BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3720

Length=1315
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009612279.1|  PREDICTED: oxygen-evolving enhancer protein ...    590   0.0      Nicotiana tomentosiformis
ref|XP_009768511.1|  PREDICTED: oxygen-evolving enhancer protein ...    586   0.0      Nicotiana sylvestris
gb|AAX53163.1|  chloroplast photosynthetic oxygen-evolving protei...    585   0.0      Nicotiana benthamiana
gb|AFH57997.1|  chloroplast PsbO1 precursor                             583   0.0      Nicotiana benthamiana
gb|AFH57998.1|  chloroplast PsbO2 precursor                             583   0.0      Nicotiana benthamiana
ref|XP_009604683.1|  PREDICTED: oxygen-evolving enhancer protein ...    581   0.0      Nicotiana tomentosiformis
gb|AFH58000.1|  chloroplast PsbO4 precursor                             580   0.0      Nicotiana benthamiana
ref|XP_009759927.1|  PREDICTED: oxygen-evolving enhancer protein ...    580   0.0      Nicotiana sylvestris
ref|XP_012079123.1|  PREDICTED: oxygen-evolving enhancer protein ...    580   0.0      Jatropha curcas
ref|XP_011004600.1|  PREDICTED: oxygen-evolving enhancer protein ...    580   0.0      Populus euphratica
ref|XP_002307234.1|  O2 evolving complex 33kD family protein            578   0.0      Populus trichocarpa [western balsam poplar]
gb|ADZ75466.1|  oxygen evolving enhancer protein 1                      577   0.0      Litchi chinensis [litchi]
gb|ABK96748.1|  unknown                                                 576   0.0      Populus trichocarpa x Populus deltoides
ref|XP_006344816.1|  PREDICTED: oxygen-evolving enhancer protein ...    573   0.0      Solanum tuberosum [potatoes]
ref|XP_004233415.1|  PREDICTED: oxygen-evolving enhancer protein ...    573   0.0      
gb|AFH57999.1|  chloroplast PsbO3 precursor                             573   0.0      Nicotiana benthamiana
ref|XP_002522386.1|  Oxygen-evolving enhancer protein 1, chloropl...    571   0.0      Ricinus communis
ref|XP_002310188.1|  O2 evolving complex 33kD family protein            568   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009379152.1|  PREDICTED: oxygen-evolving enhancer protein ...    568   0.0      Pyrus x bretschneideri [bai li]
ref|XP_008338186.1|  PREDICTED: oxygen-evolving enhancer protein ...    567   0.0      Malus domestica [apple tree]
ref|XP_009376463.1|  PREDICTED: oxygen-evolving enhancer protein ...    567   0.0      Pyrus x bretschneideri [bai li]
ref|XP_011025676.1|  PREDICTED: oxygen-evolving enhancer protein ...    567   0.0      Populus euphratica
ref|XP_002274796.1|  PREDICTED: oxygen-evolving enhancer protein ...    566   0.0      Vitis vinifera
ref|XP_009341905.1|  PREDICTED: oxygen-evolving enhancer protein ...    566   0.0      Pyrus x bretschneideri [bai li]
ref|XP_007047093.1|  Photosystem II subunit O-2                         565   0.0      
ref|XP_006338257.1|  PREDICTED: chloroplast manganese stabilizing...    565   0.0      Solanum tuberosum [potatoes]
ref|XP_008241598.1|  PREDICTED: oxygen-evolving enhancer protein ...    564   0.0      Prunus mume [ume]
gb|AEO21912.1|  chloroplast oxygen-evolving enhancer protein 1          564   0.0      Dimocarpus longan [longan]
sp|P26320.1|PSBO_SOLTU  RecName: Full=Oxygen-evolving enhancer pr...    564   0.0      Solanum tuberosum [potatoes]
ref|XP_009758248.1|  PREDICTED: oxygen-evolving enhancer protein ...    563   0.0      Nicotiana sylvestris
emb|CDP02430.1|  unnamed protein product                                563   0.0      Coffea canephora [robusta coffee]
ref|XP_004232077.1|  PREDICTED: oxygen-evolving enhancer protein ...    562   0.0      
dbj|BAA96365.3|  oxygen evolving enhancer protein 1 precursor           562   0.0      Bruguiera gymnorhiza [Burma mangrove]
ref|XP_007202212.1|  hypothetical protein PRUPE_ppa008420mg             561   0.0      Prunus persica
emb|CAA35601.1|  33kDa precursor protein of oxygen-evolving complex     561   0.0      Solanum tuberosum [potatoes]
ref|NP_001239736.1|  uncharacterized protein LOC100798485               561   0.0      Glycine max [soybeans]
ref|XP_006856169.1|  PREDICTED: oxygen-evolving enhancer protein ...    560   0.0      Amborella trichopoda
ref|XP_010924166.1|  PREDICTED: oxygen-evolving enhancer protein ...    560   0.0      Elaeis guineensis
gb|ADR71223.1|  chloroplast manganese stabilizing protein               558   0.0      Solanum tuberosum [potatoes]
gb|KDO79409.1|  hypothetical protein CISIN_1g019870mg                   558   0.0      Citrus sinensis [apfelsine]
ref|XP_010103689.1|  Oxygen-evolving enhancer protein 1                 558   0.0      Morus notabilis
ref|XP_010028333.1|  PREDICTED: oxygen-evolving enhancer protein ...    558   0.0      Eucalyptus grandis [rose gum]
ref|XP_006425778.1|  hypothetical protein CICLE_v10026034mg             558   0.0      Citrus clementina [clementine]
ref|XP_009412420.1|  PREDICTED: LOW QUALITY PROTEIN: oxygen-evolv...    558   0.0      Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010255017.1|  PREDICTED: oxygen-evolving enhancer protein ...    557   0.0      Nelumbo nucifera [Indian lotus]
gb|KJB43586.1|  hypothetical protein B456_007G208000                    556   0.0      Gossypium raimondii
ref|XP_004300575.1|  PREDICTED: oxygen-evolving enhancer protein ...    556   0.0      Fragaria vesca subsp. vesca
ref|XP_007156865.1|  hypothetical protein PHAVU_002G024000g             555   0.0      Phaseolus vulgaris [French bean]
gb|KHG13438.1|  Oxygen-evolving enhancer 1, chloroplastic               554   0.0      Gossypium arboreum [tree cotton]
ref|XP_011099252.1|  PREDICTED: oxygen-evolving enhancer protein ...    554   0.0      Sesamum indicum [beniseed]
ref|XP_003636084.1|  Oxygen-evolving enhancer protein                   552   0.0      
ref|XP_011085527.1|  PREDICTED: oxygen-evolving enhancer protein ...    552   0.0      Sesamum indicum [beniseed]
ref|NP_001241522.1|  uncharacterized protein LOC100820458               550   0.0      Glycine max [soybeans]
ref|XP_010263833.1|  PREDICTED: oxygen-evolving enhancer protein ...    550   0.0      Nelumbo nucifera [Indian lotus]
ref|XP_010673597.1|  PREDICTED: oxygen-evolving enhancer protein ...    550   0.0      Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001043134.1|  Os01g0501800                                       549   0.0      
ref|NP_001240871.1|  uncharacterized protein LOC100811386               548   0.0      Glycine max [soybeans]
ref|XP_008800919.1|  PREDICTED: oxygen-evolving enhancer protein ...    548   0.0      Phoenix dactylifera
ref|XP_003548008.1|  PREDICTED: oxygen-evolving enhancer protein ...    548   0.0      Glycine max [soybeans]
ref|XP_002283699.1|  PREDICTED: oxygen-evolving enhancer protein ...    547   0.0      Vitis vinifera
ref|XP_010550399.1|  PREDICTED: oxygen-evolving enhancer protein ...    547   0.0      Tarenaya hassleriana [spider flower]
ref|XP_004141946.1|  PREDICTED: oxygen-evolving enhancer protein ...    547   0.0      Cucumis sativus [cucumbers]
ref|XP_007155994.1|  hypothetical protein PHAVU_003G249800g             547   0.0      Phaseolus vulgaris [French bean]
ref|XP_006291313.1|  hypothetical protein CARUB_v10017447mg             548   0.0      
gb|EEC70714.1|  hypothetical protein OsI_02088                          547   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_009103510.1|  PREDICTED: oxygen-evolving enhancer protein ...    546   0.0      Brassica rapa
ref|XP_008440181.1|  PREDICTED: oxygen-evolving enhancer protein ...    546   0.0      Cucumis melo [Oriental melon]
emb|CAN79166.1|  hypothetical protein VITISV_019248                     546   0.0      Vitis vinifera
sp|P14226.1|PSBO_PEA  RecName: Full=Oxygen-evolving enhancer prot...    546   0.0      Pisum sativum [garden pea]
gb|EPS61846.1|  oxygen-evolving enhancer protein 1, chloroplastic       545   0.0      Genlisea aurea
ref|XP_002877774.1|  photosystem II subunit O-2                         545   0.0      Arabidopsis lyrata subsp. lyrata
ref|XP_006280785.1|  hypothetical protein CARUB_v10026754mg             545   0.0      Capsella rubella
ref|XP_009130561.1|  PREDICTED: oxygen-evolving enhancer protein ...    545   0.0      Brassica rapa
ref|XP_006644206.1|  PREDICTED: oxygen-evolving enhancer protein ...    545   0.0      Oryza brachyantha
gb|KFK34331.1|  hypothetical protein AALP_AA5G131000                    544   0.0      Arabis alpina [alpine rockcress]
ref|XP_004968772.1|  PREDICTED: oxygen-evolving enhancer protein ...    544   0.0      Setaria italica
ref|NP_190651.1|  oxygen-evolving enhancer protein 1-2                  544   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004509219.1|  PREDICTED: oxygen-evolving enhancer protein ...    543   0.0      
ref|XP_009616099.1|  PREDICTED: oxygen-evolving enhancer protein ...    543   0.0      
emb|CDY30764.1|  BnaC07g16640D                                          543   0.0      Brassica napus [oilseed rape]
ref|XP_008787656.1|  PREDICTED: oxygen-evolving enhancer protein ...    543   0.0      Phoenix dactylifera
emb|CDX81388.1|  BnaC09g07990D                                          543   0.0      
ref|XP_006393852.1|  hypothetical protein EUTSA_v10004563mg             543   0.0      Eutrema salsugineum [saltwater cress]
ref|XP_009112310.1|  PREDICTED: oxygen-evolving enhancer protein ...    543   0.0      Brassica rapa
ref|XP_006403995.1|  hypothetical protein EUTSA_v10010535mg             543   0.0      Eutrema salsugineum [saltwater cress]
gb|KFK28330.1|  hypothetical protein AALP_AA8G502100                    543   0.0      Arabis alpina [alpine rockcress]
gb|AGV54778.1|  oxygen-evolving enhancer protein 1                      542   0.0      Phaseolus vulgaris [French bean]
ref|XP_010444775.1|  PREDICTED: oxygen-evolving enhancer protein ...    542   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_002866754.1|  oxygen-evolving enhancer 33                        541   0.0      Arabidopsis lyrata subsp. lyrata
gb|AEN02470.1|  oxygen-evolving enhancer protein                        541   0.0      Camellia sinensis [black tea]
ref|XP_003611860.1|  Oxygen evolving enhancer protein                   541   0.0      Medicago truncatula
gb|AAT65501.1|  photosystem II protein                                  541   0.0      Brassica oleracea
emb|CDY50981.1|  BnaC02g48890D                                          540   0.0      Brassica napus [oilseed rape]
gb|AFW69213.1|  oxygen-evolving enhancer protein 1                      541   0.0      
ref|XP_010484624.1|  PREDICTED: oxygen-evolving enhancer protein ...    540   0.0      Camelina sativa [gold-of-pleasure]
ref|NP_001130585.1|  uncharacterized protein LOC100191684               540   0.0      Zea mays [maize]
gb|AAM65169.1|  33 kDa polypeptide of oxygen-evolving complex (OE...    538   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EMS63035.1|  Oxygen-evolving enhancer protein 1, chloroplastic       538   0.0      Triticum urartu
dbj|BAJ89638.1|  predicted protein                                      538   0.0      Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_201458.1|  PS II oxygen-evolving complex 1                       538   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAM96957.1|  33 kDa polypeptide of oxygen-evolving complex (OE...    537   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EYU44326.1|  hypothetical protein MIMGU_mgv1a009768mg                537   0.0      Erythranthe guttata [common monkey flower]
sp|O49079.1|PSBO_FRIAG  RecName: Full=Oxygen-evolving enhancer pr...    536   0.0      Fritillaria agrestis
gb|AAK49614.1|AF372898_1  AT5g66570/K1F13_25                            536   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAL08257.1|  AT5g66570/K1F13_25                                      536   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AFH40666.1|  chloroplast oxygen-evolving enhancer protein 1          535   0.0      Saccharum hybrid cultivar [sugarcane]
ref|XP_008647514.1|  PREDICTED: hypothetical protein isoform X1         535   0.0      
ref|XP_009149414.1|  PREDICTED: oxygen-evolving enhancer protein ...    535   0.0      Brassica rapa
gb|AAK96774.1|  33 kDa polypeptide of oxygen-evolving complex           535   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ABQ52657.1|  chloroplast oxygen-evolving enhancer protein 1          534   0.0      Leymus chinensis
ref|XP_010465252.1|  PREDICTED: oxygen-evolving enhancer protein ...    533   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_010503753.1|  PREDICTED: oxygen-evolving enhancer protein ...    533   0.0      Camelina sativa [gold-of-pleasure]
emb|CAA36675.1|  33 kDa oxygen-evolving protein                         532   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010424899.1|  PREDICTED: oxygen-evolving enhancer protein ...    532   0.0      Camelina sativa [gold-of-pleasure]
sp|P12359.1|PSBO_SPIOL  RecName: Full=Oxygen-evolving enhancer pr...    531   0.0      Spinacia oleracea
emb|CAA29062.1|  unnamed protein product                                531   0.0      Spinacia oleracea
sp|P85194.1|PSBO_HELAN  RecName: Full=Oxygen-evolving enhancer pr...    530   0.0      Helianthus annuus
ref|XP_010515458.1|  PREDICTED: oxygen-evolving enhancer protein ...    529   0.0      Camelina sativa [gold-of-pleasure]
gb|AFK43771.1|  unknown                                                 528   0.0      Lotus japonicus
dbj|BAG70021.1|  33 kDa precursor protein of the oxygen-evolving ...    528   0.0      Salicornia europaea [chicken-claws]
ref|XP_003557544.1|  PREDICTED: oxygen-evolving enhancer protein ...    528   0.0      Brachypodium distachyon [annual false brome]
ref|XP_010557854.1|  PREDICTED: oxygen-evolving enhancer protein ...    525   0.0      Tarenaya hassleriana [spider flower]
ref|XP_010924332.1|  PREDICTED: LOW QUALITY PROTEIN: oxygen-evolv...    523   0.0      Elaeis guineensis
emb|CDY26519.1|  BnaC01g23800D                                          524   0.0      Brassica napus [oilseed rape]
emb|CDY33308.1|  BnaA01g19750D                                          523   0.0      Brassica napus [oilseed rape]
emb|CAN61828.1|  hypothetical protein VITISV_027630                     519   2e-180   Vitis vinifera
gb|KJB43585.1|  hypothetical protein B456_007G208000                    516   1e-179   Gossypium raimondii
ref|XP_002866983.1|  hypothetical protein ARALYDRAFT_328078             515   9e-179   Arabidopsis lyrata subsp. lyrata
ref|XP_010446730.1|  PREDICTED: oxygen-evolving enhancer protein ...    511   2e-177   Camelina sativa [gold-of-pleasure]
ref|XP_010432119.1|  PREDICTED: oxygen-evolving enhancer protein ...    509   1e-176   Camelina sativa [gold-of-pleasure]
sp|P27665.1|PSBO_WHEAT  RecName: Full=Oxygen-evolving enhancer pr...    504   2e-174   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006411950.1|  hypothetical protein EUTSA_v10025711mg             504   2e-174   Eutrema salsugineum [saltwater cress]
gb|ACS34663.1|  chloroplast manganese stabilizing protein-II            494   2e-171   Solanum tuberosum [potatoes]
ref|XP_010446731.1|  PREDICTED: oxygen-evolving enhancer protein ...    496   2e-171   
ref|XP_010432121.1|  PREDICTED: oxygen-evolving enhancer protein ...    494   9e-171   
gb|AJG36442.1|  oxygen-evolving enhancer protein 1                      493   5e-170   Pinus sylvestris [Scotch pine]
emb|CDX72613.1|  BnaC07g46350D                                          489   6e-169   
gb|ACN40581.1|  unknown                                                 483   4e-166   Picea sitchensis
gb|ABK24541.1|  unknown                                                 482   8e-166   Picea sitchensis
gb|ABK23365.1|  unknown                                                 482   9e-166   Picea sitchensis
ref|XP_009138459.1|  PREDICTED: oxygen-evolving enhancer protein ...    481   1e-165   
emb|CDY42709.1|  BnaA03g53620D                                          478   2e-164   Brassica napus [oilseed rape]
gb|KDO79410.1|  hypothetical protein CISIN_1g019870mg                   471   2e-162   Citrus sinensis [apfelsine]
ref|XP_007155995.1|  hypothetical protein PHAVU_003G249800g             463   2e-159   Phaseolus vulgaris [French bean]
prf||2002393A  oxygen-evolving complex protein 1                        459   4e-158   Oryza sativa [red rice]
gb|ABS29557.1|  chloroplast photosynthetic water oxidation comple...    459   5e-158   Morus nigra
prf||1204192A  photosystem II protein 33kD                              451   5e-155   Spinacia oleracea
gb|ADB07372.1|  chloroplast managanese stabilizing protein              439   9e-150   Capsicum annuum
ref|WP_039310940.1|  Photosystem II manganese-stabilizing polypep...    434   2e-148   
gb|KCW55052.1|  hypothetical protein EUGRSUZ_I01025                     430   1e-146   Eucalyptus grandis [rose gum]
ref|XP_003637254.1|  Oxygen-evolving enhancer protein                   427   2e-145   
gb|AEH95324.1|  33 kDa manganese stabilizing chloroplast protein        425   6e-145   Allium cepa
ref|XP_010531775.1|  PREDICTED: oxygen-evolving enhancer protein ...    422   1e-143   Tarenaya hassleriana [spider flower]
ref|NP_001140815.1|  hypothetical protein                               420   5e-143   
gb|ABR17376.1|  unknown                                                 421   6e-142   Picea sitchensis
gb|AFW90569.1|  chloroplast manganese stabilizing protein-II            416   1e-140   Solanum tuberosum [potatoes]
emb|CBI19622.3|  unnamed protein product                                414   4e-140   Vitis vinifera
ref|XP_001756893.1|  predicted protein                                  416   9e-140   
ref|XP_001763258.1|  predicted protein                                  402   2e-134   
ref|XP_001781590.1|  predicted protein                                  401   4e-134   
dbj|BAF94218.1|  33kDa oxygen evolving protein of photosystem II        393   1e-130   Chara braunii
ref|XP_002992987.1|  hypothetical protein SELMODRAFT_187141             390   1e-129   Selaginella moellendorffii
ref|XP_002991827.1|  hypothetical protein SELMODRAFT_272235             387   1e-128   
ref|XP_001784751.1|  predicted protein                                  380   7e-127   
ref|XP_002994513.1|  hypothetical protein SELMODRAFT_138743             376   2e-125   
gb|ABR26062.1|  oxygen-evolving enhancer protein 1                      374   2e-125   Oryza sativa Indica Group [Indian rice]
dbj|BAF94220.1|  33kDa oxygen evolving protein of photosystem II        364   1e-119   Closterium peracerosum-strigosum-littorale complex
gb|ABR26133.1|  oxygen-evolving enhancer protein 1                      330   1e-108   Oryza sativa Indica Group [Indian rice]
dbj|BAF94214.1|  33kDa oxygen evolving protein of photosystem II        335   1e-108   Oedogonium obesum
gb|ACE98011.1|  putative protein                                        330   2e-108   Populus tremula [European aspen]
ref|XP_001422458.1|  psbO, PSII-O, OEE1, photosystem II polypepti...    328   5e-106   Ostreococcus lucimarinus CCE9901
ref|XP_005644574.1|  33kDa oxygen evolving protein of photosystem II    328   1e-105   Coccomyxa subellipsoidea C-169
gb|ABK95838.1|  unknown                                                 322   2e-105   Populus trichocarpa [western balsam poplar]
ref|XP_005843863.1|  hypothetical protein CHLNCDRAFT_32868              325   6e-105   Chlorella variabilis
emb|CEG01950.1|  Photosystem II PsbO, manganese-stabilising             325   1e-104   Ostreococcus tauri
gb|ABA01139.1|  chloroplast oxygen-evolving enhancer protein 1          323   2e-104   Chlamydomonas incerta
gb|AGI15739.1|  collinsiaXIII-like protein                              319   2e-104   Collinsia rattanii
gb|AGI15761.1|  collinsiaXIII-like protein                              318   3e-104   Collinsia linearis
ref|XP_003063851.1|  photosystem II manganese-stabilizing polypep...    323   9e-104   Micromonas pusilla CCMP1545
gb|AGI15756.1|  collinsiaXIII-like protein                              317   1e-103   Collinsia linearis
gb|ACU19823.1|  unknown                                                 315   8e-103   Glycine max [soybeans]
gb|ACJ84218.1|  unknown                                                 314   2e-102   Medicago truncatula
dbj|BAF94213.1|  33kDa oxygen evolving protein of photosystem II        318   3e-102   Hafniomonas montana
gb|ABG25041.1|  33kDa precursor protein of oxygen-evolving complex      314   3e-102   Nicotiana tabacum [American tobacco]
dbj|BAF94217.1|  33kDa oxygen evolving protein of photosystem II        317   4e-102   Nephroselmis olivacea
gb|AGI15742.1|  collinsiaXIII-like protein                              313   4e-102   Collinsia rattanii
ref|XP_001694699.1|  oxygen-evolving enhancer protein 1 of photos...    316   2e-101   Chlamydomonas reinhardtii
sp|P12853.1|PSBO_CHLRE  RecName: Full=Oxygen-evolving enhancer pr...    315   4e-101   Chlamydomonas reinhardtii
gb|ABQ85434.1|  33 kDa OEC protein                                      311   4e-101   Salicornia veneta
gb|AAD38521.1|AF139818_1  33 kDa oxygen evolving protein of photo...    313   2e-100   Brassica napus [oilseed rape]
gb|AFK46831.1|  unknown                                                 309   2e-100   Lotus japonicus
ref|XP_011400268.1|  Oxygen-evolving enhancer protein 1, chloropl...    313   3e-100   Auxenochlorella protothecoides
gb|AGI15740.1|  collinsiaXIII-like protein                              306   1e-99    Collinsia rattanii
ref|XP_002505809.1|  photosystem II manganese-stabilizing polypep...    311   2e-99    Micromonas commoda
dbj|BAF94216.1|  33kDa oxygen evolving protein of photosystem II        310   1e-98    Tetraselmis cordiformis
gb|ABG25040.1|  33kDa precursor protein of oxygen-evolving complex      304   2e-98    Solanum lycopersicum
gb|ACF24544.1|  photosystem II oxygen evolving enhancer protein 1       310   2e-98    Gymnochlora stellata
ref|XP_007513615.1|  predicted protein                                  309   5e-98    Bathycoccus prasinos
ref|XP_002954867.1|  subunit of oxygen evolving complex of photos...    306   2e-97    Volvox carteri f. nagariensis
sp|Q9SBN6.1|PSBO_VOLCA  RecName: Full=Oxygen-evolving enhancer pr...    306   2e-97    Volvox carteri
gb|AGI15762.1|  collinsiaXIII-like protein                              299   8e-97    Collinsia linearis
gb|KIY97139.1|  Oxygen-evolving enhancer protein 1                      303   3e-96    Monoraphidium neglectum
gb|ABV57472.1|  chloroplast PsbO                                        297   6e-96    Phyllostachys edulis [kikko-chiku]
dbj|BAF94212.1|  33kDa oxygen evolving protein of photosystem II        300   1e-94    Chlorarachnion reptans
gb|AAP79149.1|  photosystem II protein PsbO                             300   1e-94    Bigelowiella natans
dbj|BAF94215.1|  33kDa oxygen evolving protein of photosystem II        298   3e-94    Pyramimonas parkeae
gb|AAS55410.1|  photosystem II protein                                  292   5e-93    Brassica rapa
dbj|BAF94219.1|  33kDa oxygen evolving protein of photosystem II        295   8e-93    Bryopsis plumosa
dbj|BAA03529.2|  oxygen-evolving enhancer protein 1 precursor           295   4e-92    Euglena gracilis
sp|P46483.2|PSBO_EUGGR  RecName: Full=Oxygen-evolving enhancer pr...    293   6e-92    Euglena gracilis
emb|CCC15104.1|  33kDa oxygen evolving protein of photosystem II        286   4e-89    Lepidodinium chlorophorum
dbj|BAF94211.1|  33kDa oxygen evolving protein of photosystem II        285   2e-88    Eutreptiella gymnastica
gb|AIS72812.1|  oxygen evolving activity                                275   1e-87    Rhizophora apiculata
gb|ADC54897.1|  oxygen-evolving enhancer protein                        276   2e-86    Cladophora coelothrix
gb|AFK26084.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    265   3e-82    Euglena stellata
gb|AFK26083.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    265   4e-82    Euglena pseudostellata
gb|AFK26085.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    263   1e-81    Monomorphina pyrum
gb|ACT83791.1|  putative photosystem II oxygen evolving system 33...    259   3e-81    Lemna minor
ref|XP_005652213.1|  33kDa oxygen evolving protein of photosystem II    259   2e-79    Coccomyxa subellipsoidea C-169
gb|AFK26079.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    256   6e-79    Cryptoglena skujai
gb|AFK26080.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    256   7e-79    Discoplastis spathirhyncha
gb|AFK26082.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    254   4e-78    Euglena granulata
ref|XP_009387680.1|  PREDICTED: oxygen-evolving enhancer protein ...    251   1e-77    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAR85969.1|  ERT12                                                   248   2e-77    Nicotiana tabacum [American tobacco]
ref|WP_026721744.1|  Photosystem II manganese-stabilizing polypep...    249   1e-75    Hapalosiphonaceae
ref|WP_017720228.1|  Photosystem II manganese-stabilizing polypep...    249   1e-75    Oscillatoria sp. PCC 10802
gb|AFK26081.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    246   5e-75    Euglena archaeoplastidiata
gb|AAR20846.1|  oxygen-evolving enhancer protein 1                      244   5e-75    Pseudochlorella pringsheimii
ref|WP_016860504.1|  Photosystem II manganese-stabilizing polypep...    247   8e-75    Fischerella muscicola
ref|WP_026733494.1|  Photosystem II manganese-stabilizing polypep...    246   2e-74    Fischerella sp. PCC 9605
ref|WP_016865127.1|  Photosystem II manganese-stabilizing polypep...    246   2e-74    Fischerella muscicola
ref|WP_017310215.1|  Photosystem II manganese-stabilizing polypep...    245   6e-74    Fischerella sp. PCC 9339
ref|WP_009456798.1|  MULTISPECIES: photosystem II manganese-stabi...    244   7e-74    Fischerella
ref|WP_045872950.1|  Photosystem II manganese-stabilizing polypep...    243   2e-73    Nostocales
ref|WP_012411115.1|  photosystem II manganese-stabilizing protein...    242   6e-73    Nostoc
ref|WP_015115272.1|  photosystem II manganese-stabilizing protein...    242   8e-73    Nostoc sp. PCC 7107
emb|CAH04962.1|  oxygen-evolving enhancer protein 1                     244   9e-73    Cyanophora paradoxa
ref|WP_017322486.1|  Photosystem II manganese-stabilizing polypep...    241   1e-72    cyanobacterium PCC 7702
ref|WP_016872421.1|  Photosystem II manganese-stabilizing polypep...    240   3e-72    Chlorogloeopsis fritschii
ref|WP_009768009.1|  Manganese-stabilising protein / photosystem ...    240   3e-72    Oscillatoriales cyanobacterium JSC-12
gb|KIE10612.1|  Photosystem II manganese-stabilizing polypeptide        240   5e-72    
ref|WP_039205072.1|  Photosystem II manganese-stabilizing polypep...    239   5e-72    Nostocales
emb|CAA33560.1|  manganese-stabilzing protein (MSP) precursor           239   8e-72    Nostoc sp. PCC 7120
ref|WP_027404713.1|  Photosystem II manganese-stabilizing polypep...    239   9e-72    Aphanizomenon flos-aquae
ref|WP_012625990.1|  photosystem II manganese-stabilizing protein...    239   1e-71    Cyanothece sp. PCC 7425
ref|WP_028090302.1|  Photosystem II manganese-stabilizing polypep...    239   1e-71    Dolichospermum circinale
ref|WP_015204171.1|  photosystem II manganese-stabilizing protein...    238   2e-71    Crinalium epipsammum
ref|WP_017286598.1|  hypothetical protein                               238   2e-71    Leptolyngbya boryana
ref|WP_011318645.1|  photosystem II manganese-stabilizing polypep...    238   2e-71    Trichormus variabilis
ref|WP_017745622.1|  Photosystem II manganese-stabilizing polypep...    238   3e-71    Scytonema hofmannii
ref|WP_010997995.1|  photosystem II manganese-stabilizing polypep...    238   3e-71    Nostocaceae
ref|WP_015117115.1|  Manganese-stabilising protein / photosystem ...    238   3e-71    Rivularia sp. PCC 7116
ref|WP_016949009.1|  Photosystem II manganese-stabilizing polypep...    237   4e-71    Anabaena sp. PCC 7108
dbj|BAJ61705.1|  oxygen-evolving enhancer protein                       238   5e-71    Porphyridium purpureum
ref|WP_015127963.1|  photosystem II manganese-stabilizing protein...    237   8e-71    Calothrix sp. PCC 7507
ref|WP_015209602.1|  Manganese-stabilising protein / photosystem ...    236   8e-71    Cylindrospermum stagnale
ref|WP_017656098.1|  Photosystem II manganese-stabilizing polypep...    236   1e-70    Fortiea contorta
ref|WP_015139796.1|  Manganese-stabilising protein / photosystem ...    236   1e-70    Nostoc sp. PCC 7524
ref|WP_028082855.1|  Photosystem II manganese-stabilizing polypep...    236   1e-70    Dolichospermum circinale
ref|WP_036530244.1|  Photosystem II manganese-stabilizing polypep...    235   3e-70    Neosynechococcus sphagnicola
ref|WP_045053283.1|  Photosystem II manganese-stabilizing polypep...    235   3e-70    Aliterella atlantica
ref|WP_015125988.1|  Manganese-stabilising protein / photosystem ...    235   3e-70    Synechococcus sp. PCC 6312
ref|WP_015187373.1|  photosystem II manganese-stabilizing protein...    234   5e-70    Gloeocapsa sp. PCC 7428
ref|WP_009631953.1|  Manganese-stabilising protein / photosystem ...    234   6e-70    Synechocystis sp. PCC 7509
ref|WP_019494816.1|  Photosystem II manganese-stabilizing polypep...    233   1e-69    Calothrix sp. PCC 7103
ref|WP_015196540.1|  photosystem II manganese-stabilizing protein...    233   1e-69    Calothrix parietina
ref|WP_041036292.1|  Photosystem II manganese-stabilizing polypep...    233   2e-69    Tolypothrix campylonemoides
ref|WP_040939353.1|  Photosystem II manganese-stabilizing polypep...    233   2e-69    
ref|WP_015081475.1|  photosystem II manganese-stabilizing protein...    233   3e-69    Anabaena sp. 90
ref|WP_035997199.1|  Photosystem II manganese-stabilizing polypep...    232   3e-69    [Leptolyngbya] sp. JSC-1
ref|WP_039748810.1|  Photosystem II manganese-stabilizing polypep...    232   4e-69    
ref|WP_009342897.1|  Photosystem II manganese-stabilizing protein...    232   4e-69    Aphanizomenonaceae
ref|WP_017314485.1|  Photosystem II manganese-stabilizing polypep...    231   1e-68    Mastigocladopsis repens
ref|WP_013191007.1|  photosystem II manganese-stabilizing protein...    231   2e-68    Trichormus azollae
ref|WP_029636438.1|  Photosystem II manganese-stabilizing polypep...    230   2e-68    [Scytonema hofmanni] UTEX B 1581
ref|WP_006197397.1|  Photosystem II manganese-stabilizing protein...    230   3e-68    Nodularia spumigena
ref|WP_040929652.1|  Photosystem II manganese-stabilizing polypep...    229   4e-68    
ref|WP_035156929.1|  Photosystem II manganese-stabilizing polypep...    229   4e-68    Calothrix sp. 336/3
ref|WP_024125094.1|  photosystem II manganese-stabilizing protein...    228   1e-67    Thermosynechococcus sp. NK55a
ref|WP_007354116.1|  MULTISPECIES: photosystem II manganese-stabi...    228   2e-67    
ref|WP_037222014.1|  Photosystem II manganese-stabilizing protein...    228   3e-67    
ref|WP_015153476.1|  photosystem II manganese-stabilizing protein...    227   4e-67    
ref|WP_039715746.1|  Photosystem II manganese-stabilizing polypep...    227   4e-67    
dbj|BAJ61706.1|  oxygen-evolving enhancer protein                       228   4e-67    
ref|WP_006278712.1|  Photosystem II manganese-stabilizing protein...    226   6e-67    
ref|WP_015212390.1|  photosystem II manganese-stabilizing protein...    226   7e-67    
pdb|1S5L|O  Chain O, Architecture Of The Photosynthetic Oxygen Ev...    225   1e-66    
sp|D0VWR2.2|PSBO_THEVL  RecName: Full=Photosystem II manganese-st...    225   1e-66    
ref|WP_011056297.1|  photosystem II manganese-stabilizing polypep...    226   1e-66    
pdb|2AXT|O  Chain O, Crystal Structure Of Photosystem Ii From The...    225   1e-66    
ref|WP_008233010.1|  Photosystem II manganese-stabilizing protein...    225   3e-66    
pdb|4PBU|O  Chain O, Serial Time-resolved Crystallography Of Phot...    223   4e-66    
pdb|3A0B|O  Chain O, Crystal Structure Of Br-Substituted Photosys...    223   4e-66    
dbj|BAJ61701.1|  oxygen-evolving enhancer protein                       225   5e-66    
gb|ADC54902.1|  oxygen-evolving enhancer protein                        219   6e-66    
ref|WP_006630984.1|  photosystem II manganese-stabilizing protein...    224   7e-66    
ref|XP_005853586.1|  photosystem II oxygen-evolving enhancer prot...    224   1e-65    
gb|EWM24379.1|  oxygen-evolving enhancer protein                        224   2e-65    
ref|WP_031292620.1|  Photosystem II manganese-stabilizing polypep...    223   2e-65    
ref|WP_022609298.1|  manganese-stabilising protein / photosystem ...    223   2e-65    
gb|ESA36696.1|  photosystem ii manganese-stabilizing protein            222   3e-65    
ref|WP_036480960.1|  Photosystem II manganese-stabilizing polypep...    222   3e-65    
gb|EAZ89921.1|  photosystem II manganese-stabilizing polypeptide        222   5e-65    
gb|AHJ27766.1|  Photosystem II manganese-stabilizing protein (PsbO)     220   6e-65    
ref|WP_035799930.1|  Photosystem II manganese-stabilizing polypep...    221   6e-65    
ref|WP_017662186.1|  hypothetical protein                               221   6e-65    
gb|ABD51936.1|  chloroplast photosystem II 33 kDa oxygen evolving...    223   6e-65    
ref|XP_005824851.1|  hypothetical protein GUITHDRAFT_97111              223   9e-65    
ref|WP_015180190.1|  Manganese-stabilising protein / photosystem ...    221   1e-64    
ref|WP_015219672.1|  photosystem II manganese-stabilizing protein...    221   1e-64    
ref|WP_015161225.1|  Manganese-stabilising protein / photosystem ...    220   1e-64    
emb|CAH25340.1|  oxygen-evolving enhancer                               220   1e-64    
ref|WP_044204234.1|  Photosystem II manganese-stabilizing polypep...    220   2e-64    
dbj|BAJ61702.1|  oxygen-evolving enhancer protein                       222   2e-64    
gb|ABF59672.1|  photosystem II extrinsic protein O                      221   2e-64    
emb|CCQ62588.1|  Photosystem II manganese-stabilizing protein (PsbO)    220   2e-64    
gb|EDX78335.1|  Manganese-stabilizing protein / photosystem II po...    220   2e-64    
ref|WP_015175499.1|  photosystem II manganese-stabilizing protein...    220   2e-64    
ref|WP_007304841.1|  Manganese-stabilizing protein/photosystem II...    219   3e-64    
ref|XP_005761454.1|  oxygen-evolving enhancer protein 1 of photos...    221   3e-64    
ref|WP_042156912.1|  Photosystem II manganese-stabilizing polypep...    219   4e-64    
gb|KEI69285.1|  PsbO                                                    219   4e-64    
ref|WP_027841041.1|  Photosystem II manganese-stabilizing polypep...    219   4e-64    
gb|KJB43587.1|  hypothetical protein B456_007G208000                    218   7e-64    
gb|KIJ84318.1|  Photosystem II manganese-stabilizing polypeptide        218   8e-64    
ref|WP_018399127.1|  hypothetical protein                               218   9e-64    
ref|WP_026787255.1|  MULTISPECIES: Photosystem II manganese-stabi...    218   9e-64    
dbj|BAQ64588.1|  photosystem II manganese-stabilizing protein PsbO      218   9e-64    
gb|EKD06931.1|  photosystem II manganese-stabilizing protein PsbO       218   1e-63    
ref|WP_006616815.1|  MULTISPECIES: photosystem II manganese-stabi...    218   1e-63    
dbj|BAJ61711.1|  oxygen-evolving enhancer protein                       219   1e-63    
ref|WP_016922728.1|  hypothetical protein                               218   2e-63    
ref|WP_015192867.1|  photosystem II manganese-stabilizing protein...    217   3e-63    
ref|WP_039726071.1|  MULTISPECIES: Photosystem II manganese-stabi...    217   4e-63    
ref|WP_019506429.1|  hypothetical protein                               216   4e-63    
gb|ADC54900.1|  oxygen-evolving enhancer protein                        212   5e-63    
ref|WP_006518063.1|  Manganese-stabilising protein / photosystem ...    216   5e-63    
ref|XP_005713751.1|  Plastid oxygen-evolving enhancer 1                 215   6e-63    
dbj|BAQ62960.1|  photosystem II manganese-stabilizing protein PsbO      216   1e-62    
gb|AAM77466.1|  oxygen evolving enhancer 1 precursor                    216   2e-62    
gb|AAF13997.1|  photosystem II manganese stabilizing protein            214   2e-62    
ref|WP_015170887.1|  photosystem II manganese-stabilizing protein...    214   3e-62    
ref|WP_009544738.1|  MULTISPECIES: photosystem II manganese-stabi...    214   4e-62    
ref|WP_015956866.1|  photosystem II manganese-stabilizing protein...    214   4e-62    
ref|WP_015151496.1|  Manganese-stabilising protein / photosystem ...    213   6e-62    
ref|WP_015142403.1|  Manganese-stabilising protein / photosystem ...    213   6e-62    
ref|WP_015133089.1|  photosystem II manganese-stabilizing protein...    213   7e-62    
ref|XP_002180309.1|  oxygen-evolving enhancer protein 1 precursor       214   8e-62    
gb|AAO43192.1|  oxygen-evolving enhancer protein 1 precursor            214   9e-62    
ref|WP_015230300.1|  Manganese-stabilising protein / photosystem ...    213   9e-62    
dbj|BAJ61707.1|  oxygen-evolving enhancer protein                       215   1e-61    
gb|ABF73017.1|  oxygen-enhancer 1 protein precursor                     214   2e-61    
gb|AAM77464.1|  oxygen evolving enhancer 1 precursor                    213   2e-61    
dbj|BAF94210.1|  33kDa oxygen evolving protein of photosystem II        213   2e-61    
dbj|BAJ61709.1|  oxygen-evolving enhancer protein                       213   3e-61    
ref|WP_015785306.1|  MULTISPECIES: photosystem II manganese-stabi...    211   3e-61    
ref|WP_044259457.1|  Photosystem II manganese-stabilizing protein...    209   4e-61    
ref|XP_005536430.1|  manganese-stabilzing protein precursor             213   4e-61    
dbj|BAJ61704.1|  oxygen-evolving enhancer protein                       212   7e-61    
dbj|BAJ61710.1|  oxygen-evolving enhancer protein                       212   9e-61    
ref|WP_015223075.1|  photosystem II manganese-stabilizing protein...    210   1e-60    
ref|WP_008313000.1|  Manganese-stabilising protein / photosystem ...    210   2e-60    
dbj|BAG85210.1|  extrinsic protein in photosystem II                    211   2e-60    
ref|WP_017293645.1|  hypothetical protein                               209   3e-60    
ref|WP_024544659.1|  Photosystem II manganese-stabilizing polypep...    209   4e-60    
ref|WP_026072511.1|  Photosystem II manganese-stabilizing protein...    208   5e-60    
ref|WP_023065168.1|  photosystem II manganese-stabilizing polypep...    209   5e-60    
ref|WP_030006064.1|  Photosystem II manganese-stabilizing polypep...    208   5e-60    
ref|WP_006529097.1|  Manganese-stabilising protein / photosystem ...    208   6e-60    
ref|XP_005706438.1|  photosystem II PsbO protein                        211   6e-60    
ref|WP_008186133.1|  manganese-stabilising protein/ photosystem I...    208   7e-60    
emb|CCH65457.1|  Photosystem II manganese-stabilizing protein (PsbO)    206   8e-60    
ref|WP_009783095.1|  Photosystem II manganese-stabilizing protein...    207   1e-59    
ref|WP_013323533.1|  photosystem II manganese-stabilizing protein...    207   2e-59    
gb|AAN11311.1|  oxygen-evolving enhancer 1                              208   2e-59    
gb|AIR09396.1|  psbO                                                    202   2e-59    
ref|WP_002791059.1|  Photosystem II manganese-stabilizing polypep...    206   3e-59    
ref|WP_012305903.1|  photosystem II manganese stabilizing protein...    206   3e-59    
ref|WP_035985606.1|  hypothetical protein                               206   3e-59    
ref|WP_002800587.1|  Photosystem II manganese-stabilizing polypep...    206   4e-59    
ref|WP_012161181.1|  photosystem II manganese-stabilizing protein...    206   4e-59    
ref|WP_002773425.1|  Photosystem II manganese-stabilizing polypep...    206   5e-59    
ref|WP_002761031.1|  Photosystem II manganese-stabilizing polypep...    206   5e-59    
ref|WP_041596665.1|  Photosystem II manganese-stabilizing polypep...    206   5e-59    
ref|WP_004160298.1|  Photosystem II manganese-stabilizing polypep...    206   5e-59    
gb|AFZ44849.1|  photosystem II manganese-stabilizing protein PsbO       206   6e-59    
ref|WP_004162736.1|  Photosystem II manganese-stabilizing polypep...    205   9e-59    
ref|WP_008199011.1|  Photosystem II manganese-stabilizing polypep...    205   1e-58    
ref|WP_010478151.1|  photosystem II manganese-stabilizing protein       204   1e-58    
ref|WP_033373963.1|  Photosystem II manganese-stabilizing polypep...    205   1e-58    
gb|AAW33887.1|  plastid oxygen-evolving enhancer 1-2 precursor          206   2e-58    
ref|WP_002738218.1|  photosystem II manganese-stabilizing polypep...    204   2e-58    
ref|WP_002741980.1|  photosystem II manganese-stabilizing polypep...    204   2e-58    
gb|AAW33888.1|  plastid oxygen-evolving enhancer 1 precursor            206   3e-58    
ref|WP_006510630.1|  Manganese-stabilising protein / photosystem ...    203   6e-58    
gb|AAM77465.1|  oxygen evolving enhancer 1 precursor                    205   6e-58    
ref|WP_011613279.1|  photosystem II manganese-stabilizing protein...    202   8e-58    
gb|AIE75688.1|  Photosystem II manganese-stabilizing protein (PsbO)     201   2e-57    
ref|WP_028946996.1|  Photosystem II manganese-stabilizing polypep...    201   2e-57    
ref|WP_006456861.1|  Manganese-stabilizing protein / photosystem ...    201   3e-57    
ref|WP_011243530.1|  MULTISPECIES: photosystem II manganese-stabi...    200   9e-57    
ref|WP_036486652.1|  Photosystem II manganese-stabilizing polypep...    199   3e-56    
gb|EJK75097.1|  hypothetical protein THAOC_03193                        198   3e-56    
gb|ADC54905.1|  oxygen-evolving enhancer protein                        194   5e-56    
ref|WP_010873097.1|  photosystem II manganese-stabilizing polypep...    197   6e-56    
gb|AGL79736.1|  chloroplast oxygen-evolving enhancer                    199   1e-55    
gb|AGL79735.1|  chloroplast oxygen-evolving enhancer                    199   1e-55    
ref|XP_002291225.1|  oxygen-evolving enhancer protein 1 precursor       198   1e-55    
gb|ADC54906.1|  oxygen-evolving enhancer protein                        192   1e-55    
ref|WP_019500685.1|  hypothetical protein                               194   1e-54    
ref|WP_015167227.1|  Manganese-stabilising protein / photosystem ...    194   3e-54    
dbj|BAJ61703.1|  oxygen-evolving enhancer protein                       194   4e-54    
ref|XP_009033884.1|  hypothetical protein AURANDRAFT_69678              194   4e-54    
gb|ADC54890.1|  oxygen-evolving enhancer protein                        188   5e-54    
gb|ADC54904.1|  oxygen-evolving enhancer protein                        187   1e-53    
emb|CBN78902.1|  manganese stabilising protein                          193   1e-53    
gb|ADC54903.1|  oxygen-evolving enhancer protein                        187   3e-53    
ref|WP_025782239.1|  Photosystem II manganese-stabilizing polypep...    190   4e-53    
gb|ADC54913.1|  oxygen-evolving enhancer protein                        184   2e-52    
gb|ADC54901.1|  oxygen-evolving enhancer protein                        184   3e-52    
gb|ADC54894.1|  oxygen-evolving enhancer protein                        183   3e-52    
ref|WP_035832498.1|  Photosystem II manganese-stabilizing polypep...    187   4e-52    
gb|ADC54893.1|  oxygen-evolving enhancer protein                        183   5e-52    
gb|ADC54908.1|  oxygen-evolving enhancer protein                        182   2e-51    
ref|XP_005847917.1|  hypothetical protein CHLNCDRAFT_22722              185   3e-51    
gb|ADC54912.1|  oxygen-evolving enhancer protein                        181   4e-51    
gb|ADC54907.1|  oxygen-evolving enhancer protein                        180   4e-51    
ref|WP_010311944.1|  photosystem II manganese-stabilizing protein       182   4e-50    
ref|WP_015165708.1|  photosystem II manganese-stabilizing protein...    182   7e-50    
gb|ADC54898.1|  oxygen-evolving enhancer protein                        177   1e-49    
ref|WP_015109468.1|  Manganese-stabilising protein / photosystem ...    181   1e-49    
gb|EDX87597.1|  Manganese-stabilizing protein / photosystem II po...    181   2e-49    
ref|WP_043737375.1|  Photosystem II manganese-stabilizing polypep...    181   2e-49    
ref|WP_038016162.1|  Photosystem II manganese-stabilizing polypep...    181   2e-49    
dbj|BAJ61708.1|  oxygen-evolving enhancer protein                       177   2e-49    
ref|WP_006172331.1|  photosystem II manganese-stabilizing polypep...    180   3e-49    
emb|CAK29098.1|  Photosystem II manganese-stabilizing protein PsbO      180   3e-49    
gb|ADC54891.1|  oxygen-evolving enhancer protein                        176   3e-49    
ref|YP_002049183.1|  Photosystem II manganese-stabilizing polypep...    178   2e-48    
ref|WP_007099801.1|  photosystem II manganese-stabilizing polypep...    178   2e-48    
gb|ABH09263.1|  photosystem II manganese-stabilizing protein            178   2e-48    
ref|WP_006042289.1|  photosystem II manganese-stabilizing polypep...    177   5e-48    
ref|WP_011618325.1|  photosystem II manganese-stabilizing protein       176   8e-48    
ref|WP_009628648.1|  photosystem II manganese-stabilizing protein...    176   1e-47    
ref|WP_007100705.1|  photosystem II manganese-stabilizing polypep...    176   1e-47    
ref|WP_038542990.1|  Photosystem II manganese-stabilizing polypep...    174   4e-47    
ref|WP_006909436.1|  photosystem II manganese-stabilizing protein       174   4e-47    
ref|WP_010314562.1|  photosystem II manganese-stabilizing protein       174   5e-47    
gb|ADC54896.1|  oxygen-evolving enhancer protein                        169   1e-46    
ref|WP_006853634.1|  photosystem II manganese-stabilizing protein...    173   2e-46    
gb|ADC54899.1|  oxygen-evolving enhancer protein                        168   2e-46    
ref|WP_028953543.1|  Photosystem II manganese-stabilizing polypep...    172   3e-46    
gb|ACF28703.1|  oxygen evolving complex protein variant                 169   4e-46    
ref|WP_011127177.1|  photosystem II manganese-stabilizing polypep...    171   1e-45    
ref|WP_011932278.1|  photosystem II manganese-stabilizing protein...    170   2e-45    
gb|ADC54895.1|  oxygen-evolving enhancer protein                        165   2e-45    
gb|ADC54911.1|  oxygen-evolving enhancer protein                        164   4e-45    
gb|ADC54909.1|  oxygen-evolving enhancer protein                        164   5e-45    
ref|WP_006850980.1|  photosystem II manganese-stabilizing polypep...    168   1e-44    
ref|WP_009788842.1|  photosystem II manganese-stabilizing polypep...    167   2e-44    
gb|ADD94884.1|  photosystem II manganese stabilizing polypeptide        167   2e-44    
ref|WP_011363327.1|  photosystem II manganese-stabilizing polypep...    167   2e-44    
ref|WP_043694690.1|  Photosystem II manganese-stabilizing polypep...    167   2e-44    
emb|CCI69514.1|  oxygen-evolving enhancer protein                       164   2e-44    
ref|WP_038551339.1|  Photosystem II manganese-stabilizing polypep...    166   5e-44    
ref|WP_011360791.1|  photosystem II manganese-stabilizing polypep...    165   9e-44    
gb|ACF95815.1|  oxygen evolving enhancer protein 1                      162   1e-43    
gb|ADC54910.1|  oxygen-evolving enhancer protein                        157   1e-42    
gb|AEW08532.1|  hypothetical protein CL304Contig1_01                    156   1e-42    
gb|AFB34200.1|  hypothetical protein CL304Contig1_01                    155   2e-42    
ref|XP_004243178.1|  PREDICTED: oxygen-evolving enhancer protein ...    157   1e-41    
gb|ADC54892.1|  oxygen-evolving enhancer protein                        152   2e-40    
emb|CCI69513.1|  oxygen-evolving enhancer protein                       152   2e-40    
ref|WP_002806175.1|  photosystem II manganese-stabilizing protein       151   1e-38    
ref|WP_019474069.1|  MULTISPECIES: Photosystem II manganese-stabi...    151   2e-38    
gb|ABV49867.1|  Photosystem II manganese-stabilizing protein            151   2e-38    
ref|WP_026032523.1|  Photosystem II manganese-stabilizing polypep...    149   5e-38    
ref|WP_041484654.1|  Photosystem II manganese-stabilizing polypep...    149   9e-38    
ref|WP_026032868.1|  Photosystem II manganese-stabilizing polypep...    149   1e-37    
gb|ABO16873.1|  Photosystem II manganese-stabilizing protein            149   1e-37    
ref|WP_025952314.1|  Photosystem II manganese-stabilizing polypep...    148   2e-37    
ref|WP_025937984.1|  Photosystem II manganese-stabilizing polypep...    148   2e-37    
ref|WP_025979193.1|  MULTISPECIES: Photosystem II manganese-stabi...    148   2e-37    
ref|WP_025890347.1|  MULTISPECIES: Photosystem II manganese-stabi...    148   2e-37    
ref|WP_025925905.1|  Photosystem II manganese-stabilizing polypep...    148   2e-37    
gb|ABM69537.1|  Photosystem II manganese-stabilizing protein            148   2e-37    
ref|WP_042849726.1|  Photosystem II manganese-stabilizing polypep...    148   2e-37    
ref|WP_011375796.1|  photosystem II manganese-stabilizing protein       147   2e-37    
ref|WP_025945629.1|  MULTISPECIES: Photosystem II manganese-stabi...    147   3e-37    
ref|WP_025956454.1|  Photosystem II manganese-stabilizing polypep...    147   3e-37    
ref|WP_025892535.1|  MULTISPECIES: Photosystem II manganese-stabi...    147   3e-37    
ref|WP_025942737.1|  MULTISPECIES: Photosystem II manganese-stabi...    147   4e-37    
ref|WP_025955147.1|  MULTISPECIES: Photosystem II manganese-stabi...    147   4e-37    
ref|WP_025921390.1|  Photosystem II manganese-stabilizing polypep...    147   4e-37    
ref|WP_036906171.1|  Photosystem II manganese-stabilizing polypep...    147   6e-37    
ref|WP_032527523.1|  Photosystem II manganese-stabilizing polypep...    147   6e-37    
ref|WP_011294230.1|  photosystem II manganese-stabilizing protein       147   6e-37    
ref|WP_038651072.1|  Photosystem II manganese-stabilizing polypep...    146   8e-37    
ref|WP_025914084.1|  Photosystem II manganese-stabilizing polypep...    146   8e-37    
ref|WP_025941252.1|  Photosystem II manganese-stabilizing polypep...    146   1e-36    



>ref|XP_009612279.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana tomentosiformis]
 sp|Q40459.1|PSBO_TOBAC RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA45701.1| 33 kDa polypeptide of water-oxidizing complex of photosystem 
II [Nicotiana tabacum]
Length=332

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/332 (87%), Positives = 311/332 (94%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ AATLMQPTKVGV P       RS Q+V KA GV+P+ AR+TCSLQ+++K+LA 
Sbjct  1     MAASLQAAATLMQPTKVGVAPARNNLQLRSAQSVSKAFGVEPAAARLTCSLQTELKDLAQ  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              F+DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KFTDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             V +FAFKPGKY+AKKFCLEPTSFTVKAESV+KNAPP+FQ TKLMTRLTYTLDEIEGPFEV
Sbjct  121   VASFAFKPGKYNAKKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             SSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGEFLVPSYRGSS
Sbjct  181   SSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN +SSTGKIT SVT SKPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTSSSTGKITLSVTQSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  301   GVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE  332



>ref|XP_009768511.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana sylvestris]
 gb|AAP03871.1| oxygen evolving complex 33 kDa photosystem II protein [Nicotiana 
tabacum]
Length=332

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/332 (86%), Positives = 309/332 (93%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ AATLMQPTKVGV P       RS Q+V KA GV+P+ AR+TCSLQ+++K+LA 
Sbjct  1     MAASLQAAATLMQPTKVGVAPARNNLQLRSAQSVSKAFGVEPAAARLTCSLQTELKDLAQ  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61    KCTDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             V +FAFKPGKY+AKKFCLEPTSFTVKAESV+KNAPP+FQ TKLMTRLTYTLDEIEGPFEV
Sbjct  121   VASFAFKPGKYNAKKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             SSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGEFLVPSYRGSS
Sbjct  181   SSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN+KN ASSTGKIT SVT  KPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENVKNTASSTGKITLSVTQCKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  301   GVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE  332



>gb|AAX53163.1| chloroplast photosynthetic oxygen-evolving protein 33 kDa subunit 
[Nicotiana benthamiana]
Length=332

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/332 (86%), Positives = 309/332 (93%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ AATLMQPTKVGV P       RS Q+V KA GV+P+ AR+TCSLQ+++K+LA 
Sbjct  1     MAASLQAAATLMQPTKVGVAPARNNLQLRSAQSVSKAFGVEPAAARLTCSLQTELKDLAQ  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61    KCTDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             V +FAFKPGKY+A KFCLEPTSFTVKAESV+KNAPP+FQ TKLMTRLTYTLDEIEGPFEV
Sbjct  121   VASFAFKPGKYNANKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             SSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGEFLVPSYRGSS
Sbjct  181   SSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN+KN ASSTGKIT SVT SKP+TGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENVKNTASSTGKITLSVTQSKPQTGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  301   GVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE  332



>gb|AFH57997.1| chloroplast PsbO1 precursor [Nicotiana benthamiana]
Length=332

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/332 (86%), Positives = 308/332 (93%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MA SLQ AATLMQPTKVGV P       RS Q+V KA GV+P+ AR+TCSLQ+++K+LA 
Sbjct  1     MAVSLQAAATLMQPTKVGVAPARNNLQLRSAQSVCKAFGVEPAAARLTCSLQTELKDLAQ  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               +DAAK+AGFALATSAL+VSGANAEG PKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61    KCTDAAKVAGFALATSALVVSGANAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             V +FAFKPGKY+AKKFCLEPTSFTVKAESV+KNAPP+FQ TKLMTRLTYTLDEIEGPFEV
Sbjct  121   VASFAFKPGKYNAKKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             SSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGEFLVPSYRGSS
Sbjct  181   SSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN+KN ASSTGKIT SVT SKPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENVKNTASSTGKITLSVTQSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  301   GVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE  332



>gb|AFH57998.1| chloroplast PsbO2 precursor [Nicotiana benthamiana]
Length=332

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/332 (86%), Positives = 308/332 (93%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MA SLQ AATLMQPTKVGV P       RS Q+V KA GV+P+ AR+TCSLQ+++K+LA 
Sbjct  1     MATSLQAAATLMQPTKVGVAPARNNLQLRSAQSVSKAFGVEPAAARLTCSLQTELKDLAQ  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61    KCTDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             V +FAFKPGKY+A KFCLEPTSFTVKAESV+KNAPP+FQ TKLMTRLTYTLDEIEGPFEV
Sbjct  121   VASFAFKPGKYNANKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             SSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGEFLVPSYRGSS
Sbjct  181   SSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN+KN ASSTGKIT SVT SKP+TGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENVKNTASSTGKITLSVTQSKPQTGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  301   GVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE  332



>ref|XP_009604683.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=332

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/332 (86%), Positives = 308/332 (93%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ AATLMQPTKVGV         RS Q+V KA GV+P+ A++TCSLQS +K+LA 
Sbjct  1     MAASLQAAATLMQPTKVGVVSARNNLQLRSSQSVSKAFGVEPAAAKLTCSLQSDLKDLAQ  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               +DAAK+AGFALATSAL++SGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KCTDAAKIAGFALATSALVISGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             VE+FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEV
Sbjct  121   VESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             S DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEFLVPSYRGSS
Sbjct  181   SPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN +SSTGKIT SVT SKPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTSSSTGKITLSVTQSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  301   GVFESIQPSDTDLGAKVPKDVKIQGIWYAQLD  332



>gb|AFH58000.1| chloroplast PsbO4 precursor [Nicotiana benthamiana]
Length=333

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/332 (86%), Positives = 307/332 (92%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ AATLMQPTKVGV         R  Q+V KA GV+P+ AR+TCSLQS +K+LA 
Sbjct  1     MAASLQAAATLMQPTKVGVVSARNNLQLRLSQSVSKAFGVEPAAARLTCSLQSDLKDLAQ  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               +DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KCTDAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             VE+FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEV
Sbjct  121   VESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             S DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEFLVPSYRGSS
Sbjct  181   SPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN+KN ASSTGKIT SVT SKPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENVKNTASSTGKITLSVTQSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  301   GVFESIQPSDTDLGAKVPKDVKIQGIWYAQLD  332



>ref|XP_009759927.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=333

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/332 (86%), Positives = 308/332 (93%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ AATLMQPTKVGV         RS Q++ KA GV+P+ AR+TCSLQS +K+LA 
Sbjct  1     MAASLQAAATLMQPTKVGVVSARNNLQLRSSQSLSKAFGVEPAAARLTCSLQSDLKDLAQ  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               +DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KCTDAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             V++FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEV
Sbjct  121   VDSFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             S DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEFLVPSYRGSS
Sbjct  181   SPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN+KN ASSTGKIT SVT SKPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENVKNTASSTGKITLSVTRSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  301   GVFESIQPSDTDLGAKVPKDVKIQGIWYAQLD  332



>ref|XP_012079123.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Jatropha curcas]
 gb|KDP31833.1| hypothetical protein JCGZ_12294 [Jatropha curcas]
Length=332

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/331 (87%), Positives = 304/331 (92%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MAASLQ AATLMQPTKVGV  RI    RS Q V KA G++PS ARI+CSLQS +K+LA  
Sbjct  1     MAASLQAAATLMQPTKVGVPSRISLQLRSSQNVSKAFGLEPSTARISCSLQSDLKDLAQK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
               DA K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGGV
Sbjct  61    CVDATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGV  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             + FA KPGKY+AKKFCLEPTSFTVKAE VSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV+
Sbjct  121   DKFAIKPGKYNAKKFCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVA  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
              DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSG+FLVPSYRGSSF
Sbjct  181   PDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGQFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KNV SSTGKIT SVTGSKPETGEVIG
Sbjct  241   LDPKGRGGSTGYDNAVALPAGGRGDEEELAKENNKNVGSSTGKITLSVTGSKPETGEVIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  301   VFESVQPSDTDLGAKTPKDVKIQGIWYAQLE  331



>ref|XP_011004600.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Populus euphratica]
Length=331

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/331 (86%), Positives = 306/331 (92%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MAASLQ AATLMQPTKVGV  R     RS Q+V KA G++P+ ARI+CSLQS +K+LA  
Sbjct  1     MAASLQAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGLEPASARISCSLQSDLKDLAQK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
               DA+K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKGSGTANQCPT++GG 
Sbjct  61    CVDASKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGSGTANQCPTLDGGA  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             E+FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  121   ESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
              DG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQL A+GKPESFSGEFLVPSYRGSSF
Sbjct  181   PDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLTASGKPESFSGEFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN ASSTGKIT SVT SKPETGE+IG
Sbjct  241   LDPKGRGGSTGYDNAVALPAGGRGDEEELLKENIKNTASSTGKITLSVTKSKPETGEIIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFESLQPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  301   VFESLQPSDTDLGAKTPKDVKIQGIWYAQLD  331



>ref|XP_002307234.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
 gb|ABK95762.1| unknown [Populus trichocarpa]
 gb|ABK96188.1| unknown [Populus trichocarpa]
 gb|EEE94230.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
Length=331

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/331 (86%), Positives = 305/331 (92%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MAASLQ AATLMQPTKVGV  R     RS Q+V KA G +P+ ARI+CSLQS +K+LA  
Sbjct  1     MAASLQAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGFEPASARISCSLQSDLKDLARK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
               DA+K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKGSGTANQCPT++GG 
Sbjct  61    CVDASKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGSGTANQCPTLDGGA  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             E+FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  121   ESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
              DG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQL A+GKPESFSGEFLVPSYRGSSF
Sbjct  181   PDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLAASGKPESFSGEFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN ASSTGKIT SVT SKPETGE+IG
Sbjct  241   LDPKGRGGSTGYDNAVALPAGGRGDEEELLKENIKNTASSTGKITLSVTKSKPETGEIIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFESLQPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  301   VFESLQPSDTDLGAKTPKDVKIQGIWYAQLD  331



>gb|ADZ75466.1| oxygen evolving enhancer protein 1 [Litchi chinensis]
Length=333

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/332 (86%), Positives = 303/332 (91%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ AATLMQPTKVGV+P       RS Q+V KA GVD +  RITCSLQS  K++A 
Sbjct  1     MAASLQAAATLMQPTKVGVSPARSTVQLRSSQSVSKAFGVDSAGGRITCSLQSDFKDMAQ  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
                DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61    KCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             V++FAFKPGKY AKK CLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   VDSFAFKPGKYQAKKLCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             SSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF G+FLVPSYRG+S
Sbjct  181   SSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGQFLVPSYRGTS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN +SSTGKIT SVT +KPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENIKNASSSTGKITLSVTKTKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFESLQPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  301   GVFESLQPSDTDLGAKVPKDVKIQGIWYAQLE  332



>gb|ABK96748.1| unknown [Populus trichocarpa x Populus deltoides]
Length=331

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/331 (85%), Positives = 304/331 (92%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MAASLQ AATLMQPTKVGV  R     RS Q+V KA G +P+ ARI+CSLQS +K+LA  
Sbjct  1     MAASLQAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGFEPASARISCSLQSDLKDLAQK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
               DA+K+AGFALATSAL+ SGA+AEGVPKRLT+DEIQSKTYMEVKGSGTANQCPT++GG 
Sbjct  61    CVDASKIAGFALATSALIASGASAEGVPKRLTYDEIQSKTYMEVKGSGTANQCPTLDGGA  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             E+FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  121   ESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
              DG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQL A+GKPE+FSGEFLVPSYRG+SF
Sbjct  181   PDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLAASGKPENFSGEFLVPSYRGTSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN ASSTGKIT SVT SKPETGE+IG
Sbjct  241   LDPKGRGGSTGYDNAVALPAGGRGDEEELLKENIKNTASSTGKITLSVTKSKPETGEIIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFESLQPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  301   VFESLQPSDTDLGAKTPKDVKIQGIWYAQLE  331



>ref|XP_006344816.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum tuberosum]
Length=329

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/329 (86%), Positives = 303/329 (92%), Gaps = 1/329 (0%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  229
             MAASLQ AATLMQPTKVG    +  RS Q+V KA GV+   AR+TCSLQ++IKELA   +
Sbjct  1     MAASLQAAATLMQPTKVGARNNLQLRSVQSVSKAFGVEQGSARLTCSLQTEIKELAQKCT  60

Query  230   DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
             DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV +
Sbjct  61    DAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGS  120

Query  410   FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
             FAFKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEVS D
Sbjct  121   FAFKPGKYTAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPD  180

Query  590   GSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLD  769
             G+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGEFLVPSYRGSSFLD
Sbjct  181   GTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEFLVPSYRGSSFLD  240

Query  770   PKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVF  949
             PKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN AS TGKIT SVT SKPETGEVIGVF
Sbjct  241   PKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTASLTGKITLSVTQSKPETGEVIGVF  300

Query  950   ESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             ES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  301   ESIQPSDTDLGAKVPKDVKIQGIWYAQLE  329



>ref|XP_004233415.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum lycopersicum]
 sp|P23322.2|PSBO_SOLLC RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Solanum lycopersicum]
 emb|CAA78043.1| 33kDa precursor protein of oxygen-evolving complex [Solanum lycopersicum]
 prf||2001459A O2 evolving protein complex:SUBUNIT=33kD
Length=329

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/329 (86%), Positives = 303/329 (92%), Gaps = 1/329 (0%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  229
             MAASLQ AATLMQPTKVGV   +  RS Q+V KA GV+    R+TCSLQ++IKELA   +
Sbjct  1     MAASLQAAATLMQPTKVGVRNNLQLRSAQSVSKAFGVEQGSGRLTCSLQTEIKELAQKCT  60

Query  230   DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
             DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV +
Sbjct  61    DAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGS  120

Query  410   FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
             FAFKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEVS D
Sbjct  121   FAFKPGKYTAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPD  180

Query  590   GSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLD  769
             G+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGEFLVPSYRGSSFLD
Sbjct  181   GTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEFLVPSYRGSSFLD  240

Query  770   PKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVF  949
             PKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN AS TGKIT SVT SKPETGEVIGVF
Sbjct  241   PKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTASLTGKITLSVTQSKPETGEVIGVF  300

Query  950   ESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             ES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  301   ESIQPSDTDLGAKVPKDVKIQGIWYAQLE  329



>gb|AFH57999.1| chloroplast PsbO3 precursor [Nicotiana benthamiana]
Length=333

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/332 (85%), Positives = 303/332 (91%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ AATLMQPTKVGV         RS Q V KA GV+P+ AR+ CS QS +K+LA 
Sbjct  1     MAASLQAAATLMQPTKVGVVSARNNLQLRSSQCVSKAFGVEPAAARLNCSFQSDLKDLAQ  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               +DA K+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KCTDAVKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             VE+FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEV
Sbjct  121   VESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             S DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEFLVPSYRGSS
Sbjct  181   SPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGST YDNAVALPAGGRGDEEEL+KEN+KN AS+TGKIT SVT SKPETGEVI
Sbjct  241   FLDPKGRGGSTVYDNAVALPAGGRGDEEELEKENVKNTASATGKITLSVTQSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  301   GVFESIQPSDTDLGAKVPKDVKIQGIWYAQLD  332



>ref|XP_002522386.1| Oxygen-evolving enhancer protein 1, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF40070.1| Oxygen-evolving enhancer protein 1, chloroplast precursor, putative 
[Ricinus communis]
Length=334

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/333 (85%), Positives = 302/333 (91%), Gaps = 5/333 (2%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG-----RSYQTVGKALGVDPSPARITCSLQSQIKELA  217
             MAASLQ AATLMQPTKVG  P        RS Q+V KA G++P+ ARITCSLQS +K+LA
Sbjct  1     MAASLQAAATLMQPTKVGGVPSSRATLQLRSSQSVSKAFGLEPASARITCSLQSDLKDLA  60

Query  218   HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
                 DA K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61    QKCVDATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  398   GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
             G++ F+FK GKY+AKKFCLEPTSFTVKAESV+KNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121   GLDKFSFKAGKYNAKKFCLEPTSFTVKAESVNKNAPPEFQNTKLMTRLTYTLDEIEGPFE  180

Query  578   VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGS  757
             V  DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGS
Sbjct  181   VGPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGS  240

Query  758   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEV  937
             SFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN ASS GKIT SVTGSKPETGE+
Sbjct  241   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENTKNAASSVGKITLSVTGSKPETGEI  300

Query  938   IGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             IGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  301   IGVFESVQPSDTDLGAKTPKDVKIQGIWYAQLE  333



>ref|XP_002310188.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
 gb|ABK95579.1| unknown [Populus trichocarpa]
 gb|ABK96112.1| unknown [Populus trichocarpa]
 gb|ABK96443.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE90638.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
Length=332

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/331 (83%), Positives = 306/331 (92%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MAASLQ AATLMQPTKVGV  R     RS Q+V KA G++P+ ARI+CSLQS +K+LA  
Sbjct  1     MAASLQAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGLEPASARISCSLQSDLKDLAQK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
               DA+K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKGSGTANQCPTI+GG+
Sbjct  61    CVDASKIAGFALATSALVVSGASAEGVPKRLTYEEIQSKTYMEVKGSGTANQCPTIDGGL  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             ++FAFKPGKY+AKK CLEPTSFTVKAE ++KN+PP+FQ TKLMTRLTYTLDEIEGPFEVS
Sbjct  121   DSFAFKPGKYNAKKICLEPTSFTVKAEGINKNSPPDFQKTKLMTRLTYTLDEIEGPFEVS  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
             SDG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSG+FLVPSYRGSSF
Sbjct  181   SDGNIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGDFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN ASSTGKIT SVT SKPETGEVIG
Sbjct  241   LDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKNTASSTGKITLSVTKSKPETGEVIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  301   VFESVQPSDTDLGAKTPKDVKIQGIWYAQLD  331



>ref|XP_009379152.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Pyrus x bretschneideri]
Length=332

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/332 (84%), Positives = 304/332 (92%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  220
             MAASLQ AATLMQPTKVGV+ R     RS Q+V KA G++PS  AR+TCSLQS +K+LAH
Sbjct  1     MAASLQAAATLMQPTKVGVSARTSVQLRSSQSVSKAFGLEPSASARLTCSLQSDLKDLAH  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
                DA+K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61    KCLDASKIAGFALATSALVVSGAGAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              E FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   SEAFAFKPGKYTAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             + DG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPE+F+GEFLVPSYRGSS
Sbjct  181   APDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFTGEFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN A+S GKIT SVT +KPETGE+I
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENTKNTAASKGKITLSVTKTKPETGELI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFESLQPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  301   GVFESLQPSDTDLGAKTPKDVKIQGIWYAQLD  332



>ref|XP_008338186.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Malus domestica]
Length=332

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/332 (84%), Positives = 304/332 (92%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  220
             MAASLQ AATLMQPTKVGV+ R     RS Q+V KA G++PS  AR+TCSLQS +K+LAH
Sbjct  1     MAASLQAAATLMQPTKVGVSARTSVQLRSSQSVSKAFGLEPSASARLTCSLQSDLKDLAH  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
                DA+K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61    KCLDASKIAGFALATSALVVSGAGAEGSPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              E FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   TEAFAFKPGKYTAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             + DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP++F+GEFLVPSYRGSS
Sbjct  181   APDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDNFTGEFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN A+STGKIT SVT SKPE GE+I
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENTKNTAASTGKITLSVTKSKPENGELI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFES+QPSDTDLGAK PK+VKIQG+WYAQL+
Sbjct  301   GVFESIQPSDTDLGAKTPKDVKIQGVWYAQLD  332



>ref|XP_009376463.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Pyrus x bretschneideri]
Length=332

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/332 (84%), Positives = 305/332 (92%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  220
             MAASLQ AATLMQPTKVGV+ R     RS Q+V KA G++PS  AR+TCSLQS +K+LAH
Sbjct  1     MAASLQAAATLMQPTKVGVSARTSVQLRSSQSVSKAFGLEPSASARLTCSLQSDLKDLAH  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
                DA+K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61    KCLDASKIAGFALATSALVVSGAGAEGSPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              E FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   SEAFAFKPGKYTAKKFCLEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             + DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPE+F+GEFLVPSYRGSS
Sbjct  181   APDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFTGEFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN A+S+GKIT SVT SKPETGE+I
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENTKNTAASSGKITLSVTKSKPETGELI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFES+QPSDTDLGAK PK+VKIQG+WYAQL+
Sbjct  301   GVFESIQPSDTDLGAKTPKDVKIQGVWYAQLD  332



>ref|XP_011025676.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Populus euphratica]
Length=332

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/331 (83%), Positives = 305/331 (92%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MAASLQ AATLMQPTKVGV  R     RS Q+V KA G++P+ ARI+CSLQS +K+LA  
Sbjct  1     MAASLQAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGLEPASARISCSLQSDLKDLAQK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
               DA+K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKGSGTANQCPTI+GG+
Sbjct  61    CVDASKIAGFALATSALVVSGASAEGVPKRLTYEEIQSKTYMEVKGSGTANQCPTIDGGL  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             ++FAFKPGKY+AKK CLEPTSFTVKAE ++KN+PP+FQ TKLMTRLTYTLDEIEGPFEVS
Sbjct  121   DSFAFKPGKYNAKKICLEPTSFTVKAEGINKNSPPDFQKTKLMTRLTYTLDEIEGPFEVS  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
             SDG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SF GEFLVPSYRGSSF
Sbjct  181   SDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFGGEFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN ASSTGKIT SVT SKPETGEVIG
Sbjct  241   LDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKNTASSTGKITLSVTKSKPETGEVIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  301   VFESVQPSDTDLGAKTPKDVKIQGIWYAQLD  331



>ref|XP_002274796.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Vitis vinifera]
Length=332

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/331 (84%), Positives = 300/331 (91%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MAASLQ AATLMQPTKVGV  R     RS Q+V KA G++P+ AR TCSLQ+ +K+LAH 
Sbjct  1     MAASLQAAATLMQPTKVGVPTRTSLQLRSSQSVCKAFGLEPAGARFTCSLQADLKDLAHK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
               DA K+AGFALATSALLVSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61    CVDATKIAGFALATSALLVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             ++FAFK GKY  KKFCLEPTSFTVKAE VSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  121   DSFAFKSGKYQLKKFCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
             SDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+ F GEFLVPSYRGSSF
Sbjct  181   SDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDKFGGEFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL+KENIK+ +SSTGKIT SVT SKPETGEVIG
Sbjct  241   LDPKGRGGSTGYDNAVALPAGGRGDEEELKKENIKDASSSTGKITLSVTKSKPETGEVIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFES+QPSDTDLGAK PKEVKIQG WY QLE
Sbjct  301   VFESIQPSDTDLGAKTPKEVKIQGFWYGQLE  331



>ref|XP_009341905.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009341920.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=332

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/332 (83%), Positives = 305/332 (92%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  220
             MAASLQ AATLMQPTKVGV+ R     RS Q+V KA G++PS  AR+TCSLQS +K+LAH
Sbjct  1     MAASLQAAATLMQPTKVGVSARTSVQLRSSQSVSKAFGLEPSASARLTCSLQSDLKDLAH  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
                DA+K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61    KCLDASKIAGFALATSALVVSGAGAEGSPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              E FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLD+IEGPFEV
Sbjct  121   SEAFAFKPGKYTAKKFCLEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDQIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             + DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPE+F+GEFLVPSYRGSS
Sbjct  181   APDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFTGEFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN A+S+GKIT SVT SKPETGE+I
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENTKNTAASSGKITLSVTKSKPETGELI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFES+QPSDTDLGAK PK+VKIQG+WYAQL+
Sbjct  301   GVFESIQPSDTDLGAKTPKDVKIQGVWYAQLD  332



>ref|XP_007047093.1| Photosystem II subunit O-2 [Theobroma cacao]
 gb|EOX91250.1| Photosystem II subunit O-2 [Theobroma cacao]
Length=332

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/331 (84%), Positives = 303/331 (92%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MAASLQ AATLMQPTKVGV  R     RS Q+V KA G++P  AR+TCSLQS +K+LA  
Sbjct  1     MAASLQAAATLMQPTKVGVPSRTSVQLRSSQSVSKAFGLEPVGARLTCSLQSDLKDLAQK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
               DA K+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61    CVDATKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             ++FAFKPGKY AKKFCLEPTSFTVKAE VSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS
Sbjct  121   DSFAFKPGKYYAKKFCLEPTSFTVKAEGVSKNAPPEFQRTKLMTRLTYTLDEIEGPFEVS  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
             +DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF G+FLVPSYRGSSF
Sbjct  181   TDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGDFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEE+L KEN K+VASS+GKIT SVT ++PETGEVIG
Sbjct  241   LDPKGRGGSTGYDNAVALPAGGRGDEEDLAKENNKSVASSSGKITLSVTKTRPETGEVIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFESLQPSDTDLG+KAPK+VKI GIWYAQL+
Sbjct  301   VFESLQPSDTDLGSKAPKDVKITGIWYAQLD  331



>ref|XP_006338257.1| PREDICTED: chloroplast manganese stabilizing protein-II [Solanum 
tuberosum]
Length=333

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/332 (83%), Positives = 305/332 (92%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ AATLMQPTKVG V+ R     RS Q+V KA G++PS +R++CSLQ+ +K+ A 
Sbjct  1     MAASLQAAATLMQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQ  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KCTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             V++FAFK GKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEV
Sbjct  121   VDSFAFKSGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             S DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSG+FLVPSYRGSS
Sbjct  181   SPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGDFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN AS TGKITF+VT S P+TGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTASLTGKITFTVTKSNPQTGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  301   GVFESIQPSDTDLGAKTPKDVKIQGIWYAQLE  332



>ref|XP_008241598.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Prunus mume]
Length=332

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/332 (83%), Positives = 303/332 (91%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPR---IGRSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  220
             MAASLQ AATLMQPTKVG   R   + RS Q V KA G++PS  AR+TCSLQS +K+ AH
Sbjct  1     MAASLQAAATLMQPTKVGAPARTSLLLRSSQNVSKAFGLEPSASARLTCSLQSDLKDFAH  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
                DA+K+AGFALATSAL+VSGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61    KCVDASKIAGFALATSALVVSGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             +E FAFKPGKY+AKKFCLEPTSFTVKAESV+KNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   LEAFAFKPGKYTAKKFCLEPTSFTVKAESVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             S DG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPE+F GEFLVPSYRGSS
Sbjct  181   SPDGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNA+ALPAGGRGDEEEL KENIKN ASS GKIT SVT SKPE+GE+I
Sbjct  241   FLDPKGRGGSTGYDNAIALPAGGRGDEEELAKENIKNTASSKGKITLSVTKSKPESGELI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFES+QPSDTDLGAK PK+VKIQG+WYAQL+
Sbjct  301   GVFESIQPSDTDLGAKTPKDVKIQGVWYAQLD  332



>gb|AEO21912.1| chloroplast oxygen-evolving enhancer protein 1 [Dimocarpus longan]
Length=333

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/332 (83%), Positives = 299/332 (90%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ AATLMQPTKVGV+P       RS+Q+V KA G D +  RITCSLQ   K+LA 
Sbjct  1     MAASLQAAATLMQPTKVGVSPARSTVQLRSFQSVSKAFGADSAGGRITCSLQPDFKDLAQ  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               +DA K+AGFALAT AL+VSGA AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61    KCADATKIAGFALATPALVVSGAGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             V++FAFKPGKY AKKFCLEPTSFTVKAE V+KN+PPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   VDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNSPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             SSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVA+GKPESF G+FLVPSYRG+S
Sbjct  181   SSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVASGKPESFGGQFLVPSYRGTS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN +SSTGKIT SVT SKPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENIKNASSSTGKITLSVTKSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFES QPSDTDLGAK  K+VKIQGIWYAQL+
Sbjct  301   GVFESFQPSDTDLGAKVAKDVKIQGIWYAQLD  332



>sp|P26320.1|PSBO_SOLTU RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Solanum tuberosum]
Length=333

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/332 (83%), Positives = 305/332 (92%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ AATLMQPTKVG V+ R     RS Q+V KA G++PS +R++CSLQ+ +K+ A 
Sbjct  1     MAASLQAAATLMQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQ  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KCTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             V++FAFKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEV
Sbjct  121   VDSFAFKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             S DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFS +FLVPSYRGSS
Sbjct  181   SPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSVDFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN AS TGKITF+VT S P+TGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTASLTGKITFTVTKSNPQTGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  301   GVFESIQPSDTDLGAKTPKDVKIQGIWYAQLE  332



>ref|XP_009758248.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=328

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/332 (84%), Positives = 298/332 (90%), Gaps = 9/332 (3%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ AATL     +GV P       RS   V KA GV+PS AR+TCSLQ+  K+LA 
Sbjct  1     MAASLQAAATL-----IGVIPSRNNLQFRSSHCVSKAFGVEPSSARLTCSLQADFKDLAQ  55

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               SDAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  56    KCSDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  115

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             VE FAFKPGKY+AKKFCLEPTSFTVKAE V+KN+PPEFQ TKLMTRLTYTLDEIEGPFEV
Sbjct  116   VETFAFKPGKYNAKKFCLEPTSFTVKAEGVNKNSPPEFQKTKLMTRLTYTLDEIEGPFEV  175

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             SSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQL A GKPESFSGEFLVPSYRGSS
Sbjct  176   SSDGNVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLAANGKPESFSGEFLVPSYRGSS  235

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN+KN +SSTGKIT SVT SKPETGEVI
Sbjct  236   FLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENVKNTSSSTGKITLSVTNSKPETGEVI  295

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  296   GVFESIQPSDTDLGAKVPKDVKIQGIWYAQLD  327



>emb|CDP02430.1| unnamed protein product [Coffea canephora]
Length=331

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/331 (83%), Positives = 303/331 (92%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPR---IGRSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MAASLQ AATLMQP KVGV PR   + RS   + KA GV+ S AR+TCSLQ+ +K+LA  
Sbjct  1     MAASLQAAATLMQPAKVGVAPRNNVLLRSSPNLSKAFGVEQSSARLTCSLQADLKDLAQK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              +DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTI+GGV
Sbjct  61    CTDAAKVAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIDGGV  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             + FAFKPGKY AKK CLEPTSFTVKAE  +KN+PPEFQ TKLMTRLTYTLDEIEGPFEV+
Sbjct  121   DKFAFKPGKYDAKKLCLEPTSFTVKAEGPNKNSPPEFQKTKLMTRLTYTLDEIEGPFEVN  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
             +DG++KF EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGEFLVPSYRGSSF
Sbjct  181   TDGTIKFVEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYD+AVALPAGGRGDEEEL KENIKNV+SS+GKIT SVT SKPETGEVIG
Sbjct  241   LDPKGRGGSTGYDSAVALPAGGRGDEEELVKENIKNVSSSSGKITLSVTKSKPETGEVIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFES+QPSDTDLG+KAPKEVKIQGIWYAQLE
Sbjct  301   VFESVQPSDTDLGSKAPKEVKIQGIWYAQLE  331



>ref|XP_004232077.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum lycopersicum]
Length=333

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/332 (83%), Positives = 306/332 (92%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ AATLMQPTKVG V+ R     RS Q++ KA G++PS ++++CSLQ+ +K+ A 
Sbjct  1     MAASLQAAATLMQPTKVGGVSARNNLPLRSAQSLSKAFGLEPSASKLSCSLQADLKDFAQ  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KCTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             V++F+FKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEV
Sbjct  121   VDSFSFKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             S DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSG+FLVPSYRGSS
Sbjct  181   SPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGDFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN AS TGKITF+VT S P+TGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTASLTGKITFTVTKSNPQTGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  301   GVFESIQPSDTDLGAKTPKDVKIQGIWYAQLE  332



>dbj|BAA96365.3| oxygen evolving enhancer protein 1 precursor [Bruguiera gymnorhiza]
Length=332

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/331 (83%), Positives = 298/331 (90%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MAASLQ AATLMQP KVGV  R G   RS Q V +A G++P+ ARITCS Q+  K+LA  
Sbjct  1     MAASLQAAATLMQPAKVGVPSRTGLQLRSSQIVSRAFGLEPAAARITCSSQTDFKDLAQK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
               DA K+AGFALATSAL+VSGA AEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTIEGGV
Sbjct  61    CVDATKIAGFALATSALVVSGAGAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIEGGV  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             ++FAFKPGKY+ KK CLEPTSFTVKAE V+KNAPPEFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  121   DSFAFKPGKYNVKKLCLEPTSFTVKAEGVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
              DG+VKF EKDGIDYAAVTVQLPGGERVPFLFT+KQLVATGKPESFSGE+LVPSYRGSSF
Sbjct  181   PDGTVKFVEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPESFSGEYLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGY+NAVALPAGGRGDEEEL KENIKN +SSTGKIT  VT SKPETGEVIG
Sbjct  241   LDPKGRGGSTGYBNAVALPAGGRGDEEELTKENIKNTSSSTGKITLGVTKSKPETGEVIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFESLQPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  301   VFESLQPSDTDLGAKVPKDVKIQGIWYAQLD  331



>ref|XP_007202212.1| hypothetical protein PRUPE_ppa008420mg [Prunus persica]
 gb|EMJ03411.1| hypothetical protein PRUPE_ppa008420mg [Prunus persica]
Length=332

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/332 (83%), Positives = 301/332 (91%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  220
             MAASLQ AATLMQPTKVG   R     R  Q V KA G++PS  AR+TCSLQS +K+ AH
Sbjct  1     MAASLQAAATLMQPTKVGAPARTSLQLRPSQNVSKAFGLEPSASARLTCSLQSDLKDFAH  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
                DA+K+AGFALATSAL+VSGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61    KCVDASKIAGFALATSALVVSGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             +E FAFKPGKY+AKKFCLEPTSFTVKAESV+KNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   LEAFAFKPGKYTAKKFCLEPTSFTVKAESVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             S DG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPE+F GEFLVPSYRGSS
Sbjct  181   SPDGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNA+ALPAGGRGDEEEL KENIKN ASS GKIT SVT SKPE+GE+I
Sbjct  241   FLDPKGRGGSTGYDNAIALPAGGRGDEEELAKENIKNTASSKGKITLSVTKSKPESGELI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFES+QPSDTDLGAK PK+VKIQG+WYAQL+
Sbjct  301   GVFESIQPSDTDLGAKTPKDVKIQGVWYAQLD  332



>emb|CAA35601.1| 33kDa precursor protein of oxygen-evolving complex [Solanum tuberosum]
Length=332

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/331 (83%), Positives = 304/331 (92%), Gaps = 4/331 (1%)
 Frame = +2

Query  56    AASLQTAATLMQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             AASLQ AATLMQPTKVG V+ R     RS Q+V KA G++PS +R++CSLQ+ +K+ A  
Sbjct  1     AASLQAAATLMQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61    CTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             ++FAFKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEVS
Sbjct  121   DSFAFKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVS  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
              DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFS +FLVPSYRGSSF
Sbjct  181   PDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSVDFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN AS TGKITF+VT S P+TGEVIG
Sbjct  241   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTASLTGKITFTVTKSNPQTGEVIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  301   VFESIQPSDTDLGAKTPKDVKIQGIWYAQLE  331



>ref|NP_001239736.1| uncharacterized protein LOC100798485 [Glycine max]
 gb|ACU19444.1| unknown [Glycine max]
 gb|KHN42036.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=329

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/328 (83%), Positives = 300/328 (91%), Gaps = 0/328 (0%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
             MAASLQ AAT MQPTKVG+  R  +S Q + KA G++P+ A++TCSLQ  +KE A    D
Sbjct  1     MAASLQAAATFMQPTKVGIASRNLKSTQCISKAFGLEPAAAKLTCSLQPDLKEFAQKCVD  60

Query  233   AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
             A K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTIEGGV++F
Sbjct  61    ATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIEGGVDSF  120

Query  413   AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
             AFKPGKY+A+K CLEPTSFTVKAE V+KNAPPEFQNTKLMTRLTYTLDEIEGPFEV+SDG
Sbjct  121   AFKPGKYNAQKLCLEPTSFTVKAEGVAKNAPPEFQNTKLMTRLTYTLDEIEGPFEVTSDG  180

Query  593   SVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDP  772
             +VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEFLVPSYRGSSFLDP
Sbjct  181   TVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEFLVPSYRGSSFLDP  240

Query  773   KGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFE  952
             KGRG STGYDNAVALPAGGRGDEEEL KEN K+ +SS GKIT SVT +KPETGEVIGVFE
Sbjct  241   KGRGASTGYDNAVALPAGGRGDEEELAKENNKSASSSKGKITLSVTKTKPETGEVIGVFE  300

Query  953   SLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             S+QPSDTDLGAKAPK+VKIQGIWYAQL+
Sbjct  301   SVQPSDTDLGAKAPKDVKIQGIWYAQLD  328



>ref|XP_006856169.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Amborella trichopoda]
 gb|ERN17636.1| hypothetical protein AMTR_s00059p00176390 [Amborella trichopoda]
Length=331

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/331 (82%), Positives = 298/331 (90%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MAASLQ AATLMQPTK+G + R G   RS   + KA G +PS AR+TCS+Q  ++ELAH 
Sbjct  1     MAASLQAAATLMQPTKLGGSSRNGLQLRSSSQICKAFGFEPSSARLTCSIQEDLRELAHK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
               DA KLAGFALATSAL+V+GANAEGVPKRLT+DEIQSKTY EVKG+GTANQCP I+GGV
Sbjct  61    CVDATKLAGFALATSALVVAGANAEGVPKRLTYDEIQSKTYTEVKGTGTANQCPAIDGGV  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             + FAFKPGKY+ KKFCLEPTSFTVKAES++KNAPPEFQ TKLMTRLTYTLDEIEGPFEVS
Sbjct  121   DKFAFKPGKYNMKKFCLEPTSFTVKAESINKNAPPEFQKTKLMTRLTYTLDEIEGPFEVS  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
              DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPE F G+FLVPSYRGSSF
Sbjct  181   PDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPERFGGQFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNA+ALPAGGRGD+EELQKENIKN ASSTG IT SVT SKPE+GEVIG
Sbjct  241   LDPKGRGGSTGYDNAIALPAGGRGDDEELQKENIKNTASSTGNITLSVTKSKPESGEVIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  301   VFESIQPSDTDLGAKTPKDVKIQGIWYAQLE  331



>ref|XP_010924166.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Elaeis guineensis]
Length=334

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/333 (83%), Positives = 299/333 (90%), Gaps = 5/333 (2%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRI--GRSYQT---VGKALGVDPSPARITCSLQSQIKELA  217
             MAASLQ AATLMQP KVG T R   G+  +T   + KA G +P+ AR+TCSLQS +++LA
Sbjct  1     MAASLQAAATLMQPAKVGATGRTLAGQQLRTSSHLSKAFGFEPAGARLTCSLQSDLRDLA  60

Query  218   HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
             H  +DA KLAGFALATSAL+V+GANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEG
Sbjct  61    HKCADATKLAGFALATSALVVAGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEG  120

Query  398   GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
             GV++FAFKPGKY  KK CLEPTSFTVKAE VSKNAPPEFQ TKLMTRLTYTLDEIEGPFE
Sbjct  121   GVDSFAFKPGKYQMKKLCLEPTSFTVKAEGVSKNAPPEFQKTKLMTRLTYTLDEIEGPFE  180

Query  578   VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGS  757
             VS +GSV FEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF G+FLVPSYRGS
Sbjct  181   VSPNGSVTFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGQFLVPSYRGS  240

Query  758   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEV  937
             SFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN +SSTG IT SVT SKPE+GEV
Sbjct  241   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKNTSSSTGSITLSVTKSKPESGEV  300

Query  938   IGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             IGVFES+QPSDTDLGAK PKEVKIQGIWYAQLE
Sbjct  301   IGVFESVQPSDTDLGAKTPKEVKIQGIWYAQLE  333



>gb|ADR71223.1| chloroplast manganese stabilizing protein [Solanum tuberosum]
Length=321

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/320 (86%), Positives = 295/320 (92%), Gaps = 1/320 (0%)
 Frame = +2

Query  74    AATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAG  250
             AATLMQPTKVG    +  RS Q+V KA GV+   AR+TCSLQ++IKELA   +DAAK+AG
Sbjct  2     AATLMQPTKVGARNNLQLRSVQSVSKAFGVEQGSARLTCSLQTEIKELAQKCTDAAKIAG  61

Query  251   FALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGK  430
             FALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV +FAFKPGK
Sbjct  62    FALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGSFAFKPGK  121

Query  431   YSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEE  610
             Y+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEE
Sbjct  122   YTAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEE  181

Query  611   KDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGS  790
             KDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGEFLVPSYRGSSFLDPKGRGGS
Sbjct  182   KDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEFLVPSYRGSSFLDPKGRGGS  241

Query  791   TGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSD  970
             TGYDNAVALPAGGRGDEEELQKEN+KN AS TGKIT SVT SKPETGEVIGVFES+QPSD
Sbjct  242   TGYDNAVALPAGGRGDEEELQKENVKNTASLTGKITLSVTQSKPETGEVIGVFESIQPSD  301

Query  971   TDLGAKAPKEVKIQGIWYAQ  1030
             TDLGAK PK+VKIQGIWYAQ
Sbjct  302   TDLGAKVPKDVKIQGIWYAQ  321



>gb|KDO79409.1| hypothetical protein CISIN_1g019870mg [Citrus sinensis]
Length=334

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/333 (83%), Positives = 302/333 (91%), Gaps = 5/333 (2%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPARITCSLQSQIKELA  217
             MAASLQ AATLMQPTKVGV P        RS Q+V KA GVD + ARI+CSL + +K+LA
Sbjct  1     MAASLQAAATLMQPTKVGVVPARSSSLQLRSSQSVSKAFGVDSAGARISCSLNNDLKDLA  60

Query  218   HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
                 DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61    QKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  398   GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
             GV++FAFKPGKY AKKFCLEPTSFTVKAESV+KNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121   GVDSFAFKPGKYQAKKFCLEPTSFTVKAESVNKNAPPDFQNTKLMTRLTYTLDEIEGPFE  180

Query  578   VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGS  757
             VS DG++KF EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPE+F GEFLVPSYRGS
Sbjct  181   VSPDGTIKFVEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGS  240

Query  758   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEV  937
             SFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L KENIKN +SSTGKIT SVT SKPETGEV
Sbjct  241   SFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEV  300

Query  938   IGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             IGVFESLQPSDTD+GAK PK+VKIQGIWYAQLE
Sbjct  301   IGVFESLQPSDTDMGAKVPKDVKIQGIWYAQLE  333



>ref|XP_010103689.1| Oxygen-evolving enhancer protein 1 [Morus notabilis]
 gb|EXB96701.1| Oxygen-evolving enhancer protein 1 [Morus notabilis]
Length=333

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/334 (84%), Positives = 302/334 (90%), Gaps = 8/334 (2%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG------RSYQTVGKALGVDPSPARITCSLQSQIKEL  214
             MAASLQTAATL   TKVG+  R G      RS Q V KA GV+P+ AR+TCSLQS  K+L
Sbjct  1     MAASLQTAATLT--TKVGMPARGGGGSLQLRSAQAVSKAFGVEPAGARLTCSLQSDFKDL  58

Query  215   AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  394
             A    DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTI+
Sbjct  59    AQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTID  118

Query  395   GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPF  574
             GGV++FAFK GKY+ KK CLEPTSFTVKAESV+KNAPPEFQNTKLMTRLTYTLDEIEGPF
Sbjct  119   GGVDSFAFKAGKYNVKKLCLEPTSFTVKAESVNKNAPPEFQNTKLMTRLTYTLDEIEGPF  178

Query  575   EVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRG  754
             EV++DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGEFLVPSYRG
Sbjct  179   EVANDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEFLVPSYRG  238

Query  755   SSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGE  934
             SSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN ASSTGKIT SVT SKPETGE
Sbjct  239   SSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKNTASSTGKITLSVTKSKPETGE  298

Query  935   VIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VIGVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  299   VIGVFESVQPSDTDLGAKTPKDVKIQGIWYAQLD  332



>ref|XP_010028333.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55051.1| hypothetical protein EUGRSUZ_I01025 [Eucalyptus grandis]
Length=331

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/330 (83%), Positives = 302/330 (92%), Gaps = 2/330 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVG-VTPRIGRSYQTVGKALGVDP-SPARITCSLQSQIKELAHNF  226
             MAASLQ AATLMQPTKVG ++    RS Q V K  G++  + +R+TCSLQ+ +K+LA   
Sbjct  1     MAASLQAAATLMQPTKVGRISSSQLRSSQNVSKTFGLECGAGSRVTCSLQADLKDLAQKC  60

Query  227   SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  406
             +DA K+AGFALATSAL+VSGA AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG++
Sbjct  61    ADATKIAGFALATSALVVSGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGLD  120

Query  407   NFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSS  586
             +FAFKPGKY+AKK CLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS 
Sbjct  121   SFAFKPGKYNAKKICLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSP  180

Query  587   DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFL  766
             DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGEFLVPSYRGSSFL
Sbjct  181   DGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEFLVPSYRGSSFL  240

Query  767   DPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGV  946
             DPKGRGGSTGYDNAVALPAGGRGDEE+L KENIKN +SSTGKIT SVT +KPETGEVIGV
Sbjct  241   DPKGRGGSTGYDNAVALPAGGRGDEEDLTKENIKNASSSTGKITLSVTKTKPETGEVIGV  300

Query  947   FESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             FES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  301   FESVQPSDTDLGAKVPKDVKIQGVWYAQLE  330



>ref|XP_006425778.1| hypothetical protein CICLE_v10026034mg [Citrus clementina]
 ref|XP_006466690.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Citrus sinensis]
 gb|ESR39018.1| hypothetical protein CICLE_v10026034mg [Citrus clementina]
Length=334

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/333 (83%), Positives = 302/333 (91%), Gaps = 5/333 (2%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPARITCSLQSQIKELA  217
             MAASLQ AATLMQPTKVGV P        RS Q+V KA GVD + ARI+C+L + +K+LA
Sbjct  1     MAASLQAAATLMQPTKVGVVPARSSSLQLRSSQSVSKAFGVDSAGARISCTLNNDLKDLA  60

Query  218   HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
                 DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61    QKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  398   GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
             GV++FAFKPGKY AKKFCLEPTSFTVKAESV+KNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121   GVDSFAFKPGKYQAKKFCLEPTSFTVKAESVNKNAPPDFQNTKLMTRLTYTLDEIEGPFE  180

Query  578   VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGS  757
             VS DG++KF EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPE+F GEFLVPSYRGS
Sbjct  181   VSPDGTIKFVEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGS  240

Query  758   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEV  937
             SFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L KENIKN +SSTGKIT SVT SKPETGEV
Sbjct  241   SFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEV  300

Query  938   IGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             IGVFESLQPSDTD+GAK PK+VKIQGIWYAQLE
Sbjct  301   IGVFESLQPSDTDMGAKVPKDVKIQGIWYAQLE  333



>ref|XP_009412420.1| PREDICTED: LOW QUALITY PROTEIN: oxygen-evolving enhancer protein 
1, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=340

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/339 (83%), Positives = 305/339 (90%), Gaps = 11/339 (3%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPR-IG----RSYQTVGKALGVDPSPARITCSLQSQIKELA  217
             MAASLQ AATLMQP+KVGV  R IG    RS   + +A G +P+ AR+TCSLQS +++LA
Sbjct  1     MAASLQAAATLMQPSKVGVASRSIGGQQLRSGSHLSRAFGFEPTTARLTCSLQSDLRDLA  60

Query  218   HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
             H  SDAAKLAGFALATSAL+V+GA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61    HKCSDAAKLAGFALATSALVVAGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  398   GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
             GV++FAFKPGKY+AKKFCLEPTSFTVKAE VSKNAP EFQ TKLMTRLTYTLDEIEGPFE
Sbjct  121   GVDSFAFKPGKYNAKKFCLEPTSFTVKAEGVSKNAPAEFQRTKLMTRLTYTLDEIEGPFE  180

Query  578   VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGS  757
             VS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSG+FLVPSYRGS
Sbjct  181   VSPDGAVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGKFLVPSYRGS  240

Query  758   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN------VASSTGKITFSVTGSK  919
             SFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN       +SSTG IT SVT SK
Sbjct  241   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENIKNXXXXXXXSSSTGSITLSVTKSK  300

Query  920   PETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             PETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  301   PETGEVIGVFESLQPSDTDLGAKTPKDVKIQGVWYAQLE  339



>ref|XP_010255017.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nelumbo nucifera]
Length=332

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/331 (82%), Positives = 301/331 (91%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MAASLQ AATLMQPTKVGV+ R G   RS Q+V KA G + S AR+TCSLQS +K+ A  
Sbjct  1     MAASLQAAATLMQPTKVGVSSRSGQQLRSSQSVCKAFGFETSGARLTCSLQSDLKDFAQK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
               DA+K+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGG+
Sbjct  61    CVDASKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGI  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             ++F FK GKY+ KKFCLEPTSFTVKAE VSKN+PPEFQ TKLMTRLTYTLDEIEGPFEVS
Sbjct  121   DSFGFKSGKYNMKKFCLEPTSFTVKAEGVSKNSPPEFQKTKLMTRLTYTLDEIEGPFEVS  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
             +DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPE+F G+FLVPSYRGSSF
Sbjct  181   TDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFGGQFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIK+ +SSTG I+ SVT SKPE+GEVIG
Sbjct  241   LDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKDPSSSTGTISLSVTKSKPESGEVIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFES+QPSDTDLGAK PK+VKIQGIWYA+LE
Sbjct  301   VFESIQPSDTDLGAKTPKDVKIQGIWYAKLE  331



>gb|KJB43586.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=332

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/331 (82%), Positives = 298/331 (90%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MA SLQ AATLMQP KV    R     RS Q+V KA G++P  AR+TCSLQ+ +K+LA  
Sbjct  1     MAVSLQAAATLMQPIKVAAPSRTNVLLRSSQSVSKAFGLEPVGARLTCSLQTDLKDLAQK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
               DA KLAGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61    CVDATKLAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             ++FAFKPGKY AKKFCLEPTSFTVKAE V+KNAPPEFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  121   DSFAFKPGKYYAKKFCLEPTSFTVKAEGVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
             +DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SF G+FLVPSYRGSSF
Sbjct  181   TDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFGGDFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN K+ ASS+GKIT SVT SKPETGEVIG
Sbjct  241   LDPKGRGGSTGYDNAVALPAGGRGDEEELAKENNKSAASSSGKITLSVTKSKPETGEVIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFESLQPSDTDLGAK PK+VKI G+WYAQL+
Sbjct  301   VFESLQPSDTDLGAKTPKDVKITGVWYAQLD  331



>ref|XP_004300575.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=331

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/331 (82%), Positives = 298/331 (90%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIGRSYQT--VGKALGVDPSPA-RITCSLQSQIKELAHN  223
             MAAS+Q AATLMQPTK+GV  R     ++  V KA G++P+ + R+TCSLQ+ +KE AH 
Sbjct  1     MAASMQAAATLMQPTKLGVPSRTSLQLRSSNVSKAFGLEPAASSRLTCSLQTDLKEFAHK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
               DA K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG 
Sbjct  61    CVDATKIAGFALATSALVVSGAGAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGS  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             E FAFKPGKY AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  121   EAFAFKPGKYVAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
              DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP++F+GEFLVPSYRGSSF
Sbjct  181   PDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDNFTGEFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN ASS GKIT SVT +KPETGE+IG
Sbjct  241   LDPKGRGGSTGYDNAVALPAGGRGDEEELAKENTKNTASSKGKITLSVTKTKPETGELIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFES+QPSDTDLGAK PK+VKIQG+WYAQL+
Sbjct  301   VFESIQPSDTDLGAKVPKDVKIQGVWYAQLD  331



>ref|XP_007156865.1| hypothetical protein PHAVU_002G024000g [Phaseolus vulgaris]
 gb|AGV54484.1| oxygen-evolving enhancer protein 1 [Phaseolus vulgaris]
 gb|ESW28859.1| hypothetical protein PHAVU_002G024000g [Phaseolus vulgaris]
Length=329

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/328 (83%), Positives = 297/328 (91%), Gaps = 0/328 (0%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
             MA+SLQ AAT MQPTKV +  R  +S Q + KA G++PS  ++TCSL S +K+LA    D
Sbjct  1     MASSLQAAATFMQPTKVPLNSRNLKSTQCISKAFGLEPSAPKLTCSLHSDLKDLAQKCLD  60

Query  233   AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
             A KLAGFALATSALLVSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGVE+F
Sbjct  61    ATKLAGFALATSALLVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVESF  120

Query  413   AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
             AFKPGKY+AKK CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLDEIEGPFEV+ DG
Sbjct  121   AFKPGKYNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFEVTPDG  180

Query  593   SVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDP  772
             +VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSG+FLVPSYRGSSFLDP
Sbjct  181   TVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGDFLVPSYRGSSFLDP  240

Query  773   KGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFE  952
             KGRG STGYDNAVALPAGGRGDEEEL KEN K+ +SS GKIT SVT +KPETGEVIGVFE
Sbjct  241   KGRGASTGYDNAVALPAGGRGDEEELAKENNKSASSSKGKITLSVTKTKPETGEVIGVFE  300

Query  953   SLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             S+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  301   SVQPSDTDLGAKAPKDVKIQGVWYAQLE  328



>gb|KHG13438.1| Oxygen-evolving enhancer 1, chloroplastic [Gossypium arboreum]
Length=332

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/331 (82%), Positives = 298/331 (90%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MA SLQ AATLMQP KV    R     RS Q+V KA G++P  AR+TCSLQ+ +K+LA  
Sbjct  1     MAVSLQAAATLMQPIKVAAPSRTNVPLRSSQSVSKAFGLEPVGARLTCSLQTDLKDLALK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
               DA KLAGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61    CVDATKLAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             ++FAFKPGKY AKKFCLEPTSFTVKAE V+KNAPPEFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  121   DSFAFKPGKYYAKKFCLEPTSFTVKAEGVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
             +DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SF G+FLVPSYRGSSF
Sbjct  181   TDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFGGDFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN K+ ASS+GKIT SVT SKPETGEVIG
Sbjct  241   LDPKGRGGSTGYDNAVALPAGGRGDEEELAKENNKSAASSSGKITLSVTKSKPETGEVIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFESLQPSDTDLGAK PK+VKI G+WYAQL+
Sbjct  301   VFESLQPSDTDLGAKTPKDVKITGVWYAQLD  331



>ref|XP_011099252.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Sesamum indicum]
Length=331

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/331 (84%), Positives = 309/331 (93%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MA SLQ AATLMQPTKVGV+ R     RS Q+VGK+ GV+P+ AR++CSLQ+ +K+LA  
Sbjct  1     MATSLQAAATLMQPTKVGVSARSSLQLRSVQSVGKSFGVEPASARLSCSLQADLKDLAQK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              +DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTIEGGV
Sbjct  61    CTDAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIEGGV  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             ++FAFKPGKY+AKKFCLEPTSFTVKAE V+KNAPPEFQ TKLMTRLTYTLDEIEGPFEVS
Sbjct  121   DSFAFKPGKYNAKKFCLEPTSFTVKAEGVNKNAPPEFQKTKLMTRLTYTLDEIEGPFEVS  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
              DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP++F GEFLVPSYRGSSF
Sbjct  181   QDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDNFGGEFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN KNVASSTGKIT SVT SKPETGEVIG
Sbjct  241   LDPKGRGGSTGYDNAVALPAGGRGDEEELEKENNKNVASSTGKITLSVTQSKPETGEVIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFES+QPSDTDLG+KAPK+VKIQG+WYAQL+
Sbjct  301   VFESIQPSDTDLGSKAPKDVKIQGVWYAQLD  331



>ref|XP_003636084.1| Oxygen-evolving enhancer protein [Medicago truncatula]
 gb|KEH20462.1| photosystem II oxygen-evolving enhancer protein [Medicago truncatula]
Length=329

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/328 (82%), Positives = 297/328 (91%), Gaps = 0/328 (0%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
             MAASLQ AATLMQPTK+       +S Q+V KA G++   A++TCSLQS  KEL H F +
Sbjct  1     MAASLQAAATLMQPTKLRSNSLQLKSTQSVSKAFGLEHYGAKVTCSLQSDFKELTHKFVE  60

Query  233   AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
             A+K+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++F
Sbjct  61    ASKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSF  120

Query  413   AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
             +FKPGKY+AKKFCLEPTSFTVKAE V+KN P  FQNTKLMTRLTYTLDEIEGPFEVSSDG
Sbjct  121   SFKPGKYNAKKFCLEPTSFTVKAEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFEVSSDG  180

Query  593   SVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDP  772
             SVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGE+LVPSYRGSSFLDP
Sbjct  181   SVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEYLVPSYRGSSFLDP  240

Query  773   KGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFE  952
             KGRG STGYDNAVALPAGGRGDEEEL KEN K+ ASS GKIT SVT +KPETGEVIGVFE
Sbjct  241   KGRGASTGYDNAVALPAGGRGDEEELGKENNKSAASSKGKITLSVTQTKPETGEVIGVFE  300

Query  953   SLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             S+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  301   SIQPSDTDLGAKAPKDVKIQGVWYAQLE  328



>ref|XP_011085527.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Sesamum indicum]
Length=330

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/326 (86%), Positives = 305/326 (94%), Gaps = 0/326 (0%)
 Frame = +2

Query  59    ASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  238
             +SLQ AATLMQPTKVG T    RS QT+GKA GV+P+ AR+TCSLQ+ +K+LAH  +DAA
Sbjct  4     SSLQAAATLMQPTKVGRTSLQLRSVQTLGKAFGVEPAGARMTCSLQADLKDLAHKLTDAA  63

Query  239   KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  418
             K+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTIEGGV++FAF
Sbjct  64    KIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIEGGVDSFAF  123

Query  419   KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  598
             K GKY+AKKFCLEPTSFTVKAE V+KNAPPEFQ TKLMTRLTYTLDEIEGPF VS DG+V
Sbjct  124   KAGKYNAKKFCLEPTSFTVKAEGVNKNAPPEFQKTKLMTRLTYTLDEIEGPFVVSEDGTV  183

Query  599   KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKG  778
             KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF GEFLVPSYRGSSFLDPKG
Sbjct  184   KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGEFLVPSYRGSSFLDPKG  243

Query  779   RGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESL  958
             RGGSTGYDNAVALPAGGRGDEEEL+KEN KNVASSTGKIT SVT SKPETGEVIGVFES+
Sbjct  244   RGGSTGYDNAVALPAGGRGDEEELEKENNKNVASSTGKITLSVTKSKPETGEVIGVFESV  303

Query  959   QPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             QPSDTDLG+KAPK+VKIQG+WYAQL+
Sbjct  304   QPSDTDLGSKAPKDVKIQGVWYAQLD  329



>ref|NP_001241522.1| uncharacterized protein LOC100820458 [Glycine max]
 gb|ACU23458.1| unknown [Glycine max]
 gb|KHN36175.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=329

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/328 (82%), Positives = 296/328 (90%), Gaps = 0/328 (0%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
             MAASLQ AAT MQPTKVG+  R  +S Q + KA G++P+ A++ CSL+  +K+ A    D
Sbjct  1     MAASLQAAATFMQPTKVGMATRNLKSTQCISKAFGLEPAAAKLICSLKPDLKDFAQKCVD  60

Query  233   AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
             A K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTIEGGV++F
Sbjct  61    ATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIEGGVDSF  120

Query  413   AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
             AFK GKY A+K CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLDEIEGPFEVSSDG
Sbjct  121   AFKAGKYKAQKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFEVSSDG  180

Query  593   SVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDP  772
             +VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEFLVPSYRGSSFLDP
Sbjct  181   TVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEFLVPSYRGSSFLDP  240

Query  773   KGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFE  952
             KGRG STGYDNAVALPAGGRGDEEEL KEN K+ +SS GKIT SVT SKPETGEVIGVFE
Sbjct  241   KGRGASTGYDNAVALPAGGRGDEEELAKENNKSASSSKGKITLSVTKSKPETGEVIGVFE  300

Query  953   SLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             S+QPSDTDLGAKAPK+VKIQGIWYAQL+
Sbjct  301   SVQPSDTDLGAKAPKDVKIQGIWYAQLD  328



>ref|XP_010263833.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nelumbo nucifera]
Length=332

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/331 (84%), Positives = 296/331 (89%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MAASLQ AATL QPTKVGV  + G   RS  TV K  G DPS AR+TCSLQS +KELA  
Sbjct  1     MAASLQAAATLRQPTKVGVPVKGGLQLRSTPTVCKNFGFDPSCARLTCSLQSDLKELAQK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
               DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV
Sbjct  61    CVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGV  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             ++FAFK GKY+ KK CLEPTSFTVKAE VSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS
Sbjct  121   DSFAFKTGKYNLKKLCLEPTSFTVKAEGVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVS  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
              DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPE+F G+FLVPSYRGSSF
Sbjct  181   PDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFGGQFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIK+ +SSTG IT SVT SK E+GEVIG
Sbjct  241   LDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKDPSSSTGTITLSVTKSKTESGEVIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFESLQPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  301   VFESLQPSDTDLGAKTPKDVKIQGIWYAQLE  331



>ref|XP_010673597.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=330

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/329 (82%), Positives = 292/329 (89%), Gaps = 1/329 (0%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  229
             MAASLQ + T +QPTKV     +  RS   V KA GV+P+  R+  SLQS +KELA+   
Sbjct  1     MAASLQASTTFLQPTKVASRNTLQLRSTPNVCKAFGVEPASGRLCLSLQSDLKELANKCV  60

Query  230   DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
             DA KLAG ALATSAL+ SGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGGV+ 
Sbjct  61    DATKLAGLALATSALIASGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGVDT  120

Query  410   FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
             FAFK GKY+AKKFCLEPT F VKAE VSKNAPP+FQNTKLMTRLTYTLDE+EGPFEVSSD
Sbjct  121   FAFKAGKYNAKKFCLEPTKFAVKAEGVSKNAPPDFQNTKLMTRLTYTLDEMEGPFEVSSD  180

Query  590   GSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLD  769
             G+VKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVA+GKPESFSGEFLVPSYRGSSFLD
Sbjct  181   GTVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVASGKPESFSGEFLVPSYRGSSFLD  240

Query  770   PKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVF  949
             PKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN ASS G IT SVT SKPETGEVIGVF
Sbjct  241   PKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTASSKGTITLSVTQSKPETGEVIGVF  300

Query  950   ESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             +SLQPSDTDLGAK PK+VKI+GIWYAQLE
Sbjct  301   QSLQPSDTDLGAKVPKDVKIEGIWYAQLE  329



>ref|NP_001043134.1| Os01g0501800 [Oryza sativa Japonica Group]
 dbj|BAB64069.1| putative 33kDa oxygen evolving protein of photosystem II [Oryza 
sativa Japonica Group]
 dbj|BAF05048.1| Os01g0501800 [Oryza sativa Japonica Group]
 gb|EAZ12041.1| hypothetical protein OsJ_01921 [Oryza sativa Japonica Group]
 dbj|BAG96401.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96320.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96862.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96934.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99571.1| unnamed protein product [Oryza sativa Japonica Group]
Length=333

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/333 (82%), Positives = 294/333 (88%), Gaps = 5/333 (2%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVG----VTPRIGRSYQTVGKALGVDPSPA-RITCSLQSQIKELA  217
             MAASLQ AATLMQP K+G          R    V +A GVD   A RITCSLQS I+E+A
Sbjct  1     MAASLQAAATLMQPAKLGGRASSAALPSRPSSHVARAFGVDTGAAGRITCSLQSDIREVA  60

Query  218   HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
             +  +DAAKLAGFALATSALLVSGA+AEGVP+RLTFDEIQSKTYMEVKG+GTANQCPT+EG
Sbjct  61    NKCADAAKLAGFALATSALLVSGASAEGVPRRLTFDEIQSKTYMEVKGTGTANQCPTVEG  120

Query  398   GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
             GV++FAFK GKY+ KKFCLEPTSFTVKAE V+KNAPPEFQ TKLMTRLTYTLDEIEGP E
Sbjct  121   GVDSFAFKAGKYNMKKFCLEPTSFTVKAEGVAKNAPPEFQKTKLMTRLTYTLDEIEGPLE  180

Query  578   VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGS  757
             VSSDG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIK LVATGKPESF G FLVPSYRGS
Sbjct  181   VSSDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKNLVATGKPESFGGPFLVPSYRGS  240

Query  758   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEV  937
             SFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN +SSTG IT SVT SKPETGEV
Sbjct  241   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKNASSSTGNITLSVTKSKPETGEV  300

Query  938   IGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             IGVFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  301   IGVFESVQPSDTDLGAKVPKDVKIQGVWYAQLE  333



>ref|NP_001240871.1| uncharacterized protein LOC100811386 [Glycine max]
 gb|ACU17834.1| unknown [Glycine max]
 gb|KHN00579.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=326

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/329 (82%), Positives = 299/329 (91%), Gaps = 5/329 (2%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPA-RITCSLQSQIKELAHNFS  229
             MA+SLQ AAT MQPTK        +S Q + KA G++P+   ++TCSLQ+ +K+LAH   
Sbjct  1     MASSLQAAATFMQPTKFLQL----KSTQAISKAFGLEPAGVNKVTCSLQADLKDLAHKCV  56

Query  230   DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
             DA K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG+E+
Sbjct  57    DATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGLES  116

Query  410   FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
             FAFK GKY+AKKFCLEPTSFTVKAE V+KNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD
Sbjct  117   FAFKQGKYNAKKFCLEPTSFTVKAEGVAKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  176

Query  590   GSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLD  769
             G+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEFLVPSYRGSSFLD
Sbjct  177   GTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEFLVPSYRGSSFLD  236

Query  770   PKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVF  949
             PKGRG STGYDNAVALPAGGRGDEEEL KEN K+ +SS GKITFSVT +KPETGEVIGVF
Sbjct  237   PKGRGASTGYDNAVALPAGGRGDEEELAKENNKSASSSKGKITFSVTKTKPETGEVIGVF  296

Query  950   ESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             +SLQPSDTDLGAKAPK+VKIQGIWYAQLE
Sbjct  297   QSLQPSDTDLGAKAPKDVKIQGIWYAQLE  325



>ref|XP_008800919.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Phoenix dactylifera]
Length=334

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/333 (82%), Positives = 294/333 (88%), Gaps = 5/333 (2%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPR--IGRSYQT---VGKALGVDPSPARITCSLQSQIKELA  217
             MAASLQ AATLMQP KV  T R   G+  +T   + KA G +P+ AR+TCSLQS +++LA
Sbjct  1     MAASLQAAATLMQPAKVAATGRNLAGQQLRTGSHLSKAFGFEPAGARLTCSLQSDLRDLA  60

Query  218   HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
                +DA KLAGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEG
Sbjct  61    QKCADATKLAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEG  120

Query  398   GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
             GV+ FAFKPGKY  KK CLEPTSFTVKAE VSKN+PPEFQ TKLMTRLTYTLDEIEGPFE
Sbjct  121   GVDEFAFKPGKYQMKKLCLEPTSFTVKAEGVSKNSPPEFQKTKLMTRLTYTLDEIEGPFE  180

Query  578   VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGS  757
             VS  G+V F EKDGIDYAAVTVQLPGGERVPFLFT+KQLVA+GKPESF G+FLVPSYRGS
Sbjct  181   VSPSGTVNFVEKDGIDYAAVTVQLPGGERVPFLFTVKQLVASGKPESFGGQFLVPSYRGS  240

Query  758   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEV  937
             SFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN +SSTG IT SVT SKPE+GEV
Sbjct  241   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKNTSSSTGTITLSVTKSKPESGEV  300

Query  938   IGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             IGVFES+QPSDTDLGAK PKEVKIQGIWYAQLE
Sbjct  301   IGVFESIQPSDTDLGAKVPKEVKIQGIWYAQLE  333



>ref|XP_003548008.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Glycine max]
 gb|KHN13352.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=331

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/330 (82%), Positives = 301/330 (91%), Gaps = 2/330 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPAR-ITCSLQSQIKELAHNF  226
             MAASLQ AAT MQPTK+  +  +  +S Q++ KA G++P  A+ +TCSLQ+ +K+LAH  
Sbjct  1     MAASLQAAATFMQPTKLSRSNTLQQKSTQSISKAFGLEPVGAKKVTCSLQADLKDLAHKC  60

Query  227   SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  406
              DA K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG++
Sbjct  61    VDATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGLD  120

Query  407   NFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSS  586
             +FAFKPGKY+AKK CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLDEIEGPFEVSS
Sbjct  121   SFAFKPGKYNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFEVSS  180

Query  587   DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFL  766
             DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEFLVPSYRGSSFL
Sbjct  181   DGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEFLVPSYRGSSFL  240

Query  767   DPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGV  946
             DPKGRG STGYDNAVALPAGGRGDEEEL KEN K+ +SS GKIT SVT +KPETGEVIGV
Sbjct  241   DPKGRGASTGYDNAVALPAGGRGDEEELAKENNKSASSSKGKITLSVTKTKPETGEVIGV  300

Query  947   FESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             FES+QPSDTDLGAKAPK+VKIQGIWYAQLE
Sbjct  301   FESVQPSDTDLGAKAPKDVKIQGIWYAQLE  330



>ref|XP_002283699.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Vitis vinifera]
Length=331

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/331 (81%), Positives = 297/331 (90%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MAASL  AATL QPTK G+  + G   +S  +V KA G DP+ AR+TCSLQ+ +K+LA  
Sbjct  1     MAASLHVAATLRQPTKAGLPAKTGLQLKSSPSVCKAFGYDPAGARLTCSLQTHVKDLAQK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              +DAAK+AGFALATSA LVSGA AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61    CADAAKIAGFALATSAFLVSGAGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             ++FAFK G Y+ KKFCLEPTSFTVKAE VSKNAP EFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  121   DSFAFKTGSYNMKKFCLEPTSFTVKAEGVSKNAPAEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
             SD +VKF EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPE+F GEFLVPSYRGSSF
Sbjct  181   SDRTVKFIEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL++ENIK+ +SSTGKIT S+T SKPE+GEVIG
Sbjct  241   LDPKGRGGSTGYDNAVALPAGGRGDEEELKRENIKDASSSTGKITLSITKSKPESGEVIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  301   VFESIQPSDTDLGAKVPKDVKIQGVWYAQLE  331



>ref|XP_010550399.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Tarenaya hassleriana]
Length=331

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/331 (81%), Positives = 294/331 (89%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKV-GVTPRIG--RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MAASL +AAT +QPTK+   T R G  RS  +V K  G++ S AR+TCS+QS +++ A  
Sbjct  1     MAASLHSAATFLQPTKISAATSRYGHLRSSPSVAKTFGLESSSARLTCSIQSDLRDFAGK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              +DAAK+AGFALATSAL+ SGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  61    CTDAAKIAGFALATSALVSSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGS  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             + FAFKPGKYS KKFC EPTSFTVKAE VSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  121   DEFAFKPGKYSGKKFCFEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
             SDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP SF G+FLVPSYRGSSF
Sbjct  181   SDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPNSFGGKFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN ASSTG+IT  VT SKPETGE+IG
Sbjct  241   LDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKNAASSTGEITLKVTKSKPETGELIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFES+QPSDTDLGAK PK+VKIQGIWY QLE
Sbjct  301   VFESIQPSDTDLGAKVPKDVKIQGIWYGQLE  331



>ref|XP_004141946.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Cucumis sativus]
 gb|KGN48464.1| Oxygen-evolving enhancer protein 1 [Cucumis sativus]
Length=332

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/321 (83%), Positives = 294/321 (92%), Gaps = 2/321 (1%)
 Frame = +2

Query  80    TLMQPTKVG--VTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGF  253
             TLMQP+K+    T    RS Q++ KA G++ S  R+TCSL S +K+++  F+DAAK+AGF
Sbjct  11    TLMQPSKLASRTTTSHLRSSQSLSKAFGLESSGPRLTCSLHSDLKDVSRKFADAAKIAGF  70

Query  254   ALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKY  433
             ALATSAL+VSGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++FAFK GKY
Sbjct  71    ALATSALVVSGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSFAFKAGKY  130

Query  434   SAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEK  613
              AKKFCLEPTSFTVKAE VSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV +DGS+KFEEK
Sbjct  131   QAKKFCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVGADGSIKFEEK  190

Query  614   DGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGST  793
             DGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSG+FLVPSYRGSSFLDPKGRGGST
Sbjct  191   DGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGDFLVPSYRGSSFLDPKGRGGST  250

Query  794   GYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDT  973
             GYDNAVALPAGGRGDEEEL KENIKN +SSTGKIT SVT SKPETGEVIGVFES+QPSDT
Sbjct  251   GYDNAVALPAGGRGDEEELAKENIKNASSSTGKITLSVTKSKPETGEVIGVFESIQPSDT  310

Query  974   DLGAKAPKEVKIQGIWYAQLE  1036
             DLGAKAPK+VKIQG+WYAQL+
Sbjct  311   DLGAKAPKDVKIQGVWYAQLD  331



>ref|XP_007155994.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
 gb|ESW27988.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
Length=330

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/329 (81%), Positives = 299/329 (91%), Gaps = 1/329 (0%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  229
             MAASLQ AAT MQPTK+G T  +  +S Q++ KA G++P+ A+I+CSL + +K+ A    
Sbjct  1     MAASLQAAATFMQPTKLGRTNTLQLKSPQSISKAFGLEPAGAKISCSLHADLKDFAQKCV  60

Query  230   DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
             DA K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++
Sbjct  61    DATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDS  120

Query  410   FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
             FAFKPGKY+AKK CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLDEIEGPFEVSSD
Sbjct  121   FAFKPGKYNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFEVSSD  180

Query  590   GSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLD  769
             G+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF G FLVPSYRGSSFLD
Sbjct  181   GTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGPFLVPSYRGSSFLD  240

Query  770   PKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVF  949
             PKGRG STGYDNAVALPAGGRGDEEEL KEN K+ +SSTGKIT SVT +KPETGEVIGVF
Sbjct  241   PKGRGASTGYDNAVALPAGGRGDEEELAKENNKSASSSTGKITLSVTKTKPETGEVIGVF  300

Query  950   ESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             ES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  301   ESVQPSDTDLGAKAPKDVKIQGVWYAQLE  329



>ref|XP_006291313.1| hypothetical protein CARUB_v10017447mg, partial [Capsella rubella]
 gb|EOA24211.1| hypothetical protein CARUB_v10017447mg, partial [Capsella rubella]
Length=376

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/350 (76%), Positives = 297/350 (85%), Gaps = 5/350 (1%)
 Frame = +2

Query  2     IGTHREREELTLLSDPTMAASLQTAATLMQPTKVGVTPRIGR-----SYQTVGKALGVDP  166
             + T  +   L L+    MA SL  AAT +QP K+  +    R     S QTVGK+ G++ 
Sbjct  27    LSTQHKHRHLRLVCLVVMATSLHAAATFLQPAKIAASSSPSRNVYLRSNQTVGKSFGLES  86

Query  167   SPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTY  346
             S AR+TCSLQS +K+ A   SDAAK+AGFALATSAL+VSGA AEG PKRLT+DEIQSKTY
Sbjct  87    SSARLTCSLQSDLKDFAGKCSDAAKIAGFALATSALVVSGAGAEGAPKRLTYDEIQSKTY  146

Query  347   MEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTK  526
             MEVKG+GTANQCPTI+GG E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTK
Sbjct  147   MEVKGTGTANQCPTIDGGSETFSFKPGKYTGKKFCFEPTSFTVKAESVSKNAPPDFQNTK  206

Query  527   LMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATG  706
             LMTRLTYTLDEIEGPFEV SDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+G
Sbjct  207   LMTRLTYTLDEIEGPFEVGSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLEASG  266

Query  707   KPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASST  886
             KPESFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S 
Sbjct  267   KPESFSGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASV  326

Query  887   GKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             G IT  +T SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  327   GDITLRITKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  376



>gb|EEC70714.1| hypothetical protein OsI_02088 [Oryza sativa Indica Group]
Length=333

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/333 (82%), Positives = 293/333 (88%), Gaps = 5/333 (2%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPA-RITCSLQSQIKELA  217
             MAASLQ AATLMQP K+G          R    V +A GVD   A RITCSLQS I+E+A
Sbjct  1     MAASLQAAATLMQPAKLGGRASSAALPSRPSSHVARAFGVDTGAAGRITCSLQSDIREVA  60

Query  218   HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
             +  +DAAKL GFALATSALLVSGA+AEGVP+RLTFDEIQSKTYMEVKG+GTANQCPT+EG
Sbjct  61    NKCADAAKLTGFALATSALLVSGASAEGVPRRLTFDEIQSKTYMEVKGTGTANQCPTVEG  120

Query  398   GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
             GV++FAFK GKY+ KKFCLEPTSFTVKAE V+KNAPPEFQ TKLMTRLTYTLDEIEGP E
Sbjct  121   GVDSFAFKAGKYNMKKFCLEPTSFTVKAEGVAKNAPPEFQKTKLMTRLTYTLDEIEGPLE  180

Query  578   VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGS  757
             VSSDG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIK LVATGKPESF G FLVPSYRGS
Sbjct  181   VSSDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKNLVATGKPESFGGPFLVPSYRGS  240

Query  758   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEV  937
             SFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN +SSTG IT SVT SKPETGEV
Sbjct  241   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKNASSSTGNITLSVTKSKPETGEV  300

Query  938   IGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             IGVFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  301   IGVFESVQPSDTDLGAKVPKDVKIQGVWYAQLE  333



>ref|XP_009103510.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Brassica rapa]
 emb|CDY45242.1| BnaA07g12480D [Brassica napus]
Length=332

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/332 (80%), Positives = 294/332 (89%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS IK+ A 
Sbjct  1     MAASLQSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDIKDFAG  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             SSDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++F+G+FLVPSYRGSS
Sbjct  181   SSDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDNFTGKFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKVTKSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  301   GVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_008440181.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Cucumis melo]
Length=332

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/331 (82%), Positives = 301/331 (91%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQ-TAATLMQPTKVG--VTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MAAS+  TAATLMQP+K+    T    RS Q++ KA G++ + AR+TCSL S +K+++  
Sbjct  1     MAASVHATAATLMQPSKLASRTTTSQLRSSQSLSKAFGLESAGARLTCSLHSDLKDVSRK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
             F+DAAK+AGFALATSAL+VSGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTIEGGV
Sbjct  61    FADAAKIAGFALATSALVVSGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIEGGV  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             ++FAFK GKY AKKFCLEPTSFTVKAE VSKN+PPEFQNTKLMTRLTYTLDEIEGPFEV 
Sbjct  121   DSFAFKAGKYQAKKFCLEPTSFTVKAEGVSKNSPPEFQNTKLMTRLTYTLDEIEGPFEVG  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
             +DGS+KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF G+FLVPSYRGSSF
Sbjct  181   ADGSIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGDFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN +SSTGKIT SVT SKPETGEVIG
Sbjct  241   LDPKGRGGSTGYDNAVALPAGGRGDEEELAKENNKNASSSTGKITLSVTKSKPETGEVIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  301   VFESIQPSDTDLGAKAPKDVKIQGVWYAQLE  331



>emb|CAN79166.1| hypothetical protein VITISV_019248 [Vitis vinifera]
Length=331

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/331 (81%), Positives = 296/331 (89%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MAASL  AATL QPTK G+  + G   +S  +V KA G DP+ AR+TCSLQ+ +K+LA  
Sbjct  1     MAASLHVAATLRQPTKAGLPAKTGLQLKSSPSVCKAFGYDPAGARLTCSLQTHVKDLAQK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              +DAAK+AGFALATSA LVSGA AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61    CADAAKIAGFALATSAFLVSGAGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             ++FAFK G Y+ KKFCLEPTSFTVKAE VSKNAP EFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  121   DSFAFKTGSYNMKKFCLEPTSFTVKAEGVSKNAPAEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
             SD +VKF EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPE+F GEFLVPSYRGSSF
Sbjct  181   SDRTVKFIEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL+ ENIK+ +SSTGKIT S+T SKPE+GEVIG
Sbjct  241   LDPKGRGGSTGYDNAVALPAGGRGDEEELKXENIKDASSSTGKITLSITKSKPESGEVIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  301   VFESIQPSDTDLGAKVPKDVKIQGVWYAQLE  331



>sp|P14226.1|PSBO_PEA RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Pisum sativum]
 emb|CAA33408.1| unnamed protein product [Pisum sativum]
 dbj|BAA02554.1| precursor for 33-kDa protein of photosystem II [Pisum sativum]
 prf||1611461A O2 evolving complex 33kD protein
Length=329

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/328 (81%), Positives = 296/328 (90%), Gaps = 0/328 (0%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
             MAASLQ AATLMQPTK+       +S Q+V KA G++   A++TCSLQS  KELAH   +
Sbjct  1     MAASLQAAATLMQPTKLRSNTLQLKSNQSVSKAFGLEHYGAKVTCSLQSDFKELAHKCVE  60

Query  233   AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
             A+K+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++F
Sbjct  61    ASKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSF  120

Query  413   AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
             +FKPGKY+AKK CLEPTSFTVK+E V+KN P  FQNTKLMTRLTYTLDEIEGPFEVS+DG
Sbjct  121   SFKPGKYNAKKLCLEPTSFTVKSEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFEVSADG  180

Query  593   SVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDP  772
             SVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEFLVPSYRGSSFLDP
Sbjct  181   SVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEFLVPSYRGSSFLDP  240

Query  773   KGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFE  952
             KGRG STGYDNAVALPAGGRGDEEEL KEN K+ ASS GKIT SVT +KPETGEVIGVFE
Sbjct  241   KGRGASTGYDNAVALPAGGRGDEEELGKENNKSAASSKGKITLSVTQTKPETGEVIGVFE  300

Query  953   SLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             S+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  301   SIQPSDTDLGAKAPKDVKIQGVWYAQLE  328



>gb|EPS61846.1| oxygen-evolving enhancer protein 1, chloroplastic [Genlisea aurea]
Length=330

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/329 (81%), Positives = 293/329 (89%), Gaps = 1/329 (0%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  229
             MA S+Q  ATLMQP ++  T  +  RS    GK+LG++    R TCSL + +K+LA   +
Sbjct  1     MATSMQAVATLMQPARLRSTASVPIRSVPAAGKSLGIESGAGRFTCSLNTDLKQLAVKLA  60

Query  230   DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
             DAAK+AGFALATSAL+ SGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++
Sbjct  61    DAAKIAGFALATSALVASGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDS  120

Query  410   FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
             FAFK GKY+AKK CLEPTSFTVKAE V+KNAPP+FQ TKLMTRLTYTLDEIEGPFEVSSD
Sbjct  121   FAFKAGKYNAKKLCLEPTSFTVKAEGVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEVSSD  180

Query  590   GSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLD  769
             GSVKF EKDGIDYAAVTVQLPGGERVPFLFTIKQL A+G P+SFSGEFLVPSYRGSSFLD
Sbjct  181   GSVKFVEKDGIDYAAVTVQLPGGERVPFLFTIKQLAASGTPDSFSGEFLVPSYRGSSFLD  240

Query  770   PKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVF  949
             PKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN ASSTGKIT S+T +KPETGEVIGVF
Sbjct  241   PKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNTASSTGKITLSITKTKPETGEVIGVF  300

Query  950   ESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             ESLQPSDTDLG+KAPK+VKIQGIWYAQLE
Sbjct  301   ESLQPSDTDLGSKAPKDVKIQGIWYAQLE  329



>ref|XP_002877774.1| photosystem II subunit O-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54033.1| photosystem II subunit O-2 [Arabidopsis lyrata subsp. lyrata]
Length=331

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/331 (79%), Positives = 294/331 (89%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MA SLQ AAT +QP K+  +P      RS QTVGK+ G+D S AR+TCSL S +K+ A  
Sbjct  1     MATSLQAAATFLQPAKIAASPSRNVHLRSNQTVGKSFGLDSSQARLTCSLHSDLKDFAGK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              S+AAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  61    CSEAAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGS  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV 
Sbjct  121   ETFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVG  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
             SDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKPE+FSG+FLVPSYRGSSF
Sbjct  181   SDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPENFSGKFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  +T SKPETGEVIG
Sbjct  241   LDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKITKSKPETGEVIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  301   VFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  331



>ref|XP_006280785.1| hypothetical protein CARUB_v10026754mg [Capsella rubella]
 gb|EOA13683.1| hypothetical protein CARUB_v10026754mg [Capsella rubella]
Length=332

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/332 (80%), Positives = 294/332 (89%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+LA 
Sbjct  1     MAASLQSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDLAG  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             +SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP+SF+G+FLVPSYRGSS
Sbjct  181   ASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  301   GVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_009130561.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Brassica rapa]
 emb|CDY55088.1| BnaA02g34760D [Brassica napus]
Length=332

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/332 (80%), Positives = 294/332 (89%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ+A+T +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+LA 
Sbjct  1     MAASLQSASTFLQAAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDLAG  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             SSDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++FSG+FLVPSYRGSS
Sbjct  181   SSDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDNFSGKFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKVTKSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  301   GVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_006644206.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Oryza brachyantha]
Length=334

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/333 (81%), Positives = 293/333 (88%), Gaps = 6/333 (2%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG-----RSYQTVGKALGVDPSPARITCSLQSQIKELA  217
             MAASLQ AATLMQP K+G  P        R    V +A GVD +  R++CSLQS I+E+A
Sbjct  1     MAASLQAAATLMQPAKLGGRPASSAALPSRPSSHVARAFGVD-AGCRVSCSLQSDIREVA  59

Query  218   HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
                +DAAKLAGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPT++G
Sbjct  60    SKCADAAKLAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTVDG  119

Query  398   GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
             GV+ F FK GKY+ KKFCLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEGP E
Sbjct  120   GVDTFPFKSGKYNVKKFCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEGPLE  179

Query  578   VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGS  757
             VS+DG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSG FLVPSYRGS
Sbjct  180   VSADGNIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGPFLVPSYRGS  239

Query  758   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEV  937
             SFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN +SSTG IT SVT SKPETGEV
Sbjct  240   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKNASSSTGNITLSVTKSKPETGEV  299

Query  938   IGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             IGVFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  300   IGVFESVQPSDTDLGAKVPKDVKIQGVWYAQLE  332



>gb|KFK34331.1| hypothetical protein AALP_AA5G131000 [Arabis alpina]
Length=331

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/331 (79%), Positives = 293/331 (89%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MA SLQ AAT +QP K+  +P      RS QTVGK+ G+D SPAR+TCSL S  K+    
Sbjct  1     MATSLQAAATFLQPAKIAASPSRNVHLRSNQTVGKSFGLDSSPARLTCSLHSDFKDFVGK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              SDAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  61    CSDAAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGS  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV 
Sbjct  121   EAFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVG  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
             SDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++FSG+FLVPSYRGSSF
Sbjct  181   SDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPDNFSGKFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  +T SKPETGEVIG
Sbjct  241   LDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKNTAASVGEITLKITKSKPETGEVIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFES+QPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  301   VFESIQPSDTDLGAKVPKDVKIQGVWYGQLE  331



>ref|XP_004968772.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Setaria italica]
Length=333

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/331 (81%), Positives = 288/331 (87%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MAASLQ AATLMQP K+G         R    V +A GVD    RI+CSLQS ++E+A  
Sbjct  1     MAASLQAAATLMQPAKIGGRASASLPSRQASHVARAFGVDAGAGRISCSLQSDVREVASK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
               DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61    CIDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             ++F FK GKY  KKFCLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEGP EV 
Sbjct  121   DSFPFKAGKYQMKKFCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEGPLEVG  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
             SDG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVATGKPESF G FLVPSYRGSSF
Sbjct  181   SDGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPESFGGPFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN ASSTG IT SVT S PETGEVIG
Sbjct  241   LDPKGRGGSTGYDNAVALPAGGRGDEEELVKENIKNAASSTGNITLSVTKSNPETGEVIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFES+QPSDTDLGAKAPK+VKIQGIWYAQLE
Sbjct  301   VFESVQPSDTDLGAKAPKDVKIQGIWYAQLE  331



>ref|NP_190651.1| oxygen-evolving enhancer protein 1-2 [Arabidopsis thaliana]
 sp|Q9S841.1|PSBO2_ARATH RecName: Full=Oxygen-evolving enhancer protein 1-2, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=Manganese-stabilizing protein 
2; Short=MSP-2; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB42911.1| putative protein 1 photosystem II oxygen-evolving complex [Arabidopsis 
thaliana]
 emb|CAB53092.1| precursor of the 33 kDa subunit of the oxygen evolving complex 
[Arabidopsis thaliana]
 gb|AAK91379.1| AT3g50820/F18B3_100 [Arabidopsis thaliana]
 gb|AAM51568.1| AT3g50820/F18B3_100 [Arabidopsis thaliana]
 gb|AAM67110.1| putative protein 1 photosystem II oxygen-evolving complex [Arabidopsis 
thaliana]
 gb|AEE78714.1| oxygen-evolving enhancer protein 1-2 [Arabidopsis thaliana]
Length=331

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/331 (79%), Positives = 292/331 (88%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MA SLQ AAT +QP K+  +P      RS QTVGK+ G+D S AR+TCSL S +K+ A  
Sbjct  1     MATSLQAAATFLQPAKIAASPSRNVHLRSNQTVGKSFGLDSSQARLTCSLHSDLKDFAGK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              SDAAK+AGFALATSAL+VSGA AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  61    CSDAAKIAGFALATSALVVSGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGS  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             E F+FK GKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV 
Sbjct  121   ETFSFKAGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVG  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
             SDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKPESFSG+FLVPSYRGSSF
Sbjct  181   SDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPESFSGKFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  +T SKPETGEVIG
Sbjct  241   LDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKITKSKPETGEVIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFESLQPSDTDLGAK PK+VKIQG+WY Q+E
Sbjct  301   VFESLQPSDTDLGAKVPKDVKIQGVWYGQIE  331



>ref|XP_004509219.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Cicer arietinum]
Length=329

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/328 (81%), Positives = 295/328 (90%), Gaps = 0/328 (0%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
             MAASLQ AATLMQPTK+       +S Q++ KA G++ S +++TCSLQ+  K+LAH   +
Sbjct  1     MAASLQAAATLMQPTKLRSNSFQLKSTQSISKAFGLEHSGSKVTCSLQTDFKDLAHKCVE  60

Query  233   AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
             A K+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG+++F
Sbjct  61    ATKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGLDSF  120

Query  413   AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
             AFK GKY+AKKFCLEPTSFTVKAE V+KN P  FQNTKLMTRLTYTLDEIEGPFEVS DG
Sbjct  121   AFKAGKYNAKKFCLEPTSFTVKAEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFEVSPDG  180

Query  593   SVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDP  772
             SVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEFLVPSYRGSSFLDP
Sbjct  181   SVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEFLVPSYRGSSFLDP  240

Query  773   KGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFE  952
             KGRG STGYDNAVALPAGGRGDEEEL KEN K+ +SS GKIT SVT SKPETGEVIGVFE
Sbjct  241   KGRGASTGYDNAVALPAGGRGDEEELAKENNKSASSSKGKITLSVTQSKPETGEVIGVFE  300

Query  953   SLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             S+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  301   SIQPSDTDLGAKAPKDVKIQGVWYAQLE  328



>ref|XP_009616099.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana tomentosiformis]
Length=326

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/332 (82%), Positives = 293/332 (88%), Gaps = 11/332 (3%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ AATL     +GV P       RS Q+V KA GV+P+  R+TCSLQ   K+LA 
Sbjct  1     MAASLQAAATL-----IGVIPSRNNLQFRSSQSVSKAFGVEPATVRLTCSLQVDFKDLAQ  55

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               SDAAK+AGFA ATSAL+  GANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  56    KCSDAAKVAGFAFATSALV--GANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  113

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              E FAFKPGKY+AKKFCLEPTSFTVKAE V+KN+PP FQ TKLMTRLTYTLDEIEGP EV
Sbjct  114   FETFAFKPGKYNAKKFCLEPTSFTVKAEGVNKNSPPAFQKTKLMTRLTYTLDEIEGPLEV  173

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             SSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQL A+GKPESFSGEFLVPSYRGSS
Sbjct  174   SSDGNVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLAASGKPESFSGEFLVPSYRGSS  233

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN+KN +SSTGKIT SVT SKP+TGE+I
Sbjct  234   FLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENVKNTSSSTGKITLSVTNSKPDTGELI  293

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  294   GVFESIQPSDTDLGAKVPKDVKIQGIWYAQLD  325



>emb|CDY30764.1| BnaC07g16640D [Brassica napus]
Length=332

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/332 (80%), Positives = 293/332 (88%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ+AAT +   K+   P  G    RS QTVGK+ G++ S AR+TCS QS IK+ A 
Sbjct  1     MAASLQSAATFLLSAKISAAPSRGSAHLRSTQTVGKSFGLESSSARLTCSYQSDIKDFAG  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             SSDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++F+G+FLVPSYRGSS
Sbjct  181   SSDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDNFTGKFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKVTKSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  301   GVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_008787656.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Phoenix dactylifera]
Length=334

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/333 (79%), Positives = 295/333 (89%), Gaps = 5/333 (2%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG-----RSYQTVGKALGVDPSPARITCSLQSQIKELA  217
             MAASLQ AA LMQP K+G T R       R++  + KA G +P+ A +TCSLQ+ +++LA
Sbjct  1     MAASLQAAAMLMQPAKIGATGRSLAGQQLRTFSHLSKAFGFEPAGAGLTCSLQTDLRDLA  60

Query  218   HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
                +DA KLAGFA ATSAL+V+GANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEG
Sbjct  61    LKCADATKLAGFAHATSALVVAGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEG  120

Query  398   GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
             GV++FAFKPGKY  K+FCLEPTSFTVKAE ++KN+P EFQ TKLMTRLTYTLDEIEGPFE
Sbjct  121   GVDSFAFKPGKYQMKRFCLEPTSFTVKAEGINKNSPAEFQKTKLMTRLTYTLDEIEGPFE  180

Query  578   VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGS  757
             VS DG+V+F+EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF G+FLVPSYRGS
Sbjct  181   VSPDGAVRFQEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGQFLVPSYRGS  240

Query  758   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEV  937
             SFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN +SSTG IT SVT SKPE+GEV
Sbjct  241   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKNTSSSTGSITLSVTKSKPESGEV  300

Query  938   IGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             IGVFESLQPSDTD+GAK PK+VKIQGIWYAQLE
Sbjct  301   IGVFESLQPSDTDMGAKVPKDVKIQGIWYAQLE  333



>emb|CDX81388.1| BnaC09g07990D [Brassica napus]
Length=332

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/332 (79%), Positives = 293/332 (88%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ+A T +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1     MAASLQSATTFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             SSDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++F+G+FLVPSYRGSS
Sbjct  181   SSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDNFTGKFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKVTKSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  301   GVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_006393852.1| hypothetical protein EUTSA_v10004563mg [Eutrema salsugineum]
 gb|ESQ31138.1| hypothetical protein EUTSA_v10004563mg [Eutrema salsugineum]
Length=332

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/332 (80%), Positives = 295/332 (89%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+LA 
Sbjct  1     MAASLQSAATFLQSAKIATAPSRGGSHLRSTQTVGKSFGLETSSARLTCSFQSDFKDLAG  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   SEIFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             SSDGSV+F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++F+G+FLVPSYRGSS
Sbjct  181   SSDGSVQFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDNFTGKFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  301   GVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_009112310.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Brassica rapa]
 emb|CDY18611.1| BnaA09g07840D [Brassica napus]
Length=332

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/332 (79%), Positives = 292/332 (88%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ+A T +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1     MAASLQSATTFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             SSDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP+SF+G+FLVPSYRGSS
Sbjct  181   SSDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKVTKSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  301   GVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_006403995.1| hypothetical protein EUTSA_v10010535mg [Eutrema salsugineum]
 dbj|BAJ34028.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45448.1| hypothetical protein EUTSA_v10010535mg [Eutrema salsugineum]
Length=331

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/331 (79%), Positives = 292/331 (88%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MA SLQ A T +QP K+  +P      RS QTV K+ G++ SPAR+TCSL S  K+ A  
Sbjct  1     MATSLQAATTFLQPAKIAASPSRSVHLRSNQTVAKSFGLESSPARLTCSLHSDFKDFAGK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              SDAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  61    CSDAAKVAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGS  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV 
Sbjct  121   EAFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVG  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
             SDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP+SFSG+FLVPSYRGSSF
Sbjct  181   SDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPDSFSGKFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  +T SKPETGEVIG
Sbjct  241   LDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKITKSKPETGEVIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  301   VFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  331



>gb|KFK28330.1| hypothetical protein AALP_AA8G502100 [Arabis alpina]
Length=332

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/332 (79%), Positives = 292/332 (88%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1     MAASLQSAATFIQSAKIATAPSRGGASLRSSQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               SDA K+AGFALATSAL+ SGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61    KCSDAVKIAGFALATSALVASGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              E F+FK GKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   SETFSFKAGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             S+DGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP+SFSG+FLVPSYRGSS
Sbjct  181   SADGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFSGKFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKVTKSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFES+QPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  301   GVFESIQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>gb|AGV54778.1| oxygen-evolving enhancer protein 1 [Phaseolus vulgaris]
Length=329

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/328 (81%), Positives = 294/328 (90%), Gaps = 0/328 (0%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
             MA+SLQ AAT MQPTKV +  R  +S Q + KA G++PS  ++TCSL S +K+LA    D
Sbjct  1     MASSLQAAATFMQPTKVPLNSRNLKSTQCISKAFGLEPSAPKLTCSLHSDLKDLAQKCLD  60

Query  233   AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
             A KLAGFALATSALLVSGA+AEGVPKRLTFDEI+SKTY+EVKG+GTANQCPTI+GG+E+F
Sbjct  61    ATKLAGFALATSALLVSGASAEGVPKRLTFDEIRSKTYLEVKGTGTANQCPTIDGGLESF  120

Query  413   AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
             AFKPGKY+AKK CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLDEIEGPFEV+ DG
Sbjct  121   AFKPGKYNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFEVTPDG  180

Query  593   SVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDP  772
             +VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSG+FLVPSYRGSSFLDP
Sbjct  181   TVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGDFLVPSYRGSSFLDP  240

Query  773   KGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFE  952
             KGRG STGYDNAVALPAGGRGDEEEL KEN K+ + S GKI  SVT +KPETGEVIGVFE
Sbjct  241   KGRGASTGYDNAVALPAGGRGDEEELAKENNKSASFSKGKIPLSVTKTKPETGEVIGVFE  300

Query  953   SLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             S+QP DTDLGAKAPK+VKIQG+WYAQLE
Sbjct  301   SVQPFDTDLGAKAPKDVKIQGVWYAQLE  328



>ref|XP_010444775.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Camelina sativa]
Length=332

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/332 (79%), Positives = 293/332 (88%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ+AAT +Q  K+  TP  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1     MAASLQSAATFLQSAKISTTPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              E F+ KPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   SETFSIKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             +SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++F+G+FLVPSYRGSS
Sbjct  181   ASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDNFTGKFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  301   GVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_002866754.1| oxygen-evolving enhancer 33 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43013.1| oxygen-evolving enhancer 33 [Arabidopsis lyrata subsp. lyrata]
Length=332

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/332 (79%), Positives = 292/332 (88%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ+ AT +Q  K+   P  G    RS Q+VGK+ G+D S AR+TCS QS  K+ A 
Sbjct  1     MAASLQSTATFLQSAKIATAPSRGSAHLRSTQSVGKSFGLDTSSARLTCSFQSDFKDFAG  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             +SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP+SF+G+FLVPSYRGSS
Sbjct  181   ASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  301   GVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>gb|AEN02470.1| oxygen-evolving enhancer protein [Camellia sinensis]
Length=333

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/334 (82%), Positives = 297/334 (89%), Gaps = 7/334 (2%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPR-----IGRSYQTVGKALGVDPS-PARITCSLQSQIKEL  214
             MAASLQ AAT+MQPTKVGV  R     + RS Q+V K  GV+ +  AR+TCS+ +  K+L
Sbjct  1     MAASLQAAATMMQPTKVGVQGRSTNVQLLRSSQSVCKVFGVEQTGSARLTCSV-TDAKDL  59

Query  215   AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  394
             A   + AAK+AGFALATSAL+VSGA+AEG PKRLTFDEI+SKTY+EVKG+GTANQCPTIE
Sbjct  60    AQKCAVAAKVAGFALATSALVVSGASAEGPPKRLTFDEIRSKTYLEVKGTGTANQCPTIE  119

Query  395   GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPF  574
             GGV+ FAFKPGKY  KKFCLEPTSFTVKA+SVSKNA PEFQ TKLMTRLTYTLDEIEGPF
Sbjct  120   GGVDKFAFKPGKYQMKKFCLEPTSFTVKADSVSKNASPEFQRTKLMTRLTYTLDEIEGPF  179

Query  575   EVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRG  754
             EVS DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF G+FLVPSYRG
Sbjct  180   EVSPDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGQFLVPSYRG  239

Query  755   SSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGE  934
             SSFLDPKGRGGSTGYD+AVALPAGGRGDEEEL KENIKN ASSTGKIT  VT SKPETGE
Sbjct  240   SSFLDPKGRGGSTGYDSAVALPAGGRGDEEELVKENIKNTASSTGKITLGVTNSKPETGE  299

Query  935   VIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VIGVFES+QPSDTDLGAK PKEVKIQG+WYAQLE
Sbjct  300   VIGVFESIQPSDTDLGAKVPKEVKIQGVWYAQLE  333



>ref|XP_003611860.1| Oxygen evolving enhancer protein [Medicago truncatula]
 gb|AES94818.1| photosystem II oxygen-evolving enhancer protein [Medicago truncatula]
Length=329

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/332 (80%), Positives = 299/332 (90%), Gaps = 8/332 (2%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MA SLQ AATLMQPTK+G+  R      +S Q++ KA G++ + A++TCSLQ    ++AH
Sbjct  1     MAVSLQAAATLMQPTKIGINNRSTTLHLKSTQSISKAFGLEHNGAKLTCSLQ----DIAH  56

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              F+D+AK+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTIEGG
Sbjct  57    RFADSAKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIEGG  116

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              ++F+FK GKY+AKKFCLEPTSFTVK+E ++KN+P +FQNTKLMTRLTYTLDEIEGPFEV
Sbjct  117   SDSFSFKSGKYNAKKFCLEPTSFTVKSEGITKNSPLDFQNTKLMTRLTYTLDEIEGPFEV  176

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             S DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEFLVPSYRGSS
Sbjct  177   SPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEFLVPSYRGSS  236

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+ ASS GKIT SVT SKPETGEVI
Sbjct  237   FLDPKGRGASTGYDNAVALPAGGRGDEEELGKENNKSAASSKGKITLSVTQSKPETGEVI  296

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  297   GVFESIQPSDTDLGAKAPKDVKIQGVWYAQLE  328



>gb|AAT65501.1| photosystem II protein [Brassica oleracea]
Length=347

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/345 (77%), Positives = 297/345 (86%), Gaps = 4/345 (1%)
 Frame = +2

Query  14    REREELTLLSDPTMAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARI  181
             R++ EL+      MAASLQ+AAT  Q  K+   P  G    RS QTVGK+ G++ S AR+
Sbjct  3     RKKLELSERHSVAMAASLQSAATFFQSAKISTAPSRGSAHLRSAQTVGKSFGLETSSARL  62

Query  182   TCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKG  361
             TCS QS IK+ A   SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG
Sbjct  63    TCSYQSDIKDFAGKCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKG  122

Query  362   SGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRL  541
             +GTANQCPTI+GG E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRL
Sbjct  123   TGTANQCPTIDGGSETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRL  182

Query  542   TYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESF  721
             T TLDEIEGPFEVSSDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++F
Sbjct  183   TCTLDEIEGPFEVSSDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDNF  242

Query  722   SGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITF  901
             +G+FLVPSYRG SFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT 
Sbjct  243   TGKFLVPSYRGPSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITL  302

Query  902   SVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
              VT SKPETGEVIGVF+SLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  303   KVTKSKPETGEVIGVFQSLQPSDTDLGAKVPKDVKIQGVWYGQLE  347



>emb|CDY50981.1| BnaC02g48890D [Brassica napus]
Length=332

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/332 (79%), Positives = 293/332 (88%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ+A+T +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1     MAASLQSASTFLQSAKIITAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             SSDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++F+G+FLVPSYRGSS
Sbjct  181   SSDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDNFTGKFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKVTKSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  301   GVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>gb|AFW69213.1| oxygen-evolving enhancer protein 1 [Zea mays]
Length=373

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/336 (79%), Positives = 293/336 (87%), Gaps = 7/336 (2%)
 Frame = +2

Query  50    TMAASLQT--AATLMQPTKVG-----VTPRIGRSYQTVGKALGVDPSPARITCSLQSQIK  208
             TMAASLQ   AATLMQP K+G      +    R    + +A GVD   ARITCSLQS ++
Sbjct  38    TMAASLQVQAAATLMQPAKIGGRAPSASLPSSRPSSQLARAFGVDAGAARITCSLQSDVR  97

Query  209   ELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPT  388
             ++A    DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTY+EVKG+GTANQCPT
Sbjct  98    DVASKCVDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYLEVKGTGTANQCPT  157

Query  389   IEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEG  568
             I+GGV++F FKPGKY  KK CLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEG
Sbjct  158   IDGGVDSFPFKPGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEG  217

Query  569   PFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSY  748
             P EV+SDG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVATGKP+SF G FLVPSY
Sbjct  218   PLEVASDGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPDSFGGPFLVPSY  277

Query  749   RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  928
             RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN ASSTG IT SVT S P+T
Sbjct  278   RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNAASSTGNITLSVTKSNPDT  337

Query  929   GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  338   GEVIGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE  373



>ref|XP_010484624.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Camelina sativa]
Length=332

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/332 (79%), Positives = 292/332 (88%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1     MAASLQSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              E F+ KPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   SETFSIKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             +SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++F+G+FLVPSYRGSS
Sbjct  181   ASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDNFTGKFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  301   GVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|NP_001130585.1| uncharacterized protein LOC100191684 [Zea mays]
 gb|ACF78862.1| unknown [Zea mays]
 gb|ACF88206.1| unknown [Zea mays]
 gb|ACG31799.1| oxygen-evolving enhancer protein 1 [Zea mays]
 gb|ACN29302.1| unknown [Zea mays]
 gb|ACN33484.1| unknown [Zea mays]
Length=335

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/335 (79%), Positives = 292/335 (87%), Gaps = 7/335 (2%)
 Frame = +2

Query  53    MAASLQT--AATLMQPTKVG-----VTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKE  211
             MAASLQ   AATLMQP K+G      +    R    + +A GVD   ARITCSLQS +++
Sbjct  1     MAASLQVQAAATLMQPAKIGGRAPSASLPSSRPSSQLARAFGVDAGAARITCSLQSDVRD  60

Query  212   LAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTI  391
             +A    DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTY+EVKG+GTANQCPTI
Sbjct  61    VASKCVDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYLEVKGTGTANQCPTI  120

Query  392   EGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGP  571
             +GGV++F FKPGKY  KK CLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEGP
Sbjct  121   DGGVDSFPFKPGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEGP  180

Query  572   FEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYR  751
              EV+SDG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVATGKP+SF G FLVPSYR
Sbjct  181   LEVASDGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPDSFGGPFLVPSYR  240

Query  752   GSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETG  931
             GSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN ASSTG IT SVT S P+TG
Sbjct  241   GSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNAASSTGNITLSVTKSNPDTG  300

Query  932   EVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             EVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  301   EVIGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE  335



>gb|AAM65169.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
Length=332

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/332 (79%), Positives = 290/332 (87%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1     MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              E F+FKPGKYS KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   SETFSFKPGKYSGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             +SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP+SF+G+FLVPSYRGSS
Sbjct  181   ASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  301   GVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>gb|EMS63035.1| Oxygen-evolving enhancer protein 1, chloroplastic [Triticum urartu]
 gb|EMT33794.1| Oxygen-evolving enhancer protein 1, chloroplastic [Aegilops tauschii]
Length=328

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/328 (81%), Positives = 289/328 (88%), Gaps = 2/328 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
             MAASLQ AATLM P K+G      R    V +A GVD + ARITCSLQS I+E+A   +D
Sbjct  1     MAASLQAAATLM-PAKIGGRASSARPSSHVARAFGVD-AGARITCSLQSDIREVASKCAD  58

Query  233   AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
             AAK+AGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++F
Sbjct  59    AAKMAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSF  118

Query  413   AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
              FK GKY  KKFCLEPTSFTVKAE + KN PP FQ TKLMTRLTYTLDE+EGP EV +DG
Sbjct  119   PFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPAFQKTKLMTRLTYTLDEMEGPLEVGADG  178

Query  593   SVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDP  772
             ++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVATGKPESFSG FLVPSYRGSSFLDP
Sbjct  179   TLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPESFSGPFLVPSYRGSSFLDP  238

Query  773   KGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFE  952
             KGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN +SSTG IT SVT SKPETGEVIGVFE
Sbjct  239   KGRGGSTGYDNAVALPAGGRGDEEELAKENVKNASSSTGNITLSVTKSKPETGEVIGVFE  298

Query  953   SLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             S+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  299   SVQPSDTDLGAKAPKDVKIQGVWYAQLE  326



>dbj|BAJ89638.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85472.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=328

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/328 (81%), Positives = 289/328 (88%), Gaps = 2/328 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
             MAASLQ AATLM P K+G      R    V +A GVD + ARITCSLQS I+E+A   +D
Sbjct  1     MAASLQAAATLM-PAKIGGRASSVRPSSHVARAFGVDAA-ARITCSLQSDIREVASKCAD  58

Query  233   AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
             AAK+AGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++F
Sbjct  59    AAKMAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSF  118

Query  413   AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
              FK GKY  KKFCLEPTSFTVKAE + KN PP FQ TKLMTRLTYTLDE+EGP EV +DG
Sbjct  119   PFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPAFQKTKLMTRLTYTLDEMEGPLEVGADG  178

Query  593   SVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDP  772
             ++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVATGKPESFSG FLVPSYRGSSFLDP
Sbjct  179   TLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPESFSGPFLVPSYRGSSFLDP  238

Query  773   KGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFE  952
             KGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN +SSTG IT SVT SKPETGEVIGVFE
Sbjct  239   KGRGGSTGYDNAVALPAGGRGDEEELAKENVKNASSSTGNITLSVTKSKPETGEVIGVFE  298

Query  953   SLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             S+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  299   SVQPSDTDLGAKAPKDVKIQGVWYAQLE  326



>ref|NP_201458.1| PS II oxygen-evolving complex 1 [Arabidopsis thaliana]
 sp|P23321.2|PSBO1_ARATH RecName: Full=Oxygen-evolving enhancer protein 1-1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=Manganese-stabilizing protein 
1; Short=MSP-1; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL11619.1|AF424626_1 AT5g66570/K1F13_25 [Arabidopsis thaliana]
 emb|CAA75629.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
 dbj|BAB10933.1| 33 kDa polypeptide of oxygen-evolving complex [Arabidopsis thaliana]
 gb|AAK96492.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
 gb|AAL31251.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
 gb|AED98230.1| PS II oxygen-evolving complex 1 [Arabidopsis thaliana]
Length=332

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/332 (78%), Positives = 290/332 (87%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1     MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             +SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP+SF+G+FLVPSYRGSS
Sbjct  181   ASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  301   GVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>gb|AAM96957.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
 gb|AAN15726.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
Length=332

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/332 (78%), Positives = 289/332 (87%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K    
Sbjct  1     MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKNFTG  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             +SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP+SF+G+FLVPSYRGSS
Sbjct  181   ASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  301   GVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>gb|EYU44326.1| hypothetical protein MIMGU_mgv1a009768mg [Erythranthe guttata]
Length=332

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/331 (82%), Positives = 302/331 (91%), Gaps = 3/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MA SLQ AATLMQPTKVGV+ R     RS Q V ++ G +P+ +R+TCSLQS +K+LA  
Sbjct  1     MATSLQAAATLMQPTKVGVSARSSLQLRSAQNVSRSFGFEPAGSRLTCSLQSDLKDLAQK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              +DAAK+AGFALATSAL+ SGA+AEGVPKRLTFDEIQSKTYMEVKG+GTANQCPT++GG 
Sbjct  61    CTDAAKIAGFALATSALVASGASAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTLDGGS  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             ++FAFK GKY+AKKFCLEPTSFTVKAE VSKN+P EFQ TKLMTRLTYTLDEIEGPFEVS
Sbjct  121   DSFAFKSGKYTAKKFCLEPTSFTVKAEGVSKNSPAEFQKTKLMTRLTYTLDEIEGPFEVS  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
              DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF+GEFLVPSYRGSSF
Sbjct  181   QDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFTGEFLVPSYRGSSF  240

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN KNVA+ TGKIT SVT SKPETGEVIG
Sbjct  241   LDPKGRGGSTGYDNAVALPAGGRGDEEELEKENNKNVAALTGKITLSVTKSKPETGEVIG  300

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFES+QPSDTDLG+KAPK+VKIQG+WYAQL+
Sbjct  301   VFESIQPSDTDLGSKAPKDVKIQGVWYAQLD  331



>sp|O49079.1|PSBO_FRIAG RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Fritillaria agrestis]
 gb|AAC04808.1| photosystem II oxygen evolving complex protein 1 precursor [Fritillaria 
agrestis]
Length=329

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/330 (81%), Positives = 294/330 (89%), Gaps = 3/330 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPA-RITCSLQSQIKELAHNF  226
             MA+SLQ AATL+ P KVG   R   RS   + KA G D S A R+TCS+ S ++++A   
Sbjct  1     MASSLQAAATLI-PAKVGAPARTHLRSNSHLSKAFGFDNSTAGRLTCSINSDLRDIAQKC  59

Query  227   SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  406
             +DAAKLAGFALATSAL++SGA+AEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG E
Sbjct  60    TDAAKLAGFALATSALVISGASAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGTE  119

Query  407   NFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSS  586
             +F +K GKY+ KK CLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEGPFEV+ 
Sbjct  120   SFGYKTGKYTLKKLCLEPTSFTVKAEGINKNAPPEFQKTKLMTRLTYTLDEIEGPFEVAP  179

Query  587   DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFL  766
             DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVATGKPESFSG +LVPSYRGSSFL
Sbjct  180   DGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPESFSGSYLVPSYRGSSFL  239

Query  767   DPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGV  946
             DPKGRGGS GYDNAVALPAGGRGDEEEL KENIK+V+SSTGKIT SVT SKPETGEVIGV
Sbjct  240   DPKGRGGSAGYDNAVALPAGGRGDEEELVKENIKDVSSSTGKITLSVTKSKPETGEVIGV  299

Query  947   FESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             FES+QPSDTDLG+KAPK+VKIQGIWYAQLE
Sbjct  300   FESIQPSDTDLGSKAPKDVKIQGIWYAQLE  329



>gb|AAK49614.1|AF372898_1 AT5g66570/K1F13_25 [Arabidopsis thaliana]
Length=332

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/332 (78%), Positives = 290/332 (87%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1     MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             +SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP+SF+G+FLVPSYRGSS
Sbjct  181   ASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNSAASVGEITLKVTKSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  301   GVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>gb|AAL08257.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
Length=332

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/332 (78%), Positives = 290/332 (87%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1     MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               SDA K+AGFALA+SAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KCSDAVKIAGFALASSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             +SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP+SF+G+FLVPSYRGSS
Sbjct  181   ASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  301   GVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>gb|AFH40666.1| chloroplast oxygen-evolving enhancer protein 1, partial [Saccharum 
hybrid cultivar]
Length=332

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/337 (80%), Positives = 287/337 (85%), Gaps = 14/337 (4%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIGRS---------YQTVGKALGVDPSPARITCSLQSQI  205
             MAASLQ AATLMQP K+G     GR+            + +A GVD   ARITCSLQS  
Sbjct  1     MAASLQAAATLMQPAKIG-----GRAPSASLPSRSSSHLARAFGVDAGAARITCSLQSDF  55

Query  206   KELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCP  385
             + +A    DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTY+EVKG+GTANQCP
Sbjct  56    RGVASKCVDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYLEVKGTGTANQCP  115

Query  386   TIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIE  565
             T +GGVE F FK GKY  KK CLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIE
Sbjct  116   TTDGGVEAFPFKAGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIE  175

Query  566   GPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPS  745
             GP EV SDG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVATGKPESF G FLVPS
Sbjct  176   GPLEVGSDGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPESFGGPFLVPS  235

Query  746   YRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPE  925
             YRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN ASSTG IT SVT S PE
Sbjct  236   YRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNAASSTGNITLSVTKSNPE  295

Query  926   TGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             TGEVIGVFES+QPSDTDLGAKAPK+VKIQGIWYAQLE
Sbjct  296   TGEVIGVFESVQPSDTDLGAKAPKDVKIQGIWYAQLE  332



>ref|XP_008647514.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACG31595.1| oxygen-evolving enhancer protein 1 [Zea mays]
 gb|ACN32168.1| unknown [Zea mays]
 gb|AFW75930.1| oxygen-evolving enhancer protein 1 [Zea mays]
Length=329

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/338 (80%), Positives = 288/338 (85%), Gaps = 19/338 (6%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIGR----------SYQTVGKALGVDPSPARITCSLQSQ  202
             MAASLQ AATLMQP K+G     GR          S Q   +A GVD   ARITCSLQ  
Sbjct  1     MAASLQAAATLMQPAKIG-----GRAPFASLPSRPSSQLACRAFGVDAGAARITCSLQ--  53

Query  203   IKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQC  382
               ++A    DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQC
Sbjct  54    --DVASRCVDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYMEVKGTGTANQC  111

Query  383   PTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEI  562
             PTI+GGVE+F FK GKY  KK CLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEI
Sbjct  112   PTIDGGVESFPFKAGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEI  171

Query  563   EGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVP  742
             EGP EV SDG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVATGKPESF G FLVP
Sbjct  172   EGPLEVGSDGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPESFGGPFLVP  231

Query  743   SYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKP  922
             SYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN ASSTG IT SVT S P
Sbjct  232   SYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNAASSTGNITLSVTKSNP  291

Query  923   ETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             ETGEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  292   ETGEVIGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE  329



>ref|XP_009149414.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Brassica rapa]
Length=333

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/333 (78%), Positives = 294/333 (88%), Gaps = 5/333 (2%)
 Frame = +2

Query  53    MAASLQ-TAATLMQPTKVGVT-PRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELA  217
             MA SL+ T AT +QP K+  + P      RS QTVGK+ G++ SPAR+TCS+ S  K+  
Sbjct  1     MATSLKATTATFLQPAKIATSSPSRNVHLRSNQTVGKSFGLESSPARLTCSIHSDFKDFV  60

Query  218   HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
                SDAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61    GKCSDAAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  398   GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
             G E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121   GSETFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  180

Query  578   VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGS  757
             VSSDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++FSG+FLVPSYRGS
Sbjct  181   VSSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPDNFSGKFLVPSYRGS  240

Query  758   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEV  937
             SFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  +T SKPETGEV
Sbjct  241   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKITKSKPETGEV  300

Query  938   IGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             IGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  301   IGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  333



>gb|AAK96774.1| 33 kDa polypeptide of oxygen-evolving complex [Arabidopsis thaliana]
Length=332

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/332 (78%), Positives = 289/332 (87%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1     MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             +SDGSV F+E+DGIDYAAVTVQLPG ERVPFLFT+KQL A+GKP+SF+G+FLVPSYRGSS
Sbjct  181   ASDGSVNFKEEDGIDYAAVTVQLPGCERVPFLFTVKQLDASGKPDSFTGKFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  301   GVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>gb|ABQ52657.1| chloroplast oxygen-evolving enhancer protein 1 [Leymus chinensis]
Length=328

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/328 (80%), Positives = 288/328 (88%), Gaps = 2/328 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
             MAASLQ AATLM P K+G      R    V +A GVD + ARITCSLQS I+E+A   ++
Sbjct  1     MAASLQAAATLM-PAKIGGRASSARPSSHVARAFGVD-AGARITCSLQSDIREVASKCAE  58

Query  233   AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
             AAK+AGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++F
Sbjct  59    AAKMAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSF  118

Query  413   AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
              FK GKY  KKFCLEPTSFTVKAE + KN PP FQ TKLMTRLTYTLDE+EGP EV +DG
Sbjct  119   PFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPAFQKTKLMTRLTYTLDEMEGPLEVGADG  178

Query  593   SVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDP  772
             ++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVATGKPESFSG FLVPSYRGSSFLDP
Sbjct  179   TLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPESFSGPFLVPSYRGSSFLDP  238

Query  773   KGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFE  952
             KGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN +SSTG IT SVT SKPETGEVIGVFE
Sbjct  239   KGRGGSTGYDNAVALPAGGRGDEEELAKENVKNASSSTGNITLSVTKSKPETGEVIGVFE  298

Query  953   SLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
              +QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  299   RVQPSDTDLGAKAPKDVKIQGVWYAQLE  326



>ref|XP_010465252.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Camelina sativa]
Length=331

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/332 (79%), Positives = 291/332 (88%), Gaps = 5/332 (2%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1     MAASLQSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               SDA K+AGFALATSAL+VSGA+AE  PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61    KCSDAVKIAGFALATSALVVSGASAE-APKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  119

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              E F+ KPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  120   SETFSIKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  179

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             +SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++F+G+FLVPSYRGSS
Sbjct  180   ASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDNFTGKFLVPSYRGSS  239

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVI
Sbjct  240   FLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVI  299

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  300   GVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  331



>ref|XP_010503753.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Camelina sativa]
Length=336

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/336 (77%), Positives = 289/336 (86%), Gaps = 8/336 (2%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG--------RSYQTVGKALGVDPSPARITCSLQSQIK  208
             MA SLQ AAT +QP K+  +            RS QTV K+ G++ S AR TCSLQS +K
Sbjct  1     MATSLQAAATFLQPAKIAASSSSSSPSRNVHLRSNQTVAKSFGLESSSARRTCSLQSDLK  60

Query  209   ELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPT  388
             + A   S+AAK+AGF LATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPT
Sbjct  61    DFAGKCSEAAKIAGFTLATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPT  120

Query  389   IEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEG  568
             I+GG E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEG
Sbjct  121   IDGGSETFSFKPGKYTGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEG  180

Query  569   PFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSY  748
             PFEV SDGSVKF+E DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKPE+FSG+FLVPSY
Sbjct  181   PFEVGSDGSVKFKEADGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPENFSGKFLVPSY  240

Query  749   RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPET  928
             RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G IT  +T SKPET
Sbjct  241   RGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGDITLKITKSKPET  300

Query  929   GEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GEVIGVFESLQPSDTDLGAK PK+VKIQG+WY Q+E
Sbjct  301   GEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQIE  336



>emb|CAA36675.1| 33 kDa oxygen-evolving protein [Arabidopsis thaliana]
Length=332

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/332 (78%), Positives = 288/332 (87%), Gaps = 4/332 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
             MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1     MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  221   NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTAN  PTI+GG
Sbjct  61    KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANHSPTIDGG  120

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
              E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121   SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSS  760
             +SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP+SF+G+FLVPSYRGSS
Sbjct  181   ASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKFLVPSYRGSS  240

Query  761   FLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  940
             FLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVI
Sbjct  241   FLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVI  300

Query  941   GVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             GVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  301   GVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_010424899.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Camelina sativa]
Length=334

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/334 (77%), Positives = 290/334 (87%), Gaps = 6/334 (2%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG------RSYQTVGKALGVDPSPARITCSLQSQIKEL  214
             MA SLQ AAT +QP K+  +          RS QT+GK+ G++ S AR+TCSL S +K+ 
Sbjct  1     MATSLQAAATFLQPAKIAASSSPPSRSVHLRSNQTIGKSFGLESSSARLTCSLHSDLKDF  60

Query  215   AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  394
             A   S+ AK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+
Sbjct  61    AGKCSEVAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTID  120

Query  395   GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPF  574
             GG E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPF
Sbjct  121   GGSETFSFKPGKYTGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPF  180

Query  575   EVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRG  754
             EV  DGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKPE+FSG+FLVPSYRG
Sbjct  181   EVGPDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPENFSGKFLVPSYRG  240

Query  755   SSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGE  934
             SSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G IT  +T SKPETGE
Sbjct  241   SSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGDITLKITKSKPETGE  300

Query  935   VIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VIGVFESLQPSDTDLGAK PK+VKIQG+WY Q+E
Sbjct  301   VIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQIE  334



>sp|P12359.1|PSBO_SPIOL RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Spinacia oleracea]
Length=332

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/331 (80%), Positives = 292/331 (88%), Gaps = 4/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDP--SPARITCSLQSQIKELAHN  223
             MAASLQ + T +QPTKV     +  RS Q V KA GV+   S  R++ SLQS +KELA+ 
Sbjct  1     MAASLQASTTFLQPTKVASRNTLQLRSTQNVCKAFGVESASSGGRLSLSLQSDLKELANK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
               DA KLAG ALATSAL+ SGANAEG  KRLT+DEIQSKTY+EVKG+GTANQCPT+EGGV
Sbjct  61    CVDATKLAGLALATSALIASGANAEG-GKRLTYDEIQSKTYLEVKGTGTANQCPTVEGGV  119

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             ++FAFKPGKY+AKKFCLEPT F VKAE +SKN+ P+FQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  120   DSFAFKPGKYTAKKFCLEPTKFAVKAEGISKNSGPDFQNTKLMTRLTYTLDEIEGPFEVS  179

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
             SDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSG+FLVPSYRGSSF
Sbjct  180   SDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGDFLVPSYRGSSF  239

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN KNVASS G IT SVT SKPETGEVIG
Sbjct  240   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKNVASSKGTITLSVTSSKPETGEVIG  299

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VF+SLQPSDTDLGAK PK+VKI+G+WYAQLE
Sbjct  300   VFQSLQPSDTDLGAKVPKDVKIEGVWYAQLE  330



>emb|CAA29062.1| unnamed protein product [Spinacia oleracea]
 prf||1404364A protein 33kD
Length=331

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/331 (80%), Positives = 292/331 (88%), Gaps = 4/331 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDP--SPARITCSLQSQIKELAHN  223
             MAASLQ + T +QPTKV     +  RS Q V KA GV+   S  R++ SLQS +KELA+ 
Sbjct  1     MAASLQASTTFLQPTKVASRNTLQLRSTQNVCKAFGVESASSGGRLSLSLQSDLKELANK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
               DA KLAG ALATSAL+ SGANAEG  KRLT+DEIQSKTY+EVKG+GTANQCPT+EGGV
Sbjct  61    CVDATKLAGLALATSALIASGANAEG-GKRLTYDEIQSKTYLEVKGTGTANQCPTVEGGV  119

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             ++FAFKPGKY+AKKFCLEPT F VKAE +SKN+ P+FQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  120   DSFAFKPGKYTAKKFCLEPTKFAVKAEGISKNSGPDFQNTKLMTRLTYTLDEIEGPFEVS  179

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
             SDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSG+FLVPSYRGSSF
Sbjct  180   SDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGDFLVPSYRGSSF  239

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN KNVASS G IT SVT SKPETGEVIG
Sbjct  240   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKNVASSKGTITLSVTSSKPETGEVIG  299

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VF+SLQPSDTDLGAK PK+VKI+G+WYAQLE
Sbjct  300   VFQSLQPSDTDLGAKVPKDVKIEGVWYAQLE  330



>sp|P85194.1|PSBO_HELAN RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Helianthus annuus]
Length=324

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/328 (79%), Positives = 291/328 (89%), Gaps = 6/328 (2%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  229
             MAASLQ AAT M PT      R+  +S  ++ KA G++ + ++++CSLQ+ +K+ A   +
Sbjct  1     MAASLQAAATFMTPTS-----RVQLKSSPSICKAFGIESTGSKVSCSLQADLKDFAQKCT  55

Query  230   DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
             DAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV  
Sbjct  56    DAAKIAGFALATSALVVSGASAEGSPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVNG  115

Query  410   FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
             FA KPGKY+A+KFCLEPTSFTVKAE +SKN+ PEFQ TKLMTRLTYTLDEIEGP EVSSD
Sbjct  116   FAVKPGKYNAQKFCLEPTSFTVKAEGISKNSAPEFQKTKLMTRLTYTLDEIEGPLEVSSD  175

Query  590   GSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLD  769
             G++KFEEKDGIDYAAVTVQLPGGERVPFLFTIK+LVATGKPESF G FLVPSYRGSSFLD
Sbjct  176   GTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKELVATGKPESFGGNFLVPSYRGSSFLD  235

Query  770   PKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVF  949
             PKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN A+  G+ITFSVT SKPETGEVIGVF
Sbjct  236   PKGRGGSTGYDNAVALPAGGRGDEEELLKENIKNTAAGKGEITFSVTSSKPETGEVIGVF  295

Query  950   ESLQPSDTDLGAKAPKEVKIQGIWYAQL  1033
             ES+QPSDTDLGAKAPK+VKIQG+WYAQL
Sbjct  296   ESIQPSDTDLGAKAPKDVKIQGVWYAQL  323



>ref|XP_010515458.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Camelina sativa]
Length=333

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/333 (77%), Positives = 288/333 (86%), Gaps = 5/333 (2%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIGR-----SYQTVGKALGVDPSPARITCSLQSQIKELA  217
             MA SL  AAT +QP K+  +    R     S QTVGK+ G++ S  R+TCSL S +KE A
Sbjct  1     MATSLHAAATFLQPAKIAASSSPSRNVHFRSNQTVGKSFGLESSSPRLTCSLHSDLKEFA  60

Query  218   HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
                S++AK+A FALATSAL+VSGA+AEG P+RLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61    GKCSESAKIACFALATSALVVSGASAEGAPRRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  398   GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
             G E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121   GSETFSFKPGKYTGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  180

Query  578   VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGS  757
             V SDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKPE+FSG+FLVPSYRGS
Sbjct  181   VGSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPENFSGKFLVPSYRGS  240

Query  758   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEV  937
             SFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A S G IT  +T SKPETGEV
Sbjct  241   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAGSVGDITLKITKSKPETGEV  300

Query  938   IGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             IGVFESLQPSDTDLGAK PK+VKIQG+WY Q+E
Sbjct  301   IGVFESLQPSDTDLGAKVPKDVKIQGVWYGQIE  333



>gb|AFK43771.1| unknown [Lotus japonicus]
Length=332

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/335 (78%), Positives = 293/335 (87%), Gaps = 11/335 (3%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIGRS-------YQTVGKALGVDPSPARITCSLQSQIKE  211
             MA SLQ AATLMQPTKV        S        Q++ KA G++ + A++TC+LQ    +
Sbjct  1     MATSLQAAATLMQPTKVAAITSTRSSSTLQLKPTQSISKAFGLESTGAKLTCNLQ----D  56

Query  212   LAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTI  391
              A+  ++ AK+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI
Sbjct  57    FANKCAETAKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTI  116

Query  392   EGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGP  571
             EGGV++FAFK GKYSAKK CLEPTSFTVKAE V+KN+P +FQNTKLMTRLTYTLDEIEGP
Sbjct  117   EGGVDSFAFKAGKYSAKKICLEPTSFTVKAEGVTKNSPLDFQNTKLMTRLTYTLDEIEGP  176

Query  572   FEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYR  751
             FEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVA+GKPESFSG+FLVPSYR
Sbjct  177   FEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVASGKPESFSGDFLVPSYR  236

Query  752   GSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETG  931
             GSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+ +SS GKIT SVT SKPETG
Sbjct  237   GSSFLDPKGRGTSTGYDNAVALPAGGRGDEEELAKENNKSASSSKGKITLSVTQSKPETG  296

Query  932   EVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             E+IGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  297   EIIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLE  331



>dbj|BAG70021.1| 33 kDa precursor protein of the oxygen-evolving complex [Salicornia 
europaea]
Length=330

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/329 (79%), Positives = 288/329 (88%), Gaps = 1/329 (0%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  229
             MA SLQ + T +QPTKV     +  RS   V KA GVDP+  R++ SLQS +K+LA    
Sbjct  1     MATSLQASTTFLQPTKVASRNSLQLRSSPNVCKAFGVDPTAGRVSLSLQSDLKDLASKCV  60

Query  230   DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
             DA KLAG ALATSAL+ SGA+A+G  KRLT+DEIQSKTY+EVKG+GTANQCPTIEGG+E+
Sbjct  61    DATKLAGLALATSALIASGASADGGTKRLTYDEIQSKTYLEVKGTGTANQCPTIEGGLES  120

Query  410   FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
             F FK GKY+AKKFCLEPT FTVKAE +SKNAPP+FQ+TKLMTRLTYTLDE+EGPFEVSSD
Sbjct  121   FGFKAGKYTAKKFCLEPTKFTVKAEGISKNAPPDFQDTKLMTRLTYTLDEMEGPFEVSSD  180

Query  590   GSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLD  769
             G+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEFLVPSYRGSSFLD
Sbjct  181   GTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEFLVPSYRGSSFLD  240

Query  770   PKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVF  949
             PKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN ASS G IT SV+ SKPETGEVIGVF
Sbjct  241   PKGRGGSTGYDNAVALPAGGRGDEEELLKENNKNTASSKGTITLSVSKSKPETGEVIGVF  300

Query  950   ESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             +SLQPSDTDLGAK PK+VKI+GIWYAQLE
Sbjct  301   QSLQPSDTDLGAKTPKDVKIEGIWYAQLE  329



>ref|XP_003557544.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Brachypodium distachyon]
Length=330

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/328 (79%), Positives = 285/328 (87%), Gaps = 0/328 (0%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
             MAASLQ AATLMQP K+G +     +      A     +   I+CSL S ++E+A   +D
Sbjct  1     MAASLQAAATLMQPAKMGRSASSSSAVLLPSSARPSSHAARTISCSLTSDLREVATKCAD  60

Query  233   AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
             AAKLAGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV+ F
Sbjct  61    AAKLAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDAF  120

Query  413   AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
              FK GKY  KKFCLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEGP EV++DG
Sbjct  121   PFKAGKYEMKKFCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEGPLEVAADG  180

Query  593   SVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDP  772
             ++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVATGKPESFSG FLVPSYRGSSFLDP
Sbjct  181   TLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPESFSGPFLVPSYRGSSFLDP  240

Query  773   KGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFE  952
             KGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN +SS G IT SVT SKPETGEVIGVFE
Sbjct  241   KGRGGSTGYDNAVALPAGGRGDEEELAKENVKNASSSQGNITLSVTKSKPETGEVIGVFE  300

Query  953   SLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             S+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  301   SVQPSDTDLGAKAPKDVKIQGVWYAQLE  328



>ref|XP_010557854.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Tarenaya hassleriana]
Length=317

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/328 (79%), Positives = 283/328 (86%), Gaps = 11/328 (3%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
             MAASLQ AAT +  +K+   P  G   ++           +RITCS+QS +K+ A   SD
Sbjct  1     MAASLQAAATFLHQSKISAAPSRGGHLRS-----------SRITCSIQSDLKDFAGKCSD  49

Query  233   AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
              AK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG E F
Sbjct  50    TAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGSETF  109

Query  413   AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
              FK G+YS KKFC EPTSFTVKAE +SKNAPPEFQNTKLMTRLTYTLDEIEGPF+VSSDG
Sbjct  110   EFKAGQYSGKKFCFEPTSFTVKAEGISKNAPPEFQNTKLMTRLTYTLDEIEGPFDVSSDG  169

Query  593   SVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDP  772
             +VKF EKDGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP+SFSG+FLVPSYRGSSFLDP
Sbjct  170   TVKFVEKDGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPDSFSGKFLVPSYRGSSFLDP  229

Query  773   KGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFE  952
             KGRGGSTGYDNAVALPAGGRGDEEEL KENIKN ASSTG+IT  VT SKPETGE+IGVFE
Sbjct  230   KGRGGSTGYDNAVALPAGGRGDEEELTKENIKNAASSTGEITLKVTKSKPETGELIGVFE  289

Query  953   SLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             S+QPSDTDLGAK PK+VKIQGIWY QLE
Sbjct  290   SIQPSDTDLGAKVPKDVKIQGIWYGQLE  317



>ref|XP_010924332.1| PREDICTED: LOW QUALITY PROTEIN: oxygen-evolving enhancer protein 
1, chloroplastic-like [Elaeis guineensis]
Length=334

 Score =   523 bits (1346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/334 (80%), Positives = 291/334 (87%), Gaps = 7/334 (2%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPR--IGRSYQT---VGKALGVDPSPARITCSLQSQIKELA  217
             MAASLQ AATLMQP+ VG T R   G+  +T   + K  G +P+ AR+TCSLQ+ +++L 
Sbjct  1     MAASLQAAATLMQPSTVGATRRSLAGQQLRTSSHLSKTFGFEPAGARLTCSLQTDLRDLV  60

Query  218   HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
                +DA KLAGFALATSALLV+GANAEGVP RLT+DEIQSKTYMEVKG GTANQCPTIEG
Sbjct  61    QKCADATKLAGFALATSALLVAGANAEGVPSRLTYDEIQSKTYMEVKGIGTANQCPTIEG  120

Query  398   GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
             GV++FAFKPGKY  KKFCLEPTSFTVKAESV+KNAPPEFQ TKLMT LTYTLDEIEGP E
Sbjct  121   GVDSFAFKPGKYQMKKFCLEPTSFTVKAESVNKNAPPEFQKTKLMTCLTYTLDEIEGPLE  180

Query  578   VSSDGSVKFEEKDGIDYAAVTVQLPGGERV-PFLFTIKQLVATGKPESFSGEFLVPSYRG  754
             VS DG+VKFEEKDGIDYAAVTV+LPGGERV PFLFTIKQLVA+GKPE+F  +FLVPSYRG
Sbjct  181   VSPDGTVKFEEKDGIDYAAVTVRLPGGERVPPFLFTIKQLVASGKPENFGVQFLVPSYRG  240

Query  755   SSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGE  934
             SSFLDP  RGGSTGYDNAVALPAGGRGDEEEL KENIKN +SSTG IT SVT SKPE+GE
Sbjct  241   SSFLDPX-RGGSTGYDNAVALPAGGRGDEEELTKENIKNSSSSTGTITLSVTKSKPESGE  299

Query  935   VIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VIGVFESLQPSDTDLGAK PK+VKIQGI YAQLE
Sbjct  300   VIGVFESLQPSDTDLGAKVPKDVKIQGIRYAQLE  333



>emb|CDY26519.1| BnaC01g23800D [Brassica napus]
Length=373

 Score =   524 bits (1349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/332 (77%), Positives = 291/332 (88%), Gaps = 5/332 (2%)
 Frame = +2

Query  53    MAASLQ-TAATLMQPTKVGVT-PRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELA  217
             MA SL+ T AT +QP K+  + P      RS QTVGK+ G++ SPAR+TCS+ S  K+  
Sbjct  1     MATSLKATTATFLQPAKIATSSPSRNVHLRSNQTVGKSSGLESSPARLTCSIHSDFKDFV  60

Query  218   HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
                SDAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61    GKCSDAAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  398   GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
             G E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121   GSETFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  180

Query  578   VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGS  757
             VSSDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++FSG+FLVPSYRGS
Sbjct  181   VSSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPDNFSGKFLVPSYRGS  240

Query  758   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEV  937
             SFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  +T SKPETGEV
Sbjct  241   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKITKSKPETGEV  300

Query  938   IGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  1033
             IGVFESLQPSDTDLGAK PK+VKIQG+   +L
Sbjct  301   IGVFESLQPSDTDLGAKVPKDVKIQGVCATEL  332



>emb|CDY33308.1| BnaA01g19750D [Brassica napus]
Length=381

 Score =   523 bits (1348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/332 (77%), Positives = 291/332 (88%), Gaps = 5/332 (2%)
 Frame = +2

Query  53    MAASLQ-TAATLMQPTKVGVT-PRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELA  217
             MA SL+ T AT +QP K+  + P      RS QTVGK+ G++ SPAR+TCS+ S  K+  
Sbjct  1     MATSLKATTATFLQPAKIATSSPSRNVHLRSNQTVGKSFGLESSPARLTCSIHSDFKDFV  60

Query  218   HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
                SDAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61    GKCSDAAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  398   GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
             G E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121   GSETFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  180

Query  578   VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGS  757
             VSSDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++FSG+FLVPSYRGS
Sbjct  181   VSSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPDNFSGKFLVPSYRGS  240

Query  758   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEV  937
             SFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN A+S G+IT  +T SKPETGEV
Sbjct  241   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKITKSKPETGEV  300

Query  938   IGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  1033
             IGVFESLQPSDTDLGAK PK+VKIQG+   +L
Sbjct  301   IGVFESLQPSDTDLGAKVPKDVKIQGVCATEL  332



>emb|CAN61828.1| hypothetical protein VITISV_027630 [Vitis vinifera]
Length=312

 Score =   519 bits (1336),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 261/331 (79%), Positives = 280/331 (85%), Gaps = 23/331 (7%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MAASLQ AATLMQPTKVGV  R     RS Q+V KA G++P+ AR TCSLQ+ +K L   
Sbjct  1     MAASLQAAATLMQPTKVGVPTRTSLQLRSSQSVCKAFGLEPAGARFTCSLQADLKGLGSQ  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
                                 GA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61    --------------------GASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  100

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             ++FAFK GKY  KKFCLEPTSFTVKAE VSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  101   DSFAFKSGKYQLKKFCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  160

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
             SDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+ F GEFLVPSYRGSSF
Sbjct  161   SDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDKFGGEFLVPSYRGSSF  220

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL+KENIK+ +SSTGKIT SVT SKPETGEVIG
Sbjct  221   LDPKGRGGSTGYDNAVALPAGGRGDEEELKKENIKDASSSTGKITLSVTKSKPETGEVIG  280

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFES+QPSDTDLGAK PKEVKIQG WY QLE
Sbjct  281   VFESIQPSDTDLGAKTPKEVKIQGFWYGQLE  311



>gb|KJB43585.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=316

 Score =   516 bits (1330),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 259/331 (78%), Positives = 283/331 (85%), Gaps = 19/331 (6%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MA SLQ AATLMQP KV    R     RS Q+V KA G++P  AR+TCSLQ+ +K+LA  
Sbjct  1     MAVSLQAAATLMQPIKVAAPSRTNVLLRSSQSVSKAFGLEPVGARLTCSLQTDLKDLAQK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
               DA KLAGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61    CVDATKLAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             ++FAFKPGKY AKKFCLEPTSFTVK                LMTRLTYTLDEIEGPFEVS
Sbjct  121   DSFAFKPGKYYAKKFCLEPTSFTVK----------------LMTRLTYTLDEIEGPFEVS  164

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
             +DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SF G+FLVPSYRGSSF
Sbjct  165   TDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFGGDFLVPSYRGSSF  224

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN K+ ASS+GKIT SVT SKPETGEVIG
Sbjct  225   LDPKGRGGSTGYDNAVALPAGGRGDEEELAKENNKSAASSSGKITLSVTKSKPETGEVIG  284

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFESLQPSDTDLGAK PK+VKI G+WYAQL+
Sbjct  285   VFESLQPSDTDLGAKTPKDVKITGVWYAQLD  315



>ref|XP_002866983.1| hypothetical protein ARALYDRAFT_328078 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43242.1| hypothetical protein ARALYDRAFT_328078 [Arabidopsis lyrata subsp. 
lyrata]
Length=328

 Score =   515 bits (1326),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 256/329 (78%), Positives = 280/329 (85%), Gaps = 3/329 (1%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIGRSYQ-TVGKALGVDPSPARITCSLQSQIKELAHNFS  229
             MAA LQ A T +QP +V   PR     +  V K  GV+P  +R++CSL   +K L   F 
Sbjct  1     MAAFLQAAVTTVQPARVDPPPRAAAKLRMCVSKYFGVEPVASRVSCSLHDDLKNLTLKFV  60

Query  230   DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
             D  K+AGF+LA SAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG+E+
Sbjct  61    DTTKIAGFSLAASALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGLES  120

Query  410   FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
             FA KPGKY AKKFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLDEIEGPFEV+SD
Sbjct  121   FAIKPGKYYAKKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPFEVASD  180

Query  590   GSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLD  769
             G VKF EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF G+FLVPSYRGSSFLD
Sbjct  181   GKVKFLEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGDFLVPSYRGSSFLD  240

Query  770   PKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVF  949
             PKGRGGSTGYDNAVALPA  RGD+EEL KEN KN A+S GKIT SVT S PE+ EVIGVF
Sbjct  241   PKGRGGSTGYDNAVALPA--RGDDEELAKENSKNTAASLGKITLSVTKSNPESREVIGVF  298

Query  950   ESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             ES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  299   ESIQPSDTDLGAKTPKDVKIQGIWYAQLE  327



>ref|XP_010446730.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=332

 Score =   511 bits (1317),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 258/334 (77%), Positives = 288/334 (86%), Gaps = 9/334 (3%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPA-RITCSLQSQIKEL  214
             MAA LQ A T MQ T+V VTP     ++  S Q+V K  G +P+ A R++CSL + +K L
Sbjct  1     MAAFLQAAVTPMQSTRV-VTPTSAAAKLRTSSQSVSKCFGFEPAVASRVSCSLHNDLKNL  59

Query  215   AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  394
               +  DA K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKG+GTANQCPTIE
Sbjct  60    IQSCVDATKIAGFALATSALIVSGASAEGVPKRLTYEEIQSKTYMEVKGTGTANQCPTIE  119

Query  395   GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPF  574
             GGV++FA KPGKY AKKFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLDEIEGPF
Sbjct  120   GGVDSFAIKPGKYYAKKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPF  179

Query  575   EVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRG  754
             EV+SDG VKF EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+G+PESF G+FLVPSYRG
Sbjct  180   EVASDGKVKFIEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGRPESFGGDFLVPSYRG  239

Query  755   SSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGE  934
             SSFLDPKGRGGSTGYDNAVALPA  RGD+EEL KEN K+  +S GKITFSVT S PE GE
Sbjct  240   SSFLDPKGRGGSTGYDNAVALPA--RGDDEELAKENNKDTTASLGKITFSVTKSNPERGE  297

Query  935   VIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  298   VIGVFESIQPSDTDLGAKNPKDVKIQGIWYAQLE  331



>ref|XP_010432119.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=331

 Score =   509 bits (1312),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 254/333 (76%), Positives = 287/333 (86%), Gaps = 8/333 (2%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPARITCSLQSQIKELA  217
             MAA LQ A T +Q T++ VTP     ++  S Q+V K  GV+   +R++CSL + +K L+
Sbjct  1     MAAFLQAAVTPVQSTRL-VTPTSSAAKLRTSSQSVSKCFGVNTVASRVSCSLHNDLKNLS  59

Query  218   HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
              +  DA K+AGFALATSALLVSGANAEGVPKRLT+ EIQSKTYMEVKG+GTANQCPTIEG
Sbjct  60    QSCVDATKIAGFALATSALLVSGANAEGVPKRLTYKEIQSKTYMEVKGTGTANQCPTIEG  119

Query  398   GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
             GV++F+ KPGKY A+KFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  120   GVDSFSIKPGKYYARKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPFE  179

Query  578   VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGS  757
             V+SDG VKF EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+G+PESF G+FLVPSYRGS
Sbjct  180   VASDGKVKFIEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGRPESFGGDFLVPSYRGS  239

Query  758   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEV  937
             SFLDPKGRGGSTGYDNAVALPA  RGD+EEL KEN K+  +S GKITFSVT S P+T EV
Sbjct  240   SFLDPKGRGGSTGYDNAVALPA--RGDDEELSKENNKDTTASLGKITFSVTKSNPKTREV  297

Query  938   IGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             IGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  298   IGVFESIQPSDTDLGAKNPKDVKIQGIWYAQLE  330



>sp|P27665.1|PSBO_WHEAT RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Triticum aestivum]
 pir||S16260 photosystem II oxygen-evolving complex protein 1 - common wheat 
x Sanduri wheat
 emb|CAA40670.1| 33kDa oxygen evolving protein of photosystem II [Triticum aestivum]
Length=325

 Score =   504 bits (1297),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 255/328 (78%), Positives = 278/328 (85%), Gaps = 5/328 (2%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
             MAASLQ AAT+M P K+G      R    V +A GVD + ARITCSLQS I+E+A   +D
Sbjct  1     MAASLQAAATVM-PAKIGGRASSARPSSHVARAFGVD-AGARITCSLQSDIREVASKCAD  58

Query  233   AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
             AAK+AGFALATSALLVSGA AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++F
Sbjct  59    AAKMAGFALATSALLVSGATAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSF  118

Query  413   AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
              FK GKY  KKFCLEPTSFTVKAE + KN PP FQ TKLMTRLTYTLDE+EGP EV    
Sbjct  119   PFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPRFQKTKLMTRLTYTLDEMEGPLEVRRRR  178

Query  593   SVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDP  772
             ++KFEEKDGIDYAAVTVQLPGGERV FLFT+KQLVATGKPESF   FLVPSYRGSSFLDP
Sbjct  179   TLKFEEKDGIDYAAVTVQLPGGERVAFLFTVKQLVATGKPESFR-PFLVPSYRGSSFLDP  237

Query  773   KGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFE  952
             KGRGGSTGYDNA ALP GGRGDEEEL KEN+KN +SSTG IT SVT SKPETGEVIGVFE
Sbjct  238   KGRGGSTGYDNAGALPRGGRGDEEELAKENVKNASSSTGNITLSVTKSKPETGEVIGVFE  297

Query  953   SLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             S+QPSDTDL  +APK+VKIQG+WYAQLE
Sbjct  298   SVQPSDTDL--EAPKDVKIQGVWYAQLE  323



>ref|XP_006411950.1| hypothetical protein EUTSA_v10025711mg [Eutrema salsugineum]
 gb|ESQ53403.1| hypothetical protein EUTSA_v10025711mg [Eutrema salsugineum]
Length=325

 Score =   504 bits (1297),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 252/329 (77%), Positives = 279/329 (85%), Gaps = 5/329 (2%)
 Frame = +2

Query  53    MAASLQTAATLMQ-PTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  229
             M ASLQ A T +  P++     R    +Q V K+ GV+   +R+ CSL   +K LA    
Sbjct  1     MVASLQAAVTTVALPSRAAANLR--PPFQCVSKSFGVEQVTSRVYCSLHDDLKSLALKCV  58

Query  230   DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
             +  K+AG ALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG+++
Sbjct  59    ETTKIAGLALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGLDS  118

Query  410   FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
             FA KPGKY AKKFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLDEIEGPFEV+SD
Sbjct  119   FAIKPGKYYAKKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPFEVASD  178

Query  590   GSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLD  769
             G VKF EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF G+FLVPSYRGSSFLD
Sbjct  179   GKVKFIEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGDFLVPSYRGSSFLD  238

Query  770   PKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVF  949
             PKGRGGSTGYDNAVALPA  RGD+EEL KEN KN A+S GKIT SVT S PE+GEVIGVF
Sbjct  239   PKGRGGSTGYDNAVALPA--RGDDEELAKENNKNTAASVGKITLSVTKSNPESGEVIGVF  296

Query  950   ESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             +S+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  297   QSIQPSDTDLGAKTPKDVKIQGIWYAQLE  325



>gb|ACS34663.1| chloroplast manganese stabilizing protein-II [Solanum tuberosum]
Length=294

 Score =   494 bits (1273),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 244/294 (83%), Positives = 270/294 (92%), Gaps = 4/294 (1%)
 Frame = +2

Query  86   MQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGF  253
            MQPTKVG V+ R     RS Q+V KA G++PS +R++CSLQ+ +K+ A   +DAAK+AGF
Sbjct  1    MQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQKCTDAAKIAGF  60

Query  254  ALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKY  433
            ALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++FAFKPGKY
Sbjct  61   ALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKY  120

Query  434  SAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEK  613
            +AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEK
Sbjct  121  NAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEK  180

Query  614  DGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGST  793
            DGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSG+FLVPSYRGSSFLDPKGRGGST
Sbjct  181  DGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGDFLVPSYRGSSFLDPKGRGGST  240

Query  794  GYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFES  955
            GYDNAVALPAGGRGDEEELQKEN+KN AS TGKITF+VT S P+TGEVIGVFES
Sbjct  241  GYDNAVALPAGGRGDEEELQKENVKNTASLTGKITFTVTKSNPQTGEVIGVFES  294



>ref|XP_010446731.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=329

 Score =   496 bits (1277),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 252/329 (77%), Positives = 282/329 (86%), Gaps = 9/329 (3%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPA-RITCSLQSQIKEL  214
             MAA LQ A T MQ T+V VTP     ++  S Q+V K  G +P+ A R++CSL + +K L
Sbjct  1     MAAFLQAAVTPMQSTRV-VTPTSAAAKLRTSSQSVSKCFGFEPAVASRVSCSLHNDLKNL  59

Query  215   AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  394
               +  DA K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKG+GTANQCPTIE
Sbjct  60    IQSCVDATKIAGFALATSALIVSGASAEGVPKRLTYEEIQSKTYMEVKGTGTANQCPTIE  119

Query  395   GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPF  574
             GGV++FA KPGKY AKKFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLDEIEGPF
Sbjct  120   GGVDSFAIKPGKYYAKKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPF  179

Query  575   EVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRG  754
             EV+SDG VKF EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+G+PESF G+FLVPSYRG
Sbjct  180   EVASDGKVKFIEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGRPESFGGDFLVPSYRG  239

Query  755   SSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGE  934
             SSFLDPKGRGGSTGYDNAVALPA  RGD+EEL KEN K+  +S GKITFSVT S PE GE
Sbjct  240   SSFLDPKGRGGSTGYDNAVALPA--RGDDEELAKENNKDTTASLGKITFSVTKSNPERGE  297

Query  935   VIGVFESLQPSDTDLGAKAPKEVKIQGIW  1021
             VIGVFES+QPSDTDLGAK PK+VKIQGI 
Sbjct  298   VIGVFESIQPSDTDLGAKNPKDVKIQGIC  326



>ref|XP_010432121.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=324

 Score =   494 bits (1272),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 248/327 (76%), Positives = 281/327 (86%), Gaps = 8/327 (2%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPARITCSLQSQIKELA  217
             MAA LQ A T +Q T++ VTP     ++  S Q+V K  GV+   +R++CSL + +K L+
Sbjct  1     MAAFLQAAVTPVQSTRL-VTPTSSAAKLRTSSQSVSKCFGVNTVASRVSCSLHNDLKNLS  59

Query  218   HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
              +  DA K+AGFALATSALLVSGANAEGVPKRLT+ EIQSKTYMEVKG+GTANQCPTIEG
Sbjct  60    QSCVDATKIAGFALATSALLVSGANAEGVPKRLTYKEIQSKTYMEVKGTGTANQCPTIEG  119

Query  398   GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
             GV++F+ KPGKY A+KFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  120   GVDSFSIKPGKYYARKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPFE  179

Query  578   VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGS  757
             V+SDG VKF EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+G+PESF G+FLVPSYRGS
Sbjct  180   VASDGKVKFIEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGRPESFGGDFLVPSYRGS  239

Query  758   SFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEV  937
             SFLDPKGRGGSTGYDNAVALPA  RGD+EEL KEN K+  +S GKITFSVT S P+T EV
Sbjct  240   SFLDPKGRGGSTGYDNAVALPA--RGDDEELSKENNKDTTASLGKITFSVTKSNPKTREV  297

Query  938   IGVFESLQPSDTDLGAKAPKEVKIQGI  1018
             IGVFES+QPSDTDLGAK PK+VKIQGI
Sbjct  298   IGVFESIQPSDTDLGAKNPKDVKIQGI  324



>gb|AJG36442.1| oxygen-evolving enhancer protein 1 [Pinus sylvestris]
Length=340

 Score =   493 bits (1269),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 246/330 (75%), Positives = 279/330 (85%), Gaps = 4/330 (1%)
 Frame = +2

Query  59    ASLQTAATLMQPTKVGVTPRIGRSYQTVGK---ALGVDP-SPARITCSLQSQIKELAHNF  226
             ++LQ AATL+QPTK+ VT    R   +      A G +P + AR++CSLQ  +KE A   
Sbjct  9     SALQAAATLLQPTKLSVTRSSSRLSSSSSHVSRAFGFEPATSARVSCSLQDDVKEFAEKC  68

Query  227   SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  406
             + A K+A   LA SAL+ SGA AEG PKRLT+DEIQS+TY+EVKGSGTANQCPTI+GGVE
Sbjct  69    AGATKIAAVTLAASALVASGAGAEGPPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGGVE  128

Query  407   NFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSS  586
              F FK GKY  KK C+EPTSFTVKAES +KN PP+FQ T+LMTRLTYTLDEIEGP EVSS
Sbjct  129   GFPFKAGKYEMKKLCMEPTSFTVKAESTNKNLPPDFQKTRLMTRLTYTLDEIEGPLEVSS  188

Query  587   DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFL  766
             DG +KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVA+G PESFSG+FLVP+YRGSSFL
Sbjct  189   DGKLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVASGTPESFSGQFLVPAYRGSSFL  248

Query  767   DPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGV  946
             DPKGRGGSTGYDNAVALPAGGRGDEEEL KENIK+V++S G IT SV+ SKPETGEVIGV
Sbjct  249   DPKGRGGSTGYDNAVALPAGGRGDEEELAKENIKDVSASKGTITLSVSKSKPETGEVIGV  308

Query  947   FESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             FESLQPSDTDLG+KAPK+VKIQGIWYAQ+E
Sbjct  309   FESLQPSDTDLGSKAPKDVKIQGIWYAQIE  338



>emb|CDX72613.1| BnaC07g46350D [Brassica napus]
Length=319

 Score =   489 bits (1260),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 247/329 (75%), Positives = 278/329 (84%), Gaps = 16/329 (5%)
 Frame = +2

Query  50    TMAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  229
             T+A    TAA L  P+            Q+V K+    P   R++CSL   +K L+ N  
Sbjct  6     TVALQSLTAAKLHPPS------------QSVSKSF--KPVTRRVSCSLHDDLKNLSLNCV  51

Query  230   DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
             +A K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKG+GTANQCPTIEGG+E+
Sbjct  52    EATKIAGFALATSALVVSGASAEGVPKRLTYEEIQSKTYMEVKGTGTANQCPTIEGGLES  111

Query  410   FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
             FA KPGKY AKK CLEPTSFTVKAE VSKNA P FQNTKLMTRLTYTLDEIEGPF+V+SD
Sbjct  112   FAIKPGKYYAKKVCLEPTSFTVKAEGVSKNAKPVFQNTKLMTRLTYTLDEIEGPFDVASD  171

Query  590   GSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLD  769
             G+V+F EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF G+FLVPSYRGSSFLD
Sbjct  172   GTVRFLEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGDFLVPSYRGSSFLD  231

Query  770   PKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVF  949
             PKGRGGSTGYDNAVALPA  RGD+EEL KEN KN A+S G+ITFSVT SKPE+GEVIG+F
Sbjct  232   PKGRGGSTGYDNAVALPA--RGDDEELDKENNKNTAASVGEITFSVTKSKPESGEVIGLF  289

Query  950   ESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             ES+QPSDTDLGAK PK+VKIQGIWYA+LE
Sbjct  290   ESIQPSDTDLGAKTPKDVKIQGIWYAKLE  318



>gb|ACN40581.1| unknown [Picea sitchensis]
Length=341

 Score =   483 bits (1243),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 246/331 (74%), Positives = 285/331 (86%), Gaps = 5/331 (2%)
 Frame = +2

Query  59    ASLQTAATLMQPTKVGVT----PRIGRSYQTVGKALGVDP-SPARITCSLQSQIKELAHN  223
             ++LQ AATL+QPTK+ VT     R+  S   + +A G +P + AR++CSLQ  +KE A  
Sbjct  9     SALQAAATLLQPTKLSVTRTSSSRLSSSSSNLSRAFGFEPATSARVSCSLQDDVKEFAEK  68

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              + A K+A  ALA S+L+ SGA AEGVPKRLT+DEIQS+TY+EVKGSGTANQCPTI+GGV
Sbjct  69    CAGATKIAALALAASSLVASGAGAEGVPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGGV  128

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             E F FKPGKY  KK C+EPTSFTVKAE  +KN PP+FQ T+LMTRLTYTLDEIEGP EVS
Sbjct  129   EAFPFKPGKYEMKKLCMEPTSFTVKAEGTNKNQPPDFQKTRLMTRLTYTLDEIEGPLEVS  188

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
              DG +KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVA+G P+SFSG+FLVP+YRGSSF
Sbjct  189   HDGKLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVASGTPDSFSGQFLVPAYRGSSF  248

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIK+V++S G+ITFSV+ SKP+TGEVIG
Sbjct  249   LDPKGRGGSTGYDNAVALPAGGRGDEEELVKENIKDVSASKGEITFSVSKSKPDTGEVIG  308

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFESLQPSDTDLG+KAPK+VKIQGIWYAQ+E
Sbjct  309   VFESLQPSDTDLGSKAPKDVKIQGIWYAQIE  339



>gb|ABK24541.1| unknown [Picea sitchensis]
 gb|ABK26154.1| unknown [Picea sitchensis]
 gb|ACN39762.1| unknown [Picea sitchensis]
 gb|ACN40363.1| unknown [Picea sitchensis]
 gb|ACN40484.1| unknown [Picea sitchensis]
Length=341

 Score =   482 bits (1241),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 246/331 (74%), Positives = 285/331 (86%), Gaps = 5/331 (2%)
 Frame = +2

Query  59    ASLQTAATLMQPTKVGVT----PRIGRSYQTVGKALGVDP-SPARITCSLQSQIKELAHN  223
             ++LQ AATL+QPTK+ VT     R+  S   + +A G +P + AR++CSLQ  +KE A  
Sbjct  9     SALQAAATLLQPTKLSVTRTSSSRLSSSSSNLSRAFGFEPATSARVSCSLQDDVKEFAEK  68

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              + A K+A  ALA S+L+ SGA AEGVPKRLT+DEIQS+TY+EVKGSGTANQCPTI+GGV
Sbjct  69    CAGATKIAALALAASSLVASGAGAEGVPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGGV  128

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             E F FKPGKY  KK C+EPTSFTVKAE  +KN PP+FQ T+LMTRLTYTLDEIEGP EVS
Sbjct  129   EAFPFKPGKYEMKKLCMEPTSFTVKAEGTNKNQPPDFQKTRLMTRLTYTLDEIEGPLEVS  188

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
              DG +KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVA+G P+SFSG+FLVP+YRGSSF
Sbjct  189   HDGKLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVASGTPDSFSGQFLVPAYRGSSF  248

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIK+V++S G+ITFSV+ SKP+TGEVIG
Sbjct  249   LDPKGRGGSTGYDNAVALPAGGRGDEEELVKENIKDVSASKGEITFSVSKSKPDTGEVIG  308

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFESLQPSDTDLG+KAPK+VKIQGIWYAQ+E
Sbjct  309   VFESLQPSDTDLGSKAPKDVKIQGIWYAQIE  339



>gb|ABK23365.1| unknown [Picea sitchensis]
 gb|ABK26094.1| unknown [Picea sitchensis]
 gb|ABR16830.1| unknown [Picea sitchensis]
 gb|ACN39793.1| unknown [Picea sitchensis]
Length=341

 Score =   482 bits (1241),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 246/331 (74%), Positives = 285/331 (86%), Gaps = 5/331 (2%)
 Frame = +2

Query  59    ASLQTAATLMQPTKVGVT----PRIGRSYQTVGKALGVDP-SPARITCSLQSQIKELAHN  223
             ++LQ AATL+QPTK+ VT     R+  S   + +A G +P + AR++CSLQ  +KE A  
Sbjct  9     SALQAAATLLQPTKLSVTRTSSSRLSSSSSNLSRAFGFEPATSARVSCSLQDDVKEFAEK  68

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              + A K+A  ALA S+L+ SGA AEGVPKRLT+DEIQS+TY+EVKGSGTANQCPTI+GGV
Sbjct  69    CAGATKIAALALAASSLVASGAGAEGVPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGGV  128

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             E F FKPGKY  KK C+EPTSFTVKAE  +KN PP+FQ T+LMTRLTYTLDEIEGP EVS
Sbjct  129   EAFPFKPGKYEMKKLCMEPTSFTVKAEGTNKNQPPDFQKTRLMTRLTYTLDEIEGPLEVS  188

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
              DG +KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVA+G P+SFSG+FLVP+YRGSSF
Sbjct  189   QDGKLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVASGTPDSFSGQFLVPAYRGSSF  248

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
             LDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIK+V++S G+ITFSV+ SKP+TGEVIG
Sbjct  249   LDPKGRGGSTGYDNAVALPAGGRGDEEELVKENIKDVSASKGEITFSVSKSKPDTGEVIG  308

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFESLQPSDTDLG+KAPK+VKIQGIWYAQ+E
Sbjct  309   VFESLQPSDTDLGSKAPKDVKIQGIWYAQIE  339



>ref|XP_009138459.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Brassica rapa]
Length=314

 Score =   481 bits (1238),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 237/304 (78%), Positives = 266/304 (88%), Gaps = 4/304 (1%)
 Frame = +2

Query  125   RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGV  304
             RS Q+V K+    P   R++CSL   +K L  N  +A K+AGFALATSAL+VSGA+AEGV
Sbjct  14    RSSQSVSKSF--KPVTRRVSCSLHDDLKNLTLNCVEATKIAGFALATSALVVSGASAEGV  71

Query  305   PKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAE  484
             PKRLT+ EIQSKTYMEVKG+GTANQCPTIEGG+E+FA KPGKY AKK CLEPTSFTVKAE
Sbjct  72    PKRLTYKEIQSKTYMEVKGTGTANQCPTIEGGLESFAIKPGKYYAKKVCLEPTSFTVKAE  131

Query  485   SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGER  664
              VS+NA P FQNTKLMTRLTYTLDEIEGPFEV+SDG+V+F EKDG DYA VTVQLPGGER
Sbjct  132   DVSRNATPVFQNTKLMTRLTYTLDEIEGPFEVASDGTVRFLEKDGSDYATVTVQLPGGER  191

Query  665   VPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEE  844
             +PFLFTIKQLVATGKPESF G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPA  RGD+E
Sbjct  192   IPFLFTIKQLVATGKPESFGGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RGDDE  249

Query  845   ELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWY  1024
             EL KEN KN A+S G+ITFSVT SKPE+GEVI +FES+QPSDT+LGAK P++VKIQGIWY
Sbjct  250   ELDKENNKNTAASVGEITFSVTKSKPESGEVISLFESIQPSDTNLGAKTPEDVKIQGIWY  309

Query  1025  AQLE  1036
             A+LE
Sbjct  310   AKLE  313



>emb|CDY42709.1| BnaA03g53620D [Brassica napus]
Length=319

 Score =   478 bits (1231),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 242/329 (74%), Positives = 273/329 (83%), Gaps = 16/329 (5%)
 Frame = +2

Query  50    TMAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  229
             T+A    TAA L  P+            Q+V K+    P   R++CSL   +K L  N  
Sbjct  6     TVALQSLTAAKLHPPS------------QSVSKSF--KPVTRRVSCSLHDDLKNLTLNCV  51

Query  230   DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
             +A K+AGFALATSAL+VSGA+AEGVPKRLT+ +IQSKTYMEVKG+GTANQCPTIEGG+E+
Sbjct  52    EATKIAGFALATSALVVSGASAEGVPKRLTYKDIQSKTYMEVKGTGTANQCPTIEGGLES  111

Query  410   FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
             FA KPGKY AKK CLEPTSFTVKAE VS+NA P F NTKLMTRLTYTLDEIEGPFEV+SD
Sbjct  112   FAIKPGKYYAKKVCLEPTSFTVKAEGVSRNATPFFLNTKLMTRLTYTLDEIEGPFEVASD  171

Query  590   GSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLD  769
             G+V+F EKDG DYAAVTVQLPGGER+PFLFTIKQLVATGKPESF G+FLVPSYRGSSFLD
Sbjct  172   GTVRFLEKDGSDYAAVTVQLPGGERIPFLFTIKQLVATGKPESFGGDFLVPSYRGSSFLD  231

Query  770   PKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVF  949
             PKGRGGSTGYDNAVALPA  RGD+EEL KEN KN A+S G+ITFSVT SKPE+GEVI +F
Sbjct  232   PKGRGGSTGYDNAVALPA--RGDDEELDKENNKNTAASVGEITFSVTKSKPESGEVISLF  289

Query  950   ESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             ES+QPSDTDLGAK P++VKIQGIWYA+LE
Sbjct  290   ESIQPSDTDLGAKTPEDVKIQGIWYAKLE  318



>gb|KDO79410.1| hypothetical protein CISIN_1g019870mg [Citrus sinensis]
Length=271

 Score =   471 bits (1212),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 226/252 (90%), Positives = 243/252 (96%), Gaps = 0/252 (0%)
 Frame = +2

Query  281   SGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEP  460
             SGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV++FAFKPGKY AKKFCLEP
Sbjct  19    SGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEP  78

Query  461   TSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVT  640
             TSFTVKAESV+KNAPP+FQNTKLMTRLTYTLDEIEGPFEVS DG++KF EKDGIDYAAVT
Sbjct  79    TSFTVKAESVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVT  138

Query  641   VQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALP  820
             VQLPGGERVPFLFTIKQLVA+GKPE+F GEFLVPSYRGSSFLDPKGRGGSTGYDNA+ALP
Sbjct  139   VQLPGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALP  198

Query  821   AGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKE  1000
             AGGRGDEE+L KENIKN +SSTGKIT SVT SKPETGEVIGVFESLQPSDTD+GAK PK+
Sbjct  199   AGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESLQPSDTDMGAKVPKD  258

Query  1001  VKIQGIWYAQLE  1036
             VKIQGIWYAQLE
Sbjct  259   VKIQGIWYAQLE  270



>ref|XP_007155995.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
 gb|ESW27989.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
Length=264

 Score =   463 bits (1192),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 227/262 (87%), Positives = 246/262 (94%), Gaps = 2/262 (1%)
 Frame = +2

Query  257   LATSALLVS--GANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGK  430
             + T +L+V   GA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++FAFKPGK
Sbjct  2     VVTYSLIVKFKGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSFAFKPGK  61

Query  431   YSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEE  610
             Y+AKK CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLDEIEGPFEVSSDG+VKFEE
Sbjct  62    YNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEE  121

Query  611   KDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGS  790
             KDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF G FLVPSYRGSSFLDPKGRG S
Sbjct  122   KDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGPFLVPSYRGSSFLDPKGRGAS  181

Query  791   TGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSD  970
             TGYDNAVALPAGGRGDEEEL KEN K+ +SSTGKIT SVT +KPETGEVIGVFES+QPSD
Sbjct  182   TGYDNAVALPAGGRGDEEELAKENNKSASSSTGKITLSVTKTKPETGEVIGVFESVQPSD  241

Query  971   TDLGAKAPKEVKIQGIWYAQLE  1036
             TDLGAKAPK+VKIQG+WYAQLE
Sbjct  242   TDLGAKAPKDVKIQGVWYAQLE  263



>prf||2002393A oxygen-evolving complex protein 1
Length=247

 Score =   459 bits (1181),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 221/247 (89%), Positives = 234/247 (95%), Gaps = 0/247 (0%)
 Frame = +2

Query  296   EGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTV  475
             EGVP+RLTFDEIQSKTYMEVKG+GTANQCPT+EGGV++FAFKPGKY+ KKFCLEPTSFTV
Sbjct  1     EGVPRRLTFDEIQSKTYMEVKGTGTANQCPTVEGGVDSFAFKPGKYNMKKFCLEPTSFTV  60

Query  476   KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPG  655
             KAE V+KNAPPEFQ TKLMTRLTYTLDEIEGP EVSSDG+VKFEEKDGIDYAAVTVQLPG
Sbjct  61    KAEGVAKNAPPEFQKTKLMTRLTYTLDEIEGPLEVSSDGTVKFEEKDGIDYAAVTVQLPG  120

Query  656   GERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRG  835
             GERVPFLFTIK LVATGKPESF G FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRG
Sbjct  121   GERVPFLFTIKNLVATGKPESFGGPFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRG  180

Query  836   DEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQG  1015
             DEEEL KEN+KN +SSTG IT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+VKIQG
Sbjct  181   DEEELAKENVKNASSSTGNITLSVTKSKPETGEVIGVFESVQPSDTDLGAKVPKDVKIQG  240

Query  1016  IWYAQLE  1036
             +WYAQLE
Sbjct  241   VWYAQLE  247



>gb|ABS29557.1| chloroplast photosynthetic water oxidation complex 33kDa subunit 
precursor [Morus nigra]
Length=265

 Score =   459 bits (1182),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 223/256 (87%), Positives = 241/256 (94%), Gaps = 0/256 (0%)
 Frame = +2

Query  173  ARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYME  352
            AR+TCSLQS  K+LA    DA K+AG ALATSAL+VSGA+AEGVPKRLT+DEIQSKTY+E
Sbjct  8    ARLTCSLQSDFKDLAQKCVDATKIAGIALATSALVVSGASAEGVPKRLTYDEIQSKTYLE  67

Query  353  VKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  532
            VKG+GTANQCPTIEGGV++FAFK GKY+ KK CLEPTSFTVKAESV+KN+PPEFQNTKLM
Sbjct  68   VKGTGTANQCPTIEGGVDSFAFKAGKYNVKKLCLEPTSFTVKAESVNKNSPPEFQNTKLM  127

Query  533  TRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP  712
            TRLTYTLDEIEGPFEV++DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP
Sbjct  128  TRLTYTLDEIEGPFEVANDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKP  187

Query  713  ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGK  892
            ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN ASSTGK
Sbjct  188  ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKNTASSTGK  247

Query  893  ITFSVTGSKPETGEVI  940
            IT SVT SKPETGE+I
Sbjct  248  ITLSVTKSKPETGELI  263



>prf||1204192A photosystem II protein 33kD
Length=248

 Score =   451 bits (1160),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 216/243 (89%), Positives = 233/243 (96%), Gaps = 0/243 (0%)
 Frame = +2

Query  308   KRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAES  487
             KRLT+DEIQSKTY+EVKG+GTANQCPT+EGGV++FAFKPGKY+AKKFCLEPT F VKAE 
Sbjct  4     KRLTYDEIQSKTYLEVKGTGTANQCPTVEGGVDSFAFKPGKYTAKKFCLEPTKFAVKAEG  63

Query  488   VSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERV  667
             +SKN+ P+FQNTKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERV
Sbjct  64    ISKNSGPDFQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERV  123

Query  668   PFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEE  847
             PFLFTIKQLVA+GKPESFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEE
Sbjct  124   PFLFTIKQLVASGKPESFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEE  183

Query  848   LQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYA  1027
             LQKEN KNVASS G IT SVT SKPETGEVIGVF+SLQPSDTDLGAK PK+VKI+G+WYA
Sbjct  184   LQKENNKNVASSKGTITLSVTSSKPETGEVIGVFQSLQPSDTDLGAKVPKDVKIEGVWYA  243

Query  1028  QLE  1036
             QLE
Sbjct  244   QLE  246



>gb|ADB07372.1| chloroplast managanese stabilizing protein [Capsicum annuum]
Length=281

 Score =   439 bits (1129),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 228/281 (81%), Positives = 253/281 (90%), Gaps = 4/281 (1%)
 Frame = +2

Query  86   MQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGF  253
            MQPTK+G V+ R     RS Q+V K  GV+   AR+TCSLQ  +K+ A   +DAAK+AGF
Sbjct  1    MQPTKIGGVSARNNLQLRSSQSVNKTFGVEQGAARLTCSLQCDLKDFAQKCTDAAKIAGF  60

Query  254  ALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKY  433
            ALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPT++GGV++FAFKPGKY
Sbjct  61   ALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTVDGGVDSFAFKPGKY  120

Query  434  SAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEK  613
            +AKK CLEPTSFTVKAE V+KN+ PEFQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEK
Sbjct  121  NAKKLCLEPTSFTVKAEGVNKNSAPEFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEK  180

Query  614  DGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGST  793
            DGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSG+FLVPSYRGSSFLDPKGRGGST
Sbjct  181  DGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGDFLVPSYRGSSFLDPKGRGGST  240

Query  794  GYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGS  916
            GYDNAVALPAGGRGDEEEL+KEN+KN ASS GKITFSVT S
Sbjct  241  GYDNAVALPAGGRGDEEELEKENLKNTASSRGKITFSVTKS  281



>ref|WP_039310940.1| Photosystem II manganese-stabilizing polypeptide, partial [Paenibacillus 
sp. IHB B 3415]
Length=232

 Score =   434 bits (1116),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 211/232 (91%), Positives = 220/232 (95%), Gaps = 0/232 (0%)
 Frame = +2

Query  341   TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQN  520
             TY+EVKG+GTANQCPTIEGGV+ FAFKPGKY  KKFCLEPTSFTVKA+SVSKNAPPEFQ 
Sbjct  1     TYLEVKGTGTANQCPTIEGGVDKFAFKPGKYQMKKFCLEPTSFTVKADSVSKNAPPEFQR  60

Query  521   TKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA  700
             TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA
Sbjct  61    TKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA  120

Query  701   TGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVAS  880
             +GKPESF G+FLVPSYRGSSFLDPKGRGGSTGYD+AVALPAGGRGDEEEL KENIKN AS
Sbjct  121   SGKPESFGGQFLVPSYRGSSFLDPKGRGGSTGYDSAVALPAGGRGDEEELVKENIKNTAS  180

Query  881   STGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             STGKIT  VT SKPETGEVIGVFES+QPSDTDLGAK PKEVKIQG+WYAQLE
Sbjct  181   STGKITLGVTNSKPETGEVIGVFESIQPSDTDLGAKVPKEVKIQGVWYAQLE  232



>gb|KCW55052.1| hypothetical protein EUGRSUZ_I01025 [Eucalyptus grandis]
Length=247

 Score =   430 bits (1105),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 212/254 (83%), Positives = 227/254 (89%), Gaps = 16/254 (6%)
 Frame = +2

Query  275   LVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCL  454
             L  GA AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG+++FAFKPGKY+AKK CL
Sbjct  9     LSQGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGLDSFAFKPGKYNAKKICL  68

Query  455   EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAA  634
             EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAA
Sbjct  69    EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAA  128

Query  635   VTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVA  814
             VT                QLVA+GKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVA
Sbjct  129   VT----------------QLVASGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVA  172

Query  815   LPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAP  994
             LPAGGRGDEE+L KENIKN +SSTGKIT SVT +KPETGEVIGVFES+QPSDTDLGAK P
Sbjct  173   LPAGGRGDEEDLTKENIKNASSSTGKITLSVTKTKPETGEVIGVFESVQPSDTDLGAKVP  232

Query  995   KEVKIQGIWYAQLE  1036
             K+VKIQG+WYAQLE
Sbjct  233   KDVKIQGVWYAQLE  246



>ref|XP_003637254.1| Oxygen-evolving enhancer protein, partial [Medicago truncatula]
Length=255

 Score =   427 bits (1099),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 208/255 (82%), Positives = 230/255 (90%), Gaps = 0/255 (0%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
            MAASLQ AATLMQPTK+       +S Q+V KA G++   A++TCSLQS  KEL H F +
Sbjct  1    MAASLQAAATLMQPTKLRSNSLQLKSTQSVSKAFGLEHYGAKVTCSLQSDFKELTHKFVE  60

Query  233  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
            A+K+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++F
Sbjct  61   ASKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSF  120

Query  413  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
            +FKPGKY+AKKFCLEPTSFTVKAE V+KN P  FQNTKLMTRLTYTLDEIEGPFEVSSDG
Sbjct  121  SFKPGKYNAKKFCLEPTSFTVKAEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFEVSSDG  180

Query  593  SVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDP  772
            SVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGE+LVPSYRGSSFLDP
Sbjct  181  SVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEYLVPSYRGSSFLDP  240

Query  773  KGRGGSTGYDNAVAL  817
            KGRG STGYDNAVAL
Sbjct  241  KGRGASTGYDNAVAL  255



>gb|AEH95324.1| 33 kDa manganese stabilizing chloroplast protein [Allium cepa]
Length=238

 Score =   425 bits (1093),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 206/231 (89%), Positives = 223/231 (97%), Gaps = 0/231 (0%)
 Frame = +2

Query  227  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  406
            +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV+
Sbjct  2    TDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVD  61

Query  407  NFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSS  586
            +FAFKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYT+DEIEGPFEVS 
Sbjct  62   SFAFKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTMDEIEGPFEVSP  121

Query  587  DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFL  766
            D +VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSG+FLVPSYRGSSFL
Sbjct  122  DSTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGDFLVPSYRGSSFL  181

Query  767  DPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSK  919
            DPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN AS TGKITF+VT S+
Sbjct  182  DPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTASLTGKITFTVTKSQ  232



>ref|XP_010531775.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Tarenaya hassleriana]
Length=230

 Score =   422 bits (1084),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 204/230 (89%), Positives = 215/230 (93%), Gaps = 0/230 (0%)
 Frame = +2

Query  347   MEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTK  526
             MEVKG+GTANQCPTI+GG + FAFKPGKYS KKFC EPTSFTVKAE VSKNAPPEFQNTK
Sbjct  1     MEVKGTGTANQCPTIDGGSDEFAFKPGKYSGKKFCFEPTSFTVKAEGVSKNAPPEFQNTK  60

Query  527   LMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATG  706
             LMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQL A+G
Sbjct  61    LMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLDASG  120

Query  707   KPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASST  886
             KP SF G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN ASST
Sbjct  121   KPNSFGGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKNAASST  180

Query  887   GKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             G+IT  VT SKPETGE+IGVFES+QPSDTDLGAK PK+VKIQGIWY QLE
Sbjct  181   GEITLKVTKSKPETGELIGVFESIQPSDTDLGAKVPKDVKIQGIWYGQLE  230



>ref|NP_001140815.1| hypothetical protein [Zea mays]
 gb|ACF84695.1| unknown [Zea mays]
 gb|AFW75931.1| hypothetical protein ZEAMMB73_003972 [Zea mays]
Length=230

 Score =   420 bits (1080),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 203/230 (88%), Positives = 214/230 (93%), Gaps = 0/230 (0%)
 Frame = +2

Query  347   MEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTK  526
             MEVKG+GTANQCPTI+GGVE+F FK GKY  KK CLEPTSFTVKAE ++KNAPPEFQ TK
Sbjct  1     MEVKGTGTANQCPTIDGGVESFPFKAGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTK  60

Query  527   LMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATG  706
             LMTRLTYTLDEIEGP EV SDG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVATG
Sbjct  61    LMTRLTYTLDEIEGPLEVGSDGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATG  120

Query  707   KPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASST  886
             KPESF G FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN ASST
Sbjct  121   KPESFGGPFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNAASST  180

Query  887   GKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             G IT SVT S PETGEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  181   GNITLSVTKSNPETGEVIGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE  230



>gb|ABR17376.1| unknown [Picea sitchensis]
Length=327

 Score =   421 bits (1082),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 219/303 (72%), Positives = 255/303 (84%), Gaps = 5/303 (2%)
 Frame = +2

Query  59   ASLQTAATLMQPTKVGVT----PRIGRSYQTVGKALGVDP-SPARITCSLQSQIKELAHN  223
            ++LQ AATL+QPTK+ VT     R+  S   + +A G +P + AR++CSLQ  +KE A  
Sbjct  9    SALQAAATLLQPTKLSVTRTSSSRLSSSSSNLSRAFGFEPATSARVSCSLQDDVKEFAEK  68

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
             + A K+A  ALA S+L+ SGA AEGVPKRLT+DEIQS+TY+EVKGSGTANQCPTI+GGV
Sbjct  69   CAGATKIAALALAASSLVASGAGAEGVPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGGV  128

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            E F FKPGKY  KK C+EPTSFTVKAE  +KN PP+FQ T+LMTRLTYTLDEIEGP EVS
Sbjct  129  EAFPFKPGKYEMKKLCMEPTSFTVKAEGTNKNQPPDFQKTRLMTRLTYTLDEIEGPLEVS  188

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
             DG +KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVA+G P+SFSG+FLVP+YRGSSF
Sbjct  189  QDGKLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVASGTPDSFSGQFLVPAYRGSSF  248

Query  764  LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
            LDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIK+V++S G+ITFSV+ SKP+TGEVI 
Sbjct  249  LDPKGRGGSTGYDNAVALPAGGRGDEEELVKENIKDVSASKGEITFSVSKSKPDTGEVIC  308

Query  944  VFE  952
            V E
Sbjct  309  VRE  311



>gb|AFW90569.1| chloroplast manganese stabilizing protein-II [Solanum tuberosum]
Length=293

 Score =   416 bits (1070),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 214/290 (74%), Positives = 243/290 (84%), Gaps = 18/290 (6%)
 Frame = +2

Query  86   MQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGF  253
            MQPTKVG V+ R     RS Q+V KA G++PS +R++CSLQ+ +K+ A   +DAAK+AGF
Sbjct  1    MQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQKCTDAAKIAGF  60

Query  254  ALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKY  433
            ALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++FAFKPGKY
Sbjct  61   ALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKY  120

Query  434  SAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEK  613
            +AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEK
Sbjct  121  NAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEK  180

Query  614  DGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGST  793
            DGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSG+FLVPSYRGSSFLDPKGRG   
Sbjct  181  DGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGDFLVPSYRGSSFLDPKGRG---  237

Query  794  GYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
                   +   G   E E ++  +     STGKITF+VT S P+TGEVIG
Sbjct  238  ------WIHWLGGAPERERKEYRV-----STGKITFTVTKSNPQTGEVIG  276



>emb|CBI19622.3| unnamed protein product [Vitis vinifera]
Length=273

 Score =   414 bits (1065),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 218/331 (66%), Positives = 241/331 (73%), Gaps = 61/331 (18%)
 Frame = +2

Query  53    MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
             MAASL  AATL QPTK G+  + G   +S  +V KA G DP+ AR+TCSLQ+ +K+LA  
Sbjct  1     MAASLHVAATLRQPTKAGLPAKTGLQLKSSPSVCKAFGYDPAGARLTCSLQTHVKDLAQK  60

Query  224   FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              +DAAK+AGFALATSA LVSGA AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61    CADAAKIAGFALATSAFLVSGAGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  404   ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
             ++FAFK G Y+ KKFCLEPTSFTVKAE VSKNAP EFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  121   DSFAFKTGSYNMKKFCLEPTSFTVKAEGVSKNAPAEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  584   SDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSF  763
             SD +VKF EKDGIDYAAVTVQLPGGERVPFLFTIKQ                        
Sbjct  181   SDRTVKFIEKDGIDYAAVTVQLPGGERVPFLFTIKQ------------------------  216

Query  764   LDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
                   GGSTGYDNA                            IT S+T SKPE+GEVIG
Sbjct  217   ------GGSTGYDNA----------------------------ITLSITKSKPESGEVIG  242

Query  944   VFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             VFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  243   VFESIQPSDTDLGAKVPKDVKIQGVWYAQLE  273



>ref|XP_001756893.1| predicted protein [Physcomitrella patens]
 gb|EDQ78124.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   416 bits (1068),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 203/300 (68%), Positives = 239/300 (80%), Gaps = 5/300 (2%)
 Frame = +2

Query  137   TVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRL  316
             ++  A G+ P+ AR++C+L+  +K +  N    AK A   LA+SAL+   A AEGVP+RL
Sbjct  32    SMSNAFGLKPAVARVSCNLEENVKSIVDN----AKAAAIVLASSALVAGAAFAEGVPQRL  87

Query  317   TFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSK  496
             TFDE+ ++TYM+VKGSGTANQCP +  G + FAFK G Y+ +KFCLEPTSFTVKAES  K
Sbjct  88    TFDEVNAQTYMDVKGSGTANQCPIVAEGSDKFAFKDGNYTMRKFCLEPTSFTVKAESQFK  147

Query  497   NAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFL  676
                  FQ TKLMTRLTYTLDEIEGP  V  +G+++FEE DGIDYAAVTVQLPGGERVPFL
Sbjct  148   GGNEGFQPTKLMTRLTYTLDEIEGPLTVQ-NGNLRFEEVDGIDYAAVTVQLPGGERVPFL  206

Query  677   FTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQK  856
             FT+K+LVA GKPE+F G FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGG GDEEEL K
Sbjct  207   FTVKELVAEGKPEAFGGSFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGAGDEEELAK  266

Query  857   ENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             EN KN A+  G ITFS+  S  +TGE+ G FES QPSDTDLG+KAPKEVKI+GI+YAQL+
Sbjct  267   ENEKNTAALNGNITFSIAKSNVQTGEIAGTFESFQPSDTDLGSKAPKEVKIEGIFYAQLD  326



>ref|XP_001763258.1| predicted protein [Physcomitrella patens]
 gb|EDQ71788.1| predicted protein [Physcomitrella patens]
Length=327

 Score =   402 bits (1032),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 205/302 (68%), Positives = 240/302 (79%), Gaps = 5/302 (2%)
 Frame = +2

Query  131   YQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPK  310
             +  V  A G+ P+ +R++CS++  ++ +     D AK A   LA+SAL+   A AEG P+
Sbjct  30    HAPVNSAFGLKPAASRVSCSVEETVRRVV----DGAKAAALVLASSALVAGAALAEGTPQ  85

Query  311   RLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESV  490
             RLTFDEI ++TYM+VKGSGTANQCP +  G + F+FK GKY+ KK C+EPTSFTVKAES 
Sbjct  86    RLTFDEINAQTYMDVKGSGTANQCPIVPEGSDKFSFKDGKYTMKKLCMEPTSFTVKAESP  145

Query  491   SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
              K     FQNTKLMTRLTYTLDEIEGP  VS +G+++FEEKDGIDYAAVTVQLPGGERVP
Sbjct  146   FKGGSEGFQNTKLMTRLTYTLDEIEGPLTVS-NGNLRFEEKDGIDYAAVTVQLPGGERVP  204

Query  671   FLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
             FLFT+K+LVA GKPE F G FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGG GDEEEL
Sbjct  205   FLFTVKELVAEGKPEKFGGSFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGAGDEEEL  264

Query  851   QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQ  1030
              KEN KN A+  G ITFS+  S  ETGE+ G FES+QPSDTDLG+K PKEVKI+GI+YAQ
Sbjct  265   AKENEKNTAALNGNITFSIAKSNTETGEIAGTFESIQPSDTDLGSKTPKEVKIEGIFYAQ  324

Query  1031  LE  1036
             LE
Sbjct  325   LE  326



>ref|XP_001781590.1| predicted protein [Physcomitrella patens]
 gb|EDQ53641.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   401 bits (1030),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 208/327 (64%), Positives = 251/327 (77%), Gaps = 7/327 (2%)
 Frame = +2

Query  56    AASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  235
             +AS +T+  L   +K+     I  +  ++  A G+ P+ AR++C+L+  ++ +     D 
Sbjct  7     SASCKTSVALASNSKLEKVQTIKSA--SLSSAFGLTPAAARVSCNLEENVRSVV----DG  60

Query  236   AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  415
             AK A   LA+SAL+   A AEGVP+RLTFDEI ++TYM+VKGSGTANQCP +  G   F+
Sbjct  61    AKAAALVLASSALMAGAALAEGVPQRLTFDEINAQTYMDVKGSGTANQCPIVAEGSGQFS  120

Query  416   FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  595
             FK G+Y+ +K CLEPTSFTVKAES  K     +Q TKLMTRLTYTLDEIEGP  V   G+
Sbjct  121   FKDGEYTMRKLCLEPTSFTVKAESPFKGGSEGYQQTKLMTRLTYTLDEIEGPLTVKG-GN  179

Query  596   VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPK  775
             ++FEEKDGIDYAAVTVQLPGGERVPFLFT+K+LVA GKPE+F G FLVPSYRGSSFLDPK
Sbjct  180   LRFEEKDGIDYAAVTVQLPGGERVPFLFTVKELVAEGKPEAFGGSFLVPSYRGSSFLDPK  239

Query  776   GRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFES  955
             GRGGSTGYDNAVALPAGG GDEEEL KEN KN A+  G ITFS+  S  ETGE+ G FES
Sbjct  240   GRGGSTGYDNAVALPAGGAGDEEELAKENEKNTAALNGNITFSIAKSNTETGEIAGTFES  299

Query  956   LQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             +QPSDTDLG+KAPKEVKI+GI+YAQL+
Sbjct  300   IQPSDTDLGSKAPKEVKIEGIFYAQLD  326



>dbj|BAF94218.1| 33kDa oxygen evolving protein of photosystem II [Chara braunii]
Length=337

 Score =   393 bits (1009),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 205/295 (69%), Positives = 236/295 (80%), Gaps = 2/295 (1%)
 Frame = +2

Query  152   LGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEI  331
              G+    +R++CSL  +        +DAAK A  ALATSALL   A A   P RLTFDEI
Sbjct  45    FGLSKCNSRLSCSLDEEASSFVSKVADAAKGAAVALATSALLAQAAVA--APPRLTFDEI  102

Query  332   QSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPE  511
              SKTY+EVKG+GTANQCP I GG++ F+FKPGKY  +K CLEPT F VKAES  K    E
Sbjct  103   NSKTYLEVKGTGTANQCPAIGGGLDGFSFKPGKYQMQKLCLEPTEFRVKAESQFKGGDTE  162

Query  512   FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  691
             F  TKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLF++K+
Sbjct  163   FTKTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFSVKE  222

Query  692   LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  871
             LVATG+P SF G++LVPSYRGSSFLDPKGRGGSTGYDNAVALPAGG GD ++L+KEN+K+
Sbjct  223   LVATGRPSSFGGKYLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGSGDRDDLEKENLKS  282

Query  872   VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
              +++ G I F+V  S PE+GEV+G FES+QPSDTDLGAK  KEVKI GIWY QL+
Sbjct  283   TSAAEGNIVFTVAQSNPESGEVVGTFESVQPSDTDLGAKQAKEVKISGIWYGQLK  337



>ref|XP_002992987.1| hypothetical protein SELMODRAFT_187141 [Selaginella moellendorffii]
 ref|XP_002994511.1| hypothetical protein SELMODRAFT_449377 [Selaginella moellendorffii]
 gb|EFJ04419.1| hypothetical protein SELMODRAFT_449377 [Selaginella moellendorffii]
 gb|EFJ05933.1| hypothetical protein SELMODRAFT_187141 [Selaginella moellendorffii]
Length=328

 Score =   390 bits (1001),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 211/335 (63%), Positives = 248/335 (74%), Gaps = 14/335 (4%)
 Frame = +2

Query  53    MAASLQTAA---TLMQPTKVGVTPRIGRSYQ--TVGKALGV--DPSPARITCSLQSQIKE  211
             MAAS+  A    +L+QP K+  +     S +  +V KA G+  +   AR+TCS++  +K 
Sbjct  1     MAASVVAAKAGPSLLQP-KLDASAGSSASLRPVSVSKAFGLRSNGGGARLTCSMEDIVKR  59

Query  212   LAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTI  391
                  +D  K+A    A + L+   A A   PKRLT+DE+Q++TY+EVKGSGTANQCP +
Sbjct  60    A----TDVGKVAVATAAATLLVAGTAAAN--PKRLTYDEVQAQTYLEVKGSGTANQCPIL  113

Query  392   EGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGP  571
              GG E F FKPG YS KKFCLEPTSFTVK ES  K    ++ +TKLMTRLTYTLDEIE  
Sbjct  114   SGGDEGFKFKPGSYSVKKFCLEPTSFTVKKESPFKGGGDQYVDTKLMTRLTYTLDEIEAD  173

Query  572   FEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYR  751
               V   G++K  EKDGIDYAAVTVQLPGGERVPFLFTIK+LVATG P+ FSG FLVPSYR
Sbjct  174   LSVDEKGNLKLVEKDGIDYAAVTVQLPGGERVPFLFTIKELVATGSPDGFSGSFLVPSYR  233

Query  752   GSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETG  931
             GSSFLDPKGRGGSTGYDNAVALPAGG GDEEEL KEN+K+ + STG IT  V  S   TG
Sbjct  234   GSSFLDPKGRGGSTGYDNAVALPAGGAGDEEELGKENLKDTSGSTGNITLKVAESNTATG  293

Query  932   EVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             E+ GVFES+QPSDTDLG+KAPKEVKIQGIWYAQL+
Sbjct  294   EIAGVFESIQPSDTDLGSKAPKEVKIQGIWYAQLD  328



>ref|XP_002991827.1| hypothetical protein SELMODRAFT_272235 [Selaginella moellendorffii]
 gb|EFJ07089.1| hypothetical protein SELMODRAFT_272235 [Selaginella moellendorffii]
Length=328

 Score =   387 bits (994),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 210/335 (63%), Positives = 247/335 (74%), Gaps = 14/335 (4%)
 Frame = +2

Query  53    MAASLQTAA---TLMQPTKVGVTPRIGRSYQ--TVGKALGV--DPSPARITCSLQSQIKE  211
             MAAS+  A    +L+QP K+  +     S +  +V KA G+  +   AR+TCS++  +K 
Sbjct  1     MAASVVAAKAGPSLLQP-KLDASAGSSASLRPVSVSKAFGLRSNGGGARLTCSMEDIVKR  59

Query  212   LAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTI  391
                  +D  K+A    A + L+   A A   PKRLT+DE+Q++TY+EVKGSGTANQCP +
Sbjct  60    A----TDVGKVAVATAAATLLVAGTAAAN--PKRLTYDEVQAQTYLEVKGSGTANQCPIL  113

Query  392   EGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGP  571
              GG   F FKPG YS KKFCLEPTSFTVK ES  K    ++ +TKLMTRLTYTLDEIE  
Sbjct  114   SGGDGGFKFKPGSYSVKKFCLEPTSFTVKKESPFKGGGDQYVDTKLMTRLTYTLDEIEAD  173

Query  572   FEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYR  751
               V   G++K  EKDGIDYAAVTVQLPGGERVPFLFTIK+LVATG P+ FSG FLVPSYR
Sbjct  174   LSVDEKGNLKLVEKDGIDYAAVTVQLPGGERVPFLFTIKELVATGSPDGFSGSFLVPSYR  233

Query  752   GSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETG  931
             GSSFLDPKGRGGSTGYDNAVALPAGG GDEEEL KEN+K+ + STG IT  V  S   TG
Sbjct  234   GSSFLDPKGRGGSTGYDNAVALPAGGAGDEEELGKENLKDTSGSTGNITLKVAESNTATG  293

Query  932   EVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             E+ GVFES+QPSDTDLG+KAPKEVKIQGIWYAQL+
Sbjct  294   EIAGVFESIQPSDTDLGSKAPKEVKIQGIWYAQLD  328



>ref|XP_001784751.1| predicted protein [Physcomitrella patens]
 gb|EDQ50440.1| predicted protein [Physcomitrella patens]
Length=274

 Score =   380 bits (977),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 186/248 (75%), Positives = 210/248 (85%), Gaps = 1/248 (0%)
 Frame = +2

Query  293   AEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFT  472
             AEGVP+RLTFDEI ++TY++VKGSGTANQCP +  G + F  K G Y  KK CLEPTSFT
Sbjct  28    AEGVPQRLTFDEINAQTYLDVKGSGTANQCPIVAEGSDKFNLKDGNYQMKKLCLEPTSFT  87

Query  473   VKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLP  652
             VKAES  K    ++Q TKLMTRLTYTLDEIEGP  +S +G++KFEEKDGIDYAAVTVQLP
Sbjct  88    VKAESQFKQGGEDYQPTKLMTRLTYTLDEIEGPLTIS-NGNLKFEEKDGIDYAAVTVQLP  146

Query  653   GGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGR  832
             GGERVPFLFTIK+LVATGKPE+F G +LVPSYRGSSFLDPKGRGGSTGYDNAVALPAGG 
Sbjct  147   GGERVPFLFTIKELVATGKPEAFGGSYLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGA  206

Query  833   GDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQ  1012
             GDEEEL KEN KN A+  G ITFS+  S  ETGE+ G FES+QPSDTDLG+KAPKEVKI+
Sbjct  207   GDEEELAKENEKNTAALNGNITFSIAKSNVETGEIAGTFESIQPSDTDLGSKAPKEVKIE  266

Query  1013  GIWYAQLE  1036
             GI+YAQ+E
Sbjct  267   GIFYAQVE  274



>ref|XP_002994513.1| hypothetical protein SELMODRAFT_138743, partial [Selaginella 
moellendorffii]
 gb|EFJ04421.1| hypothetical protein SELMODRAFT_138743, partial [Selaginella 
moellendorffii]
Length=244

 Score =   376 bits (965),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 183/244 (75%), Positives = 203/244 (83%), Gaps = 0/244 (0%)
 Frame = +2

Query  305   PKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAE  484
             PKRLT+DE+Q++TY+EVKGSGTANQCP + GG E F FKPG YS KKFCLEPTSFTVK E
Sbjct  1     PKRLTYDEVQAQTYLEVKGSGTANQCPILSGGDEGFKFKPGSYSVKKFCLEPTSFTVKKE  60

Query  485   SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGER  664
             S  K    ++ +TKLMTRLTYTLDEIE    V   G++K  EKDGIDYAAVTVQLPGGER
Sbjct  61    SPFKGGGDQYVDTKLMTRLTYTLDEIEADLSVDEKGNLKLVEKDGIDYAAVTVQLPGGER  120

Query  665   VPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEE  844
             VPFLFTIK+LVATG P+ FSG FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGG GDEE
Sbjct  121   VPFLFTIKELVATGSPDGFSGSFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGAGDEE  180

Query  845   ELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWY  1024
             EL KEN+K+ + STG IT  V  S   TGE+ GVFES+QPSDTDLG+KAPKEVKIQGIW 
Sbjct  181   ELGKENLKDTSGSTGNITLKVAESNTATGEIAGVFESIQPSDTDLGSKAPKEVKIQGIWC  240

Query  1025  AQLE  1036
             AQL+
Sbjct  241   AQLD  244



>gb|ABR26062.1| oxygen-evolving enhancer protein 1 [Oryza sativa Indica Group]
Length=203

 Score =   374 bits (960),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  428   KYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFE  607
             KY+ KKFCLEPTSFTVKAE V+KNAPPEFQ TKLMTRLTYTLDEIEGP EVSSDG++KFE
Sbjct  1     KYNMKKFCLEPTSFTVKAEGVAKNAPPEFQKTKLMTRLTYTLDEIEGPLEVSSDGTIKFE  60

Query  608   EKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGG  787
             EKDGIDYAAVTVQLPGGERVPFLFTIK LVATGKPESF G FLVPSYRGSSFLDPKGRGG
Sbjct  61    EKDGIDYAAVTVQLPGGERVPFLFTIKNLVATGKPESFGGPFLVPSYRGSSFLDPKGRGG  120

Query  788   STGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPS  967
             STGYDNAVALPAGGRGDEEEL KEN+KN +SSTG IT SVT SKPETGEVIGVFES+QPS
Sbjct  121   STGYDNAVALPAGGRGDEEELAKENVKNASSSTGNITLSVTKSKPETGEVIGVFESVQPS  180

Query  968   DTDLGAKAPKEVKIQGIWYAQLE  1036
             DTDLGAK PK+VKIQG+WYAQLE
Sbjct  181   DTDLGAKVPKDVKIQGVWYAQLE  203



>dbj|BAF94220.1| 33kDa oxygen evolving protein of photosystem II [Closterium peracerosum-strigosum-littorale 
complex]
Length=325

 Score =   364 bits (934),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 200/329 (61%), Positives = 242/329 (74%), Gaps = 7/329 (2%)
 Frame = +2

Query  50    TMAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  229
             T A++   A+T +QP     + +       V +A G+  + A+++CS +  ++      +
Sbjct  4     TAASASLKASTFVQPKVNAASLKAA----PVSQAFGLKTASAKVSCSAEENVRGFVQKCA  59

Query  230   DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
             DA K A  ALA++AL+ S A A  VP RL FDE+QS TY EVKGSG ANQCP I GGV+ 
Sbjct  60    DAGKAAALALASTALVASSAQA-AVP-RLNFDELQSLTYSEVKGSGIANQCPIIAGGVDG  117

Query  410   FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
             FAFK GKY   K CLEPT+FTVKAES  K    EFQ TKLMTRLTYTLDEIEGP EV+ +
Sbjct  118   FAFKSGKYQVSKMCLEPTAFTVKAESQFKGQGEEFQKTKLMTRLTYTLDEIEGPLEVNGN  177

Query  590   GSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLD  769
              ++KF E DGIDYAAVTVQL GGERVPFLFT+K+LVA+G  +SF G FLVPSYRG++FLD
Sbjct  178   -NLKFTEVDGIDYAAVTVQLAGGERVPFLFTVKELVASGPADSFGGSFLVPSYRGATFLD  236

Query  770   PKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVF  949
             PKGRGGS GYD AVALPAGG GDE+ LQKEN K+  + +G ITFSV  S  ETGE+ GVF
Sbjct  237   PKGRGGSQGYDTAVALPAGGFGDEDALQKENQKSYKALSGNITFSVAKSNVETGEIGGVF  296

Query  950   ESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
              S+QPSDTD+GAK PK+VKI+GIWYAQL+
Sbjct  297   TSVQPSDTDMGAKVPKDVKIEGIWYAQLD  325



>gb|ABR26133.1| oxygen-evolving enhancer protein 1 [Oryza sativa Indica Group]
Length=178

 Score =   330 bits (847),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +2

Query  503   PPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFT  682
             PPEFQ TKLMTRLTYTLDEIEGP EVSSDG++KFEEKDGIDYAAVTVQLPGGERVPFLFT
Sbjct  1     PPEFQKTKLMTRLTYTLDEIEGPLEVSSDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFT  60

Query  683   IKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN  862
             IK LVATGKPESF G FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN
Sbjct  61    IKNLVATGKPESFGGPFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKEN  120

Query  863   IKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             +KN +SSTG IT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  121   VKNASSSTGNITLSVTKSKPETGEVIGVFESVQPSDTDLGAKVPKDVKIQGVWYAQLE  178



>dbj|BAF94214.1| 33kDa oxygen evolving protein of photosystem II [Oedogonium obesum]
Length=291

 Score =   335 bits (858),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 191/242 (79%), Gaps = 5/242 (2%)
 Frame = +2

Query  314   LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESV  490
             LTFDE+Q  TY++VKG+G AN CP I+GG  N    KPG YS +K CLEPTSFTVK E+ 
Sbjct  54    LTFDELQGLTYLQVKGTGIANTCPVIDGGSTNLKDLKPGTYSFEKLCLEPTSFTVKEENA  113

Query  491   SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
                +  EF +TKLMTRLTYTLDEI G   V S+GSV+ +E+DGIDYA VTVQLPGGERVP
Sbjct  114   KGES--EFVSTKLMTRLTYTLDEISGKLTVGSNGSVELKEEDGIDYAPVTVQLPGGERVP  171

Query  671   FLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
             FLFTIKQL A G  E FSG+F VPSYRGSSFLDPKGRGGSTGYDNAVALPA  R D EEL
Sbjct  172   FLFTIKQLEAKGTLEGFSGDFTVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RADSEEL  229

Query  851   QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQ  1030
              KEN K+VA+S G   FSV    P TGE+ GVFES+QPSDTDLGAKAPK++KI+G+WYAQ
Sbjct  230   AKENTKSVAASKGSAAFSVAVVDPATGEIAGVFESIQPSDTDLGAKAPKDIKIKGLWYAQ  289

Query  1031  LE  1036
             L+
Sbjct  290   LK  291



>gb|ACE98011.1| putative protein, partial [Populus tremula]
 gb|ACE98012.1| putative protein, partial [Populus tremula]
 gb|ACE98013.1| putative protein, partial [Populus tremula]
 gb|ACE98014.1| putative protein, partial [Populus tremula]
 gb|ACE98015.1| putative protein, partial [Populus tremula]
 gb|ACE98016.1| putative protein, partial [Populus tremula]
 gb|ACE98017.1| putative protein, partial [Populus tremula]
 gb|ACE98018.1| putative protein, partial [Populus tremula]
 gb|ACE98019.1| putative protein, partial [Populus tremula]
 gb|ACE98020.1| putative protein, partial [Populus tremula]
 gb|ACE98021.1| putative protein, partial [Populus tremula]
 gb|ACE98022.1| putative protein, partial [Populus tremula]
 gb|ACE98023.1| putative protein, partial [Populus tremula]
 gb|ACE98024.1| putative protein, partial [Populus tremula]
 gb|ACE98025.1| putative protein, partial [Populus tremula]
 gb|ACE98026.1| putative protein, partial [Populus tremula]
 gb|ACE98027.1| putative protein, partial [Populus tremula]
 gb|ACE98028.1| putative protein, partial [Populus tremula]
 gb|ACE98029.1| putative protein, partial [Populus tremula]
 gb|ACE98030.1| putative protein, partial [Populus tremula]
 gb|ACE98031.1| putative protein, partial [Populus tremula]
 gb|ACE98032.1| putative protein, partial [Populus tremula]
 gb|ACE98033.1| putative protein, partial [Populus tremula]
 gb|ACE98034.1| putative protein, partial [Populus tremula]
 gb|ACE98035.1| putative protein, partial [Populus tremula]
 gb|ACE98036.1| putative protein, partial [Populus tremula]
 gb|ACE98037.1| putative protein, partial [Populus tremula]
 gb|ACE98038.1| putative protein, partial [Populus tremula]
 gb|ACE98039.1| putative protein, partial [Populus tremula]
 gb|ACE98040.1| putative protein, partial [Populus tremula]
 gb|ACE98041.1| putative protein, partial [Populus tremula]
 gb|ACE98042.1| putative protein, partial [Populus tremula]
 gb|ACE98043.1| putative protein, partial [Populus tremula]
 gb|ACE98044.1| putative protein, partial [Populus tremula]
 gb|ACE98045.1| putative protein, partial [Populus tremula]
 gb|ACE98046.1| putative protein, partial [Populus tremula]
Length=170

 Score =   330 bits (845),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/170 (92%), Positives = 166/170 (98%), Gaps = 0/170 (0%)
 Frame = +2

Query  296  EGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTV  475
            EGVPKRLT+DEIQSKTYMEVKGSGTANQCPT++GG E+FAFK GKY+AKKFCLEPTSFTV
Sbjct  1    EGVPKRLTYDEIQSKTYMEVKGSGTANQCPTLDGGAESFAFKAGKYNAKKFCLEPTSFTV  60

Query  476  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPG  655
            KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS DG++KFEEKDGIDYAAVTVQLPG
Sbjct  61   KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFEEKDGIDYAAVTVQLPG  120

Query  656  GERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDN  805
            GERVPFLFT+KQL A+GKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDN
Sbjct  121  GERVPFLFTVKQLTASGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDN  170



>ref|XP_001422458.1| psbO, PSII-O, OEE1, photosystem II polypeptide, oxygen evolving 
enhancer 1 [Ostreococcus lucimarinus CCE9901]
 gb|ABP00775.1| psbO, PSII-O, OEE1, photosystem II polypeptide, oxygen evolving 
enhancer 1 [Ostreococcus lucimarinus CCE9901]
Length=302

 Score =   328 bits (842),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 161/258 (62%), Positives = 189/258 (73%), Gaps = 2/258 (1%)
 Frame = +2

Query  260   ATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSA  439
             A+ AL V+GA        +T+DE+Q  TY++VKG+G AN CP +EGGV     K G Y+ 
Sbjct  44    ASVALGVAGAVLAQSAGAVTYDELQGLTYLQVKGTGLANTCPVVEGGVSGKEIKAGDYAL  103

Query  440   KKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  619
             ++FC+EPTSFTVK ES  K    EF  T+LMTRLTYTLD + G F+V SDGSV  +E DG
Sbjct  104   ERFCMEPTSFTVKEESQFKQGESEFSKTRLMTRLTYTLDGMTGSFKVGSDGSVNVQENDG  163

Query  620   IDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGY  799
             +DYA VTVQLPGGERVPFLFT+K+    G    F G+F+VPSYRGSSFLDPKGRGGSTGY
Sbjct  164   LDYAPVTVQLPGGERVPFLFTLKEFTGKGNTSQFGGDFVVPSYRGSSFLDPKGRGGSTGY  223

Query  800   DNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDL  979
             DNAVALPA  R D EELQKEN KN A+  G   F+V    P TGE+ GVFES+QPSDTDL
Sbjct  224   DNAVALPA--RADSEELQKENQKNTAALKGSAVFNVAKYDPATGEIAGVFESIQPSDTDL  281

Query  980   GAKAPKEVKIQGIWYAQL  1033
             GAK PK+VKI G+WYA L
Sbjct  282   GAKVPKDVKITGLWYANL  299



>ref|XP_005644574.1| 33kDa oxygen evolving protein of photosystem II [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20030.1| 33kDa oxygen evolving protein of photosystem II [Coccomyxa subellipsoidea 
C-169]
Length=315

 Score =   328 bits (840),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 169/287 (59%), Positives = 203/287 (71%), Gaps = 11/287 (4%)
 Frame = +2

Query  179   ITCSLQSQIKELAHNFS-DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEV  355
             + C L   ++      + +  K+A   +  S+L+++GA+     + LT+DE+Q  TY++V
Sbjct  37    VVCGLSENVQSAVAAAAANVGKMA--VVVGSSLMLAGAS-----QALTYDELQGLTYLQV  89

Query  356   KGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  532
             KGSG AN CP +EGG  N    K G Y+  KFCLEPTSFTVK ES  K    +F  TKLM
Sbjct  90    KGSGIANTCPVLEGGSSNLKDLKAGDYNISKFCLEPTSFTVKEESQFKGGDTDFVKTKLM  149

Query  533   TRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP  712
             TRLTYTLDEI G F V   G+V F+E+DGIDYA VTVQLPGGERVPFLFTIK+L A G  
Sbjct  150   TRLTYTLDEISGKFSVDGSGNVNFKEEDGIDYAPVTVQLPGGERVPFLFTIKELNAKGSL  209

Query  713   ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGK  892
               F G+F+VPSYRGSSFLDPKGRGGSTGYDNAVALP  GR D EEL KEN K+  +  G+
Sbjct  210   GGFGGDFVVPSYRGSSFLDPKGRGGSTGYDNAVALP--GRSDSEELAKENNKSTVALKGQ  267

Query  893   ITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  1033
               FSV    P TGE+ GVFES+QPSDTDLG+KAPK+VKI G+WY QL
Sbjct  268   AVFSVAKVDPATGEIAGVFESIQPSDTDLGSKAPKDVKITGLWYGQL  314



>gb|ABK95838.1| unknown [Populus trichocarpa]
Length=170

 Score =   322 bits (825),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +2

Query  530   MTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGK  709
             MTRLTYTLDEIEGPFEVSSDG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GK
Sbjct  1     MTRLTYTLDEIEGPFEVSSDGNIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGK  60

Query  710   PESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTG  889
             P+SFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN ASSTG
Sbjct  61    PDSFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKNTASSTG  120

Query  890   KITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             KIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  121   KITLSVTKSKPETGEVIGVFESVQPSDTDLGAKTPKDVKIQGIWYAQLD  169



>ref|XP_005843863.1| hypothetical protein CHLNCDRAFT_32868 [Chlorella variabilis]
 gb|EFN51761.1| hypothetical protein CHLNCDRAFT_32868 [Chlorella variabilis]
Length=297

 Score =   325 bits (834),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 159/246 (65%), Positives = 188/246 (76%), Gaps = 3/246 (1%)
 Frame = +2

Query  299   GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  475
             G    L+FDE+Q  TY++VKGSG AN CPT++GG  N    KPG YS  KFC+EPTSFTV
Sbjct  53    GSANALSFDELQGLTYLQVKGSGIANTCPTLDGGSANIKDLKPGSYSLGKFCMEPTSFTV  112

Query  476   KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPG  655
             K ES  K    +F +TKLMTRLTYTLDE+ G F+V   G+V+ +E+DGIDYA VTVQLPG
Sbjct  113   KEESQFKGGDSDFVSTKLMTRLTYTLDEMSGSFKVDGSGNVELKEEDGIDYAPVTVQLPG  172

Query  656   GERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRG  835
             GERVPFLF++KQL A G  + F GEF+VPSYRGS+FLDPKGRG +TGYDNAVALPA    
Sbjct  173   GERVPFLFSVKQLEAKGNADGFGGEFVVPSYRGSTFLDPKGRGAATGYDNAVALPAA--S  230

Query  836   DEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQG  1015
             D EE  KENIK+ A+  G+  FS+    P TGE+ GVFES+QPSDTDLGAKAPK+VKI G
Sbjct  231   DAEEFLKENIKSTAAMKGQAVFSIAKVDPVTGEIAGVFESVQPSDTDLGAKAPKDVKITG  290

Query  1016  IWYAQL  1033
             +WYAQL
Sbjct  291   LWYAQL  296



>emb|CEG01950.1| Photosystem II PsbO, manganese-stabilising [Ostreococcus tauri]
Length=302

 Score =   325 bits (832),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/258 (61%), Positives = 189/258 (73%), Gaps = 2/258 (1%)
 Frame = +2

Query  260   ATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSA  439
             AT +L V+GA        +T+DE+Q  TY++VKG+G AN CP +EGGV     K G Y  
Sbjct  45    ATVSLGVAGAVLAQSASAVTYDELQGLTYLQVKGTGLANTCPVVEGGVSGKDIKAGDYKL  104

Query  440   KKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  619
             ++FC+EPTSFTVK ES  K    EFQ T+LMTRLTYTLD + G F+V SDGSV+ +E DG
Sbjct  105   ERFCMEPTSFTVKEESQFKAGESEFQKTRLMTRLTYTLDGMTGDFKVGSDGSVQIKENDG  164

Query  620   IDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGY  799
             +DYA VTVQLPGGERVPFLFT+K+    G    F G+F+VPSYRGSSFLDPKGRGGSTGY
Sbjct  165   LDYAPVTVQLPGGERVPFLFTLKEFTGKGNTSQFGGDFVVPSYRGSSFLDPKGRGGSTGY  224

Query  800   DNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDL  979
             DNAVALPA  R D EELQKEN K+ A+  G   F++    P TGE+ GVFES+QPSDTDL
Sbjct  225   DNAVALPA--RADSEELQKENNKSAAALKGSAVFNIAKYDPATGEIAGVFESIQPSDTDL  282

Query  980   GAKAPKEVKIQGIWYAQL  1033
             GAK PK+VKI G+WY  +
Sbjct  283   GAKVPKDVKITGLWYGNI  300



>gb|ABA01139.1| chloroplast oxygen-evolving enhancer protein 1 [Chlamydomonas 
incerta]
Length=291

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/247 (65%), Positives = 181/247 (73%), Gaps = 3/247 (1%)
 Frame = +2

Query  299   GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  475
             G    LTFDEIQ  TY++VKGSG AN CP +E G  N    K G Y  + FC+EPTSFTV
Sbjct  47    GSANALTFDEIQGLTYLQVKGSGIANTCPVLESGTTNLKELKAGSYKLENFCIEPTSFTV  106

Query  476   KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPG  655
             K ES  K    EF  TKLMTRLTYTLD + G F+V SDGS + +E DGIDYAA TVQLPG
Sbjct  107   KEESQFKGGDSEFVKTKLMTRLTYTLDAMSGSFKVGSDGSAELKEDDGIDYAATTVQLPG  166

Query  656   GERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRG  835
             GERV FLFTIKQ    G  ++  G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPA  R 
Sbjct  167   GERVAFLFTIKQFDGKGTLDNIKGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RA  224

Query  836   DEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQG  1015
             D EEL KEN+KN  +  G   FSV    P TGE+ GVFES+QPSDTDLGAKAPK++K+ G
Sbjct  225   DAEELLKENVKNTKALKGSAVFSVAKVDPVTGEIAGVFESIQPSDTDLGAKAPKDIKVTG  284

Query  1016  IWYAQLE  1036
             +WYAQL+
Sbjct  285   LWYAQLK  291



>gb|AGI15739.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=167

 Score =   319 bits (817),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/167 (94%), Positives = 162/167 (97%), Gaps = 0/167 (0%)
 Frame = +2

Query  443  KFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGI  622
            KFCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDGI
Sbjct  1    KFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDGI  60

Query  623  DYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYD  802
            DYAAVTVQLPGGERVPFLFT+KQLVA+GKP+SFSG+FLVPSYRGSSFLDPKGRGGSTGYD
Sbjct  61   DYAAVTVQLPGGERVPFLFTVKQLVASGKPDSFSGDFLVPSYRGSSFLDPKGRGGSTGYD  120

Query  803  NAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
            NAVALPAGGRGDEEELQKEN KNVASSTGKIT SVT SKPETGE+IG
Sbjct  121  NAVALPAGGRGDEEELQKENNKNVASSTGKITLSVTKSKPETGEIIG  167



>gb|AGI15761.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=167

 Score =   318 bits (816),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 157/167 (94%), Positives = 162/167 (97%), Gaps = 0/167 (0%)
 Frame = +2

Query  446  FCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGID  625
            FCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDGID
Sbjct  1    FCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDGID  60

Query  626  YAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDN  805
            YAAVTVQLPGGERVPFLFT+KQLVA+GKP+SFSG+FLVPSYRGSSFLDPKGRGGSTGYDN
Sbjct  61   YAAVTVQLPGGERVPFLFTVKQLVASGKPDSFSGDFLVPSYRGSSFLDPKGRGGSTGYDN  120

Query  806  AVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGV  946
            AVALPAGGRGDEEELQKEN KNVASSTGKIT SVT SKPETGE+IGV
Sbjct  121  AVALPAGGRGDEEELQKENNKNVASSTGKITLSVTKSKPETGEIIGV  167



>ref|XP_003063851.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
pusilla CCMP1545]
 gb|EEH52224.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
pusilla CCMP1545]
Length=303

 Score =   323 bits (827),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 154/241 (64%), Positives = 186/241 (77%), Gaps = 2/241 (1%)
 Frame = +2

Query  314   LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  493
             +T+DE+Q  TY++VKG+G AN CP ++GG  + + K G Y+ +KFC+EPTSFTVK +S  
Sbjct  65    VTYDELQGLTYLQVKGTGLANTCPVVDGGESSKSIKAGDYALEKFCMEPTSFTVKEDSAF  124

Query  494   KNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
             K    EF  TKLMTRLTYTLD + G F+V SDGSV  +E+DG+DYA VTVQLPGGERVPF
Sbjct  125   KAGESEFTKTKLMTRLTYTLDGMTGSFKVGSDGSVAIQERDGLDYAPVTVQLPGGERVPF  184

Query  674   LFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQ  853
             LFT+K+    G    F G+F+VPSYRGSSFLDPKGRGGSTGYDNAVALPA  + D +EL 
Sbjct  185   LFTLKEFTGKGNTSQFGGDFVVPSYRGSSFLDPKGRGGSTGYDNAVALPA--KSDADELL  242

Query  854   KENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  1033
             KEN KNVA+  G   F+V    P TGEV GVFES+QPSDTDLG+KAPK+VKI G+WYAQL
Sbjct  243   KENNKNVAALKGSAVFNVAKYDPVTGEVAGVFESIQPSDTDLGSKAPKDVKITGLWYAQL  302

Query  1034  E  1036
             +
Sbjct  303   Q  303



>gb|AGI15756.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15757.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15758.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15759.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15760.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=166

 Score =   317 bits (812),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +2

Query  446  FCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGID  625
            FCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDGID
Sbjct  1    FCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDGID  60

Query  626  YAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDN  805
            YAAVTVQLPGGERVPFLFT+KQLVA+GKP+SFSG+FLVPSYRGSSFLDPKGRGGSTGYDN
Sbjct  61   YAAVTVQLPGGERVPFLFTVKQLVASGKPDSFSGDFLVPSYRGSSFLDPKGRGGSTGYDN  120

Query  806  AVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  943
            AVALPAGGRGDEEELQKEN KNVASSTGKIT SVT SKPETGE+IG
Sbjct  121  AVALPAGGRGDEEELQKENNKNVASSTGKITLSVTKSKPETGEIIG  166



>gb|ACU19823.1| unknown [Glycine max]
Length=170

 Score =   315 bits (807),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +2

Query  530   MTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGK  709
             MTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GK
Sbjct  1     MTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGK  60

Query  710   PESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTG  889
             P+SFSGEFLVPSYRGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+ +SS G
Sbjct  61    PDSFSGEFLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELAKENNKSASSSKG  120

Query  890   KITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             KIT SVT +KPETGEVIGVFES+QPSDTDLGAKAPK+VKIQGIWYAQLE
Sbjct  121   KITLSVTKTKPETGEVIGVFESVQPSDTDLGAKAPKDVKIQGIWYAQLE  169



>gb|ACJ84218.1| unknown [Medicago truncatula]
Length=170

 Score =   314 bits (805),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  530   MTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGK  709
             MTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GK
Sbjct  1     MTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGK  60

Query  710   PESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTG  889
             P+SFSGEFLVPSYRGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+ ASS G
Sbjct  61    PDSFSGEFLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELGKENNKSAASSKG  120

Query  890   KITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             KIT SVT SKPETGEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  121   KITLSVTQSKPETGEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLE  169



>dbj|BAF94213.1| 33kDa oxygen evolving protein of photosystem II [Hafniomonas 
montana]
Length=290

 Score =   318 bits (815),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 163/247 (66%), Positives = 185/247 (75%), Gaps = 3/247 (1%)
 Frame = +2

Query  299   GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF-AFKPGKYSAKKFCLEPTSFTV  475
             G    LT+DE+Q  TY++VKGSG AN CP +E G  N    K G Y  +K C+EPTSFTV
Sbjct  45    GSANALTYDELQGLTYLQVKGSGIANTCPVVEAGTTNLNELKAGNYKFQKMCMEPTSFTV  104

Query  476   KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPG  655
             K ES  +    EF  TKLMTRLTYTLDE+ G F+V   G V+ +E+DGIDYAA TVQLPG
Sbjct  105   KEESQFRGGDSEFVKTKLMTRLTYTLDEMSGTFKVDGSGKVELQEEDGIDYAATTVQLPG  164

Query  656   GERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRG  835
             GERVPFLFTIKQL A G  +SFSG+F+VPSYRGSSFLDPKGRG STGYDNAVALPA  R 
Sbjct  165   GERVPFLFTIKQLNAKGTLDSFSGDFVVPSYRGSSFLDPKGRGASTGYDNAVALPA--RA  222

Query  836   DEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQG  1015
             D EEL KEN K+ ASS G   FS+    P TGEV GVFES+QPSDTDLGAK PK++KI G
Sbjct  223   DAEELAKENSKSAASSKGSAVFSIAKVDPVTGEVAGVFESIQPSDTDLGAKTPKDIKITG  282

Query  1016  IWYAQLE  1036
             IWYAQL+
Sbjct  283   IWYAQLQ  289



>gb|ABG25041.1| 33kDa precursor protein of oxygen-evolving complex [Nicotiana 
tabacum]
Length=179

 Score =   314 bits (804),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  125  RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGV  304
            RS Q+V KA GV+P+ AR+TCS Q+++K+LA  F+DAAK+AGFALATSAL+VSGANAEGV
Sbjct  3    RSAQSVSKAFGVEPAAARLTCSSQTELKDLAQKFTDAAKVAGFALATSALVVSGANAEGV  62

Query  305  PKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAE  484
            PKRLTFDEIQSKTYMEVKG+GTANQCPTIEGGV +FAFKPGKY+AKKFCLEPTSFTVKA 
Sbjct  63   PKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGVASFAFKPGKYNAKKFCLEPTSFTVKAG  122

Query  485  SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPG  655
            SV+KNAPP+FQ TKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPG
Sbjct  123  SVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPG  179



>dbj|BAF94217.1| 33kDa oxygen evolving protein of photosystem II, partial [Nephroselmis 
olivacea]
Length=260

 Score =   317 bits (812),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 158/241 (66%), Positives = 184/241 (76%), Gaps = 3/241 (1%)
 Frame = +2

Query  314   LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  493
             L++D++ + TY++VKG+G AN CP IE  V N   K G YS ++ C+EPTSFTVK ES  
Sbjct  23    LSYDDLNALTYLQVKGTGIANTCPVIEKNV-NDKIKAGDYSIEQLCMEPTSFTVKEESQF  81

Query  494   KNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
             K    EF  TKL+TRLTYTLD+I G F+V +DGSV F E+DGIDYAA TVQLPGGERVPF
Sbjct  82    KAGEAEFVKTKLLTRLTYTLDDISGKFKVGADGSVTFTEEDGIDYAATTVQLPGGERVPF  141

Query  674   LFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQ  853
             LFTIK+LVA G    F G+F+VPSYRGSSFLDPKGRG STGYD AVALPA   GD EEL 
Sbjct  142   LFTIKELVAKGNTSQFGGDFVVPSYRGSSFLDPKGRGASTGYDTAVALPAA--GDAEELA  199

Query  854   KENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  1033
             KEN K+ AS TG   F+V      TGE+ GVFES+QPSDTDLGAKAPK+VKI G+WYAQL
Sbjct  200   KENNKSAASLTGSAVFNVAKYDAATGEIAGVFESIQPSDTDLGAKAPKDVKITGLWYAQL  259

Query  1034  E  1036
             +
Sbjct  260   K  260



>gb|AGI15742.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15743.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15744.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15745.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15746.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15747.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15748.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15749.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15750.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15751.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15752.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15753.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15754.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15755.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=164

 Score =   313 bits (802),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = +2

Query  446  FCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGID  625
            FCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDGID
Sbjct  1    FCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDGID  60

Query  626  YAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDN  805
            YAAVTVQLPGGERVPFLFT+KQLVA+GKP+SFSG+FLVPSYRGSSFLDPKGRGGSTGYDN
Sbjct  61   YAAVTVQLPGGERVPFLFTVKQLVASGKPDSFSGDFLVPSYRGSSFLDPKGRGGSTGYDN  120

Query  806  AVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEV  937
            AVALPAGGRGDEEELQKEN KNVASSTGKIT SVT SKPETGE+
Sbjct  121  AVALPAGGRGDEEELQKENNKNVASSTGKITLSVTKSKPETGEI  164



>ref|XP_001694699.1| oxygen-evolving enhancer protein 1 of photosystem II [Chlamydomonas 
reinhardtii]
 gb|EDP02283.1| oxygen-evolving enhancer protein 1 of photosystem II [Chlamydomonas 
reinhardtii]
Length=291

 Score =   316 bits (810),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/247 (64%), Positives = 179/247 (72%), Gaps = 3/247 (1%)
 Frame = +2

Query  299   GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  475
             G    LTFDEIQ  TY++VKGSG AN CP +E G  N    K G Y  + FC+EPTSFTV
Sbjct  47    GSANALTFDEIQGLTYLQVKGSGIANTCPVLESGTTNLKELKAGSYKLENFCIEPTSFTV  106

Query  476   KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPG  655
             K ES  K    EF  TKLMTRLTYTLD + G F+V SDGS + +E DGIDYAA TVQLPG
Sbjct  107   KEESQFKGGETEFVKTKLMTRLTYTLDAMSGSFKVGSDGSAELKEDDGIDYAATTVQLPG  166

Query  656   GERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRG  835
             GERV FLFTIKQ    G  ++  G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPA  R 
Sbjct  167   GERVAFLFTIKQFDGKGTLDNIKGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RA  224

Query  836   DEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQG  1015
             D EEL KEN+K   +  G   FSV    P TGE+ GVFES+QPSDTDLGAK PK++K+ G
Sbjct  225   DAEELLKENVKITKALKGSAVFSVAKVDPVTGEIAGVFESIQPSDTDLGAKPPKDIKVTG  284

Query  1016  IWYAQLE  1036
             +WYAQL+
Sbjct  285   LWYAQLK  291



>sp|P12853.1|PSBO_CHLRE RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Chlamydomonas reinhardtii]
 emb|CAA32053.1| OEE1 precursor protein [Chlamydomonas reinhardtii]
 prf||1807335A photosystem II OEE1 protein
Length=291

 Score =   315 bits (808),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 158/247 (64%), Positives = 178/247 (72%), Gaps = 3/247 (1%)
 Frame = +2

Query  299   GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  475
             G    LTFDEIQ  TY++VKGSG AN CP +E G  N    K G Y  + FC+EPTSFTV
Sbjct  47    GSANALTFDEIQGLTYLQVKGSGIANTCPVLESGTTNLKELKAGSYKLENFCIEPTSFTV  106

Query  476   KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPG  655
             K ES  K    EF  TKLMTRLTYTLD + G F+V SDGS + +E DGIDYAA TVQLPG
Sbjct  107   KEESQFKGGETEFVKTKLMTRLTYTLDAMSGSFKVGSDGSAELKEDDGIDYAATTVQLPG  166

Query  656   GERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRG  835
             GERV FLFTIKQ    G  +   G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPA  R 
Sbjct  167   GERVAFLFTIKQFDGKGTLDGIKGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RA  224

Query  836   DEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQG  1015
             D EEL KEN+K   +  G   FSV    P TGE+ GVFES+QPSDTDLGAK PK++K+ G
Sbjct  225   DAEELLKENVKITKALKGSAVFSVAKVDPVTGEIAGVFESIQPSDTDLGAKPPKDIKVTG  284

Query  1016  IWYAQLE  1036
             +WYAQL+
Sbjct  285   LWYAQLK  291



>gb|ABQ85434.1| 33 kDa OEC protein, partial [Salicornia veneta]
Length=170

 Score =   311 bits (796),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +2

Query  530   MTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGK  709
             MTRLTYTLDE+EGPFEVSSD +VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GK
Sbjct  1     MTRLTYTLDEMEGPFEVSSDETVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGK  60

Query  710   PESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTG  889
             P+SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN ASS G
Sbjct  61    PDSFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELLKENNKNAASSKG  120

Query  890   KITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
              IT SV+ SKPETGEVIGVF+SLQPSDTDLGAK PK+VKI+GIWYAQLE
Sbjct  121   TITLSVSKSKPETGEVIGVFQSLQPSDTDLGAKTPKDVKIEGIWYAQLE  169



>gb|AAD38521.1|AF139818_1 33 kDa oxygen evolving protein of photosystem II [Brassica napus]
Length=274

 Score =   313 bits (802),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 165/257 (64%), Positives = 186/257 (72%), Gaps = 10/257 (4%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ+A T +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSATTFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFL---FTIKQLVATGKPESFSGEFLVPSYR  751
            SSDGS    E  G     +        R P          L      +    +FLVPSYR
Sbjct  181  SSDGS---REVQGRRRNRLRCSHRPASRRPTCASSSRSSSLTPQQTRQLHLAKFLVPSYR  237

Query  752  GSSFLDPKGRGGSTGYD  802
            GSSFLDPKGRGGS GY+
Sbjct  238  GSSFLDPKGRGGSPGYE  254



>gb|AFK46831.1| unknown [Lotus japonicus]
Length=170

 Score =   309 bits (791),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +2

Query  530   MTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGK  709
             MTRL YTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVT QLPGGERVP LFTIKQLVA+GK
Sbjct  1     MTRLAYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTAQLPGGERVPSLFTIKQLVASGK  60

Query  710   PESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTG  889
             P+SFSGEFLVPSYRGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+ +SS G
Sbjct  61    PDSFSGEFLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELAKENNKSASSSKG  120

Query  890   KITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             KIT SVT SKP+TGEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  121   KITLSVTQSKPDTGEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLE  169



>ref|XP_011400268.1| Oxygen-evolving enhancer protein 1, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM27301.1| Oxygen-evolving enhancer protein 1, chloroplastic [Auxenochlorella 
protothecoides]
Length=303

 Score =   313 bits (803),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/240 (65%), Positives = 179/240 (75%), Gaps = 3/240 (1%)
 Frame = +2

Query  317   TFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESVS  493
             TFDE+Q  TY++VKGSG AN CPT+ GG  N    K G YS  K CLEPTSF VK E+  
Sbjct  65    TFDELQGLTYLQVKGSGIANTCPTLSGGSSNIKDLKSGTYSVNKMCLEPTSFKVKEEAQF  124

Query  494   KNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
             KN   +F  TKL+TRLTYTLDEI G  ++   G V+F+E+DGIDYAAVTVQLPGGERVPF
Sbjct  125   KNGEADFVPTKLVTRLTYTLDEISGQMKIDGSGGVEFKEEDGIDYAAVTVQLPGGERVPF  184

Query  674   LFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQ  853
             LFTIK+L A G  + F GEF VPSYRGSSFLDPKGRG STGYDNAVALPA   GD EEL+
Sbjct  185   LFTIKELDAKGTADGFKGEFTVPSYRGSSFLDPKGRGASTGYDNAVALPAA--GDSEELE  242

Query  854   KENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  1033
             KEN K+  +  G+  FS+      TGEV G+FES+QPSDTDLGAK PKEVKI G+WY QL
Sbjct  243   KENNKSTKALKGEAIFSIAKVDAGTGEVAGIFESIQPSDTDLGAKVPKEVKITGLWYGQL  302



>gb|AGI15740.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15741.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=160

 Score =   306 bits (785),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  446  FCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGID  625
            FCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDGID
Sbjct  1    FCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDGID  60

Query  626  YAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDN  805
            YAAVTVQLPGGERVPFLFT+KQLVA+GKP+SFSG+FLVPSYRGSSFLDPKGRGGSTGYDN
Sbjct  61   YAAVTVQLPGGERVPFLFTVKQLVASGKPDSFSGDFLVPSYRGSSFLDPKGRGGSTGYDN  120

Query  806  AVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPE  925
            AVALPAGGRGDEEELQKEN KNVASSTGKIT SVT SKPE
Sbjct  121  AVALPAGGRGDEEELQKENNKNVASSTGKITLSVTKSKPE  160



>ref|XP_002505809.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
sp. RCC299]
 gb|ACO67067.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
sp. RCC299]
Length=303

 Score =   311 bits (798),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/247 (63%), Positives = 185/247 (75%), Gaps = 2/247 (1%)
 Frame = +2

Query  293   AEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFT  472
             A G  + +T+DE+Q  TY++VKG+G AN CP +E G    + K G Y+ +KFC+EPTSFT
Sbjct  57    AAGSAQAVTYDELQGLTYLQVKGTGLANTCPVVETGGSGSSIKGGDYALEKFCMEPTSFT  116

Query  473   VKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLP  652
             VK ES  K    EF  TKLMTRLTYTLD + G F+V SDGSV  +E+DG+DYA VTVQLP
Sbjct  117   VKEESAFKAGESEFVKTKLMTRLTYTLDGMTGSFKVGSDGSVAVQERDGLDYAPVTVQLP  176

Query  653   GGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGR  832
             GGERVPFLFT+K+    G    F G+F+VPSYRGSSFLDPKGRGGSTGYDNAVALPA  +
Sbjct  177   GGERVPFLFTLKEFTGKGNTSQFGGDFVVPSYRGSSFLDPKGRGGSTGYDNAVALPA--K  234

Query  833   GDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQ  1012
              D +EL KEN KNVA+  G   F+V      TGE+ GVFES+QPSDTDLG+KAPK+VKI 
Sbjct  235   SDADELLKENNKNVAALKGSAVFNVAKYDEVTGEIAGVFESIQPSDTDLGSKAPKDVKIT  294

Query  1013  GIWYAQL  1033
             G+WYAQL
Sbjct  295   GLWYAQL  301



>dbj|BAF94216.1| 33kDa oxygen evolving protein of photosystem II [Tetraselmis 
cordiformis]
Length=308

 Score =   310 bits (793),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/241 (64%), Positives = 180/241 (75%), Gaps = 3/241 (1%)
 Frame = +2

Query  314   LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKP-GKYSAKKFCLEPTSFTVKAESV  490
             LT+D++Q  TY++VKG+G AN CP I GG  N    P G Y   +FCLEPTSFTVK +S 
Sbjct  67    LTYDQLQGLTYLQVKGTGVANTCPVISGGSTNPKDIPAGNYKFSEFCLEPTSFTVKEDSQ  126

Query  491   SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
              K    E   TKLMTRLTYTLD++ G   + SDG V F+E+DGIDYA VTVQLPGGERVP
Sbjct  127   FKAGESELVKTKLMTRLTYTLDDMSGKMTIGSDGKVTFKEEDGIDYAPVTVQLPGGERVP  186

Query  671   FLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
             FLFT+++L A G  +SFSG+F V SYRGSSFLDPKGRGGSTGYDNAVALPA  R D+EEL
Sbjct  187   FLFTVRELDAKGTLDSFSGDFTVTSYRGSSFLDPKGRGGSTGYDNAVALPA--RSDDEEL  244

Query  851   QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQ  1030
              KEN KN A+  G I  SV      TGE+ GVFES+QPSDTDLG+KAPK+VKI G+WY Q
Sbjct  245   FKENNKNTAALKGSIVLSVAKVDASTGEIAGVFESIQPSDTDLGSKAPKDVKITGLWYGQ  304

Query  1031  L  1033
             L
Sbjct  305   L  305



>gb|ABG25040.1| 33kDa precursor protein of oxygen-evolving complex [Solanum lycopersicum]
Length=179

 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  125  RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGV  304
            RS Q+V KA GV+    R+TCSLQ++IKELA   +DAAK+AGFALATSAL+VSGANAEGV
Sbjct  3    RSAQSVSKAFGVEQGSGRLTCSLQTEIKELAQKCTDAAKIAGFALATSALVVSGANAEGV  62

Query  305  PKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAE  484
            PKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV +FAFKPGKY+AKKFCLEPTSFTVKAE
Sbjct  63   PKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGSFAFKPGKYTAKKFCLEPTSFTVKAE  122

Query  485  SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPG  655
             VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPG
Sbjct  123  GVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPG  179



>gb|ACF24544.1| photosystem II oxygen evolving enhancer protein 1 [Gymnochlora 
stellata]
Length=331

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/241 (63%), Positives = 183/241 (76%), Gaps = 4/241 (2%)
 Frame = +2

Query  317   TFDEIQSKTYMEVKGSGTANQCPTIEGGVENF--AFKPGKYSAKKFCLEPTSFTVKAESV  490
             TFDE Q  +Y++VKGSG AN CP +  G  +   + KPG Y  +KFC+EP+SF VK E V
Sbjct  91    TFDEFQGLSYLDVKGSGMANTCPVLSSGTSDVKGSLKPGTYKFEKFCIEPSSFQVK-EDV  149

Query  491   SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
              K    EF NTKLMTRLTYTLD + G  +V S G+++F+E+DGIDYA  TVQLPGG RVP
Sbjct  150   GK-GKKEFINTKLMTRLTYTLDAMSGTMKVGSGGAIEFKEEDGIDYAPTTVQLPGGSRVP  208

Query  671   FLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
             FLFT+K+L A G  E+FSGEF VPSYRGS+FLDPKGRG +TGYD AVA+PAGG GDEEEL
Sbjct  209   FLFTVKELEAKGDIEAFSGEFSVPSYRGSTFLDPKGRGAATGYDTAVAIPAGGAGDEEEL  268

Query  851   QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQ  1030
              KEN K++   +GK   S+    P TGEV GVF+S+QPSDTDLGAK PK++KIQG+WYAQ
Sbjct  269   VKENNKSIKPLSGKAVLSIAKYDPATGEVAGVFQSVQPSDTDLGAKVPKDIKIQGLWYAQ  328

Query  1031  L  1033
             L
Sbjct  329   L  329



>ref|XP_007513615.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16140.1| predicted protein [Bathycoccus prasinos]
Length=331

 Score =   309 bits (791),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 153/241 (63%), Positives = 178/241 (74%), Gaps = 4/241 (2%)
 Frame = +2

Query  314   LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  493
             +T+DE+Q  TY++VKG+G AN CP +E G    A K G Y   KFC+EPTSFTVK E   
Sbjct  95    VTYDELQGLTYLQVKGTGLANTCPVVESGSGPKALKAGDYKFDKFCVEPTSFTVKEEKA-  153

Query  494   KNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
              +   EF  TKLMTRLTYTLD + G F+V SDGSV   EKDGIDYA  TVQL GGERVPF
Sbjct  154   -DGSTEFAKTKLMTRLTYTLDAMSGDFKVGSDGSVNVVEKDGIDYAPTTVQLAGGERVPF  212

Query  674   LFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQ  853
             LFT+K+L A G    F G+F+V SYRGSSFLDPKGRGGSTGYDNAVALPA  R D ++LQ
Sbjct  213   LFTLKELQAKGNTSQFGGDFVVASYRGSSFLDPKGRGGSTGYDNAVALPA--RSDADDLQ  270

Query  854   KENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  1033
             KEN KNVA+  G   F+V      TGE+ GVFES+QPSDTDLG+KAPK+VKI G+WY QL
Sbjct  271   KENNKNVAALKGSAVFNVAKYDETTGEIAGVFESIQPSDTDLGSKAPKDVKITGLWYMQL  330

Query  1034  E  1036
             +
Sbjct  331   Q  331



>ref|XP_002954867.1| subunit of oxygen evolving complex of photosystem II [Volvox 
carteri f. nagariensis]
 gb|EFJ44066.1| subunit of oxygen evolving complex of photosystem II [Volvox 
carteri f. nagariensis]
Length=297

 Score =   306 bits (784),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 178/246 (72%), Gaps = 3/246 (1%)
 Frame = +2

Query  299   GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  475
             G    LT+DE+Q  TY++VKG+G AN CP +E G  + +    G Y  + FC+EPTSFTV
Sbjct  52    GSANALTYDELQGLTYLQVKGTGIANTCPVLEKGSTDLSELSAGTYKLENFCIEPTSFTV  111

Query  476   KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPG  655
             K ESV K    EF  TKLMTRLTYTLD + G  +V SDGS + +E+DGIDYAA TVQLPG
Sbjct  112   KEESVFKGGETEFVKTKLMTRLTYTLDAMSGTLKVGSDGSAELKEEDGIDYAATTVQLPG  171

Query  656   GERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRG  835
             GERV FLFTIKQ    G  ++  G+F+VPSYRGSSFLDPKGRGGSTGYDNAVALPA  R 
Sbjct  172   GERVAFLFTIKQFDGKGTLDNIKGDFVVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RA  229

Query  836   DEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQG  1015
             D EEL KEN+K+  +  G   FSV      TGE+ GVFES+QPSDTDLGAK PK++KI G
Sbjct  230   DAEELLKENVKSTKALKGSAVFSVAKVNTATGEIAGVFESIQPSDTDLGAKPPKDIKITG  289

Query  1016  IWYAQL  1033
             +WY QL
Sbjct  290   LWYGQL  295



>sp|Q9SBN6.1|PSBO_VOLCA RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Volvox carteri]
 gb|AAD55562.1|AF110780_1 oxygen-evolving enhancer protein 1 precursor [Volvox carteri 
f. nagariensis]
Length=293

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 178/246 (72%), Gaps = 3/246 (1%)
 Frame = +2

Query  299   GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  475
             G    LT+DE+Q  TY++VKG+G AN CP +E G  + +    G Y  + FC+EPTSFTV
Sbjct  48    GSANALTYDELQGLTYLQVKGTGIANTCPVLEKGSTDLSELSAGTYKLENFCIEPTSFTV  107

Query  476   KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPG  655
             K ESV K    EF  TKLMTRLTYTLD + G  +V SDGS + +E+DGIDYAA TVQLPG
Sbjct  108   KEESVFKGGETEFVKTKLMTRLTYTLDAMSGTLKVGSDGSAELKEEDGIDYAATTVQLPG  167

Query  656   GERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRG  835
             GERV FLFTIKQ    G  ++  G+F+VPSYRGSSFLDPKGRGGSTGYDNAVALPA  R 
Sbjct  168   GERVAFLFTIKQFDGKGTLDNIKGDFVVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RA  225

Query  836   DEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQG  1015
             D EEL KEN+K+  +  G   FSV      TGE+ GVFES+QPSDTDLGAK PK++KI G
Sbjct  226   DAEELLKENVKSTKALKGSAVFSVAKVNTATGEIAGVFESIQPSDTDLGAKPPKDIKITG  285

Query  1016  IWYAQL  1033
             +WY QL
Sbjct  286   LWYGQL  291



>gb|AGI15762.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=158

 Score =   299 bits (766),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +2

Query  464  SFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTV  643
            SFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDGIDYAAVTV
Sbjct  1    SFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDGIDYAAVTV  60

Query  644  QLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPA  823
            QLPGGERVPFLFT+KQLVA+GKP+SFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPA
Sbjct  61   QLPGGERVPFLFTVKQLVASGKPDSFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPA  120

Query  824  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEV  937
            GGRGDEEELQKEN KNVASSTGKIT SVT SKPETGE+
Sbjct  121  GGRGDEEELQKENNKNVASSTGKITLSVTKSKPETGEI  158



>gb|KIY97139.1| Oxygen-evolving enhancer protein 1 [Monoraphidium neglectum]
Length=289

 Score =   303 bits (775),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/258 (58%), Positives = 188/258 (73%), Gaps = 9/258 (3%)
 Frame = +2

Query  266   SALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAK  442
             +++L   ANA      LT+DE+QS TY++VKGSG AN CP +  G  N    K G Y  +
Sbjct  40    TSMLAGAANA------LTYDELQSLTYLQVKGSGLANTCPVLSSGSTNLKDLKAGTYKLE  93

Query  443   KFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGI  622
             +FC+EPT+F+VK ES  K     F  TKLMTRLTYTLD + G F+V   G+V+ +E DGI
Sbjct  94    RFCMEPTAFSVKEESQFKGGETNFVATKLMTRLTYTLDGMTGTFKVDGSGNVELKEDDGI  153

Query  623   DYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYD  802
             DYA VTVQLPGGERVPFLF++KQ+ A G  ++F G+F+VPSYRGS+FLDPKGRG S GY+
Sbjct  154   DYAPVTVQLPGGERVPFLFSVKQITAKGAADAFGGDFVVPSYRGSTFLDPKGRGASQGYE  213

Query  803   NAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLG  982
             +A+AL      D+E + KEN+K+VA+S G   FSV    P TGE+ GVFES+QPSDTDLG
Sbjct  214   SAIALQTA--QDDEFVLKENVKSVAASKGSAVFSVAKVDPSTGEIAGVFESVQPSDTDLG  271

Query  983   AKAPKEVKIQGIWYAQLE  1036
             AKAPK+VKI G+WYAQL+
Sbjct  272   AKAPKDVKITGLWYAQLQ  289



>gb|ABV57472.1| chloroplast PsbO [Phyllostachys edulis]
Length=160

 Score =   297 bits (761),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  335  SKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEF  514
            SKTYMEVKG+GTANQCPTI+GGV++F FKPGKY  KKFCLEPTSFTVKAE V+KNAPPEF
Sbjct  1    SKTYMEVKGTGTANQCPTIDGGVDSFPFKPGKYYMKKFCLEPTSFTVKAEGVAKNAPPEF  60

Query  515  QNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQL  694
            Q TKLMTRLTYTLDEIEGP EV +DG++KF EKDGIDYAAVTVQLPGGERVPFLFT+KQL
Sbjct  61   QKTKLMTRLTYTLDEIEGPLEVGADGTIKFVEKDGIDYAAVTVQLPGGERVPFLFTVKQL  120

Query  695  VATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVA  814
            +ATGKPESFSG FLVPSYRGSSFLDPKGRGGSTGYDNAVA
Sbjct  121  IATGKPESFSGSFLVPSYRGSSFLDPKGRGGSTGYDNAVA  160



>dbj|BAF94212.1| 33kDa oxygen evolving protein of photosystem II [Chlorarachnion 
reptans]
Length=328

 Score =   300 bits (768),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/247 (60%), Positives = 178/247 (72%), Gaps = 4/247 (2%)
 Frame = +2

Query  299   GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF--AFKPGKYSAKKFCLEPTSFT  472
             G  K LT+DE Q  +Y++VKGSG AN CP +  G  +   A KPG Y   KFC+EPT F 
Sbjct  81    GASKALTYDEFQGLSYLDVKGSGMANTCPVLSSGTTDVKTALKPGNYKFDKFCIEPTKFQ  140

Query  473   VKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLP  652
             VK E V K    EF +TKLMTRLTYTLD + G  +V S G+++F E+DGID A  TVQLP
Sbjct  141   VK-EDVGKG-KKEFIDTKLMTRLTYTLDAMSGSMKVGSGGAIEFAEEDGIDNAPTTVQLP  198

Query  653   GGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGR  832
             GG RVPFLFT+K+L A G   +F G+F VPSYRGS+FLDPKGRG +TGYD AVA+PAGG 
Sbjct  199   GGSRVPFLFTVKELNAKGDISAFGGDFSVPSYRGSTFLDPKGRGAATGYDTAVAIPAGGA  258

Query  833   GDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQ  1012
             GDEE L KEN K++    GK   S+    P TGEV GVF+S+QPSDTDLGAK PK++K+Q
Sbjct  259   GDEEALGKENNKSIKPLVGKAQLSIAKYDPATGEVAGVFQSVQPSDTDLGAKVPKDIKVQ  318

Query  1013  GIWYAQL  1033
             G+WYAQL
Sbjct  319   GVWYAQL  325



>gb|AAP79149.1| photosystem II protein PsbO [Bigelowiella natans]
Length=327

 Score =   300 bits (768),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 160/295 (54%), Positives = 194/295 (66%), Gaps = 17/295 (6%)
 Frame = +2

Query  158   VDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQS  337
             V P   R+  S  + +K +A         AG A A     VS     G    LTFDE Q 
Sbjct  47    VAPRQTRVFASKPNAMKNIA---------AGLAAAG----VSSIGFLGASNALTFDEFQG  93

Query  338   KTYMEVKGSGTANQCPTIEGGVENF--AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPE  511
              +Y +VKGSG AN CP +  G  +   + K G Y   KFC+EPTSF VK E V K    E
Sbjct  94    LSYTDVKGSGMANTCPILNSGTTDVKGSLKAGTYKFDKFCIEPTSFQVK-EDVGKG-KKE  151

Query  512   FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  691
             F + KLMTRLTYTLD + G  +V S G+++F+E+DGIDYA  TVQLPGG RVPFLFT+K+
Sbjct  152   FIDVKLMTRLTYTLDAMSGSMKVGSGGAIEFKEEDGIDYAPTTVQLPGGARVPFLFTVKE  211

Query  692   LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  871
             L A G   SFSG+F VPSYRGS+FLDPKGRG +TGYD AVA+PAGG GDE+ L KEN K+
Sbjct  212   LDAKGDVSSFSGDFAVPSYRGSTFLDPKGRGAATGYDTAVAIPAGGAGDEDALGKENNKS  271

Query  872   VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             +    GK   S+      TGEV GVF+S+QPSDTDLGAK PK++KIQG+WYAQL+
Sbjct  272   IKPLAGKAQLSIAKYDAATGEVAGVFQSIQPSDTDLGAKVPKDIKIQGLWYAQLQ  326



>dbj|BAF94215.1| 33kDa oxygen evolving protein of photosystem II [Pyramimonas 
parkeae]
Length=303

 Score =   298 bits (763),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 157/250 (63%), Positives = 182/250 (73%), Gaps = 8/250 (3%)
 Frame = +2

Query  284   GANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPT  463
             GANA      LT++E+Q+ TYM+VKG+G AN CP +EG   N     G Y  +K CLEPT
Sbjct  61    GANA------LTYNELQNLTYMQVKGTGIANTCPIVEGAAGNIKLGSGTYKIEKMCLEPT  114

Query  464   SFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTV  643
             SFTVK ES  K    E+  TKLMTRLTYTLDEI G   V + G V F E+DGIDYA VTV
Sbjct  115   SFTVKEESQFKGGADEYVQTKLMTRLTYTLDEISGALTVGAAGDVTFVEEDGIDYAPVTV  174

Query  644   QLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPA  823
             QLPGGERVPFLFT+K+L A G    F G+F VPSYRG++FLDPKGRG +TGYDNAVALPA
Sbjct  175   QLPGGERVPFLFTVKELNAKGNLSQFGGDFTVPSYRGATFLDPKGRGNATGYDNAVALPA  234

Query  824   GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  1003
                 D EEL KEN+KN A+  G   F+V    P+TGEV GVFES+QPSDTDLGAKAPK+V
Sbjct  235   --AADAEELLKENVKNTAALKGSAVFNVAKFDPKTGEVAGVFESIQPSDTDLGAKAPKDV  292

Query  1004  KIQGIWYAQL  1033
             KI G+WYAQ+
Sbjct  293   KITGLWYAQI  302



>gb|AAS55410.1| photosystem II protein [Brassica rapa]
Length=233

 Score =   292 bits (748),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 166/204 (81%), Gaps = 4/204 (2%)
 Frame = +2

Query  14   REREELTLLSDPTMAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARI  181
            R++ EL+      MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+
Sbjct  3    RKKLELSERHSVAMAASLQSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARL  62

Query  182  TCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKG  361
            TCS QS IK+ A   SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG
Sbjct  63   TCSFQSDIKDFAGKCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKG  122

Query  362  SGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRL  541
            +GTANQCPTI+GG E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRL
Sbjct  123  TGTANQCPTIDGGSETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRL  182

Query  542  TYTLDEIEGPFEVSSDGSVKFEEK  613
            TYTLDEIEGPFEVSSDG  + +E+
Sbjct  183  TYTLDEIEGPFEVSSDGKRELQER  206



>dbj|BAF94219.1| 33kDa oxygen evolving protein of photosystem II [Bryopsis plumosa]
Length=302

 Score =   295 bits (754),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 147/241 (61%), Positives = 171/241 (71%), Gaps = 3/241 (1%)
 Frame = +2

Query  314   LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  493
             +TFDE+Q  TY++VKG+G AN CPT+  G +    K G Y     C+EPT+F VK ES  
Sbjct  63    VTFDELQGLTYLQVKGTGVANTCPTLSTGGDGSTLKAGSYQISGMCIEPTAFKVKEESQF  122

Query  494   KNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFE-EKDGIDYAAVTVQLPGGERVP  670
             K    EF  TKLMTRLTYTLD + G   V SDGSV F+ + +GID+A  TVQLPGGERVP
Sbjct  123   KEGTSEFVKTKLMTRLTYTLDGLSGKMTVGSDGSVDFKKDNEGIDFAPTTVQLPGGERVP  182

Query  671   FLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
             FLFT KQ    G  + FSG+F VPSYRGSSFLDPKGRGGSTGYD AV LPA  +GD EEL
Sbjct  183   FLFTFKQFAGKGTVDGFSGDFTVPSYRGSSFLDPKGRGGSTGYDTAVGLPA--KGDAEEL  240

Query  851   QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQ  1030
              KENIK+ A+  G   FSV      TGEV G+FES+QPSDTDLGAK PK+VKI G+WY Q
Sbjct  241   LKENIKSTAALKGSAVFSVAKVDSGTGEVAGIFESVQPSDTDLGAKVPKDVKITGVWYGQ  300

Query  1031  L  1033
             +
Sbjct  301   I  301



>dbj|BAA03529.2| oxygen-evolving enhancer protein 1 precursor [Euglena gracilis]
Length=384

 Score =   295 bits (756),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 144/241 (60%), Positives = 171/241 (71%), Gaps = 3/241 (1%)
 Frame = +2

Query  314   LTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESV  490
             LT+DE+QS +Y+EVK SG A  CP +  GV +  + K GKY    +CLEP+SF VK    
Sbjct  142   LTYDELQSLSYLEVKSSGIAGTCPVLADGVSSKLSLKAGKYEINNWCLEPSSFQVKLPPT  201

Query  491   SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
              K    EF+ TKLMTRLTYTLD I     V  DGS   +EKDG+DYAA TVQL GGERVP
Sbjct  202   EKQQVTEFERTKLMTRLTYTLDAISADLNVGGDGSWTIQEKDGLDYAATTVQLAGGERVP  261

Query  671   FLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
             FLFTIK L+A G    F G+F VPSYRG++FLDPKGRGG++GYD AVALPA   GD+EE 
Sbjct  262   FLFTIKNLLAKGDAGQFLGQFDVPSYRGATFLDPKGRGGASGYDTAVALPAS--GDDEEY  319

Query  851   QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQ  1030
              KEN K+ A+S G I F V     ETGE+ GVFES+QPSDTDLGAK PK++K  G+WYAQ
Sbjct  320   AKENSKSTAASVGTIAFKVAKVNAETGEIAGVFESIQPSDTDLGAKVPKDIKTSGVWYAQ  379

Query  1031  L  1033
             +
Sbjct  380   I  380



>sp|P46483.2|PSBO_EUGGR RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Euglena gracilis]
Length=338

 Score =   293 bits (751),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 144/241 (60%), Positives = 171/241 (71%), Gaps = 3/241 (1%)
 Frame = +2

Query  314   LTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESV  490
             LT+DE+QS +Y+EVK SG A  CP +  GV +  + K GKY    +CLEP+SF VK    
Sbjct  96    LTYDELQSLSYLEVKSSGIAGTCPVLADGVSSKLSLKAGKYEINNWCLEPSSFQVKLPPT  155

Query  491   SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
              K    EF+ TKLMTRLTYTLD I     V  DGS   +EKDG+DYAA TVQL GGERVP
Sbjct  156   EKQQVTEFERTKLMTRLTYTLDAISADLNVGGDGSWTIQEKDGLDYAATTVQLAGGERVP  215

Query  671   FLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
             FLFTIK L+A G    F G+F VPSYRG++FLDPKGRGG++GYD AVALPA   GD+EE 
Sbjct  216   FLFTIKNLLAKGDAGQFLGQFDVPSYRGATFLDPKGRGGASGYDTAVALPAS--GDDEEY  273

Query  851   QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQ  1030
              KEN K+ A+S G I F V     ETGE+ GVFES+QPSDTDLGAK PK++K  G+WYAQ
Sbjct  274   AKENSKSTAASVGTIAFKVAKVNAETGEIAGVFESIQPSDTDLGAKVPKDIKTSGVWYAQ  333

Query  1031  L  1033
             +
Sbjct  334   I  334



>emb|CCC15104.1| 33kDa oxygen evolving protein of photosystem II [Lepidodinium 
chlorophorum]
Length=341

 Score =   286 bits (732),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 167/229 (73%), Gaps = 3/229 (1%)
 Frame = +2

Query  314  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKP-GKYSAKKFCLEPTSFTVKAESV  490
            L +D++Q  TY++VKGSG AN CP +  G  N    P G Y+  K CLEPTSF VK ES 
Sbjct  115  LDYDQLQGLTYLQVKGSGLANTCPDLNSGTTNLKELPAGDYAVSKLCLEPTSFKVKEESQ  174

Query  491  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
             K    +F +TKLMTRLTYTLD+I G  ++ SDG V FEE+DGIDYA  T+QLPGGERV 
Sbjct  175  FKGGAADFVDTKLMTRLTYTLDDISGKLKLGSDGKVTFEEEDGIDYAPTTIQLPGGERVA  234

Query  671  FLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
            FLFT+KQL A+G   + +GEF VPSYRGSSFLDPKGRGGSTGYD AVALPA  RGD+E L
Sbjct  235  FLFTVKQLRASGSLSNLAGEFNVPSYRGSSFLDPKGRGGSTGYDTAVALPA--RGDDEGL  292

Query  851  QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPK  997
             KEN KN A+  G I  S     P TGE+ GVF+S+QPSDTDLGAK+PK
Sbjct  293  AKENSKNTAALKGSIVLSAAKVDPATGEIAGVFQSIQPSDTDLGAKSPK  341



>dbj|BAF94211.1| 33kDa oxygen evolving protein of photosystem II [Eutreptiella 
gymnastica]
Length=346

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/240 (59%), Positives = 165/240 (69%), Gaps = 3/240 (1%)
 Frame = +2

Query  317   TFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESVS  493
             T+DEIQS +YME+KG+G +N CP I    E+    + G Y     CLEP+SF VK  S  
Sbjct  106   TYDEIQSLSYMEMKGTGLSNTCPIIADSSESKLNLRAGNYKINNMCLEPSSFQVKVPSPD  165

Query  494   KNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
                  +F+ TKLMTRLTYTLD I     V  DGS K +E DGIDYAA TVQL GGERVPF
Sbjct  166   GKTVTDFEKTKLMTRLTYTLDGIRADLAVGGDGSWKIKEIDGIDYAATTVQLAGGERVPF  225

Query  674   LFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQ  853
             LFT+K L A+G    F G+F V SYRG++FLDPKGRG +TGYDNAVALPA    D EEL 
Sbjct  226   LFTVKNLAASGDAGQFLGQFDVASYRGATFLDPKGRGAATGYDNAVALPAA--SDTEELA  283

Query  854   KENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  1033
             KEN KN+A S G I F V     ETGEV GVFES+QPSDTDLG+K PK++K  G+WY Q+
Sbjct  284   KENTKNIAGSVGTIAFKVAKVNTETGEVAGVFESIQPSDTDLGSKVPKDIKTAGVWYGQI  343



>gb|AIS72812.1| oxygen evolving activity, partial [Rhizophora apiculata]
Length=147

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +2

Query  287  ANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTS  466
            A AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV++FAFKPGKY+ KK CLEPTS
Sbjct  1    AGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVDSFAFKPGKYNVKKLCLEPTS  60

Query  467  FTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQ  646
            FTVKAE V+KNAPPEFQNTKLMTRLTYTLDEIEGPFEVS DG+VKF EKDGIDYAAVTVQ
Sbjct  61   FTVKAEGVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSPDGTVKFVEKDGIDYAAVTVQ  120

Query  647  LPGGERVPFLFTIKQLVATGKPESFSG  727
            LPGGERVPFLFTIKQLVATGKPESF G
Sbjct  121  LPGGERVPFLFTIKQLVATGKPESFGG  147



>gb|ADC54897.1| oxygen-evolving enhancer protein, partial [Cladophora coelothrix]
Length=235

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/239 (58%), Positives = 175/239 (73%), Gaps = 6/239 (3%)
 Frame = +2

Query  314   LTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESV  490
             LT+D+ QS TYM++KG+G AN CP I+GG +N    KPG YS  KFC+EPTSF V+ ES+
Sbjct  1     LTYDQFQSLTYMQIKGTGLANTCPIIDGGSDNPKDIKPGTYSMYKFCMEPTSFKVQEESM  60

Query  491   SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
              + AP  F +TKL+TRLTYTLDE+EG F V SDGS++  E++G+D+AAVTVQ+PGGERVP
Sbjct  61    QRGAPSFFSDTKLLTRLTYTLDEMEGKFVVGSDGSLRVTEEEGLDFAAVTVQMPGGERVP  120

Query  671   FLFTIKQLVATGKPE-SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEE  847
             FLFT+K+L   GK + +  G FLVPSYRGS+FLDPKGRGGSTGY+    +  G + D E 
Sbjct  121   FLFTVKELDLKGKVDGNLEGSFLVPSYRGSTFLDPKGRGGSTGYN----VVQGVQADAEN  176

Query  848   LQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWY  1024
              + +N K   S TGK  FS+    P TG V GVFE++ PSDTDLGAK  ++VK  GIWY
Sbjct  177   EEFKNEKTTESGTGKAVFSIAKVDPSTGGVAGVFETVSPSDTDLGAKEARDVKTNGIWY  235



>gb|AFK26084.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena stellata]
Length=248

 Score =   265 bits (678),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 152/222 (68%), Gaps = 3/222 (1%)
 Frame = +2

Query  314  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAESV  490
            LTFDEIQS +Y+EVKGSG AN CP +  G       + G Y    FCLEP+SF VK    
Sbjct  29   LTFDEIQSLSYLEVKGSGLANTCPVLADGTGSKLNLRSGNYKIDNFCLEPSSFQVKVPPT  88

Query  491  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
                 PEF+ TKLMTRLTYTLD I    +V  DGS   +EKDGIDYAA TVQL GGERVP
Sbjct  89   DSKPKPEFEKTKLMTRLTYTLDGIRADLQVGGDGSWTLKEKDGIDYAATTVQLAGGERVP  148

Query  671  FLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
            FLFT+K L A G    F G+F VPSYRG++FLDPKGRGG+TGYD AVALPA   GD+EE 
Sbjct  149  FLFTVKNLEAKGDAGQFLGQFDVPSYRGATFLDPKGRGGATGYDTAVALPAA--GDDEEF  206

Query  851  QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTD  976
             KEN K+ AS  G I F V     ETGE+ GVFES+QPSDTD
Sbjct  207  AKENSKSTASGVGTIAFKVAKVNAETGEIAGVFESIQPSDTD  248



>gb|AFK26083.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena pseudostellata]
Length=249

 Score =   265 bits (677),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 152/222 (68%), Gaps = 3/222 (1%)
 Frame = +2

Query  314  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAESV  490
            LTFDEIQS +Y+EVKGSG AN CP +  G       + G Y    FCLEP+SF VK    
Sbjct  30   LTFDEIQSLSYLEVKGSGLANTCPVLADGTGSKLNLRSGNYKIDNFCLEPSSFQVKVPPT  89

Query  491  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
                 PEF+ TKLMTRLTYTLD I    +V  DGS   +EKDGIDYAA TVQL GGERVP
Sbjct  90   DSKPKPEFEKTKLMTRLTYTLDGIRADLQVGGDGSWTLKEKDGIDYAATTVQLAGGERVP  149

Query  671  FLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
            FLFT+K L A G    F G+F VPSYRG++FLDPKGRGG+TGYD AVALPA   GD+EE 
Sbjct  150  FLFTVKNLEAKGDAGQFLGQFDVPSYRGATFLDPKGRGGATGYDTAVALPAA--GDDEEF  207

Query  851  QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTD  976
             KEN K+ AS  G I F V     ETGE+ GVFES+QPSDTD
Sbjct  208  AKENSKSTASGVGTIAFKVAKVNAETGEIAGVFESIQPSDTD  249



>gb|AFK26085.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Monomorphina pyrum]
Length=237

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 153/221 (69%), Gaps = 4/221 (2%)
 Frame = +2

Query  314  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAESV  490
            LTFDEIQS +Y+EVKGSG AN CP I  G     + K G Y     CLEP+SF VK  S 
Sbjct  20   LTFDEIQSLSYLEVKGSGLANTCPXIADGTGAKLSLKSGNYKINNMCLEPSSFQVKTPS-  78

Query  491  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
            +   P EF+ TKLMTRLTYTLD I    +V  DGS K +E DGIDYAA TVQL GGERVP
Sbjct  79   TDGKPSEFEKTKLMTRLTYTLDGIRADLQVGGDGSWKIKEIDGIDYAATTVQLAGGERVP  138

Query  671  FLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
            FLFT+K L A G    F G+F VPSYRG++FLDPKGRGG+TGYD AVALPA   GD+EE 
Sbjct  139  FLFTVKNLQAQGDAGQFLGQFDVPSYRGATFLDPKGRGGATGYDTAVALPAA--GDDEEF  196

Query  851  QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDT  973
             KEN K+ ASS G I F V     ETGEV GVFES+QP DT
Sbjct  197  AKENAKSAASSVGTIAFKVAKVNAETGEVAGVFESIQPGDT  237



>gb|ACT83791.1| putative photosystem II oxygen evolving system 33 kDa subunit 
[Lemna minor]
Length=151

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +2

Query  353  VKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  532
            VKG+GTANQCPTI+GGV+ F FK GKY+ KKFCLEPTSFTVKAE VSKN+ PEFQ TKLM
Sbjct  1    VKGTGTANQCPTIDGGVDGFPFKAGKYNLKKFCLEPTSFTVKAEGVSKNSAPEFQKTKLM  60

Query  533  TRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP  712
            TRLTYTLDEIEGP EVSSDG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVATG P
Sbjct  61   TRLTYTLDEIEGPLEVSSDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGTP  120

Query  713  ESFSGEFLVPSYRGSSFLDPKGRGGSTG  796
              F G FLVPSYRGSSFLDPKGRGG  G
Sbjct  121  GKFGGSFLVPSYRGSSFLDPKGRGGPKG  148



>ref|XP_005652213.1| 33kDa oxygen evolving protein of photosystem II, partial [Coccomyxa 
subellipsoidea C-169]
 gb|EIE27669.1| 33kDa oxygen evolving protein of photosystem II, partial [Coccomyxa 
subellipsoidea C-169]
Length=270

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/262 (51%), Positives = 171/262 (65%), Gaps = 24/262 (9%)
 Frame = +2

Query  314   LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESV  490
             +T+D++Q+ +Y EV+G+G A  CP IE G  N A  KPG Y  K  CLEPT   V+ E +
Sbjct  10    ITYDQLQNMSYNEVRGTGLAAVCPLIEEGSTNLADLKPGTYKLKNLCLEPTKIQVQEEGL  69

Query  491   SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG--IDYAAVTVQLPGGER  664
             +K + P++ NTKL+TR T  L +IE   +V  +G+V  +E D   ++ A +TVQLPGGER
Sbjct  70    TKGSGPQWSNTKLLTRQTTNLSDIEADLKVGPNGAVVLKESDSYSLNLAPITVQLPGGER  129

Query  665   VPFLFTIK-------------------QLVATGKPESFSGEFLVPSYRGSSFLDPKGRGG  787
             VPFLFTIK                   +L A+G   SF G+  VPSYRGS+FLDPKGRGG
Sbjct  130   VPFLFTIKARPHHNTFGYYSSSSHMPLELEASGDLSSFGGQIRVPSYRGSTFLDPKGRGG  189

Query  788   STGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPS  967
             STGYD A AL    R D+E L+ EN+K   S  G++ FSV    P TGEV GVFES+QPS
Sbjct  190   STGYDTAHALHT--RADDEALESENLKKFDSGIGQVVFSVAKVDPGTGEVAGVFESVQPS  247

Query  968   DTDLGAKAPKEVKIQGIWYAQL  1033
             DTD+GAK PK+VK+QG+WY QL
Sbjct  248   DTDMGAKVPKQVKVQGLWYGQL  269



>gb|AFK26079.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Cryptoglena skujae]
Length=236

 Score =   256 bits (654),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 152/221 (69%), Gaps = 4/221 (2%)
 Frame = +2

Query  314  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAESV  490
            LTFDEIQS +Y+EVKGSG AN CP I  G     + K G Y     CLEP+SF VK  S 
Sbjct  19   LTFDEIQSLSYLEVKGSGLANTCPIIADGTGAKLSLKSGNYKINNMCLEPSSFQVKVPS-  77

Query  491  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
            +   P EF+ TKLMTRLTYTLD I    +V  DGS   +E DGIDYA  TVQL GGERVP
Sbjct  78   TDGKPTEFEKTKLMTRLTYTLDGIRADLQVGGDGSWSIKEIDGIDYAPTTVQLAGGERVP  137

Query  671  FLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
            FL++IK L A G    F G+F VPSYRG++FLDPKGRGG+TGYD AVALPA   GD+EE 
Sbjct  138  FLYSIKNLQAKGDAGQFLGQFDVPSYRGATFLDPKGRGGATGYDTAVALPA--SGDDEEY  195

Query  851  QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDT  973
             KEN K+ AS+ G I F V     ETGEV GVFES+QPSDT
Sbjct  196  AKENRKSTASAVGTIAFKVAKVNAETGEVAGVFESIQPSDT  236



>gb|AFK26080.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Discoplastis spathirhyncha]
Length=239

 Score =   256 bits (654),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 148/221 (67%), Gaps = 3/221 (1%)
 Frame = +2

Query  320  FDEIQSKTYMEVKGSGTANQCPTI-EGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSK  496
            +DEIQS +Y+EVKGSG AN CP I EG     A K G Y     CLEP+SF VK  S   
Sbjct  21   YDEIQSLSYLEVKGSGLANTCPIIAEGSGNKLALKAGNYKINNMCLEPSSFQVKVPSPDG  80

Query  497  NAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFL  676
                +F+ TKLMTRLTYTLD I     V  DGS   +E DGIDYAA TVQL GGERVPFL
Sbjct  81   KTVTDFEKTKLMTRLTYTLDGIRADLTVGGDGSWTIKEIDGIDYAATTVQLAGGERVPFL  140

Query  677  FTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQK  856
            FT+K L A G    F G+F V SYRG++FLDPKGRGG+TGYD AVALPA   GD EE  K
Sbjct  141  FTVKNLQAKGDAGQFIGQFDVASYRGATFLDPKGRGGATGYDTAVALPAA--GDSEEYAK  198

Query  857  ENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDL  979
            EN K+ A S G I F V     ETGEV GVFES+QPSDTDL
Sbjct  199  ENSKSTAGSVGTIAFKVAKVNAETGEVAGVFESIQPSDTDL  239



>gb|AFK26082.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena granulata]
Length=239

 Score =   254 bits (649),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 128/222 (58%), Positives = 151/222 (68%), Gaps = 3/222 (1%)
 Frame = +2

Query  314  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAESV  490
            LT++E+QS +Y+E+KG+G +N CP I  G       K GKY     CLEP++F VK    
Sbjct  20   LTYNEMQSLSYLEMKGTGLSNTCPIITDGTGTKLNLKAGKYEINNMCLEPSAFQVKVPPT  79

Query  491  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
                 PEF+ TKLMTRLTYTLD I     V  DGS    EKDGIDYAA TVQL GGERVP
Sbjct  80   DVRPNPEFERTKLMTRLTYTLDGIRADLTVGGDGSWSIXEKDGIDYAATTVQLAGGERVP  139

Query  671  FLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
            FLFT+K + A G    F G+F VPSYRG++FLDPKGRGG+TGYD AVALPA   GD+EE 
Sbjct  140  FLFTVKNMEAKGDAGQFLGQFDVPSYRGATFLDPKGRGGATGYDTAVALPAA--GDDEEY  197

Query  851  QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTD  976
             KEN+K+ A + G I F V     ETGE+ GVFES+QPSDTD
Sbjct  198  AKENVKSAAGAVGTIAFKVAKVDVETGEIAGVFESIQPSDTD  239



>ref|XP_009387680.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like, 
partial [Musa acuminata subsp. malaccensis]
Length=170

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 142/170 (84%), Gaps = 6/170 (4%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG-----RSYQTVGKALGVDPSP-ARITCSLQSQIKEL  214
            MAASLQ AATLMQP KVG T R       RS   + KA G++P+  AR+TCSLQS ++E+
Sbjct  1    MAASLQAAATLMQPAKVGATSRTAAGVQLRSSSHLTKAFGLEPAASARLTCSLQSDVREM  60

Query  215  AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  394
            A   +D  KLAGFALA SAL+V+GA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+
Sbjct  61   AQKCADGVKLAGFALAASALVVTGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTID  120

Query  395  GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLT  544
            GGVE+FAFKPGKY+ KK CLEPTSFTVKAE+VSKNAPPEFQ TKLMTRLT
Sbjct  121  GGVESFAFKPGKYNTKKLCLEPTSFTVKAEAVSKNAPPEFQKTKLMTRLT  170



>gb|AAR85969.1| ERT12 [Nicotiana tabacum]
Length=132

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +2

Query  638   TVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVAL  817
             TVQLPGGERVPFLFTIKQL A GKPESFSGEFLVPSYRGSSFLDPKGRGGST YDNAVAL
Sbjct  1     TVQLPGGERVPFLFTIKQLAANGKPESFSGEFLVPSYRGSSFLDPKGRGGSTSYDNAVAL  60

Query  818   PAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPK  997
             PAGGRGDEEEL+KEN+KN +SSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK
Sbjct  61    PAGGRGDEEELEKENVKNTSSSTGKITLSVTNSKPETGEVIGVFESIQPSDTDLGAKVPK  120

Query  998   EVKIQGIWYAQL  1033
             +VKIQGIWYAQL
Sbjct  121   DVKIQGIWYAQL  132



>ref|WP_026721744.1| Photosystem II manganese-stabilizing polypeptide [Fischerella 
sp. PCC 9431]
Length=277

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/244 (55%), Positives = 166/244 (68%), Gaps = 16/244 (7%)
 Frame = +2

Query  341   TYMEVKGSGTANQCP----TIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPP  508
             TY ++KG+G AN+CP    T  G +   A +   Y  K+ CLEPT+F ++ E  +K    
Sbjct  34    TYDQIKGTGLANKCPQLTETSRGSIPIDASQ--SYVIKELCLEPTNFFIREEPANKRQKA  91

Query  509   EFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIK  688
             EF   KL+TR TY+LD+IEG   V+SDGS+ F EKDG D+ A TVQLPGGERVPFLFTIK
Sbjct  92    EFVAGKLVTRKTYSLDQIEGDLNVNSDGSLTFVEKDGFDFQATTVQLPGGERVPFLFTIK  151

Query  689   QLVATGKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEE  844
              LVA  +P          F G F VPSYRG++FLDPKGRG ++GYDNAVALPA  + D+E
Sbjct  152   GLVAQSQPGMTSINTSTDFEGSFRVPSYRGATFLDPKGRGVASGYDNAVALPA--QSDDE  209

Query  845   ELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWY  1024
             EL + N+K V    GKI+ SV      TGE+ G FES QPSDTDLGA  PK+VK++GI+Y
Sbjct  210   ELLRANVKRVDVLNGKISLSVAKVDSSTGEIAGTFESDQPSDTDLGAGEPKDVKVRGIFY  269

Query  1025  AQLE  1036
             A+LE
Sbjct  270   ARLE  273



>ref|WP_017720228.1| Photosystem II manganese-stabilizing polypeptide [Oscillatoria 
sp. PCC 10802]
Length=274

 Score =   249 bits (635),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/242 (55%), Positives = 164/242 (68%), Gaps = 12/242 (5%)
 Frame = +2

Query  341   TYMEVKGSGTANQCPTI-EGGVENFAFKPGK-YSAKKFCLEPTSFTVKAESVSKNAPPEF  514
             TY ++KG+G AN CPT+ E      A + GK Y     CL+PTSF VK E  +K    EF
Sbjct  32    TYDQIKGTGLANNCPTLQETSRGAIALESGKSYVLSDLCLQPTSFFVKEEPANKRQEAEF  91

Query  515   QNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQL  694
                KL+TR T TL +I+G  +  SDG++ FEEKDGID+ A+TVQLPGGE VPFLFTIK L
Sbjct  92    VPGKLLTRYTSTLTQIQGALKFGSDGTLTFEEKDGIDFQAITVQLPGGEGVPFLFTIKNL  151

Query  695   VATGKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
             VAT +P          F G+F VPSYRGSSFLDPKGRG +TGYDNAVA PAG   D EEL
Sbjct  152   VATSQPGLTEINTSTDFEGQFKVPSYRGSSFLDPKGRGEATGYDNAVATPAG--ADREEL  209

Query  851   QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQ  1030
              + N+K    S GKI+  ++     TGE+ G+FES QPSDTDLGA+ P EVKI+G++Y +
Sbjct  210   IRANVKRAEVSKGKISLQISKVDSSTGEIAGIFESEQPSDTDLGAQEPLEVKIRGVFYGR  269

Query  1031  LE  1036
             ++
Sbjct  270   VQ  271



>gb|AFK26081.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena archaeoplastidiata]
Length=237

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 150/221 (68%), Gaps = 4/221 (2%)
 Frame = +2

Query  314  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESV  490
            LT+DE+QS +Y+E+KGSG +N CP I  G  N  + K G Y     CLEP SF V++ S 
Sbjct  20   LTYDEMQSLSYLEMKGSGLSNTCPIIADGTGNKLSLKAGDYKILNMCLEPASFQVRSPS-  78

Query  491  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
            +   P EF+ TKLMTRLTYTLD I    +V  DGS   +E DGIDYAA TVQL GGERVP
Sbjct  79   ADGKPSEFEKTKLMTRLTYTLDGIRANLKVGGDGSWSVKEIDGIDYAATTVQLAGGERVP  138

Query  671  FLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
            FLFT++ + A G    F G+F VPSYRG++FLDPKGRGG+TGYD AVALPA   GD EE 
Sbjct  139  FLFTVRNVEAKGDAGQFLGQFDVPSYRGATFLDPKGRGGATGYDTAVALPAA--GDSEEY  196

Query  851  QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDT  973
             KEN K+   S G I F V      TGE+ GVFES+QPSDT
Sbjct  197  AKENSKSTLPSVGTIAFKVAKVNAATGEIAGVFESIQPSDT  237



>gb|AAR20846.1| oxygen-evolving enhancer protein 1 [Pseudochlorella pringsheimii]
Length=173

 Score =   244 bits (622),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 139/170 (82%), Gaps = 2/170 (1%)
 Frame = +2

Query  524   KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVAT  703
             KLMTRLTYTLDEI G F++   G+V+ +E+DGIDYAAVTV +PGGERVPFLFTIK+L A 
Sbjct  4     KLMTRLTYTLDEISGDFKIDGSGNVELKEEDGIDYAAVTVXMPGGERVPFLFTIKELEAK  63

Query  704   GKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASS  883
             G  ++F GEF VPSYRGSSFLDPKGRGGSTGYDNA ALPA  R D +ELQKEN K+VA+ 
Sbjct  64    GTADAFGGEFTVPSYRGSSFLDPKGRGGSTGYDNAXALPA--RSDPDELQKENNKSVAAL  121

Query  884   TGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  1033
              G+  FS+    P TGE+ GVFES+QPSDTDLG+KAPK+VKI G+WY QL
Sbjct  122   KGQAVFSIAKVDPATGEIAGVFESIQPSDTDLGSKAPKDVKIIGLWYGQL  171



>ref|WP_016860504.1| Photosystem II manganese-stabilizing polypeptide [Fischerella 
muscicola]
Length=277

 Score =   247 bits (630),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 131/244 (54%), Positives = 166/244 (68%), Gaps = 16/244 (7%)
 Frame = +2

Query  341   TYMEVKGSGTANQCP----TIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPP  508
             TY ++KG+G AN+CP    T  G +   A +   Y  K+ CLEPT+F VK E  +K    
Sbjct  34    TYDQIKGTGLANKCPQLTETSRGSIPIDASQ--SYVIKELCLEPTNFFVKEEPANKRQKA  91

Query  509   EFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIK  688
             EF   KL+TR TY+LD+IEG  +++SDGS+ F EKDG D+ A TVQLPGGERVPFLFT+K
Sbjct  92    EFVAGKLVTRKTYSLDQIEGDLKINSDGSLTFVEKDGFDFQATTVQLPGGERVPFLFTVK  151

Query  689   QLVATGKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEE  844
              LVA  +P          F G F VPSYRG++FLDPKGRG ++GYDNAVALPA  + D+E
Sbjct  152   GLVAQSQPGMTSINTSTDFEGAFRVPSYRGATFLDPKGRGVASGYDNAVALPA--QSDDE  209

Query  845   ELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWY  1024
             EL + N+K      GKI+ SV      +GE+ G FES QPSDTDLGA  PK+VK++GI+Y
Sbjct  210   ELLRANVKRADVLNGKISLSVAKVDSSSGEIAGTFESDQPSDTDLGAGEPKDVKVRGIFY  269

Query  1025  AQLE  1036
             A+LE
Sbjct  270   ARLE  273



>ref|WP_026733494.1| Photosystem II manganese-stabilizing polypeptide [Fischerella 
sp. PCC 9605]
Length=276

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 165/244 (68%), Gaps = 16/244 (7%)
 Frame = +2

Query  341   TYMEVKGSGTANQCP----TIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPP  508
             TY ++KG+G AN+CP    T  G +   A +   Y  K+ CLEPT F VK E  +K    
Sbjct  33    TYDQIKGTGLANKCPQLAETSRGSIPLDASQ--SYVIKELCLEPTQFFVKEEPANKRQKA  90

Query  509   EFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIK  688
             E+   KL+TR TY+LD+I+G  +++SDGS+ F EKDG D+ A TVQLPGGERVPFLFTIK
Sbjct  91    EYVAGKLLTRKTYSLDQIQGDLKINSDGSLTFVEKDGFDFQASTVQLPGGERVPFLFTIK  150

Query  689   QLVATGKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEE  844
              LVA  +P          F G F VPSYRG++FLDPKGRG +TGYDNAVALPA  + D+E
Sbjct  151   GLVAQSQPGMTSINTSTDFEGAFRVPSYRGATFLDPKGRGVATGYDNAVALPA--QSDDE  208

Query  845   ELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWY  1024
             EL + N+K      GKI+ SV      TGE+ G FES QPSDTDLGA  PK+VKI+GI+Y
Sbjct  209   ELTRANVKRTDILNGKISLSVAKVDSATGEIAGTFESEQPSDTDLGAGEPKDVKIRGIFY  268

Query  1025  AQLE  1036
             A++E
Sbjct  269   ARVE  272



>ref|WP_016865127.1| Photosystem II manganese-stabilizing polypeptide [Fischerella 
muscicola]
Length=277

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 133/244 (55%), Positives = 165/244 (68%), Gaps = 16/244 (7%)
 Frame = +2

Query  341   TYMEVKGSGTANQCP----TIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPP  508
             TY ++KG+G AN+CP    T  G +   A +   Y  K+ CLEPT+F V+ E  +K    
Sbjct  34    TYDQIKGTGLANKCPQLTETSRGSIPIDASQ--SYVIKELCLEPTNFFVREEPANKRQKA  91

Query  509   EFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIK  688
             EF   KL+TR TY+LD+IEG  +V+ DGS+ F EKDG D+ A TVQLPGGERVPFLFTIK
Sbjct  92    EFVAGKLVTRKTYSLDQIEGDLKVNPDGSLTFVEKDGFDFQATTVQLPGGERVPFLFTIK  151

Query  689   QLVATGKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEE  844
              LVA  +P          F G F VPSYRG++FLDPKGRG +TGYD+AVALPA  + D+E
Sbjct  152   GLVAQSQPGMTSINTSTDFEGTFRVPSYRGATFLDPKGRGVATGYDSAVALPA--QSDDE  209

Query  845   ELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWY  1024
             EL + N+K      GKI+ SV      TGE+ G FES QPSDTDLGA  PKEVK++GI+Y
Sbjct  210   ELLRANVKRADVLNGKISLSVAKVDSSTGEIAGTFESEQPSDTDLGAGEPKEVKVRGIFY  269

Query  1025  AQLE  1036
             A+LE
Sbjct  270   ARLE  273



>ref|WP_017310215.1| Photosystem II manganese-stabilizing polypeptide [Fischerella 
sp. PCC 9339]
Length=277

 Score =   245 bits (625),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 131/244 (54%), Positives = 165/244 (68%), Gaps = 16/244 (7%)
 Frame = +2

Query  341   TYMEVKGSGTANQCP----TIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPP  508
             TY ++KG+G AN+CP    T  G +   A +   Y  K+ CLEPT+F V+ E  +K    
Sbjct  34    TYDQIKGTGLANKCPQLTETSRGSIPIDASQ--SYVIKELCLEPTNFFVREEPANKRQKA  91

Query  509   EFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIK  688
             EF   KL+TR TY+LD+IEG  +++SDGS+ F EKDG D+ A TVQL GGERVPFLFTIK
Sbjct  92    EFVPGKLVTRKTYSLDQIEGDLKINSDGSLTFVEKDGFDFQATTVQLAGGERVPFLFTIK  151

Query  689   QLVATGKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEE  844
              LVA  +P          F G F VPSYRG++FLDPKGRG ++GYDNAVALPA  + D+E
Sbjct  152   GLVAQSQPGMTSINTSTDFEGAFRVPSYRGATFLDPKGRGVASGYDNAVALPA--QSDDE  209

Query  845   ELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWY  1024
             EL + N+K      GKI+ SV      TGE+ G FES QPSDTDLGA  PK+VK++GI+Y
Sbjct  210   ELLRANVKRADVLNGKISLSVAKVDSSTGEIAGTFESDQPSDTDLGAGEPKDVKVRGIFY  269

Query  1025  AQLE  1036
             A+LE
Sbjct  270   ARLE  273



>ref|WP_009456798.1| MULTISPECIES: photosystem II manganese-stabilizing protein PsbO 
[Fischerella]
 gb|EHC13949.1| photosystem II manganese-stabilizing protein PsbO [Fischerella 
sp. JSC-11]
Length=277

 Score =   244 bits (624),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 131/244 (54%), Positives = 164/244 (67%), Gaps = 16/244 (7%)
 Frame = +2

Query  341   TYMEVKGSGTANQCP----TIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPP  508
             TY ++KG+G AN+CP    T  G +   A +   Y  K+ CLEPT+F V+ E  +K    
Sbjct  34    TYDQIKGTGLANKCPQLTETSRGSIPIDASQ--SYVIKELCLEPTNFFVREEPANKRQKA  91

Query  509   EFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIK  688
             EF   KL+TR TY+LD+IEG  +++ DGS+ F EKDG D+   TVQLPGGERVPFLFTIK
Sbjct  92    EFVAGKLVTRKTYSLDQIEGDLKINPDGSLTFVEKDGFDFQPTTVQLPGGERVPFLFTIK  151

Query  689   QLVATGKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEE  844
              LVA  +P          F G F VPSYRG++FLDPKGRG ++GYDNAVALPA  + D+E
Sbjct  152   GLVAQSQPGMTSINTSTDFEGTFRVPSYRGATFLDPKGRGVASGYDNAVALPA--QSDDE  209

Query  845   ELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWY  1024
             EL + N+K      GKI+ SV      TGE+ G FES QPSDTDLGA  PKEVK++GI+Y
Sbjct  210   ELLRANVKRADVMNGKISLSVAKVDSSTGEIAGTFESEQPSDTDLGAGEPKEVKVRGIFY  269

Query  1025  AQLE  1036
             A+LE
Sbjct  270   ARLE  273



>ref|WP_045872950.1| Photosystem II manganese-stabilizing polypeptide [Tolypothrix 
sp. PCC 7601]
 gb|EKE99178.1| photosystem II manganese [Tolypothrix sp. PCC 7601]
Length=277

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/242 (52%), Positives = 166/242 (69%), Gaps = 12/242 (5%)
 Frame = +2

Query  341   TYMEVKGSGTANQCPTI-EGGVENFAFKPGK-YSAKKFCLEPTSFTVKAESVSKNAPPEF  514
             TY +++G+G AN+CP + E    +      + Y+ K+ CLEPT+F VK E  +K    EF
Sbjct  34    TYEQIRGTGLANKCPQLAETSRGSIPLDSSQSYTIKELCLEPTNFFVKEEPANKRQEAEF  93

Query  515   QNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQL  694
                KL+TR T T+D+++G   ++SD S+ F EKDG+D+ A+TVQLPGGERVPFLFTIK L
Sbjct  94    VAGKLLTRYTSTIDQVQGDLTINSDSSLTFAEKDGLDFQAITVQLPGGERVPFLFTIKNL  153

Query  695   VATGKPES--------FSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
             VA  +P S        F G F VPSYRG++FLDPKGRG  +GYDNAVALPA  + D++EL
Sbjct  154   VAQTQPGSISLNTSTDFEGTFKVPSYRGAAFLDPKGRGVVSGYDNAVALPA--QADDDEL  211

Query  851   QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQ  1030
              + N+K   S +GKI+  V      TGE+ G F+S QPSDTDLGA  PKEVKI+G++YA+
Sbjct  212   TRTNVKRAESLSGKISLQVAKVDNSTGEIAGTFDSEQPSDTDLGAGEPKEVKIRGLFYAR  271

Query  1031  LE  1036
             +E
Sbjct  272   VE  273



>ref|WP_012411115.1| photosystem II manganese-stabilizing protein PsbO [Nostoc punctiforme]
 gb|ACC83159.1| photosystem II manganese-stabilizing protein PsbO [Nostoc punctiforme 
PCC 73102]
Length=277

 Score =   242 bits (618),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 122/242 (50%), Positives = 165/242 (68%), Gaps = 12/242 (5%)
 Frame = +2

Query  341   TYMEVKGSGTANQCPTI-EGGVENFAFKPGK-YSAKKFCLEPTSFTVKAESVSKNAPPEF  514
             TY +++G+G AN+CP + E    +      + Y+ K+ CLEPTSF +K E  +K    EF
Sbjct  34    TYDQIRGTGLANKCPQLAETSRGSIPIDSSQSYAIKELCLEPTSFFIKEEPANKRQEAEF  93

Query  515   QNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQL  694
                KL+TR T T+D+++G  +++SD S+ FEE DG+D+ A+TVQLPGGERVPFLFTIK L
Sbjct  94    VAGKLLTRYTSTIDQVQGNLKINSDNSLTFEETDGLDFQAITVQLPGGERVPFLFTIKNL  153

Query  695   VATGKPE--------SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
             VA  +P          F G F VPSYRG++FLDPKGRG  +GYDNAVALPA  + D+EEL
Sbjct  154   VAQTQPSLSSINTSTDFEGTFKVPSYRGAAFLDPKGRGVVSGYDNAVALPA--QADDEEL  211

Query  851   QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQ  1030
              + N+K   +  GKI+  +      +GE+ G FES QPSDTDLGA  PKEVKI+G+++A+
Sbjct  212   TRTNVKRAENLNGKISLQIAKVDSSSGEIAGTFESEQPSDTDLGAGEPKEVKIRGLFFAR  271

Query  1031  LE  1036
             +E
Sbjct  272   VE  273



>ref|WP_015115272.1| photosystem II manganese-stabilizing protein PsbO [Nostoc sp. 
PCC 7107]
 gb|AFY45079.1| photosystem II manganese-stabilizing protein PsbO [Nostoc sp. 
PCC 7107]
Length=277

 Score =   242 bits (617),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 162/242 (67%), Gaps = 12/242 (5%)
 Frame = +2

Query  341   TYMEVKGSGTANQCPTIEGGVENFAFKPGK--YSAKKFCLEPTSFTVKAESVSKNAPPEF  514
             TY +++G+G AN+CP +           G   YS K+ CLEPT+F VK E  +K    EF
Sbjct  34    TYEQIRGTGLANKCPQLAETSRGSIPIDGSQSYSIKELCLEPTNFFVKEEPANKRQTAEF  93

Query  515   QNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQL  694
                KL+TR T T+D+++GP + +SDGS+ F E+DG+D+ A+TVQLPGGERVPFLFTIK L
Sbjct  94    VAGKLLTRYTSTIDQVQGPLKFNSDGSLTFVEEDGLDFQAITVQLPGGERVPFLFTIKDL  153

Query  695   VA--------TGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
             VA              F GEF VPSYRG++FLDPKGRG  +GYDNAVALPA  + D+EEL
Sbjct  154   VAQTQSGLTSINTSTDFEGEFKVPSYRGAAFLDPKGRGIVSGYDNAVALPA--QADDEEL  211

Query  851   QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQ  1030
              + N+K      GKI+  V      +GE+ G FES QPSDTDLGA  PKEVKI+G++YA+
Sbjct  212   TRANVKRAEILKGKISLQVAKIDNSSGEIAGTFESEQPSDTDLGAGEPKEVKIRGLFYAR  271

Query  1031  LE  1036
             +E
Sbjct  272   VE  273



>emb|CAH04962.1| oxygen-evolving enhancer protein 1 [Cyanophora paradoxa]
Length=347

 Score =   244 bits (623),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 168/262 (64%), Gaps = 17/262 (6%)
 Frame = +2

Query  278   VSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE-NFAFKPGK-YSAKKFC  451
             VS ANAEG    LTFD++ S  Y+++KG+G +N CPT+      N + + GK Y     C
Sbjct  86    VSQANAEG----LTFDQLNSANYLKLKGTGISNTCPTLGASARGNISLEKGKEYYLTDLC  141

Query  452   LEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYA  631
             ++PT   VKAES+ K    EFQ T+L+TR TYT+D++EGP  V SD  V F EKDG DY 
Sbjct  142   IQPTEILVKAESLQKGKGEEFQPTRLVTRATYTIDKVEGPIFVDSDNQVTFVEKDGFDYQ  201

Query  632   AVTVQLPGGERVPFLFTIKQLVATG--------KPESFSGEFLVPSYRGSSFLDPKGRGG  787
             A+TV+LPGGE VP LFT+K+L+A             +  G F VPSYR  +FLDPKGRG 
Sbjct  202   ALTVKLPGGELVPMLFTVKELIAKAPVSDGGISPATNLKGSFAVPSYRMGNFLDPKGRGL  261

Query  788   STGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPS  967
             +TGYD A ALPA    D+EEL KEN K   +  G+I+  V      TGE+ GV+ES QP 
Sbjct  262   ATGYDFAHALPA---ADQEELAKENDKQNITREGQISLQVVRVDGATGEIAGVWESSQPG  318

Query  968   DTDLGAKAPKEVKIQGIWYAQL  1033
             D DLG+K PK VK+ G+WYA++
Sbjct  319   DDDLGSKNPKPVKLSGVWYARV  340



>ref|WP_017322486.1| Photosystem II manganese-stabilizing polypeptide [cyanobacterium 
PCC 7702]
Length=277

 Score =   241 bits (616),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 165/242 (68%), Gaps = 12/242 (5%)
 Frame = +2

Query  341   TYMEVKGSGTANQCPTI-EGGVENFAFKPGK-YSAKKFCLEPTSFTVKAESVSKNAPPEF  514
             TY ++KG+G AN+CP + E    +    P K Y  K+ CLEPT F VK E+ +K   P++
Sbjct  34    TYDQIKGTGLANKCPQLTETSRGSIPIDPEKSYVIKELCLEPTQFFVKGEATNKRQKPQY  93

Query  515   QNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQL  694
                KL+TR TY+LD+I+G  +V+ DGS+ FEEK+G D+  +TV+LPGGE VPFLFTIK L
Sbjct  94    IAGKLLTRQTYSLDQIQGDLKVNPDGSLTFEEKEGFDFQPITVKLPGGETVPFLFTIKGL  153

Query  695   VATGKPE--------SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
             VA  +P          F G F VPSYRG++FLDPKGRG ++GYD AVALPA  + D+EEL
Sbjct  154   VAQSQPSMTSINTSTDFEGTFRVPSYRGATFLDPKGRGVASGYDAAVALPA--QSDDEEL  211

Query  851   QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQ  1030
              + N+K      GKI+ SV      TGE+ G FES QPSDTDLGA  PK+VK++GI+YA+
Sbjct  212   LRANVKRAEVLNGKISLSVAKVDSATGEIAGTFESEQPSDTDLGADEPKDVKVRGIFYAR  271

Query  1031  LE  1036
             +E
Sbjct  272   VE  273



>ref|WP_016872421.1| Photosystem II manganese-stabilizing polypeptide [Chlorogloeopsis 
fritschii]
Length=277

 Score =   240 bits (613),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/242 (52%), Positives = 164/242 (68%), Gaps = 12/242 (5%)
 Frame = +2

Query  341   TYMEVKGSGTANQCPTI-EGGVENFAFKPGK-YSAKKFCLEPTSFTVKAESVSKNAPPEF  514
             TY ++KG+G AN+CP + E    +     G+ Y  K+ CLEPT F VK E  +K   P++
Sbjct  34    TYDQIKGTGLANKCPQLTETSRGSIPVDAGQSYIIKELCLEPTQFFVKGEPTNKRQKPQY  93

Query  515   QNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQL  694
                KL+TR TY+LD+I+G  +V+ DGS+ F EKDG D+ A TV+LPGGE VPFLFT+K L
Sbjct  94    IAGKLLTRKTYSLDQIQGDLKVNPDGSLTFVEKDGFDFQAATVKLPGGEMVPFLFTVKGL  153

Query  695   VATGKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
             VA  +P          F G F VPSYRG++FLDPKGRG ++GYDNAVALPA  + DEE+L
Sbjct  154   VAQSQPGMTSINTSTDFEGSFRVPSYRGATFLDPKGRGVASGYDNAVALPA--QSDEEQL  211

Query  851   QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQ  1030
              + N+K      GKI+ S+      TGE+ G FES QPSDTDLGA  P+EVK++GI+YA+
Sbjct  212   LRANVKRADVLEGKISLSIAKVDSATGEIAGTFESEQPSDTDLGADEPEEVKVRGIFYAR  271

Query  1031  LE  1036
             +E
Sbjct  272   VE  273



>ref|WP_009768009.1| Manganese-stabilising protein / photosystem II polypeptide [Oscillatoriales 
cyanobacterium JSC-12]
 gb|EKQ68898.1| Manganese-stabilising protein / photosystem II polypeptide [Oscillatoriales 
cyanobacterium JSC-12]
Length=274

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/245 (52%), Positives = 167/245 (68%), Gaps = 13/245 (5%)
 Frame = +2

Query  332   QSKTYMEVKGSGTANQCPTI-EGGVENFAFKPGK-YSAKKFCLEPTSFTVKAESVSKNAP  505
             ++ TY +++G+G AN C  + E    +   +PGK Y     CL+PTSF VK E   + A 
Sbjct  30    ETLTYEQIRGTGLANSCLQVAETSRGSIPIEPGKSYKLTNLCLQPTSFLVKEEGTKRQAA  89

Query  506   PEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTI  685
              EF  +KLMTR T T+DE++G  +++ DGS+ F E+DG+D+ A+TVQLPGGERVPFLFTI
Sbjct  90    -EFVPSKLMTRYTSTIDEVQGQLKLNPDGSLTFIEEDGLDFQAITVQLPGGERVPFLFTI  148

Query  686   KQLVATGKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDE  841
             K+LVAT +P          F GEF VPSYR ++FLDPKGRG +TGYDNAVALPA  + D 
Sbjct  149   KELVATTQPGLSAINASTDFEGEFKVPSYRTANFLDPKGRGLTTGYDNAVALPA--QADS  206

Query  842   EELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIW  1021
             EEL KEN+K      GKI+  VT     TGE+ G FES QPS+TD+G+   KEVKI+G++
Sbjct  207   EELVKENVKRFQLDKGKISLQVTRVDGSTGEIAGNFESNQPSETDMGSHEAKEVKIRGVF  266

Query  1022  YAQLE  1036
             Y ++E
Sbjct  267   YGRVE  271



>gb|KIE10612.1| Photosystem II manganese-stabilizing polypeptide [Tolypothrix 
bouteillei VB521301]
Length=275

 Score =   240 bits (612),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 125/242 (52%), Positives = 163/242 (67%), Gaps = 12/242 (5%)
 Frame = +2

Query  341   TYMEVKGSGTANQCPTI-EGGVENFAFKP-GKYSAKKFCLEPTSFTVKAESVSKNAPPEF  514
             TY +++G+G AN+CP + E    +    P G Y+ K+ CLEPT F +K E ++K    E+
Sbjct  33    TYDQIRGTGLANKCPQLAETSRGSIPIDPKGAYAIKELCLEPTQFFIKEEPINKRQKAEY  92

Query  515   QNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQL  694
                KL+TR TY+LD+I G  +V+SDGS+ F EKDG D+ A TV+LPGGE +PFLFT+K L
Sbjct  93    VAGKLLTRRTYSLDQIMGDLDVNSDGSLTFVEKDGFDFQAATVKLPGGESIPFLFTVKGL  152

Query  695   VATGKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
             VA  +P          F G F VPSYRG++FLDPKGRG ++GYDNAVALPA  + D+ EL
Sbjct  153   VAQSQPGLSSINTSTDFEGTFKVPSYRGATFLDPKGRGVASGYDNAVALPA--QADDREL  210

Query  851   QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQ  1030
                N+K      GKI+  V      TGE+ G FES QPSDTDLGAK P+EVKI+G++YA+
Sbjct  211   VNANVKRTDVLKGKISLQVAKVDNVTGEIGGTFESEQPSDTDLGAKEPEEVKIRGLFYAR  270

Query  1031  LE  1036
             LE
Sbjct  271   LE  272



>ref|WP_039205072.1| Photosystem II manganese-stabilizing polypeptide [Aphanizomenon 
flos-aquae]
 gb|KHG39015.1| Photosystem II manganese-stabilizing polypeptide [Aphanizomenon 
flos-aquae 2012/KM1/D3]
Length=276

 Score =   239 bits (611),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 163/242 (67%), Gaps = 12/242 (5%)
 Frame = +2

Query  341   TYMEVKGSGTANQCPTI-EGGVENFAFKPG-KYSAKKFCLEPTSFTVKAESVSKNAPPEF  514
             TY +++G+G AN+CP + E    + A  P  KYS K+ CLEPTSF VK E  +K    EF
Sbjct  34    TYEQIRGTGLANKCPQLAETSRGSIAIDPSVKYSIKELCLEPTSFFVKEEPANKRQKAEF  93

Query  515   QNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQL  694
                K+MTR T T+D+++G    ++D S+ F+E+DG+D+ A+TV+LPGGE VPFLFTIK L
Sbjct  94    VPGKIMTRYTSTIDQVQGQLTSNADKSLTFKEEDGLDFQAITVKLPGGELVPFLFTIKNL  153

Query  695   VATGKPE--------SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
             VA  +P          F G F VPSYRG++FLDPKGRG  +GYDNAVALPAG   D EEL
Sbjct  154   VAQTQPNLTSINTSTDFEGTFKVPSYRGAAFLDPKGRGVVSGYDNAVALPAG--SDNEEL  211

Query  851   QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQ  1030
              + N+K      GKI+  V      +GE+ G FES QPSDTDLGA  PKEVKI+G++YA+
Sbjct  212   TRTNVKRAEILPGKISLQVAKVDNTSGEIAGTFESEQPSDTDLGAGEPKEVKIRGLFYAR  271

Query  1031  LE  1036
             +E
Sbjct  272   IE  273



>emb|CAA33560.1| manganese-stabilzing protein (MSP) precursor [Nostoc sp. PCC 
7120]
Length=273

 Score =   239 bits (610),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 124/242 (51%), Positives = 160/242 (66%), Gaps = 12/242 (5%)
 Frame = +2

Query  341   TYMEVKGSGTANQCPTI-EGGVENFAFKPGK-YSAKKFCLEPTSFTVKAESVSKNAPPEF  514
             TY +++G+G AN+CP + E    +      K Y  K+ CLEPT+F VK E  +K    EF
Sbjct  34    TYEQIRGTGLANKCPQLTETSRGSIPLDSSKSYVLKELCLEPTNFFVKEEPANKRQTAEF  93

Query  515   QNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQL  694
                KL+TR T T+D++ G  + + D S+ F EKDG+D+ A+TVQLPGGERVPFLFTIK L
Sbjct  94    VAGKLLTRYTSTIDQVSGDLKFNDDSSLTFVEKDGLDFQAITVQLPGGERVPFLFTIKNL  153

Query  695   VATGKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
             VA  +P          F G F VPSYRGS+FLDPKGRG  +GYDNAVALPA  + D+E+L
Sbjct  154   VAQTQPGLSSLNTSTDFEGTFKVPSYRGSAFLDPKGRGVVSGYDNAVALPA--QADDEDL  211

Query  851   QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQ  1030
              + N+K      GKI+  +      +GE+ G FES QPSDTDLGA  PKEVKI+GI+YA+
Sbjct  212   TRTNVKRAEILNGKISLQIAKVDSSSGEIAGTFESEQPSDTDLGADEPKEVKIRGIFYAR  271

Query  1031  LE  1036
             +E
Sbjct  272   VE  273



>ref|WP_027404713.1| Photosystem II manganese-stabilizing polypeptide [Aphanizomenon 
flos-aquae]
Length=276

 Score =   239 bits (610),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 163/242 (67%), Gaps = 12/242 (5%)
 Frame = +2

Query  341   TYMEVKGSGTANQCPTI-EGGVENFAFKPG-KYSAKKFCLEPTSFTVKAESVSKNAPPEF  514
             TY +++G+G AN+CP + E    + A  P  KYS K+ CLEPTSF VK E  +K    EF
Sbjct  34    TYEQIRGTGLANKCPQLAETSRGSIAIDPSVKYSIKELCLEPTSFFVKEEPANKRQKAEF  93

Query  515   QNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQL  694
                K+MTR T T+D+++G    ++D S+ F+E+DG+D+ A+TV+LPGGE VPFLFTIK L
Sbjct  94    VPGKIMTRYTSTIDQVQGQLISNADKSLTFKEEDGLDFQAITVKLPGGELVPFLFTIKNL  153

Query  695   VATGKPE--------SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
             VA  +P          F G F VPSYRG++FLDPKGRG  +GYDNAVALPAG   D EEL
Sbjct  154   VAQTQPNLTSINTSTDFEGTFKVPSYRGAAFLDPKGRGVVSGYDNAVALPAG--SDNEEL  211

Query  851   QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQ  1030
              + N+K      GKI+  V      +GE+ G FES QPSDTDLGA  PKEVKI+G++YA+
Sbjct  212   TRTNVKRAEILPGKISLQVAKVDNTSGEIAGTFESEQPSDTDLGAGEPKEVKIRGLFYAR  271

Query  1031  LE  1036
             +E
Sbjct  272   IE  273



>ref|WP_012625990.1| photosystem II manganese-stabilizing protein PsbO [Cyanothece 
sp. PCC 7425]
 gb|ACL42889.1| photosystem II manganese-stabilizing protein PsbO [Cyanothece 
sp. PCC 7425]
Length=274

 Score =   239 bits (609),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/277 (46%), Positives = 173/277 (62%), Gaps = 20/277 (7%)
 Frame = +2

Query  236   AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTI-EGGVENF  412
             A +  F      +L  G NA      LT+D+I        +G+G AN CP++ E    +F
Sbjct  5     AFIVAFLAFCLGMLTLGGNALAAKPALTYDQI--------RGTGLANNCPSLDETARGSF  56

Query  413   AFKPGK-YSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
             A  P + Y     CL+PT+F VK E  S+    +F   K+MTR T ++D+++GP + +S+
Sbjct  57    ALDPNQSYRMSALCLQPTTFLVKEEPKSRRQEADFVPAKVMTRYTSSIDQVQGPLKFNSN  116

Query  590   GSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP--------ESFSGEFLVPS  745
             GS+ F E+DG D+  +TVQLPGGERVP LF++K LVAT +P          F G+F VPS
Sbjct  117   GSLTFTEEDGFDFQPITVQLPGGERVPLLFSVKNLVATTQPGLTSINTSTDFEGDFNVPS  176

Query  746   YRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPE  925
             YR S+FLDPKGRG +TGYDNAVALPAG   DE+EL + N+K    + GKI+  V+     
Sbjct  177   YRTSNFLDPKGRGLATGYDNAVALPAG--ADEDELTRANVKRFDVTKGKISLQVSKVNSR  234

Query  926   TGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  1036
             TGE+ G FES Q SD D+GA   KE+KIQGI+Y+++E
Sbjct  235   TGEIAGTFESEQLSDDDMGAHESKEMKIQGIFYSRIE  271



>ref|WP_028090302.1| Photosystem II manganese-stabilizing polypeptide [Dolichospermum 
circinale]
Length=276

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/242 (52%), Positives = 162/242 (67%), Gaps = 12/242 (5%)
 Frame = +2

Query  341   TYMEVKGSGTANQCPTI-EGGVENFAFKPG-KYSAKKFCLEPTSFTVKAESVSKNAPPEF  514
             TY +++G+G AN+CP + E    + A  P   YS K+ CLEPT+F VK E  +K    EF
Sbjct  34    TYEQIRGTGLANKCPQLAETSRGSIAVDPNVTYSIKELCLEPTNFFVKEEPANKRQEAEF  93

Query  515   QNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQL  694
                K+MTR T T+D+++G   V+SD S+ F EKDG+D+ A+TV+LPGGE VPFLFTIK L
Sbjct  94    VPGKVMTRYTSTIDQVQGKLTVNSDNSLTFTEKDGLDFQAITVKLPGGELVPFLFTIKNL  153

Query  695   VATGKPE--------SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
             VA  +P          F G F VPSYRG++FLDPKGRG  +GYDNAVALPA  + D+EEL
Sbjct  154   VAQTQPNLTSINTSTDFEGTFKVPSYRGAAFLDPKGRGVVSGYDNAVALPA--QADDEEL  211

Query  851   QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQ  1030
              + N+K      GKI+  V      +GE+ G FES QPSDTDLGA  PKEVKI+G++Y +
Sbjct  212   TRTNVKRAEVLKGKISLQVAKVDNTSGEIAGTFESEQPSDTDLGAGEPKEVKIRGLFYGR  271

Query  1031  LE  1036
             +E
Sbjct  272   IE  273



>ref|WP_015204171.1| photosystem II manganese-stabilizing protein PsbO [Crinalium 
epipsammum]
 gb|AFZ14065.1| photosystem II manganese-stabilizing protein PsbO [Crinalium 
epipsammum PCC 9333]
Length=277

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 137/279 (49%), Positives = 179/279 (64%), Gaps = 22/279 (8%)
 Frame = +2

Query  239   KLAGFALATSALL--VSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCP----TIEGG  400
             K  GF +A  AL   V  A +EG P   T   +   TY +++G+G AN CP    T  G 
Sbjct  2     KFRGFIVAFLALCLGVLTACSEG-PASATNAPL---TYDQIRGTGLANNCPILSETTRGA  57

Query  401   VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             +   + +   YS K+ CL+PT+F VK ESV+K    EF   KL+TR T +LD+I G  +V
Sbjct  58    IPVDSSQ--TYSLKELCLQPTTFFVKEESVNKRQAAEFVPGKLLTRFTSSLDQISGTIKV  115

Query  581   SSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP--------ESFSGEFL  736
             S +GS+ F E+DGID+  +TV+L GGE+VPF FTIK LVA+ +P          F GEF 
Sbjct  116   SKNGSLTFTEEDGIDFQPITVRLAGGEQVPFFFTIKNLVASSQPGMDSINTSTDFEGEFN  175

Query  737   VPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTGKITFSVTGS  916
             VPSYRG+ FLDPKGRG ++GYDNAVALP+    D E+L++ N+K V +  GKI+  V   
Sbjct  176   VPSYRGAVFLDPKGRGVASGYDNAVALPS--EADSEQLRRANVKRVETGKGKISLQVAKV  233

Query  917   KPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  1033
                TGEV G FES QPSDTDLGA  PKEVK++GI+YA++
Sbjct  234   DSNTGEVAGTFESEQPSDTDLGADDPKEVKVRGIFYARI  272



>ref|WP_017286598.1| hypothetical protein [Leptolyngbya boryana]
Length=275

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/241 (52%), Positives = 161/241 (67%), Gaps = 12/241 (5%)
 Frame = +2

Query  341   TYMEVKGSGTANQCPTIEGGVE-NFAFKPGK-YSAKKFCLEPTSFTVKAESVSKNAPPEF  514
             TY +++ +G AN CP IE     +   + GK YS    CL+PTS+ VK E+ SK    EF
Sbjct  33    TYEQIRNTGLANNCPQIEATSRGSIPIESGKTYSITGLCLQPTSYFVKEETASKRREAEF  92

Query  515   QNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQL  694
                KLMTR T ++D + G  + +SDGS+ F E+DG+D+ A+TVQLPGGERVPFLFTIK L
Sbjct  93    VPAKLMTRYTSSIDAVSGTLKSNSDGSLTFTEEDGLDFQAITVQLPGGERVPFLFTIKGL  152

Query  695   VATGKPES--------FSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
             VAT  P S        F+GEF VPSYR S+FLDPKGRG +TGYDNAVALPA    D EEL
Sbjct  153   VATTDPGSSSINTSTDFTGEFRVPSYRTSNFLDPKGRGLTTGYDNAVALPAS--ADSEEL  210

Query  851   QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQ  1030
             +KEN+K      G I+  V      +GE+ G FES QPS+TD+G++   EVKI+G++YA+
Sbjct  211   RKENVKRFQLDKGTISLQVAKIDSASGEIAGTFESDQPSETDMGSREASEVKIRGLFYAR  270

Query  1031  L  1033
             +
Sbjct  271   V  271



>ref|WP_011318645.1| photosystem II manganese-stabilizing polypeptide [Anabaena variabilis]
 gb|ABA21465.1| Photosystem II manganese-stabilizing protein PsbO [Anabaena variabilis 
ATCC 29413]
Length=273

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/242 (51%), Positives = 160/242 (66%), Gaps = 12/242 (5%)
 Frame = +2

Query  341   TYMEVKGSGTANQCPTI-EGGVENFAFKPGK-YSAKKFCLEPTSFTVKAESVSKNAPPEF  514
             TY +++G+G AN+CP + E    +      K Y  K+ CLEPT+F VK E  +K    EF
Sbjct  34    TYEQIRGTGLANKCPQLTETSRGSIPLDSSKSYVIKELCLEPTNFFVKEEPANKRQAAEF  93

Query  515   QNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQL  694
                KL+TR T T+D++ G  + + D S+ F EKDG+D+ A+TVQLPGGERVPFLFTIK L
Sbjct  94    VAGKLLTRYTSTIDQVSGDLKFNDDSSLTFVEKDGLDFQAITVQLPGGERVPFLFTIKNL  153

Query  695   VATGKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
             VA  +P          F G F VPSYRG++FLDPKGRG  +GYDNAVALPA  + D+E+L
Sbjct  154   VAQTQPGLSSLNTSTDFEGTFKVPSYRGAAFLDPKGRGVVSGYDNAVALPA--QADDEDL  211

Query  851   QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQ  1030
              + N+K      GKI+  +      +GE+ G FES QPSDTDLGA  PKEVKI+GI+YA+
Sbjct  212   TRTNVKRAEILNGKISLQIAKVDSSSGEIAGTFESEQPSDTDLGADEPKEVKIRGIFYAR  271

Query  1031  LE  1036
             +E
Sbjct  272   VE  273



>ref|WP_017745622.1| Photosystem II manganese-stabilizing polypeptide [Scytonema hofmanni]
Length=275

 Score =   238 bits (606),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 161/242 (67%), Gaps = 12/242 (5%)
 Frame = +2

Query  341   TYMEVKGSGTANQCPTI-EGGVENFAFKP-GKYSAKKFCLEPTSFTVKAESVSKNAPPEF  514
             TY +++G+G AN+CP + E    +    P G Y  K+ CLEPT F VK E ++K    E+
Sbjct  33    TYDQIRGTGLANKCPQLAETSRGSIPIDPKGAYVIKELCLEPTQFFVKEEPLNKRQQAEY  92

Query  515   QNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQL  694
                KL+TR TY+LD+I G   V+SDGS+ F EKDG D+ A TV+LPGGE +PFLFT+K L
Sbjct  93    VGGKLLTRRTYSLDQISGDLNVNSDGSLTFVEKDGFDFQAATVKLPGGESIPFLFTVKGL  152

Query  695   VATGKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL  850
             VA  +P          F G F VPSYRG++FLDPKGRG ++GYDNAVALPA  + D+ EL
Sbjct  153   VAQSQPGLTSINTSTDFEGSFKVPSYRGATFLDPKGRGVASGYDNAVALPA--QADDSEL  210

Query  851   QKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQ  1030
                N+K      GKI+  V      TGE+ G FES QPSDTDLGAK P+EVKI+G++YA+
Sbjct  211   VNANVKRTDVLKGKISLQVAKVDNGTGEIGGTFESEQPSDTDLGAKEPEEVKIRGLFYAR  270

Query  1031  LE  1036
             LE
Sbjct  271   LE  272



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3820435310730