPGELLAMLGPSGSGKTTLLTSLAGRL  138

Query  488  YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            +GK SG +TYN Q FS S+KR TGFV QDDVLYPHLTV ETL + ALLRLP  LT+EE
Sbjct  139  HGKFSGNITYNDQQFSSSMKRKTGFVTQDDVLYPHLTVFETLTYAALLRLPSKLTKEE  196



>ref|XP_011077437.1| PREDICTED: ABC transporter G family member 21 [Sesamum indicum]
Length=672

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 100/135 (74%), Gaps = 1/135 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDK-GSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            S L+ +L P+ LKFE++ Y +  +++ G CC+       + ILN V+G V PGE+LAMLG
Sbjct  53   SVLRESLRPVTLKFEDVSYTIKLQNRRGGCCSSSEPKLTRNILNSVSGTVRPGELLAMLG  112

Query  437  PSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLL  616
            PSGSGKTTLLTAL GRL GK SG +TYN Q FS S+KR TGFV QDDVLYPHLTV ETL 
Sbjct  113  PSGSGKTTLLTALAGRLPGKFSGTITYNEQAFSSSMKRKTGFVTQDDVLYPHLTVLETLT  172

Query  617  FTALLRLPQSLTREE  661
            + ALL+LP  LT++E
Sbjct  173  YAALLKLPSKLTKKE  187



>ref|XP_003591854.1| ABC transporter G family member [Medicago truncatula]
 gb|AES62105.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=665

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 113/180 (63%), Gaps = 6/180 (3%)
 Frame = +2

Query  140  PKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQ----SFLQRALYPIVLKFEE  307
            P+ EN S     D +++         D   +  P    T     S L ++L P+ LKFE+
Sbjct  4    PETENSSIHGEPDGSSSNKVKPSLDIDHNAINIPSHPTTPLTSFSILPQSLRPVTLKFED  63

Query  308  IVYKVG--GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGG  481
            + Y +    + K  C  GK S   + ILNGVTG+  PGE+ AMLGPSGSGKTTLLTAL G
Sbjct  64   VSYSITMTNQKKNGCVMGKESKVTRKILNGVTGVARPGELTAMLGPSGSGKTTLLTALAG  123

Query  482  RLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            RL GK++G +TYN    S  +KR  GFV+QDDV+YPHLTV ETL +TALLRLP++LTREE
Sbjct  124  RLAGKVTGTITYNGNSDSSCMKRKIGFVSQDDVVYPHLTVLETLTYTALLRLPKTLTREE  183



>ref|XP_007149612.1| hypothetical protein PHAVU_005G084300g [Phaseolus vulgaris]
 gb|ESW21606.1| hypothetical protein PHAVU_005G084300g [Phaseolus vulgaris]
Length=624

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 99/127 (78%), Gaps = 1/127 (1%)
 Frame = +2

Query  281  YPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTT  460
            + + LKF+++VYK+  + KG     K     K IL GVTG+V PGE+LAMLGPSGSGKTT
Sbjct  26   HQVTLKFDDVVYKIKTK-KGGLLAKKRETVVKEILKGVTGVVEPGEMLAMLGPSGSGKTT  84

Query  461  LLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLP  640
            LLTALGGRL GKL G +TYN + FS  +KR TGFV QDDVLYPHLTV ETL+FTALLRLP
Sbjct  85   LLTALGGRLGGKLHGSITYNGEAFSNDMKRNTGFVTQDDVLYPHLTVLETLVFTALLRLP  144

Query  641  QSLTREE  661
            +S+T+E+
Sbjct  145  KSVTKEK  151



>ref|XP_003526081.1| PREDICTED: ABC transporter G family member 9-like [Glycine max]
Length=624

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 94/126 (75%), Gaps = 2/126 (2%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            P+ LKF +++YK+     G     K  A EK ILNGVTGM   GEILAMLGPSGSGKTTL
Sbjct  28   PVTLKFHDVIYKIKTTKWGFLKNTK--AEEKVILNGVTGMAQSGEILAMLGPSGSGKTTL  85

Query  464  LTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQ  643
            L ALGGRL GKL G +TYN + FS  +KR TGFV QDD+LYPHLTV ET++FTALLRLP+
Sbjct  86   LAALGGRLGGKLHGSITYNGKAFSNVMKRNTGFVTQDDILYPHLTVVETVVFTALLRLPK  145

Query  644  SLTREE  661
            S T +E
Sbjct  146  SFTTKE  151



>ref|XP_011095242.1| PREDICTED: ABC transporter G family member 9-like isoform X2 
[Sesamum indicum]
Length=618

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +2

Query  242  LQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEI  421
            +Q    +  ++A   + LKF ++VYKV            +++ EK +L G+TG+V PGE+
Sbjct  8    IQDENHAIFKKAKSRVTLKFADVVYKVTIGQSKKLLNKNTNSEEKLVLKGITGVVRPGEM  67

Query  422  LAMLGPSGSGKTTLLTALGGRLY-GKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLT  598
            LAMLGPSGSGKTTLLTALGGRL  G L G +TYN +PFS ++KR TGFV QDDVLYPHLT
Sbjct  68   LAMLGPSGSGKTTLLTALGGRLVSGHLGGAITYNGKPFSTTMKRNTGFVTQDDVLYPHLT  127

Query  599  VKETLLFTALLRLPQSLTREE  661
            V ETL++TALLRLP++LT+E+
Sbjct  128  VTETLVYTALLRLPRTLTKEQ  148



>ref|XP_010921129.1| PREDICTED: ABC transporter G family member 9 [Elaeis guineensis]
Length=619

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 104/138 (75%), Gaps = 9/138 (7%)
 Frame = +2

Query  257  QSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            +S   +A +P+ +KFE++VY +  +  GS         EKTIL GV+G V PGE+LAM+G
Sbjct  22   RSIFAKASHPVTIKFEDVVYMIKTKANGS------KKGEKTILKGVSGAVVPGEMLAMMG  75

Query  437  PSGSGKTTLLTALGGRLYG---KLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKE  607
            PSGSGKTTLLTALGGRL     +LSG +TYN +PFS S++R  GFV QDD+LYPHLTV E
Sbjct  76   PSGSGKTTLLTALGGRLARPGRRLSGSITYNGRPFSNSLRRNMGFVNQDDILYPHLTVSE  135

Query  608  TLLFTALLRLPQSLTREE  661
            TLL+TALLRLP++L+R+E
Sbjct  136  TLLYTALLRLPRTLSRDE  153



>ref|XP_011095241.1| PREDICTED: ABC transporter G family member 9-like isoform X1 
[Sesamum indicum]
Length=654

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +2

Query  242  LQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEI  421
            +Q    +  ++A   + LKF ++VYKV            +++ EK +L G+TG+V PGE+
Sbjct  44   IQDENHAIFKKAKSRVTLKFADVVYKVTIGQSKKLLNKNTNSEEKLVLKGITGVVRPGEM  103

Query  422  LAMLGPSGSGKTTLLTALGGRLY-GKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLT  598
            LAMLGPSGSGKTTLLTALGGRL  G L G +TYN +PFS ++KR TGFV QDDVLYPHLT
Sbjct  104  LAMLGPSGSGKTTLLTALGGRLVSGHLGGAITYNGKPFSTTMKRNTGFVTQDDVLYPHLT  163

Query  599  VKETLLFTALLRLPQSLTREE  661
            V ETL++TALLRLP++LT+E+
Sbjct  164  VTETLVYTALLRLPRTLTKEQ  184



>ref|XP_009586692.1| PREDICTED: ABC transporter G family member 21-like [Nicotiana 
tomentosiformis]
Length=675

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 98/135 (73%), Gaps = 1/135 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            S L+ +L P+ LKFE++ Y +  E +KG C +     + + +L GVTG+V PGEILAMLG
Sbjct  57   SVLRESLRPVTLKFEDVSYTIKLERNKGGCFSSTQQKQTRMLLQGVTGIVKPGEILAMLG  116

Query  437  PSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLL  616
            PSG GKTTLLTAL GRL GK SG +TYN Q FS S+KR  GFV QDDVLYPHLTV ETL 
Sbjct  117  PSGCGKTTLLTALSGRLPGKFSGTITYNGQQFSSSMKRKIGFVTQDDVLYPHLTVLETLT  176

Query  617  FTALLRLPQSLTREE  661
            + ALLRLP  LT +E
Sbjct  177  YAALLRLPNKLTNQE  191



>ref|XP_009383080.1| PREDICTED: ABC transporter G family member 9 [Musa acuminata 
subsp. malaccensis]
Length=634

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 117/178 (66%), Gaps = 18/178 (10%)
 Frame = +2

Query  137  APKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVY  316
            A   E+    + +D+  T  + AD           L+ N  S   +A  P+ LKFE++VY
Sbjct  6    ARAVEDGKETKELDNDVTVYRLADHK------GLILKINIYS---KANRPVTLKFEDVVY  56

Query  317  KVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGK  496
            K+  + KG    G     E+ IL GV+G V PGE+LAMLGPSGSGKTTLLT LGGR+ G+
Sbjct  57   KIKTKGKGKAKEG-----ERVILKGVSGAVSPGEMLAMLGPSGSGKTTLLTVLGGRI-GR  110

Query  497  ---LSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
               L+G +TYN +PF+ S+KR TGFV QDDVLYPHLTV ETL++TALLRLP +L+R+E
Sbjct  111  TRLLTGSITYNGKPFTNSLKRRTGFVTQDDVLYPHLTVTETLVYTALLRLPSTLSRQE  168



>emb|CDP05875.1| unnamed protein product [Coffea canephora]
Length=629

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 114/166 (69%), Gaps = 9/166 (5%)
 Frame = +2

Query  164  DQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGS  343
            +Q M D         A   K C A        +  ++A  P+ LKFE++VYK+  + +G 
Sbjct  2    EQEMADVEAPQPNGSAGQQKSCAA--------AIFEKANRPVTLKFEDVVYKIKVKKEG-  52

Query  344  CCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNS  523
                 + + EKTIL G++GMV PGE+LAMLGPSGSGKTTLLTALGGRL G LSG +TYN 
Sbjct  53   WFKKSTESEEKTILKGISGMVLPGEMLAMLGPSGSGKTTLLTALGGRLGGSLSGSITYNG  112

Query  524  QPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            +PFS  +KR TGFV QDD+LYPHLTV ETL+FTALLRLP SLT+EE
Sbjct  113  KPFSNVVKRNTGFVTQDDILYPHLTVNETLIFTALLRLPNSLTKEE  158



>ref|XP_010675645.1| PREDICTED: ABC transporter G family member 9 [Beta vulgaris subsp. 
vulgaris]
Length=636

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 102/134 (76%), Gaps = 3/134 (2%)
 Frame = +2

Query  269  QRALYPIVLKFEEIVYKV---GGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGP  439
            ++A +P++LKF+++VYKV       K    T  S  RE+ ILN ++G+V PGE+LAMLGP
Sbjct  20   KKAKHPVILKFKDVVYKVKFPSQRKKFFKQTTSSPVRERVILNSISGVVYPGEMLAMLGP  79

Query  440  SGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLF  619
            SGSGKTTLLTALGGRL G L G +TY+ +PFS  +KR TGFV QDDVL+ HLTV ETL++
Sbjct  80   SGSGKTTLLTALGGRLGGNLKGSITYDGKPFSNQMKRNTGFVTQDDVLHAHLTVTETLVY  139

Query  620  TALLRLPQSLTREE  661
            TALLRLP + T+E+
Sbjct  140  TALLRLPNTFTKEQ  153



>emb|CAB43874.1| putative protei [Arabidopsis thaliana]
 emb|CAB81392.1| putative protein [Arabidopsis thaliana]
Length=635

 Score =   160 bits (405),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 101/137 (74%), Gaps = 3/137 (2%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGP  439
            S  ++A  P+ LKFE +VY V  +D   C        E+TIL G+TG+V PGEILAMLGP
Sbjct  26   SIFKKANNPVTLKFENLVYTVKLKDSQGCFGKNDKTEERTILKGLTGIVKPGEILAMLGP  85

Query  440  SGSGKTTLLTALGGRL---YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKET  610
            SGSGKT+LLTALGGR+    GKL+G ++YN++P S ++KR TGFV QDD LYP+LTV ET
Sbjct  86   SGSGKTSLLTALGGRVGEGKGKLTGNISYNNKPLSKAVKRTTGFVTQDDALYPNLTVTET  145

Query  611  LLFTALLRLPQSLTREE  661
            L+FTALLRLP S  ++E
Sbjct  146  LVFTALLRLPNSFKKQE  162



>ref|NP_194472.3| ABC transporter G family member 9 [Arabidopsis thaliana]
 sp|Q9SZR9.2|AB9G_ARATH RecName: Full=ABC transporter G family member 9; Short=ABC transporter 
ABCG.9; Short=AtABCG9; AltName: Full=Probable white-brown 
complex homolog protein 9; Short=AtWBC9 [Arabidopsis 
thaliana]
 gb|AEE85338.1| ABC transporter G family member 9 [Arabidopsis thaliana]
Length=638

 Score =   160 bits (405),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 101/137 (74%), Gaps = 3/137 (2%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGP  439
            S  ++A  P+ LKFE +VY V  +D   C        E+TIL G+TG+V PGEILAMLGP
Sbjct  26   SIFKKANNPVTLKFENLVYTVKLKDSQGCFGKNDKTEERTILKGLTGIVKPGEILAMLGP  85

Query  440  SGSGKTTLLTALGGRL---YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKET  610
            SGSGKT+LLTALGGR+    GKL+G ++YN++P S ++KR TGFV QDD LYP+LTV ET
Sbjct  86   SGSGKTSLLTALGGRVGEGKGKLTGNISYNNKPLSKAVKRTTGFVTQDDALYPNLTVTET  145

Query  611  LLFTALLRLPQSLTREE  661
            L+FTALLRLP S  ++E
Sbjct  146  LVFTALLRLPNSFKKQE  162



>ref|XP_011649112.1| PREDICTED: ABC transporter G family member 21 [Cucumis sativus]
 gb|KGN61520.1| hypothetical protein Csa_2G153580 [Cucumis sativus]
Length=673

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 110/154 (71%), Gaps = 5/154 (3%)
 Frame = +2

Query  215  PDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGE-DKGSCCTGKSSARE----KT  379
            PD    A P   +T S L+++L+ + LKFE I Y +  + +K  C + +++  +    +T
Sbjct  29   PDLLIHAVPSAPDTFSILRQSLFSLTLKFENISYSIKVQTNKRGCLSLRNNESQSNTTRT  88

Query  380  ILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTG  559
            ILNGV+G+V PGE+LAMLG SGSGKTTLLTAL  RL GK+SG +TYN +PFS SIKR  G
Sbjct  89   ILNGVSGLVRPGELLAMLGTSGSGKTTLLTALAARLPGKISGTITYNDKPFSSSIKRKIG  148

Query  560  FVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            FV+QDDVLYPHL+V ETL + A+LRLP  LT EE
Sbjct  149  FVSQDDVLYPHLSVLETLTYAAMLRLPNKLTYEE  182



>emb|CDY29304.1| BnaC01g19560D [Brassica napus]
Length=638

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 99/138 (72%), Gaps = 4/138 (3%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVG-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            S  ++A  PI LKFE IVY V   E K      K    E TIL G+ G+V PGEILAMLG
Sbjct  26   SIFKKANLPITLKFENIVYTVKVKEPKSWLSQTKVKTEEMTILKGINGIVKPGEILAMLG  85

Query  437  PSGSGKTTLLTALGGRL---YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKE  607
            PSGSGKT+LLTALGGR+    GKL+G ++YN++PFS  +KR TGFV QDD LYPHLTV E
Sbjct  86   PSGSGKTSLLTALGGRVSEGKGKLTGNISYNNKPFSKGVKRATGFVTQDDALYPHLTVTE  145

Query  608  TLLFTALLRLPQSLTREE  661
            TL+FTALLRLP S  ++E
Sbjct  146  TLVFTALLRLPNSFKKQE  163



>ref|XP_004252105.1| PREDICTED: ABC transporter G family member 9-like [Solanum lycopersicum]
Length=628

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 96/127 (76%), Gaps = 1/127 (1%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            P+ LKFE +VYK+    +G       S  EK IL GV+G+V PGE+LA+LGPSGSGKTTL
Sbjct  28   PVTLKFENVVYKINLAKEGCFKNSPKSNEEKRILKGVSGIVSPGEMLAILGPSGSGKTTL  87

Query  464  LTALGGRLY-GKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLP  640
            LT LGGRL  G L G +TYN++PF+ ++ R TGFV QDDVLYPHLTV ETL+FTALLRLP
Sbjct  88   LTGLGGRLVNGHLKGVITYNNKPFTNAMNRSTGFVTQDDVLYPHLTVSETLVFTALLRLP  147

Query  641  QSLTREE  661
            ++ T EE
Sbjct  148  KTFTVEE  154



>ref|XP_009143407.1| PREDICTED: ABC transporter G family member 9 [Brassica rapa]
 emb|CDX89252.1| BnaA01g16410D [Brassica napus]
Length=638

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 99/138 (72%), Gaps = 4/138 (3%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVG-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            S  ++A  PI LKFE +VY V   E K      K    E TIL G+ G+V PGEILAMLG
Sbjct  26   SIFKKANLPITLKFENVVYTVKVKEPKSWLSQTKVKTEEMTILKGINGIVKPGEILAMLG  85

Query  437  PSGSGKTTLLTALGGRL---YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKE  607
            PSGSGKT+LLTALGGR+    GKL+G ++YN++PFS  +KR TGFV QDD LYPHLTV E
Sbjct  86   PSGSGKTSLLTALGGRISEGKGKLTGNISYNNKPFSKGVKRATGFVTQDDALYPHLTVTE  145

Query  608  TLLFTALLRLPQSLTREE  661
            TL+FTALLRLP S  ++E
Sbjct  146  TLVFTALLRLPNSFKKQE  163



>emb|CDX92829.1| BnaC07g40870D [Brassica napus]
Length=644

 Score =   160 bits (404),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 102/143 (71%), Gaps = 4/143 (3%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVG-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEI  421
            QT   S  ++A  PI LKFE +VY V   E K      K    +KTIL GV G+V PGEI
Sbjct  27   QTLPFSIFKKANLPITLKFENVVYTVKVKEPKSWLGQTKGKTEDKTILKGVNGIVKPGEI  86

Query  422  LAMLGPSGSGKTTLLTALGGRL---YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPH  592
            LAMLGPSGSGKT+LLTALGGR+    GKL+G ++YN++PFS  +KR TGFV QDD LYPH
Sbjct  87   LAMLGPSGSGKTSLLTALGGRVSEGKGKLTGNISYNNKPFSKGVKRATGFVTQDDALYPH  146

Query  593  LTVKETLLFTALLRLPQSLTREE  661
            LTV ETL+FTALLRLP S  +++
Sbjct  147  LTVTETLVFTALLRLPNSFKKQD  169



>gb|EYU28941.1| hypothetical protein MIMGU_mgv1a002356mg [Erythranthe guttata]
Length=684

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 101/138 (73%), Gaps = 4/138 (3%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKG---SCCTGKSSAREKTILNGVTGMVCPGEILAM  430
            S L+ +L P+ LKFE++ Y +    +    +CC        + +LNGVTG V PGE+LAM
Sbjct  57   SVLRESLRPVTLKFEDVSYTIKLSRRSGATNCCASSQPKVTRKLLNGVTGTVRPGELLAM  116

Query  431  LGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGS-IKRLTGFVAQDDVLYPHLTVKE  607
            LGPSGSGKTTLLTAL G+L GK+SG ++YN Q FSGS +KR TGFV QDDVLYPHLTV E
Sbjct  117  LGPSGSGKTTLLTALAGKLSGKVSGTISYNGQSFSGSCMKRKTGFVTQDDVLYPHLTVLE  176

Query  608  TLLFTALLRLPQSLTREE  661
            TL + ALL+LP SLT+EE
Sbjct  177  TLTYAALLKLPSSLTKEE  194



>ref|XP_012084971.1| PREDICTED: ABC transporter G family member 9-like [Jatropha curcas]
 gb|KDP27016.1| hypothetical protein JCGZ_20951 [Jatropha curcas]
Length=621

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 103/134 (77%), Gaps = 0/134 (0%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGP  439
            S  ++   P+ LKFE+++YKV    +G+ C       EK IL GVTG V PGE+LAMLGP
Sbjct  19   SIFEKTNRPLTLKFEDVIYKVVSNKRGTLCQKGLKQEEKMILKGVTGTVLPGEMLAMLGP  78

Query  440  SGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLF  619
            SGSGKTTLLTALGG+L G+L G +TYN +PFS ++KR TGFV QDDVLYPHLTV ETL+F
Sbjct  79   SGSGKTTLLTALGGKLGGQLGGVITYNGKPFSNAVKRNTGFVTQDDVLYPHLTVTETLVF  138

Query  620  TALLRLPQSLTREE  661
            TALLRLP SLT+EE
Sbjct  139  TALLRLPNSLTKEE  152



>ref|XP_010448138.1| PREDICTED: ABC transporter G family member 9 [Camelina sativa]
 ref|XP_010448139.1| PREDICTED: ABC transporter G family member 9 [Camelina sativa]
Length=638

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 100/137 (73%), Gaps = 3/137 (2%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGP  439
            S  +++  P+ LKFE +VY V  ++            E+TIL G+TG+V PGEILAMLGP
Sbjct  26   SIFKKSNNPVTLKFENLVYTVKLKEPNGWFRTNDKTEERTILKGLTGLVKPGEILAMLGP  85

Query  440  SGSGKTTLLTALGGRL---YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKET  610
            SGSGKT+LLTALGGRL    GKL+G ++YN++P S ++KR TGFV QDD LYPHLTV ET
Sbjct  86   SGSGKTSLLTALGGRLGEGKGKLTGNISYNNKPLSKAVKRTTGFVTQDDALYPHLTVTET  145

Query  611  LLFTALLRLPQSLTREE  661
            L+FTALLRLP S  ++E
Sbjct  146  LVFTALLRLPNSFKQQE  162



>ref|XP_006359003.1| PREDICTED: ABC transporter G family member 9-like [Solanum tuberosum]
Length=628

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 95/127 (75%), Gaps = 1/127 (1%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            P+ LKFE +VYK+    +G       S  EK IL GV+G+V PGE+LA+LGPSGSGKTTL
Sbjct  28   PVTLKFENVVYKINLVKEGCFKNSPKSNEEKIILKGVSGIVSPGEMLAILGPSGSGKTTL  87

Query  464  LTALGGRLY-GKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLP  640
            LT LGGRL  G L G +TYN++ FS ++ R TGFV QDDVLYPHLTV ETL+FTALLRLP
Sbjct  88   LTGLGGRLVNGHLKGVITYNNKTFSNAMNRNTGFVTQDDVLYPHLTVSETLVFTALLRLP  147

Query  641  QSLTREE  661
            ++ T EE
Sbjct  148  KTFTVEE  154



>ref|XP_003573439.1| PREDICTED: ABC transporter G family member 14 [Brachypodium distachyon]
Length=711

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 104/151 (69%), Gaps = 24/151 (16%)
 Frame = +2

Query  281  YPIVLKFEEIVYKV----GGEDKGSCCTGKSS-------------------AREKTILNG  391
            +P+VLKFE++VYKV     G  +G C    S+                   A EKTI++G
Sbjct  64   FPLVLKFEDVVYKVKVGQSGSGEGWCSRLSSAIGGVGSAGNKKKPSSAPAPAWEKTIISG  123

Query  392  VTGMVCPGEILAMLGPSGSGKTTLLTALGGR-LYGKLSGKVTYNSQPFSGSIKRLTGFVA  568
            ++G+V PGE+LAMLGPSGSGKTTLLTALGGR   G LSGK+TYN  PFSG +KR TGFV 
Sbjct  124  MSGVVRPGEMLAMLGPSGSGKTTLLTALGGRQTTGHLSGKITYNGHPFSGPVKRRTGFVT  183

Query  569  QDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            Q DVLYPHLTV ETL +TALLRLP++L+  E
Sbjct  184  QHDVLYPHLTVSETLWYTALLRLPRTLSAAE  214



>ref|XP_010433373.1| PREDICTED: ABC transporter G family member 9-like [Camelina sativa]
Length=638

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 100/137 (73%), Gaps = 3/137 (2%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGP  439
            S  +++  P+ LKFE +VY V  ++            E+TIL G+TG+V PGEILAMLGP
Sbjct  26   SIFKKSNNPVTLKFENLVYTVKLKEPNGWFRTNDKTEERTILKGLTGLVKPGEILAMLGP  85

Query  440  SGSGKTTLLTALGGRL---YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKET  610
            SGSGKT+LLTALGGRL    GKL+G ++YN++P S ++KR TGFV QDD LYPHLTV ET
Sbjct  86   SGSGKTSLLTALGGRLGEGKGKLTGNISYNNKPLSKAVKRTTGFVTQDDALYPHLTVTET  145

Query  611  LLFTALLRLPQSLTREE  661
            L+FTALLRLP S  ++E
Sbjct  146  LVFTALLRLPNSFKQQE  162



>ref|XP_010438619.1| PREDICTED: ABC transporter G family member 9-like [Camelina sativa]
Length=636

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 100/137 (73%), Gaps = 3/137 (2%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGP  439
            S  +++  P+ LKFE +VY V  ++            E+TIL G+TG+V PGEILAMLGP
Sbjct  26   SIFKKSNNPVTLKFENLVYTVKLKEPNGWFRTNDKTEERTILKGLTGLVKPGEILAMLGP  85

Query  440  SGSGKTTLLTALGGRL---YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKET  610
            SGSGKT+LLTALGGRL    GKL+G ++YN++P S ++KR TGFV QDD LYPHLTV ET
Sbjct  86   SGSGKTSLLTALGGRLGEGKGKLTGNISYNNKPLSKAVKRTTGFVTQDDALYPHLTVTET  145

Query  611  LLFTALLRLPQSLTREE  661
            L+FTALLRLP S  ++E
Sbjct  146  LVFTALLRLPNSFKQQE  162



>ref|XP_009137658.1| PREDICTED: ABC transporter G family member 9-like [Brassica rapa]
Length=644

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 101/143 (71%), Gaps = 4/143 (3%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVG-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEI  421
            QT   S  ++A  PI LKFE +VY V   E K      K    +KTIL GV G+V P EI
Sbjct  27   QTLPFSVFKKANLPITLKFENVVYTVKVKEPKSWLGQTKGKTEDKTILKGVNGIVKPREI  86

Query  422  LAMLGPSGSGKTTLLTALGGRL---YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPH  592
            LAMLGPSGSGKT+LLTALGGR+    GKL+G +TYN++PFS  +KR TGFV QDD LYPH
Sbjct  87   LAMLGPSGSGKTSLLTALGGRVSEGKGKLTGNITYNNKPFSKGVKRATGFVTQDDALYPH  146

Query  593  LTVKETLLFTALLRLPQSLTREE  661
            LTV ETL+FTALLRLP S  +++
Sbjct  147  LTVTETLVFTALLRLPNSFKKQD  169



>ref|XP_004496215.1| PREDICTED: ABC transporter G family member 21-like [Cicer arietinum]
Length=681

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 120/185 (65%), Gaps = 16/185 (9%)
 Frame = +2

Query  152  NCSPDQRMDDAATTNQPADAAPD---KPCL----AYPLQTNTQ-----SFLQRALYPIVL  295
            N SP     ++++ +  A+ +     KP L    A P +T T      S L ++L P+ L
Sbjct  16   NISPITNRTESSSIHGEAEGSFSNKVKPSLDDHNAIPSRTTTVPLTSFSILPQSLRPVTL  75

Query  296  KFEEIVYKV---GGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLL  466
            KFE++ Y +     ++KG C  GK     + +LNGVTG+  PGE+ AMLGPSGSGKTTLL
Sbjct  76   KFEDVSYSITLTNQKNKG-CVLGKEPKVTRKVLNGVTGIAKPGELTAMLGPSGSGKTTLL  134

Query  467  TALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQS  646
            TAL GRL GK+SG +TYN    S  +KR  GFV+QDDV+YPHLTV ETL +TALLRLP++
Sbjct  135  TALAGRLTGKVSGTITYNGNSDSSCMKRKIGFVSQDDVVYPHLTVLETLTYTALLRLPKT  194

Query  647  LTREE  661
            LTREE
Sbjct  195  LTREE  199



>emb|CDY29837.1| BnaA03g48580D [Brassica napus]
Length=644

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 101/143 (71%), Gaps = 4/143 (3%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVG-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEI  421
            QT   S  ++A  PI LKFE +VY V   E K      K    +KTIL GV G+V P EI
Sbjct  27   QTLPFSVFKKANLPITLKFENVVYTVKVKEPKSWLGQTKGKTEDKTILKGVNGIVKPREI  86

Query  422  LAMLGPSGSGKTTLLTALGGRL---YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPH  592
            LAMLGPSGSGKT+LLTALGGR+    GKL+G +TYN++PFS  +KR TGFV QDD LYPH
Sbjct  87   LAMLGPSGSGKTSLLTALGGRVSEGKGKLTGNITYNNKPFSKGVKRATGFVTQDDALYPH  146

Query  593  LTVKETLLFTALLRLPQSLTREE  661
            LTV ETL+FTALLRLP S  +++
Sbjct  147  LTVTETLVFTALLRLPNSFKKQD  169



>ref|XP_009139468.1| PREDICTED: ABC transporter G family member 27 [Brassica rapa]
Length=735

 Score =   158 bits (399),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 110/185 (59%), Gaps = 25/185 (14%)
 Frame = +2

Query  110  LAMPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPI  289
             A+P    + P   +CS D  ++D           P++P                  +PI
Sbjct  99   FAVPHEEEIIPSERSCSNDDNLEDIEAATSSVVKLPEEPT-----------------FPI  141

Query  290  VLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLT  469
             LKF +I YKV        C   +S+ EK+ILNG++G   PGE+LA++GPSGSGKTTLL 
Sbjct  142  YLKFIDITYKV-------TCKAMTSSSEKSILNGISGSAYPGELLALMGPSGSGKTTLLN  194

Query  470  ALGGRLYGK-LSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQS  646
             LGGR   +  SG V+YN +PFS  +K   GFV QDDVL+PHLTVKETL +TALLRLP++
Sbjct  195  VLGGRFNQQNTSGSVSYNDKPFSKHLKSRIGFVTQDDVLFPHLTVKETLTYTALLRLPKT  254

Query  647  LTREE  661
            LT++E
Sbjct  255  LTKQE  259



>gb|KHN16959.1| ABC transporter G family member 14 [Glycine soja]
Length=569

 Score =   156 bits (395),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +2

Query  401  MVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDV  580
            MV PGEI+AMLGPSGSGKTTLLTALGGRL GKLSGKVTYN+QPFSG++KR TGFVAQDDV
Sbjct  1    MVSPGEIMAMLGPSGSGKTTLLTALGGRLSGKLSGKVTYNNQPFSGAMKRRTGFVAQDDV  60

Query  581  LYPHLTVKETLLFTALLRLPQSLTREE  661
            LYPHLTV ETLLFTALLRLP SLT+EE
Sbjct  61   LYPHLTVFETLLFTALLRLPNSLTKEE  87



>ref|XP_008775311.1| PREDICTED: ABC transporter G family member 9-like [Phoenix dactylifera]
Length=627

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 100/132 (76%), Gaps = 9/132 (7%)
 Frame = +2

Query  275  ALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGK  454
            A +P+ LKFE++VYK+  +  GS         EKTIL GV+G V PGE+LAM+GPSGSGK
Sbjct  28   ARHPVTLKFEDVVYKIEVKADGS------RKGEKTILKGVSGAVLPGEMLAMMGPSGSGK  81

Query  455  TTLLTALGGRLYG---KLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTA  625
            TTLLTAL GRL     +LSG +TYN +PFS  ++R  GFV+QDD+LYPHLTV ETLL+TA
Sbjct  82   TTLLTALAGRLARPGRRLSGSITYNGRPFSNQLRRNMGFVSQDDILYPHLTVSETLLYTA  141

Query  626  LLRLPQSLTREE  661
            LLRLP++L+R E
Sbjct  142  LLRLPRTLSRTE  153



>ref|XP_008799253.1| PREDICTED: ABC transporter G family member 9-like [Phoenix dactylifera]
Length=627

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 100/132 (76%), Gaps = 9/132 (7%)
 Frame = +2

Query  275  ALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGK  454
            A +P+ LKFE++VYK+  +  GS         EKTIL GV+G V PGE+LAM+GPSGSGK
Sbjct  28   ARHPVTLKFEDVVYKIEVKADGS------RKGEKTILKGVSGAVLPGEMLAMMGPSGSGK  81

Query  455  TTLLTALGGRLYG---KLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTA  625
            TTLLTAL GRL     +LSG +TYN +PFS  ++R  GFV+QDD+LYPHLTV ETLL+TA
Sbjct  82   TTLLTALAGRLARPGRRLSGSITYNGRPFSNQLRRSMGFVSQDDILYPHLTVSETLLYTA  141

Query  626  LLRLPQSLTREE  661
            LLRLP++L+R E
Sbjct  142  LLRLPRTLSRTE  153



>ref|XP_009593646.1| PREDICTED: ABC transporter G family member 21 [Nicotiana tomentosiformis]
Length=644

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 108/161 (67%), Gaps = 12/161 (7%)
 Frame = +2

Query  215  PDK--PCLAYPLQTNTQ-------SFLQRALYPIVLKFEEIVYKVGGE-DKG-SCCTGKS  361
            PD+  PC     Q N Q       S L  +L+P+ LKFE+I Y +  E +KG S  +   
Sbjct  4    PDQVSPCANDDFQDNQQQSNHVKLSVLHESLHPVTLKFEDISYTIKLESNKGISYFSTPQ  63

Query  362  SAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLS-GKVTYNSQPFSG  538
              + + IL GVTG+V PGE LAMLGPSGSGKTTLLTAL GRL GKLS G +TYN Q FS 
Sbjct  64   RKQNRAILQGVTGIVHPGEFLAMLGPSGSGKTTLLTALAGRLPGKLSTGSITYNGQQFSS  123

Query  539  SIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
             +KR  GFV QDDVLYPHLTV ETL + ALLRLP+ LT+++
Sbjct  124  YMKRKIGFVTQDDVLYPHLTVLETLTYAALLRLPKKLTKQQ  164



>ref|XP_006366061.1| PREDICTED: ABC transporter G family member 21-like [Solanum tuberosum]
Length=675

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 110/178 (62%), Gaps = 15/178 (8%)
 Frame = +2

Query  134  VAPKPENCSPDQRM-DDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEI  310
            + P    C+   R+ DD  + +Q +  A               S L+ +L+P+ LKFE++
Sbjct  32   IEPNGPTCNVSPRVNDDRVSDHQQSHHAK-------------LSILRESLHPVTLKFEDV  78

Query  311  VYKVGGE-DKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRL  487
             Y +  E +K    +     + + IL  V G+V PGE+LAMLGPSGSGKTTLLT++ GRL
Sbjct  79   SYTIKLESNKRGYFSSHQQKQTRMILQNVMGIVKPGELLAMLGPSGSGKTTLLTSIAGRL  138

Query  488  YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            +GK SG +TYN Q FS S+KR  GFV QDDVLYPHLTV ETL + ALLRLP  LT +E
Sbjct  139  HGKFSGTITYNDQQFSSSMKRKIGFVTQDDVLYPHLTVLETLTYAALLRLPSKLTNQE  196



>dbj|BAJ97566.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=686

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 105/151 (70%), Gaps = 24/151 (16%)
 Frame = +2

Query  281  YPIVLKFEEIVYKVG-GEDKGSCCTGKSSA----------------------REKTILNG  391
            +P+VLKFEE+VYKV  G+     CT  S+A                      REKTI++G
Sbjct  48   FPLVLKFEEVVYKVKVGQATDGWCTRVSAACRGGGGAGGKKNKAAAAAVSPPREKTIISG  107

Query  392  VTGMVCPGEILAMLGPSGSGKTTLLTALGGR-LYGKLSGKVTYNSQPFSGSIKRLTGFVA  568
            ++G+V PGE+LAMLGPSGSGKTTLLTALGGR  +  LSGK+TYN + FSG++KR TGFV 
Sbjct  108  MSGVVRPGEMLAMLGPSGSGKTTLLTALGGRHRHALLSGKITYNGKSFSGAVKRRTGFVT  167

Query  569  QDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            Q DVLYPHLTV ETL +TALLRLP++L   E
Sbjct  168  QHDVLYPHLTVSETLWYTALLRLPRALGAGE  198



>dbj|BAJ95904.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96160.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=686

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 105/151 (70%), Gaps = 24/151 (16%)
 Frame = +2

Query  281  YPIVLKFEEIVYKVG-GEDKGSCCTGKSSA----------------------REKTILNG  391
            +P+VLKFEE+VYKV  G+     CT  S+A                      REKTI++G
Sbjct  48   FPLVLKFEEVVYKVKVGQATDGWCTRVSAACRGGGGAGGKKNKAAAAAVSPPREKTIISG  107

Query  392  VTGMVCPGEILAMLGPSGSGKTTLLTALGGR-LYGKLSGKVTYNSQPFSGSIKRLTGFVA  568
            ++G+V PGE+LAMLGPSGSGKTTLLTALGGR  +  LSGK+TYN + FSG++KR TGFV 
Sbjct  108  MSGVVRPGEMLAMLGPSGSGKTTLLTALGGRHRHALLSGKITYNGKSFSGAVKRRTGFVT  167

Query  569  QDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            Q DVLYPHLTV ETL +TALLRLP++L   E
Sbjct  168  QHDVLYPHLTVSETLWYTALLRLPRALGAGE  198



>gb|KFK29257.1| hypothetical protein AALP_AA7G109600 [Arabis alpina]
Length=639

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 103/143 (72%), Gaps = 4/143 (3%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKVG-GEDKGSCCTGKSSAREKTILNGVTGMVCPGEI  421
            QT   S  ++A   + LKFE +VY V   E KG     K    E+TIL G+TG+V PGEI
Sbjct  21   QTLPFSIFKKANRSVTLKFENVVYTVKVKEAKGWPWQTKDKTEERTILKGLTGIVKPGEI  80

Query  422  LAMLGPSGSGKTTLLTALGGRL---YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPH  592
            LAMLGPSGSGKT+LLTALGGR+    GKL+G ++YN++P S  +KR TGFV QDD LYP+
Sbjct  81   LAMLGPSGSGKTSLLTALGGRVSEGKGKLTGTISYNNKPLSKGVKRTTGFVTQDDALYPY  140

Query  593  LTVKETLLFTALLRLPQSLTREE  661
            LTV ETL++TALLRLP S+ R+E
Sbjct  141  LTVTETLVYTALLRLPNSIKRKE  163



>gb|KHN08925.1| ABC transporter G family member 9, partial [Glycine soja]
Length=592

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 90/121 (74%), Gaps = 2/121 (2%)
 Frame = +2

Query  299  FEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALG  478
            F +++YK+     G     K  A EK ILNGVTGM   GEILAMLGPSGSGKTTLL ALG
Sbjct  1    FHDVIYKIKTTKWGFLKNTK--AEEKVILNGVTGMAQSGEILAMLGPSGSGKTTLLAALG  58

Query  479  GRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTRE  658
            GRL GKL G +TYN + FS  +KR TGFV QDD+LYPHLTV ET++FTALLRLP+S T +
Sbjct  59   GRLGGKLHGSITYNGKAFSNVMKRNTGFVTQDDILYPHLTVVETVVFTALLRLPKSFTTK  118

Query  659  E  661
            E
Sbjct  119  E  119



>ref|XP_008452272.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
9-like [Cucumis melo]
Length=629

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            P+ L+F ++ YK+  + +      K    EKTIL G++G+VCP E+L +LGPSGSGK+TL
Sbjct  29   PVTLRFNDLHYKIKSKQRRFLIPKKPQCEEKTILKGLSGLVCPAEMLVILGPSGSGKSTL  88

Query  464  LTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQ  643
            LTAL GRL G+L G +TYN +PFS  +K   GFV QDD+L+PHLTV ETL+FTALLRLP 
Sbjct  89   LTALSGRLGGRLDGSITYNGKPFSSEMKHRIGFVTQDDILHPHLTVAETLVFTALLRLPN  148

Query  644  SLTREE  661
            +LT++E
Sbjct  149  TLTKQE  154



>ref|XP_007143780.1| hypothetical protein PHAVU_007G100900g [Phaseolus vulgaris]
 gb|ESW15774.1| hypothetical protein PHAVU_007G100900g [Phaseolus vulgaris]
Length=681

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 96/136 (71%), Gaps = 2/136 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGED--KGSCCTGKSSAREKTILNGVTGMVCPGEILAML  433
            S L ++L PI LKFE++ Y +  E   K  C     S   + +L+GVTG+  PGE+ AML
Sbjct  66   SVLHQSLRPITLKFEDVSYTITFESQKKKGCVLRNESKLRRKVLSGVTGVANPGELTAML  125

Query  434  GPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETL  613
            GPSGSGKTTLLTAL GRL GK+SG +TYN    S  +KR  GFV QDDVLYPHLTV ETL
Sbjct  126  GPSGSGKTTLLTALAGRLAGKVSGTITYNGHSDSSFVKRKVGFVPQDDVLYPHLTVLETL  185

Query  614  LFTALLRLPQSLTREE  661
             + ALLRLP+SL+REE
Sbjct  186  TYAALLRLPKSLSREE  201



>ref|XP_006464709.1| PREDICTED: ABC transporter G family member 9-like [Citrus sinensis]
Length=628

 Score =   154 bits (388),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 101/130 (78%), Gaps = 3/130 (2%)
 Frame = +2

Query  272  RALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSG  451
            RA +P+ LKFE+IVYK+  + KG   + K    EK IL G+TGMV PGE+LAMLGPSG G
Sbjct  32   RAKHPVTLKFEDIVYKIKMK-KGFYGSNKK-IEEKAILKGITGMVKPGEMLAMLGPSGCG  89

Query  452  KTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALL  631
            KTTLLTALGGRL G+++G++TYN +PFS  + R TGFV Q+DVL P+LTV ET++FTALL
Sbjct  90   KTTLLTALGGRL-GRINGRITYNGKPFSNQMTRNTGFVTQEDVLSPYLTVTETMVFTALL  148

Query  632  RLPQSLTREE  661
            +LP S T +E
Sbjct  149  QLPNSFTEKE  158



>gb|KDO74147.1| hypothetical protein CISIN_1g010509mg [Citrus sinensis]
Length=508

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 100/130 (77%), Gaps = 3/130 (2%)
 Frame = +2

Query  272  RALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSG  451
            RA +P+ LKFE+IVYK+    KG   + K    EK IL G+TGMV PGE+LAMLGPSG G
Sbjct  32   RAKHPVTLKFEDIVYKIK-MKKGFYGSNKK-IEEKAILKGITGMVKPGEMLAMLGPSGCG  89

Query  452  KTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALL  631
            KTTLLTALGGRL G+++G++TYN +PFS  + R TGFV Q+DVL P+LTV ET++FTALL
Sbjct  90   KTTLLTALGGRL-GRINGRITYNGKPFSNQMTRNTGFVTQEDVLSPYLTVTETMVFTALL  148

Query  632  RLPQSLTREE  661
            +LP S T +E
Sbjct  149  QLPNSFTEKE  158



>ref|XP_004252106.1| PREDICTED: ABC transporter G family member 9-like [Solanum lycopersicum]
Length=1013

 Score =   156 bits (395),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 115/201 (57%), Gaps = 14/201 (7%)
 Frame = +2

Query  77   ISITQTFLRFSLAMPALHSVAPK--PENCS---PDQRMDDAATTNQPADAAPDKPCLAYP  241
            IS+     RF+LA+P    +      E C+    +  M+     N       D       
Sbjct  347  ISLQYVKFRFNLAVPLSKGLGKDLVVETCNGMGININMEQEIMENIENHIHID-------  399

Query  242  LQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEI  421
              + ++        PI LKFE + YK+    +G       S  +K IL GV+G+V PGE+
Sbjct  400  -HSKSEVIFDNTNRPITLKFENVAYKIKLVKEGCLKNSSKSEEDKIILKGVSGIVSPGEM  458

Query  422  LAMLGPSGSGKTTLLTALGGRLY-GKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLT  598
            LA+LGPSG GKTTLLT LGGRL  G L G +TYN+ PFS S+KR  GFV QDDVLYPHLT
Sbjct  459  LAILGPSGCGKTTLLTGLGGRLVNGHLDGAITYNNNPFSSSMKRSIGFVTQDDVLYPHLT  518

Query  599  VKETLLFTALLRLPQSLTREE  661
            V ETL+FTALLRLP++ + EE
Sbjct  519  VYETLVFTALLRLPKTYSIEE  539



>emb|CDX95330.1| BnaC04g28280D [Brassica napus]
Length=738

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 124/205 (60%), Gaps = 31/205 (15%)
 Frame = +2

Query  56   SSTTKTPISITQTFLRFSLAMPALHSVAPKPENCSPDQRMDD--AATTNQPADAAPDKPC  229
            S  T   + ++ +F  F  A+P    + P  ++CS +  ++D  AAT+N           
Sbjct  82   SRATSASLGLSFSFTGF--AVPHEEEIIPSEQSCSNEDNLEDIEAATSN-----------  128

Query  230  LAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVC  409
                LQ       +   +PI LKF +I YKV        C   +S+ EK+ILNG++G   
Sbjct  129  -VVKLQ-------EEPTFPIYLKFIDITYKV-------TCKAMTSSSEKSILNGISGSAY  173

Query  410  PGEILAMLGPSGSGKTTLLTALGGRL-YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLY  586
            PGEILA++GPSGSGKTTLL  LGGR+ +  + G V+YN +P+S  +K   GFV QDDVL+
Sbjct  174  PGEILALMGPSGSGKTTLLNVLGGRINHQNMGGSVSYNDKPYSKHLKTRIGFVTQDDVLF  233

Query  587  PHLTVKETLLFTALLRLPQSLTREE  661
            PHLTVKETL +TALLRLP++LT+++
Sbjct  234  PHLTVKETLTYTALLRLPKTLTKQQ  258



>emb|CDY23205.1| BnaA04g05540D [Brassica napus]
Length=735

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 109/185 (59%), Gaps = 25/185 (14%)
 Frame = +2

Query  110  LAMPALHSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPI  289
             A+P    + P   +CS D  ++D            ++P                  +PI
Sbjct  99   FAVPHEEEIIPSERSCSNDDNLEDIEAATSSVVKLQEEPT-----------------FPI  141

Query  290  VLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLT  469
             LKF +I YKV        C   +S+ EK+ILNG++G   PGEILA++GPSGSGKTTLL 
Sbjct  142  YLKFIDITYKV-------TCKAMTSSSEKSILNGISGSAYPGEILALMGPSGSGKTTLLN  194

Query  470  ALGGRLYGK-LSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQS  646
             LGGR   +  SG V+YN +P+S  +K   GFV QDDVL+PHLTVKETL +TALLRLP++
Sbjct  195  VLGGRFNQQNTSGSVSYNDKPYSKHLKTRIGFVTQDDVLFPHLTVKETLTYTALLRLPKT  254

Query  647  LTREE  661
            LT++E
Sbjct  255  LTKQE  259



>ref|XP_009793168.1| PREDICTED: ABC transporter G family member 21-like [Nicotiana 
sylvestris]
Length=644

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 108/161 (67%), Gaps = 12/161 (7%)
 Frame = +2

Query  215  PDK--PCLAYPLQTNTQ-------SFLQRALYPIVLKFEEIVYKVGGE-DKG-SCCTGKS  361
            PD+  PC       N Q       S L+++L P+ LKF+ + Y +  E +KG S  +   
Sbjct  4    PDQVSPCANDDFPDNQQQSNHVKLSVLRKSLRPVTLKFQNVSYTIKLESNKGISYFSTPQ  63

Query  362  SAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLS-GKVTYNSQPFSG  538
              + + IL GVTG++ PGE LAMLGPSGSGKTTLLTAL GRL GKLS G +TYN Q FS 
Sbjct  64   RKQNRAILQGVTGIIHPGEFLAMLGPSGSGKTTLLTALAGRLSGKLSSGSITYNGQQFSS  123

Query  539  SIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            S+KR  GFV QDDVLYPHLTV ETL + ALLRLP+ LT++E
Sbjct  124  SMKRKIGFVTQDDVLYPHLTVLETLTYAALLRLPKKLTKQE  164



>ref|XP_002533914.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF28469.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=632

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 107/144 (74%), Gaps = 10/144 (7%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGE--DKGSC--------CTGKSSAREKTILNGVTGMVC  409
            S  ++A  P+ LKF+E+VYKVG +     SC        C       EK IL G+TGMV 
Sbjct  18   SIFKKANRPVTLKFDEVVYKVGLQKPSGWSCQKGMKVVSCQNGIKGDEKVILKGITGMVF  77

Query  410  PGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYP  589
            PGE+LAMLGPSGSGKTTLLTALGG+L GKL GK+TYN +PFS ++KR TGFV QDDVLYP
Sbjct  78   PGEMLAMLGPSGSGKTTLLTALGGKLGGKLGGKITYNGKPFSNAMKRNTGFVTQDDVLYP  137

Query  590  HLTVKETLLFTALLRLPQSLTREE  661
            HLTV ETL+FTALLRLP+ LT++E
Sbjct  138  HLTVTETLVFTALLRLPKELTKQE  161



>ref|XP_006359002.1| PREDICTED: ABC transporter G family member 9-like [Solanum tuberosum]
Length=629

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 92/127 (72%), Gaps = 1/127 (1%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            PI LKFE + YK+    +G       S  EK IL  V+G+V PGE+LA+LGPSG GKTTL
Sbjct  29   PITLKFENVAYKIKLVKEGCLKNSSKSEEEKIILKDVSGIVYPGEMLAILGPSGCGKTTL  88

Query  464  LTALGGRLY-GKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLP  640
            LT LGGRL  G L G +TYN+ PFS S+KR  GFV QDDVLYPHLTV ETL+FTALLRLP
Sbjct  89   LTGLGGRLVKGHLDGVITYNNNPFSSSMKRSIGFVTQDDVLYPHLTVYETLVFTALLRLP  148

Query  641  QSLTREE  661
            ++ + EE
Sbjct  149  KTYSVEE  155



>ref|XP_006589394.1| PREDICTED: ABC transporter G family member 21-like [Glycine max]
Length=684

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 96/136 (71%), Gaps = 2/136 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGED--KGSCCTGKSSAREKTILNGVTGMVCPGEILAML  433
            S L ++L PI LKFE++ Y +  E   K  C   K S   + +L GVTG+V PGE+ AML
Sbjct  69   SVLHQSLRPITLKFEDVSYTITFESQKKKGCVLRKESKLRRKVLTGVTGVVNPGELTAML  128

Query  434  GPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETL  613
            GPSGSGKTTLLTAL GRL GK+SG +TYN Q     +KR  GFV QDDV YPHLTV ETL
Sbjct  129  GPSGSGKTTLLTALAGRLAGKVSGTITYNGQTDPTFVKRKVGFVPQDDVHYPHLTVLETL  188

Query  614  LFTALLRLPQSLTREE  661
             + ALLRLP+SL+REE
Sbjct  189  TYAALLRLPKSLSREE  204



>ref|XP_012084913.1| PREDICTED: ABC transporter G family member 9-like [Jatropha curcas]
Length=618

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 102/134 (76%), Gaps = 1/134 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGP  439
            S  Q+A  P+ LKFE++VYKV    +  C  G     E+ IL G+TGMV PGE+LAMLGP
Sbjct  19   SIFQKANRPVTLKFEDVVYKVVSSKQKLCQKGLKQ-EERVILKGITGMVLPGEMLAMLGP  77

Query  440  SGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLF  619
            SGSGKTTLLTALGG+L GKL G +TYN +PFS +IKR  GFV QDD LYP+LTV ETL+F
Sbjct  78   SGSGKTTLLTALGGKLGGKLEGTITYNGKPFSNAIKRSIGFVTQDDALYPNLTVTETLVF  137

Query  620  TALLRLPQSLTREE  661
            TALLRLP SLT+EE
Sbjct  138  TALLRLPNSLTKEE  151



>ref|XP_002443920.1| hypothetical protein SORBIDRAFT_07g004390 [Sorghum bicolor]
 gb|EES13415.1| hypothetical protein SORBIDRAFT_07g004390 [Sorghum bicolor]
Length=749

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 106/165 (64%), Gaps = 38/165 (23%)
 Frame = +2

Query  281  YPIVLKFEEIVYKVG-GEDKGSCCTGKSSA------------------------------  367
            +P+VLKFEE+VYKV  G+     C   S+A                              
Sbjct  91   FPLVLKFEEVVYKVKLGKPTAGWCDKLSAAASNMASFGGGDGSKNKKATASAAGSSSSSS  150

Query  368  ----REKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGK---LSGKVTYNSQ  526
                REKTI++G++G+V PGE+LAMLGPSGSGKTTLLTALGGR  G+   LSGK+TYN Q
Sbjct  151  RARAREKTIISGMSGVVRPGEMLAMLGPSGSGKTTLLTALGGRHGGRAAVLSGKITYNGQ  210

Query  527  PFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            PFSG++KR TGFV Q DVLYPHLTV ETL +TA LRLP+SL+  E
Sbjct  211  PFSGAVKRRTGFVTQHDVLYPHLTVSETLWYTAALRLPRSLSAGE  255



>gb|KHN00888.1| ABC transporter G family member 21 [Glycine soja]
Length=674

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 96/136 (71%), Gaps = 2/136 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGED--KGSCCTGKSSAREKTILNGVTGMVCPGEILAML  433
            S L ++L PI LKFE++ Y +  E   K  C   K S   + +L GVTG+  PGE+ AML
Sbjct  66   SVLHQSLRPITLKFEDVSYTITFESQKKKGCVLRKESKLRRKVLTGVTGVANPGELTAML  125

Query  434  GPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETL  613
            GPSGSGKTTLLTAL GRL GK+SG +TYN Q     +KR  GFV Q+DVLYPHLTV ETL
Sbjct  126  GPSGSGKTTLLTALAGRLAGKVSGTITYNGQTDPTFVKRKVGFVPQEDVLYPHLTVLETL  185

Query  614  LFTALLRLPQSLTREE  661
             + ALLRLP+SL+REE
Sbjct  186  TYAALLRLPKSLSREE  201



>ref|XP_004134252.1| PREDICTED: ABC transporter G family member 9-like [Cucumis sativus]
Length=628

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = +2

Query  263  FLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPS  442
            FL++   P+ L+F ++ YK+  +        K    EKTIL G++G+V P E+L +LGPS
Sbjct  22   FLRKPNRPVTLRFNDVHYKIKSKHTWFLIPKKPQWEEKTILKGLSGLVRPAEMLVILGPS  81

Query  443  GSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFT  622
            GSGK+TLLTAL GRL G+L G +TYN +PFS  +K   GFV QDD+L+PHLT+ ETL+FT
Sbjct  82   GSGKSTLLTALSGRLSGRLDGAITYNGKPFSSEMKHRIGFVTQDDILHPHLTIAETLVFT  141

Query  623  ALLRLPQSLTREE  661
            ALLRLP +LT++E
Sbjct  142  ALLRLPNTLTKQE  154



>ref|XP_006451938.1| hypothetical protein CICLE_v10007744mg [Citrus clementina]
 gb|ESR65178.1| hypothetical protein CICLE_v10007744mg [Citrus clementina]
Length=628

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 100/130 (77%), Gaps = 3/130 (2%)
 Frame = +2

Query  272  RALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSG  451
            RA +P+ LKFE+IVYK+  + KG   + K    EK IL G+TGMV PGE+LAMLGPSG G
Sbjct  32   RAKHPVTLKFEDIVYKIKMK-KGFYGSNKK-IEEKAILKGITGMVKPGEMLAMLGPSGCG  89

Query  452  KTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALL  631
            KTTLLTALGGRL G ++G++TYN +PFS  + R TGFV Q+DVL P+LTV ET++FTALL
Sbjct  90   KTTLLTALGGRL-GPINGRITYNGKPFSNQMTRNTGFVTQEDVLSPYLTVTETMVFTALL  148

Query  632  RLPQSLTREE  661
            +LP S T +E
Sbjct  149  QLPNSFTEKE  158



>ref|XP_006493205.1| PREDICTED: ABC transporter G family member 9-like [Citrus sinensis]
Length=650

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 106/152 (70%), Gaps = 15/152 (10%)
 Frame = +2

Query  245  QTNTQSFLQRALYPIVLKFEEIVYKV---GGEDKGS----CC--TGKSSAREKTILNGVT  397
            + N +  L++    +++KFE++ +K+   GG  +GS    CC    K+S  EK IL GV+
Sbjct  26   KQNVEDMLKKVNMLVIIKFEDVTHKIKTKGG--RGSLGRYCCYLLNKNSDEEKMILKGVS  83

Query  398  GMVCPGEILAMLGPSGSGKTTLLTALGGRL-YGK---LSGKVTYNSQPFSGSIKRLTGFV  565
            G V PGE+LA+LGPSG GKTTLLTALGGRL  GK     G +TYN + FS  +KR TGFV
Sbjct  84   GAVSPGELLAILGPSGCGKTTLLTALGGRLSNGKDTVTQGHITYNGKQFSAEVKRRTGFV  143

Query  566  AQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            AQ++V YPHLTV ETL+FTALLRLP SL REE
Sbjct  144  AQNNVFYPHLTVAETLVFTALLRLPNSLKREE  175



>emb|CAN77762.1| hypothetical protein VITISV_026760 [Vitis vinifera]
Length=315

 Score =   147 bits (371),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 101/152 (66%), Gaps = 18/152 (12%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDK---GSCCT------GKSSAR--------EKTILN  388
            +FL  + YPI LKF +I Y+V  E K   G  C        KSS R        EKTILN
Sbjct  29   NFLMASCYPISLKFIDICYRVKLEKKKSRGGLCRPMLGGPTKSSDRGSTTETIQEKTILN  88

Query  389  GVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGK-LSGKVTYNSQPFSGSIKRLTGFV  565
            GVTGM CPGEILA+LGPSGSGK+TLL AL GR+ G   +G V  N +  +  + R TGFV
Sbjct  89   GVTGMACPGEILAVLGPSGSGKSTLLNALAGRIQGHCFTGTVLANGRKLTKPVLRRTGFV  148

Query  566  AQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
             QDD+LYPHLTV+ETL+F +LLRLP +LT++E
Sbjct  149  TQDDILYPHLTVRETLIFCSLLRLPNTLTKQE  180



>ref|XP_006855537.2| PREDICTED: ABC transporter G family member 14 [Amborella trichopoda]
Length=638

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 109/168 (65%), Gaps = 24/168 (14%)
 Frame = +2

Query  230  LAYP-LQTNTQSFLQRALYPIVLKFEEIVYKVGG---EDKGSCCTGKSSAR----EKTIL  385
            LA P + + T   L++ + PI +KFE++VYK+ G   ++K  C      AR    E+TIL
Sbjct  3    LATPAVDSETHDLLRQPIQPISVKFEDVVYKIKGPNNKEKEKCSLLPLGARQPDAERTIL  62

Query  386  NGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLY----------------GKLSGKVTY  517
             G+TG V PGE+LA+LGPSGSGKTT L+ALGGRL                 GKLSG + Y
Sbjct  63   KGITGAVRPGEMLALLGPSGSGKTTFLSALGGRLPLSSKTSPFAALGGCCPGKLSGSIKY  122

Query  518  NSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            N   FS SI R TGFV QDD+LYPHLTV E+LL+TALLRLP +L++ E
Sbjct  123  NGHHFSDSINRRTGFVTQDDILYPHLTVYESLLYTALLRLPNTLSKGE  170



>gb|ERN17004.1| hypothetical protein AMTR_s00057p00214480 [Amborella trichopoda]
Length=646

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 109/168 (65%), Gaps = 24/168 (14%)
 Frame = +2

Query  230  LAYP-LQTNTQSFLQRALYPIVLKFEEIVYKVGG---EDKGSCCTGKSSAR----EKTIL  385
            LA P + + T   L++ + PI +KFE++VYK+ G   ++K  C      AR    E+TIL
Sbjct  11   LATPAVDSETHDLLRQPIQPISVKFEDVVYKIKGPNNKEKEKCSLLPLGARQPDAERTIL  70

Query  386  NGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLY----------------GKLSGKVTY  517
             G+TG V PGE+LA+LGPSGSGKTT L+ALGGRL                 GKLSG + Y
Sbjct  71   KGITGAVRPGEMLALLGPSGSGKTTFLSALGGRLPLSSKTSPFAALGGCCPGKLSGSIKY  130

Query  518  NSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            N   FS SI R TGFV QDD+LYPHLTV E+LL+TALLRLP +L++ E
Sbjct  131  NGHHFSDSINRRTGFVTQDDILYPHLTVYESLLYTALLRLPNTLSKGE  178



>ref|XP_003556255.1| PREDICTED: ABC transporter G family member 21-like [Glycine max]
Length=682

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 95/136 (70%), Gaps = 2/136 (1%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGED--KGSCCTGKSSAREKTILNGVTGMVCPGEILAML  433
            S L ++L PI LKFE++ Y +  E   K  C   K S   + +L GVTG+  PGE+ AML
Sbjct  67   SVLHQSLRPITLKFEDVSYTITFESQKKKGCVLRKESKLRRKVLTGVTGVANPGELTAML  126

Query  434  GPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETL  613
            GPSGSGKTTLLTAL GRL GK+SG +TYN       +KR  GFV Q+DVLYPHLTV ETL
Sbjct  127  GPSGSGKTTLLTALAGRLAGKVSGTITYNGHTDPTFVKRKVGFVPQEDVLYPHLTVLETL  186

Query  614  LFTALLRLPQSLTREE  661
             + ALLRLP+SL+REE
Sbjct  187  TYAALLRLPKSLSREE  202



>ref|XP_002867504.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43763.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=639

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 100/138 (72%), Gaps = 4/138 (3%)
 Frame = +2

Query  260  SFLQRALYPIVLK-FEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLG  436
            S  ++A  P+ LK FE +VY V  ++            E+TIL G+TG+V PGEILAMLG
Sbjct  26   SIFKKANTPVTLKQFENLVYTVKLKEPQGWFRKNDKTEERTILKGLTGIVKPGEILAMLG  85

Query  437  PSGSGKTTLLTALGGRL---YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKE  607
            PSGSGKT+LLTALGGR+    GKL+G ++YN++P S ++KR TGFV QDD LYP+LTV E
Sbjct  86   PSGSGKTSLLTALGGRVGEGKGKLTGNISYNNKPLSKAVKRRTGFVTQDDALYPNLTVTE  145

Query  608  TLLFTALLRLPQSLTREE  661
            TL+FTALLRLP S  ++E
Sbjct  146  TLVFTALLRLPNSFKQQE  163



>gb|KHN37813.1| ABC transporter G family member 21 [Glycine soja]
Length=666

 Score =   149 bits (375),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 96/137 (70%), Gaps = 3/137 (2%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGED--KGSCCTGKSSAREKTILNGVTGMVCPGEILAML  433
            S L ++L PI LKFE++ Y +  E   K  C   K S   + +L GVTG+V PGE+ AML
Sbjct  68   SVLHQSLRPITLKFEDVSYTITFESQKKKGCVLRKESKLRRKVLTGVTGVVNPGELTAML  127

Query  434  GPSGSGKTTLLTALGGRLYGKLSG-KVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKET  610
            GPSGSGKTTLLTAL GRL GK+SG  +TYN Q     +KR  GFV QDDV YPHLTV ET
Sbjct  128  GPSGSGKTTLLTALAGRLAGKVSGTTITYNGQTDPTFVKRKVGFVPQDDVHYPHLTVLET  187

Query  611  LLFTALLRLPQSLTREE  661
            L + ALLRLP+SL+REE
Sbjct  188  LTYAALLRLPKSLSREE  204



>gb|EEC82957.1| hypothetical protein OsI_27950 [Oryza sativa Indica Group]
Length=761

 Score =   149 bits (377),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 89/152 (59%), Positives = 105/152 (69%), Gaps = 25/152 (16%)
 Frame = +2

Query  281  YPIVLKFEEIVYKVG-GEDKGSCCTGKSSA-----------------REKTILNGVTGMV  406
            YP+VLKFEE+VYKV  G+     C   SSA                 +EKTI++G++G+V
Sbjct  101  YPLVLKFEEVVYKVKIGKPAAGWCARMSSAIGGGGEGRRKKGAAAVAKEKTIISGMSGVV  160

Query  407  CPGEILAMLGPSGSGKTTLLTALGGRLYGK-------LSGKVTYNSQPFSGSIKRLTGFV  565
             PGE+LAMLGPSGSGKTTLLTALGGR  G        LSGK+TYN QPFSG++KR TGFV
Sbjct  161  RPGEMLAMLGPSGSGKTTLLTALGGRHGGGGGGGRGMLSGKITYNGQPFSGAVKRRTGFV  220

Query  566  AQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
             Q DVLYPHLTV ETL +TALLRLP++L   E
Sbjct  221  TQHDVLYPHLTVAETLWYTALLRLPRALGASE  252



>dbj|BAC99536.1| putative ABC transporter AbcG1 [Oryza sativa Japonica Group]
 dbj|BAC99846.1| putative ABC transporter AbcG1 [Oryza sativa Japonica Group]
Length=757

 Score =   149 bits (376),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 88/148 (59%), Positives = 104/148 (70%), Gaps = 25/148 (17%)
 Frame = +2

Query  281  YPIVLKFEEIVYKVG-GEDKGSCCTGKSSA-----------------REKTILNGVTGMV  406
            YP+VLKFEE+VYKV  G+     C   SSA                 +EKTI++G++G+V
Sbjct  97   YPLVLKFEEVVYKVKIGKPAAGWCARMSSAIGGGGEGRRKKGAAAVAKEKTIISGMSGVV  156

Query  407  CPGEILAMLGPSGSGKTTLLTALGGRLYGK-------LSGKVTYNSQPFSGSIKRLTGFV  565
             PGE+LAMLGPSGSGKTTLLTALGGR  G        LSGK+TYN QPFSG++KR TGFV
Sbjct  157  RPGEMLAMLGPSGSGKTTLLTALGGRHGGGGGGGRGMLSGKITYNGQPFSGAVKRRTGFV  216

Query  566  AQDDVLYPHLTVKETLLFTALLRLPQSL  649
             Q DVLYPHLTV ETL +TALLRLP++L
Sbjct  217  TQHDVLYPHLTVAETLWYTALLRLPRAL  244



>gb|EAZ41641.1| hypothetical protein OsJ_26175 [Oryza sativa Japonica Group]
Length=757

 Score =   149 bits (376),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 88/148 (59%), Positives = 104/148 (70%), Gaps = 25/148 (17%)
 Frame = +2

Query  281  YPIVLKFEEIVYKVG-GEDKGSCCTGKSSA-----------------REKTILNGVTGMV  406
            YP+VLKFEE+VYKV  G+     C   SSA                 +EKTI++G++G+V
Sbjct  97   YPLVLKFEEVVYKVKIGKPAAGWCARMSSAIGGGGEGRRKKGAAAVAKEKTIISGMSGVV  156

Query  407  CPGEILAMLGPSGSGKTTLLTALGGRLYGK-------LSGKVTYNSQPFSGSIKRLTGFV  565
             PGE+LAMLGPSGSGKTTLLTALGGR  G        LSGK+TYN QPFSG++KR TGFV
Sbjct  157  RPGEMLAMLGPSGSGKTTLLTALGGRHGGGGGGGRGMLSGKITYNGQPFSGAVKRRTGFV  216

Query  566  AQDDVLYPHLTVKETLLFTALLRLPQSL  649
             Q DVLYPHLTV ETL +TALLRLP++L
Sbjct  217  TQHDVLYPHLTVAETLWYTALLRLPRAL  244



>ref|XP_010036577.1| PREDICTED: ABC transporter G family member 22-like [Eucalyptus 
grandis]
 ref|XP_010036578.1| PREDICTED: ABC transporter G family member 22-like [Eucalyptus 
grandis]
 gb|KCW48184.1| hypothetical protein EUGRSUZ_K01911 [Eucalyptus grandis]
Length=759

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 91/127 (72%), Gaps = 8/127 (6%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            PI LKF ++ YKV          G  S +EK ILNG+TG V PGE+LA++GPSGSGKTTL
Sbjct  160  PIYLKFTDVTYKV-------ILKGMKSKQEKDILNGITGSVNPGEVLALMGPSGSGKTTL  212

Query  464  LTALGGRLYG-KLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLP  640
            L  LGGR+    + G +TYN QP+S S+K   GFV QDDVL+PHLTVKETL + ALLRLP
Sbjct  213  LNLLGGRIMKPTVGGSITYNDQPYSKSLKSRIGFVTQDDVLFPHLTVKETLTYAALLRLP  272

Query  641  QSLTREE  661
            +SL REE
Sbjct  273  KSLKREE  279



>ref|XP_007199008.1| hypothetical protein PRUPE_ppa017466mg [Prunus persica]
 gb|EMJ00207.1| hypothetical protein PRUPE_ppa017466mg [Prunus persica]
Length=614

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 109/148 (74%), Gaps = 9/148 (6%)
 Frame = +2

Query  218  DKPCLAYPLQTNTQS--FLQRALYPIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNG  391
            +K  L   +QT T++    + A+ P+ LKFE++VYK+   +        +   EK ILNG
Sbjct  2    EKEMLDIDIQTATEAPTIFKEAIRPVTLKFEDVVYKIKQNNS-------TKNEEKVILNG  54

Query  392  VTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQ  571
            V+G+V PGEILAMLGPSGSGKTTL+TALGGRL G+LSG +TYN +PFS ++KR TGFV Q
Sbjct  55   VSGLVQPGEILAMLGPSGSGKTTLITALGGRLGGRLSGAITYNKKPFSNAMKRNTGFVTQ  114

Query  572  DDVLYPHLTVKETLLFTALLRLPQSLTR  655
            DD LYPHLTV ETL +TALLRLP +L++
Sbjct  115  DDFLYPHLTVIETLFYTALLRLPNTLSK  142



>ref|XP_010110448.1| ABC transporter G family member 22 [Morus notabilis]
 gb|EXC26390.1| ABC transporter G family member 22 [Morus notabilis]
Length=761

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 91/127 (72%), Gaps = 8/127 (6%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            PI LKF ++ YKV          G  +  EK ILNG+TG V PGE+LA++GPSGSGKTTL
Sbjct  162  PIYLKFTDVTYKV-------VIKGMRANEEKDILNGITGAVNPGEVLALMGPSGSGKTTL  214

Query  464  LTALGGRLYG-KLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLP  640
            L  LGGR+    + G +TYN QP+S  +K   GFV QDDVL+PHLTVKETL +TALLRLP
Sbjct  215  LNLLGGRVIQPTVGGSITYNDQPYSKFLKSRIGFVTQDDVLFPHLTVKETLTYTALLRLP  274

Query  641  QSLTREE  661
            +SLTREE
Sbjct  275  KSLTREE  281



>emb|CBI18157.3| unnamed protein product [Vitis vinifera]
Length=645

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 101/152 (66%), Gaps = 18/152 (12%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDK---GSCCT------GKSSAR--------EKTILN  388
            +FL  + YPI LKF +I Y+V  E K   G  C        KSS R        EKTILN
Sbjct  32   NFLMASCYPISLKFIDICYRVKLEKKKSRGGLCRPMLGGPTKSSDRGSTTETIQEKTILN  91

Query  389  GVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGK-LSGKVTYNSQPFSGSIKRLTGFV  565
            GVTGM CPGEILA+LGPSGSGK+TLL AL GR+ G   +G V  N +  +  + R TGFV
Sbjct  92   GVTGMACPGEILAVLGPSGSGKSTLLNALAGRIQGHCFTGTVLANGRKLTKPVLRRTGFV  151

Query  566  AQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
             QDD+LYPHLTV+ETL+F +LLRLP +LT++E
Sbjct  152  TQDDILYPHLTVRETLIFCSLLRLPNTLTKQE  183



>ref|XP_002268373.1| PREDICTED: ABC transporter G family member 25 [Vitis vinifera]
Length=664

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 101/152 (66%), Gaps = 18/152 (12%)
 Frame = +2

Query  260  SFLQRALYPIVLKFEEIVYKVGGEDK---GSCCT------GKSSAR--------EKTILN  388
            +FL  + YPI LKF +I Y+V  E K   G  C        KSS R        EKTILN
Sbjct  32   NFLMASCYPISLKFIDICYRVKLEKKKSRGGLCRPMLGGPTKSSDRGSTTETIQEKTILN  91

Query  389  GVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGK-LSGKVTYNSQPFSGSIKRLTGFV  565
            GVTGM CPGEILA+LGPSGSGK+TLL AL GR+ G   +G V  N +  +  + R TGFV
Sbjct  92   GVTGMACPGEILAVLGPSGSGKSTLLNALAGRIQGHCFTGTVLANGRKLTKPVLRRTGFV  151

Query  566  AQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
             QDD+LYPHLTV+ETL+F +LLRLP +LT++E
Sbjct  152  TQDDILYPHLTVRETLIFCSLLRLPNTLTKQE  183



>gb|KJB14995.1| hypothetical protein B456_002G153900 [Gossypium raimondii]
Length=554

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 93/127 (73%), Gaps = 8/127 (6%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            PI LKF E+ YKV          G +S+ E+ ILNG++G V PGE++A++GPSGSGKTTL
Sbjct  149  PIYLKFREVSYKV-------VIKGMTSSEERDILNGISGDVSPGEVVALMGPSGSGKTTL  201

Query  464  LTALGGRL-YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLP  640
            L  LGGRL +  ++G VTYN QP+S  +K   GFV QDDVL+PHLTVKETL + ALLRLP
Sbjct  202  LNILGGRLTHSAVAGSVTYNDQPYSKFLKSRIGFVTQDDVLFPHLTVKETLTYAALLRLP  261

Query  641  QSLTREE  661
             +LT+++
Sbjct  262  LTLTKQQ  268



>sp|Q9FT51.1|AB27G_ARATH RecName: Full=ABC transporter G family member 27; Short=ABC transporter 
ABCG.27; Short=AtABCG27; AltName: Full=Probable white-brown 
complex homolog protein 28; Short=AtWBC28 [Arabidopsis 
thaliana]
 emb|CAC07922.1| ABC transporter-like protein [Arabidopsis thaliana]
Length=737

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 104/179 (58%), Gaps = 25/179 (14%)
 Frame = +2

Query  128  HSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEE  307
            H      E CS D  ++D             +P                  +PI LKF +
Sbjct  107  HEEIIASERCSNDDILEDIEAATSSVVKFQAEPT-----------------FPIYLKFID  149

Query  308  IVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRL  487
            I YKV          G +S+ EK+ILNG++G   PGE+LA++GPSGSGKTTLL ALGGR 
Sbjct  150  ITYKV-------TTKGMTSSSEKSILNGISGSAYPGELLALMGPSGSGKTTLLNALGGRF  202

Query  488  YGK-LSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
              + + G V+YN +P+S  +K   GFV QDDVL+PHLTVKETL +TALLRLP++LT +E
Sbjct  203  NQQNIGGSVSYNDKPYSKHLKTRIGFVTQDDVLFPHLTVKETLTYTALLRLPKTLTEQE  261



>gb|ABR17189.1| unknown [Picea sitchensis]
Length=819

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 94/130 (72%), Gaps = 4/130 (3%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAR----EKTILNGVTGMVCPGEILAMLGPSGSG  451
            PI LKF E+ YKV  + K +     S       EK IL GV+G + PGE+LAM+GPSGSG
Sbjct  195  PICLKFLEVQYKVILQGKPTSILTSSWTEPIFFEKDILYGVSGSIAPGEMLAMMGPSGSG  254

Query  452  KTTLLTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALL  631
            KTTL+  LGGR+   +SG +TYN QP+S ++KR  GFV QDDVL+PHLTV+ETL +TALL
Sbjct  255  KTTLINLLGGRIQQNVSGSITYNDQPYSKALKRRIGFVTQDDVLFPHLTVRETLTYTALL  314

Query  632  RLPQSLTREE  661
            RLP++LT+ +
Sbjct  315  RLPRTLTKHQ  324



>emb|CBI20349.3| unnamed protein product [Vitis vinifera]
Length=574

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 98/125 (78%), Gaps = 1/125 (1%)
 Frame = +2

Query  287  IVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLL  466
            ++LKFEE+ YK     KG      S   EK IL G+TG+V PGE+LAMLGPSGSGKTTLL
Sbjct  30   VILKFEEVDYK-AKTHKGGLLRKDSKPEEKHILKGITGIVLPGEMLAMLGPSGSGKTTLL  88

Query  467  TALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQS  646
            TALGGRL G+L+G +TYN +PFS  +KR TGFV QDDVLYPHLTV ETL+FTALLRLP +
Sbjct  89   TALGGRLGGRLNGSITYNGKPFSNRMKRSTGFVTQDDVLYPHLTVTETLVFTALLRLPNT  148

Query  647  LTREE  661
            +++E+
Sbjct  149  ISKED  153



>ref|XP_002876135.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52394.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=752

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 105/179 (59%), Gaps = 25/179 (14%)
 Frame = +2

Query  128  HSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEE  307
            H      E CS D  ++D             +P                  +PI LKF +
Sbjct  107  HEEIIASEQCSNDDILEDIEAATSTVVKFQAEPT-----------------FPIYLKFID  149

Query  308  IVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRL  487
            I YKV          G +S+ EK+ILNG++G   PGE+LA++GPSGSGKTTLL ALGGR 
Sbjct  150  ITYKV-------TTKGMTSSSEKSILNGISGSAYPGELLALMGPSGSGKTTLLNALGGRF  202

Query  488  YGK-LSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
              + + G V+YN +P+S  +K   GFV QDDVL+PHLTVKETL +TALLRLP++LT++E
Sbjct  203  NQQNIRGFVSYNDKPYSKHLKTRIGFVTQDDVLFPHLTVKETLTYTALLRLPKTLTKQE  261



>ref|XP_008237152.1| PREDICTED: ABC transporter G family member 25 [Prunus mume]
Length=669

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 107/175 (61%), Gaps = 19/175 (11%)
 Frame = +2

Query  179  DAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVGGEDK----GSC  346
            D  T+ +      D P    P   N+ +      +PI LKF ++ Y+V  ++K    G C
Sbjct  6    DTTTSGEHQTPNRDLPSDHSPFMINSSN-----CFPITLKFLDVCYRVKIDNKLQYKGGC  60

Query  347  CTGKSSA----------REKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGK  496
            C  K             +E+TIL+G+TGMV PGEILA+LGPSGSGK+TLL AL GRL  +
Sbjct  61   CFSKGRLMQKGQPGQEPQERTILHGITGMVSPGEILAILGPSGSGKSTLLNALAGRLTQR  120

Query  497  LSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
              G V  N +  + ++ R TGFV QDDVLYPHLTV+ETL+F +LLRLPQS+++ +
Sbjct  121  HHGTVLANGRSLTKAVLRRTGFVTQDDVLYPHLTVRETLVFCSLLRLPQSVSKRD  175



>ref|XP_009796796.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Nicotiana sylvestris]
Length=608

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 90/126 (71%), Gaps = 7/126 (6%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            PI LKF E+ YKV          G +S REK IL G++G V PGE+LAM+GPSGSGKTTL
Sbjct  10   PIYLKFTEVCYKV-------VIKGVTSTREKEILTGISGSVDPGEVLAMMGPSGSGKTTL  62

Query  464  LTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQ  643
            L+ LGGR+     G +TYN QP+S  +K   GFV QDD+L+PHLTV+ETL + A LRLP+
Sbjct  63   LSLLGGRIKEPTGGSITYNEQPYSKLLKSRIGFVTQDDILFPHLTVRETLTYAARLRLPK  122

Query  644  SLTREE  661
            +LT+EE
Sbjct  123  TLTKEE  128



>ref|NP_190799.2| ABC transporter G family member 27 [Arabidopsis thaliana]
 gb|AEE78930.1| ABC transporter G family member 27 [Arabidopsis thaliana]
Length=784

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 104/179 (58%), Gaps = 25/179 (14%)
 Frame = +2

Query  128  HSVAPKPENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEE  307
            H      E CS D  ++D             +P                  +PI LKF +
Sbjct  154  HEEIIASERCSNDDILEDIEAATSSVVKFQAEPT-----------------FPIYLKFID  196

Query  308  IVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRL  487
            I YKV          G +S+ EK+ILNG++G   PGE+LA++GPSGSGKTTLL ALGGR 
Sbjct  197  ITYKV-------TTKGMTSSSEKSILNGISGSAYPGELLALMGPSGSGKTTLLNALGGRF  249

Query  488  YGK-LSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
              + + G V+YN +P+S  +K   GFV QDDVL+PHLTVKETL +TALLRLP++LT +E
Sbjct  250  NQQNIGGSVSYNDKPYSKHLKTRIGFVTQDDVLFPHLTVKETLTYTALLRLPKTLTEQE  308



>ref|XP_002281949.1| PREDICTED: ABC transporter G family member 9 [Vitis vinifera]
Length=623

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 98/125 (78%), Gaps = 1/125 (1%)
 Frame = +2

Query  287  IVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLL  466
            ++LKFEE+ YK     KG      S   EK IL G+TG+V PGE+LAMLGPSGSGKTTLL
Sbjct  30   VILKFEEVDYK-AKTHKGGLLRKDSKPEEKHILKGITGIVLPGEMLAMLGPSGSGKTTLL  88

Query  467  TALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQS  646
            TALGGRL G+L+G +TYN +PFS  +KR TGFV QDDVLYPHLTV ETL+FTALLRLP +
Sbjct  89   TALGGRLGGRLNGSITYNGKPFSNRMKRSTGFVTQDDVLYPHLTVTETLVFTALLRLPNT  148

Query  647  LTREE  661
            +++E+
Sbjct  149  ISKED  153



>ref|NP_001061077.2| Os08g0167000 [Oryza sativa Japonica Group]
 dbj|BAF22991.2| Os08g0167000, partial [Oryza sativa Japonica Group]
Length=326

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 102/149 (68%), Gaps = 25/149 (17%)
 Frame = +2

Query  290  VLKFEEIVYKVG-GEDKGSCCTGKSSA-----------------REKTILNGVTGMVCPG  415
            +++FEE+VYKV  G+     C   SSA                 +EKTI++G++G+V PG
Sbjct  1    LVQFEEVVYKVKIGKPAAGWCARMSSAIGGGGEGRRKKGAAAVAKEKTIISGMSGVVRPG  60

Query  416  EILAMLGPSGSGKTTLLTALGGRLYGK-------LSGKVTYNSQPFSGSIKRLTGFVAQD  574
            E+LAMLGPSGSGKTTLLTALGGR  G        LSGK+TYN QPFSG++KR TGFV Q 
Sbjct  61   EMLAMLGPSGSGKTTLLTALGGRHGGGGGGGRGMLSGKITYNGQPFSGAVKRRTGFVTQH  120

Query  575  DVLYPHLTVKETLLFTALLRLPQSLTREE  661
            DVLYPHLTV ETL +TALLRLP++L   E
Sbjct  121  DVLYPHLTVAETLWYTALLRLPRALGAGE  149



>emb|CAN62144.1| hypothetical protein VITISV_007841 [Vitis vinifera]
Length=603

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 98/125 (78%), Gaps = 1/125 (1%)
 Frame = +2

Query  287  IVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLL  466
            ++LKFEE+ YK     KG      S   EK IL G+TG+V PGE+LAMLGPSGSGKTTLL
Sbjct  33   VILKFEEVDYK-AKTHKGGLLRKDSKPEEKHILKGITGIVLPGEMLAMLGPSGSGKTTLL  91

Query  467  TALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQS  646
            TALGGRL G+L+G +TYN +PFS  +KR TGFV QDDVLYPHLTV ETL+FTALLRLP +
Sbjct  92   TALGGRLGGRLNGSITYNGKPFSNRMKRSTGFVTQDDVLYPHLTVTETLVFTALLRLPNT  151

Query  647  LTREE  661
            +++E+
Sbjct  152  ISKED  156



>gb|KDO70711.1| hypothetical protein CISIN_1g0045372mg, partial [Citrus sinensis]
Length=435

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 90/127 (71%), Gaps = 8/127 (6%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            PI LKF ++ YKV          G +S+ EK ILNG+TG V PGE+LA++GPSGSGKTTL
Sbjct  20   PIYLKFTDVTYKV-------ILKGMTSSEEKDILNGITGSVNPGEVLALMGPSGSGKTTL  72

Query  464  LTALGGRLYG-KLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLP  640
            L  L GRL    + G +TYN  P+S S+K   GFV QDDVL+PHLTVKETL + ALLRLP
Sbjct  73   LNLLSGRLMEPTVGGSITYNDHPYSKSLKSKIGFVTQDDVLFPHLTVKETLTYAALLRLP  132

Query  641  QSLTREE  661
             +LT+++
Sbjct  133  NTLTKQQ  139



>ref|XP_004228604.1| PREDICTED: ABC transporter G family member 22-like [Solanum lycopersicum]
 ref|XP_010315863.1| PREDICTED: ABC transporter G family member 22-like [Solanum lycopersicum]
Length=749

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 89/126 (71%), Gaps = 7/126 (6%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            PI LKF E+ YKV          G +S REK IL G++G V PGE+LAM+GPSGSGKTTL
Sbjct  151  PIYLKFTEVCYKV-------VIKGVTSTREKEILTGISGSVDPGEVLAMMGPSGSGKTTL  203

Query  464  LTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQ  643
            L+ LGGR+     G +TYN QP+S  +K   GFV QDD+L+PHLTV+ETL + A LRLP+
Sbjct  204  LSLLGGRVKEPTGGSITYNEQPYSKHLKSRIGFVTQDDILFPHLTVRETLTYAARLRLPK  263

Query  644  SLTREE  661
             LT+EE
Sbjct  264  KLTKEE  269



>ref|XP_006348422.1| PREDICTED: ABC transporter G family member 22-like [Solanum tuberosum]
Length=751

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 89/126 (71%), Gaps = 7/126 (6%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            PI LKF E+ YKV          G +S REK IL G++G V PGE+LAM+GPSGSGKTTL
Sbjct  153  PIYLKFTEVCYKV-------VIKGVTSTREKEILTGISGSVDPGEVLAMMGPSGSGKTTL  205

Query  464  LTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQ  643
            L+ LGGR+     G +TYN QP+S  +K   GFV QDD+L+PHLTV+ETL + A LRLP+
Sbjct  206  LSLLGGRVKEPTGGSITYNEQPYSKHLKSRIGFVTQDDILFPHLTVRETLTYAARLRLPK  265

Query  644  SLTREE  661
             LT+EE
Sbjct  266  KLTKEE  271



>ref|XP_009796795.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Nicotiana sylvestris]
Length=744

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 90/126 (71%), Gaps = 7/126 (6%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            PI LKF E+ YKV          G +S REK IL G++G V PGE+LAM+GPSGSGKTTL
Sbjct  146  PIYLKFTEVCYKV-------VIKGVTSTREKEILTGISGSVDPGEVLAMMGPSGSGKTTL  198

Query  464  LTALGGRLYGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQ  643
            L+ LGGR+     G +TYN QP+S  +K   GFV QDD+L+PHLTV+ETL + A LRLP+
Sbjct  199  LSLLGGRIKEPTGGSITYNEQPYSKLLKSRIGFVTQDDILFPHLTVRETLTYAARLRLPK  258

Query  644  SLTREE  661
            +LT+EE
Sbjct  259  TLTKEE  264



>ref|XP_010557969.1| PREDICTED: ABC transporter G family member 22-like [Tarenaya 
hassleriana]
Length=750

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 103/173 (60%), Gaps = 19/173 (11%)
 Frame = +2

Query  146  PENCSPDQRMDDAATTNQPADAAPDKPCLAYPLQTNTQSFLQRALYPIVLKFEEIVYKVG  325
            PE  S  +   D    ++  +A   +P            F      PI LKF +I YKV 
Sbjct  118  PEEISDSKPFSDDEMIHEDIEAGNKQP-----------KFQAEPTLPIYLKFSDITYKV-  165

Query  326  GEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLYGK-LS  502
                     G +S+ EK ILNG+ G V PGE+LA++GPSGSGKTTLL+ LGGRL    + 
Sbjct  166  ------VIKGITSSEEKEILNGINGSVVPGEVLALMGPSGSGKTTLLSLLGGRLPQPCVG  219

Query  503  GKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLPQSLTREE  661
            G VTYN +P+S  +K   GFV QDDVL+PHLTVKETL + A LRLP+SLTRE+
Sbjct  220  GSVTYNDKPYSKFLKSKIGFVTQDDVLFPHLTVKETLTYAARLRLPKSLTREQ  272



>gb|KJB16510.1| hypothetical protein B456_002G233500 [Gossypium raimondii]
Length=632

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 90/127 (71%), Gaps = 8/127 (6%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            PI LKF ++ YKV          G +S  E+ ILNG+TG V PGE+LA++GPSGSGKTTL
Sbjct  151  PIYLKFTDVTYKV-------IIKGMTSCEERDILNGITGAVNPGEVLALMGPSGSGKTTL  203

Query  464  LTALGGRLY-GKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLP  640
            L  LGGRL    +SG +TYN QP+S  +K   GFV QDDVL+PHLTVKETL + A LRLP
Sbjct  204  LNLLGGRLIQSTVSGSITYNDQPYSKFLKSRIGFVTQDDVLFPHLTVKETLTYAARLRLP  263

Query  641  QSLTREE  661
            + LTR++
Sbjct  264  KVLTRQQ  270



>gb|KJB14994.1| hypothetical protein B456_002G153900 [Gossypium raimondii]
Length=745

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 93/127 (73%), Gaps = 8/127 (6%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            PI LKF E+ YKV          G +S+ E+ ILNG++G V PGE++A++GPSGSGKTTL
Sbjct  149  PIYLKFREVSYKV-------VIKGMTSSEERDILNGISGDVSPGEVVALMGPSGSGKTTL  201

Query  464  LTALGGRL-YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLP  640
            L  LGGRL +  ++G VTYN QP+S  +K   GFV QDDVL+PHLTVKETL + ALLRLP
Sbjct  202  LNILGGRLTHSAVAGSVTYNDQPYSKFLKSRIGFVTQDDVLFPHLTVKETLTYAALLRLP  261

Query  641  QSLTREE  661
             +LT+++
Sbjct  262  LTLTKQQ  268



>gb|KJB14993.1| hypothetical protein B456_002G153900 [Gossypium raimondii]
Length=751

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 93/127 (73%), Gaps = 8/127 (6%)
 Frame = +2

Query  284  PIVLKFEEIVYKVGGEDKGSCCTGKSSAREKTILNGVTGMVCPGEILAMLGPSGSGKTTL  463
            PI LKF E+ YKV          G +S+ E+ ILNG++G V PGE++A++GPSGSGKTTL
Sbjct  149  PIYLKFREVSYKV-------VIKGMTSSEERDILNGISGDVSPGEVVALMGPSGSGKTTL  201

Query  464  LTALGGRL-YGKLSGKVTYNSQPFSGSIKRLTGFVAQDDVLYPHLTVKETLLFTALLRLP  640
            L  LGGRL +  ++G VTYN QP+S  +K   GFV QDDVL+PHLTVKETL + ALLRLP
Sbjct  202  LNILGGRLTHSAVAGSVTYNDQPYSKFLKSRIGFVTQDDVLFPHLTVKETLTYAALLRLP  261

Query  641  QSLTREE  661
             +LT+++
Sbjct  262  LTLTKQQ  268



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1063448340092