BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3685

Length=824
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAB41076.1|  MAR-binding protein                                    441   5e-149   Nicotiana tabacum [American tobacco]
ref|XP_009769588.1|  PREDICTED: probable nucleolar protein 5-2          440   1e-148   Nicotiana sylvestris
ref|XP_009591833.1|  PREDICTED: probable nucleolar protein 5-2          439   2e-148   Nicotiana tomentosiformis
ref|XP_006362168.1|  PREDICTED: probable nucleolar protein 5-2-li...    437   1e-147   
ref|XP_004247627.1|  PREDICTED: probable nucleolar protein 5-2          437   2e-147   
emb|CBI34244.3|  unnamed protein product                                432   6e-147   Vitis vinifera
emb|CAN73717.1|  hypothetical protein VITISV_038844                     432   6e-147   Vitis vinifera
ref|XP_002273273.2|  PREDICTED: probable nucleolar protein 5-2          433   1e-145   Vitis vinifera
emb|CDP04715.1|  unnamed protein product                                427   1e-145   Coffea canephora [robusta coffee]
ref|XP_004239682.1|  PREDICTED: probable nucleolar protein 5-2          430   2e-145   Solanum lycopersicum
ref|XP_010243588.1|  PREDICTED: probable nucleolar protein 5-1          432   2e-145   Nelumbo nucifera [Indian lotus]
ref|XP_010097360.1|  hypothetical protein L484_010238                   429   4e-145   
ref|XP_006345813.1|  PREDICTED: probable nucleolar protein 5-2-like     427   8e-144   Solanum tuberosum [potatoes]
ref|XP_009382561.1|  PREDICTED: probable nucleolar protein 5-2          427   2e-143   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010241493.1|  PREDICTED: probable nucleolar protein 5-2 is...    427   2e-143   Nelumbo nucifera [Indian lotus]
ref|XP_010904781.1|  PREDICTED: probable nucleolar protein 5-2          426   7e-143   Elaeis guineensis
ref|XP_011099778.1|  PREDICTED: probable nucleolar protein 5-2          425   2e-142   Sesamum indicum [beniseed]
ref|XP_008799299.1|  PREDICTED: probable nucleolar protein 5-2          421   3e-142   Phoenix dactylifera
tpg|DAA45361.1|  TPA: hypothetical protein ZEAMMB73_906298              419   4e-142   
ref|XP_011099781.1|  PREDICTED: probable nucleolar protein 5-2          424   4e-142   Sesamum indicum [beniseed]
ref|XP_009411704.1|  PREDICTED: probable nucleolar protein 5-1          424   8e-142   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010687356.1|  PREDICTED: probable nucleolar protein 5-2          423   9e-142   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008796213.1|  PREDICTED: probable nucleolar protein 5-2 is...    422   1e-141   Phoenix dactylifera
ref|XP_008796212.1|  PREDICTED: probable nucleolar protein 5-2 is...    422   2e-141   Phoenix dactylifera
ref|XP_010025094.1|  PREDICTED: probable nucleolar protein 5-2          422   3e-141   Eucalyptus grandis [rose gum]
emb|CAK22424.1|  matrix attachment region binding protein               421   3e-141   Beta vulgaris [beet]
ref|XP_008655653.1|  PREDICTED: probable nucleolar protein 5-2          421   4e-141   Zea mays [maize]
ref|XP_010241470.1|  PREDICTED: probable nucleolar protein 5-2 is...    422   4e-141   Nelumbo nucifera [Indian lotus]
ref|XP_007208461.1|  hypothetical protein PRUPE_ppa003941mg             419   6e-141   Prunus persica
ref|XP_008218165.1|  PREDICTED: probable nucleolar protein 5-2          419   8e-141   Prunus mume [ume]
ref|XP_010938712.1|  PREDICTED: probable nucleolar protein 5-2          421   1e-140   Elaeis guineensis
ref|NP_001050112.1|  Os03g0350100                                       419   1e-140   
ref|XP_002456868.1|  hypothetical protein SORBIDRAFT_03g044260          419   2e-140   
ref|XP_006650080.1|  PREDICTED: probable nucleolar protein 5-2-like     419   2e-140   Oryza brachyantha
ref|XP_008671899.1|  PREDICTED: probable nucleolar protein 5-2          414   2e-140   
ref|NP_001050113.1|  Os03g0350300                                       419   2e-140   
gb|ABF95925.1|  Nucleolar protein NOP5, putative, expressed             419   2e-140   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008660157.1|  PREDICTED: probable nucleolar protein 5-2          418   4e-140   Zea mays [maize]
dbj|BAN15014.1|  SAR DNA binding protein                                417   5e-140   Bromus inermis [awnless brome grass]
ref|XP_003557835.1|  PREDICTED: probable nucleolar protein 5-2          417   6e-140   Brachypodium distachyon [annual false brome]
ref|XP_008649917.1|  PREDICTED: LOW QUALITY PROTEIN: probable nuc...    409   6e-140   
ref|XP_004984388.1|  PREDICTED: probable nucleolar protein 5-2-like     418   6e-140   Setaria italica
dbj|BAA31260.1|  SAR DNA binding protein                                415   7e-140   Oryza sativa [red rice]
gb|EEC75255.1|  hypothetical protein OsI_11566                          421   8e-140   Oryza sativa Indica Group [Indian rice]
ref|XP_002533223.1|  nucleolar protein nop56, putative                  417   8e-140   Ricinus communis
gb|EYU23803.1|  hypothetical protein MIMGU_mgv1a003693mg                417   1e-139   Erythranthe guttata [common monkey flower]
ref|XP_004984387.1|  PREDICTED: probable nucleolar protein 5-2-like     417   2e-139   Setaria italica
gb|EYU23804.1|  hypothetical protein MIMGU_mgv1a003941mg                415   6e-139   Erythranthe guttata [common monkey flower]
ref|XP_012089180.1|  PREDICTED: probable nucleolar protein 5-1          416   6e-139   Jatropha curcas
gb|KJB26511.1|  hypothetical protein B456_004G245100                    411   7e-139   Gossypium raimondii
ref|XP_008666415.1|  PREDICTED: probable nucleolar protein 5-2          410   9e-139   
ref|XP_008388628.1|  PREDICTED: probable nucleolar protein 5-2          414   1e-138   
ref|XP_009342020.1|  PREDICTED: probable nucleolar protein 5-2          414   1e-138   Pyrus x bretschneideri [bai li]
ref|XP_009364569.1|  PREDICTED: probable nucleolar protein 5-2          414   2e-138   Pyrus x bretschneideri [bai li]
ref|XP_008455669.1|  PREDICTED: probable nucleolar protein 5-2          414   2e-138   Cucumis melo [Oriental melon]
ref|XP_004139213.1|  PREDICTED: probable nucleolar protein 5-2          413   2e-138   Cucumis sativus [cucumbers]
gb|KJB45049.1|  hypothetical protein B456_007G287100                    409   2e-138   Gossypium raimondii
ref|XP_008370662.1|  PREDICTED: probable nucleolar protein 5-2          413   2e-138   
ref|XP_002512277.1|  nucleolar protein nop56, putative                  413   5e-138   Ricinus communis
ref|XP_003537858.1|  PREDICTED: probable nucleolar protein 5-2-like     412   7e-138   Glycine max [soybeans]
gb|KHN25404.1|  Putative nucleolar protein 5-2                          412   1e-137   Glycine soja [wild soybean]
ref|XP_003540996.1|  PREDICTED: probable nucleolar protein 5-2-like     412   1e-137   Glycine max [soybeans]
gb|EMS65034.1|  hypothetical protein TRIUR3_04158                       411   2e-137   Triticum urartu
gb|KJB26509.1|  hypothetical protein B456_004G245100                    411   2e-137   Gossypium raimondii
gb|KJB45047.1|  hypothetical protein B456_007G287100                    411   2e-137   Gossypium raimondii
gb|KJB82563.1|  hypothetical protein B456_013G202500                    405   4e-137   Gossypium raimondii
ref|XP_012075114.1|  PREDICTED: probable nucleolar protein 5-1          410   6e-137   Jatropha curcas
ref|XP_004507477.1|  PREDICTED: probable nucleolar protein 5-1-like     410   7e-137   Cicer arietinum [garbanzo]
ref|XP_006491841.1|  PREDICTED: probable nucleolar protein 5-1-like     409   8e-137   Citrus sinensis [apfelsine]
ref|XP_007131795.1|  hypothetical protein PHAVU_011G042200g             409   8e-137   Phaseolus vulgaris [French bean]
ref|XP_007030688.1|  NOP56-like pre RNA processing ribonucleoprot...    404   2e-136   
gb|KHG01423.1|  putative nucleolar 5-2 -like protein                    408   4e-136   Gossypium arboreum [tree cotton]
ref|XP_006432265.1|  hypothetical protein CICLE_v10000758mg             407   6e-136   Citrus clementina [clementine]
gb|KJB82560.1|  hypothetical protein B456_013G202500                    407   6e-136   Gossypium raimondii
gb|KHG00213.1|  putative nucleolar 5-2 -like protein                    407   1e-135   Gossypium arboreum [tree cotton]
ref|XP_006838803.1|  PREDICTED: probable nucleolar protein 5-2          407   2e-135   Amborella trichopoda
ref|XP_003562489.1|  PREDICTED: probable nucleolar protein 5-2          406   2e-135   Brachypodium distachyon [annual false brome]
ref|XP_007030689.1|  NOP56-like pre RNA processing ribonucleoprot...    398   1e-134   
ref|XP_002319598.1|  hypothetical protein POPTR_0013s03260g             404   1e-134   Populus trichocarpa [western balsam poplar]
gb|KHG01259.1|  putative nucleolar 5-2 -like protein                    404   1e-134   Gossypium arboreum [tree cotton]
ref|XP_007030686.1|  NOP56-like pre RNA processing ribonucleoprot...    404   2e-134   
ref|XP_010674932.1|  PREDICTED: probable nucleolar protein 5-2          404   3e-134   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS70798.1|  hypothetical protein M569_03961                         397   5e-134   Genlisea aurea
ref|XP_011013586.1|  PREDICTED: probable nucleolar protein 5-1          402   7e-134   Populus euphratica
ref|XP_011032532.1|  PREDICTED: probable nucleolar protein 5-1          402   1e-133   Populus euphratica
ref|XP_006382714.1|  hypothetical protein POPTR_0005s04710g             402   1e-133   Populus trichocarpa [western balsam poplar]
ref|XP_011003824.1|  PREDICTED: probable nucleolar protein 5-2          401   2e-133   Populus euphratica
ref|XP_010546633.1|  PREDICTED: probable nucleolar protein 5-2          400   3e-133   Tarenaya hassleriana [spider flower]
ref|XP_003611088.1|  SAR DNA-binding protein-1                          400   7e-133   Medicago truncatula
ref|XP_010550954.1|  PREDICTED: probable nucleolar protein 5-2          399   8e-133   Tarenaya hassleriana [spider flower]
gb|AAC16330.1|  SAR DNA-binding protein-1                               398   2e-132   Pisum sativum [garden pea]
ref|XP_008650437.1|  PREDICTED: probable nucleolar protein 5-2          394   4e-132   
ref|XP_007030687.1|  NOP56-like pre RNA processing ribonucleoprot...    396   8e-132   
ref|XP_006468094.1|  PREDICTED: probable nucleolar protein 5-2-li...    395   4e-131   Citrus sinensis [apfelsine]
ref|XP_006468095.1|  PREDICTED: probable nucleolar protein 5-2-li...    395   5e-131   Citrus sinensis [apfelsine]
ref|XP_006468096.1|  PREDICTED: probable nucleolar protein 5-2-li...    395   6e-131   Citrus sinensis [apfelsine]
ref|XP_006468097.1|  PREDICTED: probable nucleolar protein 5-2-li...    395   8e-131   Citrus sinensis [apfelsine]
ref|XP_006436388.1|  hypothetical protein CICLE_v10031140mg             394   1e-130   Citrus clementina [clementine]
ref|XP_003606983.1|  SAR DNA-binding protein-1                          392   5e-130   
gb|ACJ85748.1|  unknown                                                 390   3e-129   Medicago truncatula
ref|XP_006408115.1|  hypothetical protein EUTSA_v10020473mg             385   2e-127   Eutrema salsugineum [saltwater cress]
tpg|DAA47456.1|  TPA: hypothetical protein ZEAMMB73_782083              377   2e-127   
ref|XP_010421656.1|  PREDICTED: probable nucleolar protein 5-1 is...    383   6e-127   Camelina sativa [gold-of-pleasure]
gb|AAC16331.1|  SAR DNA-binding protein-2                               384   9e-127   Pisum sativum [garden pea]
ref|XP_010455156.1|  PREDICTED: probable nucleolar protein 5-1          382   2e-126   Camelina sativa [gold-of-pleasure]
emb|CDX80674.1|  BnaC07g27700D                                          382   3e-126   
tpg|DAA47457.1|  TPA: hypothetical protein ZEAMMB73_782083              379   4e-126   
ref|XP_009151230.1|  PREDICTED: probable nucleolar protein 5-1          381   4e-126   Brassica rapa
ref|XP_010494044.1|  PREDICTED: probable nucleolar protein 5-1          380   7e-126   Camelina sativa [gold-of-pleasure]
emb|CDY19706.1|  BnaA09g03590D                                          381   8e-126   Brassica napus [oilseed rape]
emb|CDY00004.1|  BnaC09g02970D                                          381   8e-126   
ref|XP_006394992.1|  hypothetical protein EUTSA_v10003966mg             379   5e-125   Eutrema salsugineum [saltwater cress]
gb|AFW84118.1|  hypothetical protein ZEAMMB73_870642                    379   1e-124   
gb|KFK37913.1|  hypothetical protein AALP_AA3G046300                    377   2e-124   Arabis alpina [alpine rockcress]
ref|XP_009111930.1|  PREDICTED: probable nucleolar protein 5-1          376   4e-124   Brassica rapa
gb|AAN72071.1|  SAR DNA-binding protein - like                          371   2e-123   Arabidopsis thaliana [mouse-ear cress]
emb|CDY52494.1|  BnaAnng11410D                                          374   2e-123   Brassica napus [oilseed rape]
ref|XP_002884489.1|  hypothetical protein ARALYDRAFT_896572             374   3e-123   Arabidopsis lyrata subsp. lyrata
ref|NP_187157.1|  putative SAR DNA-binding protein                      374   3e-123   Arabidopsis thaliana [mouse-ear cress]
gb|AAB61073.1|  similar to S. cerevisiae SIK1P (PID:g984964)            370   5e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001756465.1|  predicted protein                                  374   6e-123   
ref|XP_010485906.1|  PREDICTED: probable nucleolar protein 5-2          371   4e-122   Camelina sativa [gold-of-pleasure]
ref|XP_010422824.1|  PREDICTED: probable nucleolar protein 5-2          372   4e-122   Camelina sativa [gold-of-pleasure]
ref|NP_198064.1|  putative SAR DNA-binding protein                      370   7e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001753892.1|  predicted protein                                  372   1e-121   
ref|XP_002874406.1|  hypothetical protein ARALYDRAFT_489610             370   1e-121   
emb|CAE45597.1|  SAR DNA-binding protein-like protein                   369   3e-121   Lotus japonicus
ref|XP_010464014.1|  PREDICTED: probable nucleolar protein 5-2          368   1e-120   Camelina sativa [gold-of-pleasure]
ref|XP_006287421.1|  hypothetical protein CARUB_v10000627mg             368   2e-120   
ref|XP_011457678.1|  PREDICTED: probable nucleolar protein 5-2          367   3e-120   Fragaria vesca subsp. vesca
gb|KFK23538.1|  hypothetical protein AALP_AAs63573U000200               364   6e-120   Arabis alpina [alpine rockcress]
ref|XP_006297275.1|  hypothetical protein CARUB_v10013290mg             365   4e-119   
ref|XP_002970093.1|  hypothetical protein SELMODRAFT_146841             356   9e-116   Selaginella moellendorffii
ref|XP_002985284.1|  hypothetical protein SELMODRAFT_121625             351   8e-114   Selaginella moellendorffii
gb|KJB26512.1|  hypothetical protein B456_004G245100                    345   7e-112   Gossypium raimondii
ref|XP_005850162.1|  hypothetical protein CHLNCDRAFT_57124              355   4e-109   Chlorella variabilis
emb|CDY50583.1|  BnaC02g39570D                                          329   8e-106   Brassica napus [oilseed rape]
ref|XP_005650009.1|  Nop-domain-containing protein                      326   2e-104   Coccomyxa subellipsoidea C-169
emb|CEF96991.1|  NOSIC                                                  323   2e-104   Ostreococcus tauri
gb|KIY95194.1|  putative nucleolar protein NOP5-2                       315   3e-103   Monoraphidium neglectum
gb|AAZ31075.2|  MAR-binding protein                                     319   1e-101   Dunaliella salina
gb|ACA96503.1|  MAR-binding protein                                     319   1e-101   Dunaliella salina
ref|XP_001416562.1|  predicted protein                                  316   2e-101   Ostreococcus lucimarinus CCE9901
ref|XP_006681446.1|  hypothetical protein BATDEDRAFT_33621              315   2e-100   Batrachochytrium dendrobatidis JAM81
ref|XP_007512606.1|  predicted protein                                  314   2e-100   Bathycoccus prasinos
tpg|DAA42144.1|  TPA: hypothetical protein ZEAMMB73_016967              306   3e-99    
ref|XP_002507734.1|  nucleolar RNA binding protein                      310   6e-99    Micromonas commoda
gb|EEE59058.1|  hypothetical protein OsJ_10836                          308   1e-97    Oryza sativa Japonica Group [Japonica rice]
gb|AAY34142.1|  Nop58p                                                  306   1e-97    Physarum polycephalum
emb|CAJ82550.1|  nucleolar protein 5                                    306   3e-97    Xenopus tropicalis [western clawed frog]
ref|NP_989298.1|  NOP58 ribonucleoprotein                               306   7e-97    Xenopus tropicalis [western clawed frog]
gb|AAI30064.1|  LOC398558 protein                                       305   1e-96    Xenopus laevis [clawed frog]
gb|AAH44082.1|  LOC398558 protein                                       305   1e-96    Xenopus laevis [clawed frog]
gb|AAH77204.1|  MGC78950 protein                                        305   2e-96    Xenopus laevis [clawed frog]
ref|NP_001086628.1|  NOP58 ribonucleoprotein                            305   2e-96    Xenopus laevis [clawed frog]
gb|AAI06292.1|  LOC398558 protein                                       305   3e-96    Xenopus laevis [clawed frog]
ref|XP_011399356.1|  putative nucleolar protein 5-2                     303   4e-96    Auxenochlorella protothecoides
ref|XP_005995462.1|  PREDICTED: nucleolar protein 58 isoform X1         304   6e-96    Latimeria chalumnae
ref|XP_005995463.1|  PREDICTED: nucleolar protein 58 isoform X2         303   7e-96    Latimeria chalumnae
ref|XP_009496003.1|  hypothetical protein H696_03867                    301   8e-96    Fonticula alba
gb|KHN07217.1|  Putative nucleolar protein 5-2                          290   4e-95    Glycine soja [wild soybean]
ref|XP_001690352.1|  nucleolar protein, component of C/D snoRNPs        300   7e-95    Chlamydomonas reinhardtii
emb|CDS04923.1|  hypothetical protein LRAMOSA07453                      300   8e-95    Lichtheimia ramosa
emb|CDH51673.1|  loc398558 protein                                      300   1e-94    Lichtheimia corymbifera JMRC:FSU:9682
gb|KDD76960.1|  putative snoRNA binding domain-containing protein       299   1e-94    Helicosporidium sp. ATCC 50920
ref|XP_009054674.1|  hypothetical protein LOTGIDRAFT_144966             298   2e-94    Lottia gigantea
ref|XP_002166198.2|  PREDICTED: nucleolar protein 58-like               294   2e-94    
ref|XP_003056558.1|  nucleolar RNA binding protein                      298   3e-94    Micromonas pusilla CCMP1545
ref|XP_002598583.1|  hypothetical protein BRAFLDRAFT_113716             298   5e-94    Branchiostoma floridae
ref|XP_005777664.1|  hypothetical protein EMIHUDRAFT_206438             293   5e-94    Emiliania huxleyi CCMP1516
ref|XP_005771074.1|  hypothetical protein EMIHUDRAFT_75659              294   1e-93    Emiliania huxleyi CCMP1516
emb|CEP14638.1|  hypothetical protein                                   296   2e-93    Parasitella parasitica
gb|EFX84998.1|  hypothetical protein DAPPUDRAFT_300779                  297   2e-93    Daphnia pulex
ref|XP_006567771.1|  PREDICTED: nucleolar protein 58-like               298   2e-93    Apis mellifera [bee]
ref|XP_006618628.1|  PREDICTED: nucleolar protein 58-like               298   4e-93    Apis dorsata [rock honeybee]
ref|XP_012061459.1|  PREDICTED: nucleolar protein 58                    299   5e-93    Atta cephalotes
ref|XP_008618047.1|  hypothetical protein SDRG_13728                    294   2e-92    Saprolegnia diclina VS20
gb|KDO24106.1|  hypothetical protein SPRG_10894                         293   2e-92    Saprolegnia parasitica CBS 223.65
ref|XP_002874404.1|  hypothetical protein ARALYDRAFT_326985             291   8e-92    
ref|XP_007501981.1|  PREDICTED: nucleolar protein 58 isoform X4         293   8e-92    Monodelphis domestica
ref|XP_007501980.1|  PREDICTED: nucleolar protein 58 isoform X3         293   9e-92    Monodelphis domestica
ref|XP_007501979.1|  PREDICTED: nucleolar protein 58 isoform X2         293   9e-92    Monodelphis domestica
ref|XP_001371978.1|  PREDICTED: nucleolar protein 58 isoform X1         293   1e-91    Monodelphis domestica
gb|EIE91295.1|  hypothetical protein RO3G_16006                         291   1e-91    Rhizopus delemar RA 99-880
ref|XP_011064344.1|  PREDICTED: nucleolar protein 58-like               295   2e-91    Acromyrmex echinatior
ref|XP_003491528.1|  PREDICTED: nucleolar protein 58-like               293   6e-91    Bombus impatiens
gb|EPB89396.1|  hypothetical protein HMPREF1544_03765                   290   6e-91    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_001641027.1|  predicted protein                                  290   1e-90    Nematostella vectensis
dbj|GAN04212.1|  nop-domain-containing protein                          288   2e-90    Mucor ambiguus
ref|XP_001750802.1|  hypothetical protein                               287   7e-90    Monosiga brevicollis MX1
emb|CEI87149.1|  Putative U3 snoRNP protein Nop58                       283   7e-90    Rhizopus microsporus
ref|XP_011267939.1|  PREDICTED: nucleolar protein 58                    291   9e-90    Camponotus floridanus
ref|XP_005837542.1|  hypothetical protein GUITHDRAFT_66997              287   1e-89    Guillardia theta CCMP2712
ref|XP_009086324.1|  PREDICTED: nucleolar protein 58                    287   2e-89    Serinus canaria [canary]
ref|XP_003230376.2|  PREDICTED: nucleolar protein 58-like               287   2e-89    Anolis carolinensis [Carolina anole]
ref|XP_010563240.1|  PREDICTED: nucleolar protein 58 isoform X2         285   2e-89    Haliaeetus leucocephalus
gb|EMC81163.1|  Nucleolar protein 58                                    284   4e-89    
ref|XP_005519952.1|  PREDICTED: nucleolar protein 58                    286   4e-89    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005049217.1|  PREDICTED: nucleolar protein 58                    286   4e-89    Ficedula albicollis
ref|XP_010563232.1|  PREDICTED: nucleolar protein 58 isoform X1         286   4e-89    Haliaeetus leucocephalus
ref|XP_011575167.1|  PREDICTED: nucleolar protein 58                    286   4e-89    Aquila chrysaetos canadensis
ref|XP_007422082.1|  PREDICTED: nucleolar protein 58                    286   6e-89    Python bivittatus
emb|CCA22673.1|  nucleolar protein NOP5 putative                        285   6e-89    Albugo laibachii Nc14
ref|XP_011341650.1|  PREDICTED: nucleolar protein 58                    289   7e-89    Ooceraea biroi
emb|CEG70655.1|  Putative Nucleolar protein 58                          284   8e-89    Rhizopus microsporus
emb|CEI96131.1|  Putative Nucleolar protein 58                          284   9e-89    Rhizopus microsporus
ref|XP_421942.1|  PREDICTED: nucleolar protein 58                       285   1e-88    Gallus gallus [bantam]
ref|XP_010711773.1|  PREDICTED: nucleolar protein 58                    285   2e-88    Meleagris gallopavo [common turkey]
gb|ESA16249.1|  hypothetical protein GLOINDRAFT_158776                  281   2e-88    
ref|XP_006273562.1|  PREDICTED: nucleolar protein 58                    284   2e-88    Alligator mississippiensis
ref|XP_005144700.1|  PREDICTED: nucleolar protein 58                    284   2e-88    Melopsittacus undulatus
ref|XP_005306283.1|  PREDICTED: nucleolar protein 58 isoform X1         284   2e-88    Chrysemys picta bellii
ref|XP_011629518.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    287   3e-88    
ref|XP_005511378.1|  PREDICTED: nucleolar protein 58                    284   3e-88    
ref|XP_002189225.1|  PREDICTED: nucleolar protein 58                    284   3e-88    Taeniopygia guttata
ref|XP_006017720.1|  PREDICTED: nucleolar protein 58                    284   3e-88    Alligator sinensis
ref|XP_002903084.1|  nucleolar protein NOP5                             282   8e-88    Phytophthora infestans T30-4
ref|XP_004367446.1|  matrix attachment region binding protein           282   1e-87    Acanthamoeba castellanii str. Neff
ref|XP_003743589.1|  PREDICTED: nucleolar protein 58                    282   2e-87    Galendromus occidentalis
ref|XP_003966575.1|  PREDICTED: nucleolar protein 58                    281   2e-87    Takifugu rubripes [tiger puffer]
ref|XP_004378293.1|  PREDICTED: nucleolar protein 58                    281   4e-87    Trichechus manatus latirostris
ref|XP_008911207.1|  hypothetical protein PPTG_15671                    280   5e-87    Phytophthora parasitica INRA-310
ref|XP_008113176.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    277   5e-87    Anolis carolinensis [Carolina anole]
gb|ETL31667.1|  hypothetical protein L916_15560                         280   5e-87    Phytophthora parasitica
gb|ETI38018.1|  hypothetical protein F443_16119                         280   6e-87    Phytophthora parasitica P1569
ref|XP_003701979.1|  PREDICTED: nucleolar protein 58                    282   6e-87    Megachile rotundata
ref|XP_009836884.1|  hypothetical protein H257_11594                    280   9e-87    Aphanomyces astaci
ref|XP_007908792.1|  PREDICTED: nucleolar protein 58                    280   1e-86    Callorhinchus milii [Australian ghost shark]
gb|KDO50620.1|  hypothetical protein CISIN_1g0088522mg                  267   1e-86    Citrus sinensis [apfelsine]
ref|XP_009530825.1|  hypothetical protein PHYSODRAFT_246404             278   1e-86    Phytophthora sojae
ref|XP_008187145.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    278   1e-86    
ref|XP_006636806.1|  PREDICTED: nucleolar protein 58-like               279   2e-86    
ref|XP_008872332.1|  hypothetical protein H310_08394                    278   2e-86    Aphanomyces invadans
ref|XP_002407966.1|  ribosome biogenesis protein - Nop58p/Nop5p, ...    278   2e-86    Ixodes scapularis [blacklegged tick]
ref|XP_001601436.1|  PREDICTED: nucleolar protein 58                    280   3e-86    Nasonia vitripennis
gb|AAH44394.1|  Nop58 protein                                           278   3e-86    Danio rerio [leopard danio]
ref|XP_011154526.1|  PREDICTED: nucleolar protein 58                    282   4e-86    Harpegnathos saltator
ref|NP_001009889.1|  nucleolar protein 58                               278   4e-86    
gb|AAI55195.1|  Nop58 protein                                           279   5e-86    Danio rerio [leopard danio]
ref|XP_005165784.1|  PREDICTED: nucleolar protein 58 isoform X1         279   5e-86    
emb|CBJ32359.1|  conserved unknown protein                              279   6e-86    Ectocarpus siliculosus
gb|AAI51885.1|  Nop58 protein                                           278   6e-86    Danio rerio [leopard danio]
dbj|BAJ91724.1|  predicted protein                                      280   6e-86    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EXX52337.1|  Nop58p                                                  281   7e-86    Rhizophagus irregularis DAOM 197198w
ref|XP_007248939.1|  PREDICTED: nucleolar protein 58-like               278   9e-86    
ref|XP_011308274.1|  PREDICTED: nucleolar protein 58                    278   1e-85    Fopius arisanus
ref|XP_003907873.1|  PREDICTED: nucleolar protein 58 isoform X1         274   1e-85    
ref|XP_011696387.1|  PREDICTED: nucleolar protein 58                    281   1e-85    Wasmannia auropunctata
ref|XP_008323109.1|  PREDICTED: nucleolar protein 58                    278   1e-85    
ref|XP_005574023.1|  PREDICTED: nucleolar protein 58 isoform X4         273   2e-85    
ref|XP_007190607.1|  PREDICTED: nucleolar protein 58 isoform X6         273   3e-85    Balaenoptera acutorostrata scammoni
emb|CAH91951.1|  hypothetical protein                                   274   6e-85    Pongo abelii [orang utan]
ref|XP_010141276.1|  PREDICTED: nucleolar protein 58                    275   6e-85    Buceros rhinoceros silvestris
ref|XP_002946402.1|  hypothetical protein VOLCADRAFT_102990             275   7e-85    Volvox carteri f. nagariensis
ref|XP_005574021.1|  PREDICTED: nucleolar protein 58 isoform X2         273   8e-85    Macaca fascicularis [crab eating macaque]
ref|XP_011879643.1|  PREDICTED: nucleolar protein 58                    279   8e-85    Vollenhovia emeryi
gb|KFH64217.1|  hypothetical protein MVEG_10042                         274   1e-84    Mortierella verticillata NRRL 6337
ref|XP_008556600.1|  PREDICTED: nucleolar protein 58                    276   1e-84    
ref|XP_006921426.1|  PREDICTED: nucleolar protein 58 isoform X1         274   2e-84    Pteropus alecto
ref|XP_006153110.1|  PREDICTED: nucleolar protein 58-like isoform X1    274   2e-84    Tupaia chinensis
ref|XP_007520557.1|  PREDICTED: nucleolar protein 58                    274   2e-84    Erinaceus europaeus [common hedgehog]
gb|AAH09306.1|  NOP58 protein                                           274   2e-84    Homo sapiens [man]
ref|XP_009236281.1|  PREDICTED: nucleolar protein 58                    273   2e-84    
ref|XP_005858298.1|  PREDICTED: nucleolar protein 58 isoform X2         274   2e-84    
ref|XP_006756294.1|  PREDICTED: nucleolar protein 58 isoform X1         274   2e-84    Myotis davidii
ref|XP_003483763.1|  PREDICTED: nucleolar protein 58                    274   2e-84    
ref|XP_011484149.1|  PREDICTED: nucleolar protein 58                    270   2e-84    
ref|XP_005858297.1|  PREDICTED: nucleolar protein 58 isoform X1         274   2e-84    Myotis brandtii
emb|CBK23082.2|  unnamed protein product                                274   2e-84    Blastocystis hominis
ref|XP_008144676.1|  PREDICTED: nucleolar protein 58                    274   3e-84    Eptesicus fuscus
emb|CCI10534.1|  unnamed protein product                                273   3e-84    Albugo candida
ref|XP_004393512.1|  PREDICTED: nucleolar protein 58 isoform 2          273   3e-84    Odobenus rosmarus divergens
ref|XP_003785079.1|  PREDICTED: nucleolar protein 58                    273   3e-84    Otolemur garnettii
ref|XP_003820813.1|  PREDICTED: nucleolar protein 58 isoform X1         273   3e-84    Pan paniscus [bonobo]
ref|XP_516036.2|  PREDICTED: nucleolar protein 58 isoform X1            273   3e-84    Pan troglodytes
ref|NP_057018.1|  nucleolar protein 58                                  273   3e-84    Homo sapiens [man]
ref|NP_001248115.1|  nucleolar protein 58                               273   3e-84    Macaca mulatta [rhesus macaque]
ref|XP_007964075.1|  PREDICTED: nucleolar protein 58 isoform X1         273   3e-84    Chlorocebus sabaeus
ref|XP_011902951.1|  PREDICTED: nucleolar protein 58 isoform X1         273   3e-84    Cercocebus atys
ref|XP_003254003.1|  PREDICTED: nucleolar protein 58                    273   3e-84    
ref|XP_008063382.1|  PREDICTED: nucleolar protein 58                    273   3e-84    
ref|XP_004393511.1|  PREDICTED: nucleolar protein 58 isoform 1          273   3e-84    
ref|XP_002712586.1|  PREDICTED: nucleolar protein 58 isoform X1         273   3e-84    
ref|XP_011223162.1|  PREDICTED: nucleolar protein 58 isoform X1         273   3e-84    
ref|XP_004904636.1|  PREDICTED: nucleolar protein 58                    273   3e-84    
ref|XP_005640603.1|  PREDICTED: nucleolar protein 58 isoform X1         273   4e-84    
ref|XP_005640604.1|  PREDICTED: nucleolar protein 58 isoform X2         273   4e-84    
ref|XP_006734634.1|  PREDICTED: nucleolar protein 58 isoform X1         273   4e-84    
ref|XP_004601337.1|  PREDICTED: nucleolar protein 58                    273   4e-84    
ref|XP_008833672.1|  PREDICTED: nucleolar protein 58 isoform X1         273   4e-84    
ref|XP_008685594.1|  PREDICTED: nucleolar protein 58 isoform X1         273   4e-84    
ref|XP_006734635.1|  PREDICTED: nucleolar protein 58 isoform X2         273   4e-84    
ref|XP_004764235.1|  PREDICTED: nucleolar protein 58 isoform X2         273   4e-84    
ref|XP_006935540.1|  PREDICTED: nucleolar protein 58 isoform X1         273   4e-84    
ref|XP_004701594.1|  PREDICTED: nucleolar protein 58                    273   4e-84    
ref|XP_004764234.1|  PREDICTED: nucleolar protein 58 isoform X1         273   4e-84    
ref|XP_003406179.1|  PREDICTED: nucleolar protein 58 isoform X1         273   4e-84    
ref|XP_007090043.1|  PREDICTED: nucleolar protein 58 isoform X1         273   4e-84    
ref|XP_004426861.1|  PREDICTED: nucleolar protein 58                    273   4e-84    
ref|XP_005397115.1|  PREDICTED: nucleolar protein 58                    273   5e-84    
ref|XP_010614435.1|  PREDICTED: nucleolar protein 58 isoform X1         273   5e-84    
ref|XP_004262889.1|  PREDICTED: nucleolar protein 58 isoform 2          273   6e-84    
ref|XP_007469243.1|  PREDICTED: nucleolar protein 58 isoform X2         273   6e-84    
ref|XP_007190602.1|  PREDICTED: nucleolar protein 58 isoform X1         273   6e-84    
ref|XP_002749695.1|  PREDICTED: nucleolar protein 58 isoform X1         273   7e-84    
ref|XP_004262888.1|  PREDICTED: nucleolar protein 58 isoform 1          273   7e-84    
ref|XP_007469242.1|  PREDICTED: nucleolar protein 58 isoform X1         273   7e-84    
ref|XP_005980259.1|  PREDICTED: nucleolar protein 58 isoform X3         272   8e-84    
ref|XP_011552337.1|  PREDICTED: nucleolar protein 58                    272   8e-84    
ref|XP_006189991.1|  PREDICTED: nucleolar protein 58 isoform X1         272   8e-84    
gb|AAH87637.1|  Nol5 protein                                            270   8e-84    
ref|XP_006205257.1|  PREDICTED: nucleolar protein 58 isoform X2         272   9e-84    
ref|XP_006205258.1|  PREDICTED: nucleolar protein 58 isoform X3         272   9e-84    
ref|XP_006189993.1|  PREDICTED: nucleolar protein 58 isoform X3         272   9e-84    
ref|XP_006189992.1|  PREDICTED: nucleolar protein 58 isoform X2         272   9e-84    
ref|XP_005676439.1|  PREDICTED: nucleolar protein 58 isoform X2         272   9e-84    
ref|XP_006862038.1|  PREDICTED: nucleolar protein 58                    272   9e-84    
ref|XP_004524214.1|  PREDICTED: nucleolar protein 58-like               271   9e-84    
ref|XP_006205256.1|  PREDICTED: nucleolar protein 58 isoform X1         272   1e-83    
gb|AAI51726.1|  NOP58 protein                                           272   1e-83    
ref|NP_001179886.1|  nucleolar protein 58                               272   1e-83    
ref|XP_005676438.1|  PREDICTED: nucleolar protein 58 isoform X1         272   1e-83    
ref|XP_005904317.1|  PREDICTED: nucleolar protein 58                    272   1e-83    
ref|XP_005980258.1|  PREDICTED: nucleolar protein 58 isoform X2         272   1e-83    
dbj|BAE21954.1|  unnamed protein product                                270   1e-83    
ref|XP_005202669.1|  PREDICTED: nucleolar protein 58 isoform X1         272   1e-83    
emb|CAB55989.2|  hypothetical protein                                   269   1e-83    
ref|XP_007117841.1|  PREDICTED: nucleolar protein 58 isoform X1         272   1e-83    
gb|KHN70664.1|  Nucleolar protein 58                                    273   2e-83    
ref|XP_004458928.1|  PREDICTED: nucleolar protein 58 isoform 1          271   2e-83    
gb|AAC23535.1|  unknown                                                 270   2e-83    
ref|XP_005980257.1|  PREDICTED: nucleolar protein 58 isoform X1         272   2e-83    
ref|XP_005338975.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    271   2e-83    
ref|XP_005097537.1|  PREDICTED: nucleolar protein 58-like               271   3e-83    
ref|XP_006975091.1|  PREDICTED: nucleolar protein 58 isoform X1         271   3e-83    
dbj|BAE22082.1|  unnamed protein product                                270   4e-83    
ref|XP_005808115.1|  PREDICTED: nucleolar protein 58-like               270   5e-83    
gb|EWM24974.1|  nucleolar protein expressed                             270   6e-83    
gb|KFP49456.1|  Nucleolar protein 58                                    265   6e-83    
dbj|BAC31822.1|  unnamed protein product                                270   6e-83    
ref|NP_061356.2|  nucleolar protein 58                                  270   7e-83    
ref|XP_006889153.1|  PREDICTED: nucleolar protein 58                    270   7e-83    
ref|XP_005366385.1|  PREDICTED: nucleolar protein 58 isoform X2         270   8e-83    
ref|NP_068522.1|  nucleolar protein 58                                  270   8e-83    
ref|XP_008423022.1|  PREDICTED: nucleolar protein 58                    270   9e-83    
ref|XP_005366384.1|  PREDICTED: nucleolar protein 58 isoform X1         270   1e-82    
gb|KFB40543.1|  AGAP002171-PA-like protein                              270   1e-82    
ref|XP_002052488.1|  GJ17567                                            269   2e-82    
ref|XP_006082477.1|  PREDICTED: nucleolar protein 58                    269   2e-82    
ref|XP_003497458.1|  PREDICTED: nucleolar protein 58 isoform X1         269   3e-82    
gb|ERE81087.1|  nucleolar protein 58                                    269   3e-82    
gb|KFV47252.1|  Nucleolar protein 58                                    265   3e-82    
gb|EIE85756.1|  hypothetical protein RO3G_10466                         266   4e-82    
ref|XP_009962135.1|  PREDICTED: nucleolar protein 58                    265   5e-82    
ref|XP_007565433.1|  PREDICTED: nucleolar protein 58 isoform X2         268   5e-82    
ref|XP_004929127.1|  PREDICTED: nucleolar protein 58-like isoform X3    267   8e-82    
ref|XP_001864867.1|  nucleolar protein NOP5                             268   8e-82    
ref|XP_011171488.1|  PREDICTED: nucleolar protein 58                    270   8e-82    
ref|XP_005070655.1|  PREDICTED: nucleolar protein 58 isoform X2         267   9e-82    
gb|EGW06124.1|  Nucleolar protein 58                                    257   9e-82    
ref|XP_005070654.1|  PREDICTED: nucleolar protein 58 isoform X1         267   1e-81    
ref|XP_004929126.1|  PREDICTED: nucleolar protein 58-like isoform X2    267   1e-81    
ref|XP_004929125.1|  PREDICTED: nucleolar protein 58-like isoform X1    267   1e-81    
ref|XP_308017.5|  AGAP002171-PA                                         266   2e-81    
ref|XP_004570504.1|  PREDICTED: nucleolar protein 58-like isoform X2    266   2e-81    
ref|XP_781458.2|  PREDICTED: nucleolar protein 58                       266   2e-81    
ref|XP_005943429.1|  PREDICTED: nucleolar protein 58-like isoform X2    266   2e-81    
ref|XP_005943428.1|  PREDICTED: nucleolar protein 58-like isoform X1    266   2e-81    
ref|XP_004570503.1|  PREDICTED: nucleolar protein 58-like isoform X1    266   2e-81    
ref|NP_001133496.1|  Nucleolar protein 5                                266   2e-81    
sp|O04656.2|NOP5C_ARATH  RecName: Full=Putative nucleolar protein...    264   2e-81    
gb|KDR23571.1|  Nucleolar protein 58                                    267   3e-81    
ref|XP_011432893.1|  PREDICTED: nucleolar protein 58-like               265   3e-81    
ref|XP_973420.1|  PREDICTED: nucleolar protein 58                       266   3e-81    
gb|KFV52995.1|  Nucleolar protein 58                                    262   3e-81    
ref|XP_006809619.1|  PREDICTED: nucleolar protein 58-like               266   3e-81    
gb|KFO12035.1|  Nucleolar protein 58                                    265   4e-81    
ref|XP_007071996.1|  PREDICTED: nucleolar protein 58                    266   5e-81    
gb|KFV18563.1|  Nucleolar protein 58                                    265   6e-81    
ref|XP_010738555.1|  PREDICTED: nucleolar protein 58                    265   6e-81    
ref|XP_008283621.1|  PREDICTED: nucleolar protein 58 isoform X2         265   6e-81    
ref|XP_008283620.1|  PREDICTED: nucleolar protein 58 isoform X1         265   6e-81    
gb|KFR14872.1|  Nucleolar protein 58                                    263   7e-81    
gb|KGL97403.1|  Nucleolar protein 58                                    264   7e-81    
gb|EMD41003.1|  hypothetical protein CERSUDRAFT_71225                   262   8e-81    
ref|XP_005465917.1|  PREDICTED: nucleolar protein 58                    265   8e-81    
gb|KFQ00730.1|  Nucleolar protein 58                                    264   1e-80    
ref|XP_009985382.1|  PREDICTED: nucleolar protein 58                    265   1e-80    
ref|XP_010885076.1|  PREDICTED: nucleolar protein 58                    264   1e-80    
ref|XP_005484291.1|  PREDICTED: nucleolar protein 58                    265   1e-80    
ref|XP_004350742.1|  MAR-binding protein                                266   1e-80    
ref|XP_003766066.1|  PREDICTED: nucleolar protein 58                    266   1e-80    
ref|XP_001752003.1|  predicted protein                                  256   2e-80    
gb|KFQ17268.1|  Nucleolar protein 58                                    263   2e-80    
gb|ETN58428.1|  nucleolar protein NOP5                                  264   2e-80    
gb|ENN72260.1|  hypothetical protein YQE_11121                          263   3e-80    
gb|KFP42804.1|  Nucleolar protein 58                                    263   3e-80    
gb|KFV10796.1|  Nucleolar protein 58                                    263   3e-80    
gb|KFQ12269.1|  Nucleolar protein 58                                    263   3e-80    
gb|KFQ45269.1|  Nucleolar protein 58                                    263   3e-80    
gb|KFO75339.1|  Nucleolar protein 58                                    263   3e-80    
ref|XP_002088107.1|  GE18393                                            262   4e-80    
gb|KFP26270.1|  Nucleolar protein 58                                    263   4e-80    
ref|XP_005416180.1|  PREDICTED: nucleolar protein 58                    263   4e-80    
gb|KFZ49164.1|  Nucleolar protein 58                                    263   5e-80    
ref|XP_007364391.1|  Nop-domain-containing protein                      263   5e-80    
gb|KFQ94812.1|  Nucleolar protein 58                                    262   5e-80    
gb|EJW86153.1|  hypothetical protein WUBG_02934                         261   5e-80    
gb|ERE81088.1|  nucleolar protein 58                                    263   6e-80    
gb|EPT03090.1|  hypothetical protein FOMPIDRAFT_1159146                 263   7e-80    
ref|XP_002737742.1|  PREDICTED: nucleolar protein 58-like               263   7e-80    
gb|KFP88851.1|  Nucleolar protein 58                                    262   7e-80    
gb|ETE66100.1|  Nucleolar protein 58                                    262   7e-80    
ref|XP_010076307.1|  PREDICTED: nucleolar protein 58                    262   7e-80    
ref|XP_005237133.1|  PREDICTED: nucleolar protein 58                    263   8e-80    
gb|KFQ40527.1|  Nucleolar protein 58                                    261   9e-80    
gb|KFV64288.1|  Nucleolar protein 58                                    261   9e-80    
gb|KFO59877.1|  Nucleolar protein 58                                    261   1e-79    
gb|KFM11174.1|  Nucleolar protein 58                                    261   1e-79    
gb|KFW02653.1|  Nucleolar protein 58                                    261   1e-79    
gb|KFQ74083.1|  Nucleolar protein 58                                    261   1e-79    
gb|KFW61788.1|  Nucleolar protein 58                                    261   1e-79    
gb|KFW89632.1|  Nucleolar protein 58                                    261   1e-79    
ref|XP_009938133.1|  PREDICTED: nucleolar protein 58                    261   1e-79    
ref|XP_010120485.1|  PREDICTED: nucleolar protein 58                    261   1e-79    
ref|XP_009912989.1|  PREDICTED: nucleolar protein 58                    261   1e-79    
gb|EOB03329.1|  Nucleolar protein 5                                     259   1e-79    
gb|KFU84958.1|  Nucleolar protein 58                                    261   1e-79    
ref|XP_010202697.1|  PREDICTED: nucleolar protein 58                    261   1e-79    
ref|XP_005016922.1|  PREDICTED: nucleolar protein 58 isoform X2         261   1e-79    
gb|KFP19825.1|  Nucleolar protein 58                                    261   1e-79    
ref|XP_008947581.1|  PREDICTED: nucleolar protein 58                    263   1e-79    
ref|XP_005016921.1|  PREDICTED: nucleolar protein 58 isoform X1         261   1e-79    
ref|XP_005434610.1|  PREDICTED: nucleolar protein 58                    263   1e-79    
emb|CCL99180.1|  predicted protein                                      262   2e-79    
ref|XP_008633036.1|  PREDICTED: nucleolar protein 58                    261   2e-79    
dbj|GAM26411.1|  hypothetical protein SAMD00019534_095860               264   2e-79    
ref|XP_003696631.1|  PREDICTED: nucleolar protein 58-like               267   2e-79    
gb|KFZ53794.1|  Nucleolar protein 58                                    260   2e-79    
gb|KFP67783.1|  Nucleolar protein 58                                    260   2e-79    
ref|XP_009331224.1|  PREDICTED: nucleolar protein 58                    261   2e-79    
ref|XP_008035630.1|  Nop-domain-containing protein                      261   3e-79    
gb|KFP02491.1|  Nucleolar protein 58                                    258   3e-79    
ref|XP_002116484.1|  hypothetical protein TRIADDRAFT_30778              259   3e-79    
ref|XP_010784446.1|  PREDICTED: nucleolar protein 58 isoform X2         260   3e-79    
ref|XP_010405578.1|  PREDICTED: nucleolar protein 58                    261   3e-79    
ref|XP_010784445.1|  PREDICTED: nucleolar protein 58 isoform X1         260   3e-79    
ref|XP_010150930.1|  PREDICTED: nucleolar protein 58                    259   4e-79    
ref|NP_198066.1|  NOP56-like pre RNA processing ribonucleoprotein       258   4e-79    
gb|KFQ66314.1|  Nucleolar protein 58                                    259   5e-79    
dbj|BAN20575.1|  hypothetical protein                                   260   5e-79    
ref|XP_009894776.1|  PREDICTED: nucleolar protein 58                    259   5e-79    
ref|XP_003384738.1|  PREDICTED: nucleolar protein 58-like               259   5e-79    
gb|AAY34140.1|  Nop58p                                                  255   5e-79    
ref|XP_011495780.1|  PREDICTED: nucleolar protein 58                    261   5e-79    
ref|XP_009704053.1|  PREDICTED: nucleolar protein 58                    259   5e-79    
ref|XP_002430815.1|  Nucleolar protein NOP5, putative                   261   6e-79    
ref|XP_009558103.1|  PREDICTED: nucleolar protein 58                    259   6e-79    
ref|XP_009489427.1|  PREDICTED: nucleolar protein 58                    259   6e-79    
ref|XP_009867823.1|  PREDICTED: nucleolar protein 58                    259   7e-79    
ref|XP_010161415.1|  PREDICTED: nucleolar protein 58                    259   7e-79    
gb|EFA85918.1|  MAR-binding protein                                     262   7e-79    
ref|XP_009888542.1|  PREDICTED: nucleolar protein 58                    260   9e-79    
ref|XP_010005686.1|  PREDICTED: nucleolar protein 58                    261   9e-79    
gb|EHJ76702.1|  hypothetical protein KGM_05763                          259   9e-79    
gb|KFQ83091.1|  Nucleolar protein 58                                    259   1e-78    
ref|XP_009460634.1|  PREDICTED: nucleolar protein 58                    261   1e-78    
ref|XP_007381782.1|  Nop-domain-containing protein                      260   1e-78    
ref|XP_007862590.1|  Nop domain-containing protein                      259   2e-78    
ref|XP_009809548.1|  PREDICTED: nucleolar protein 58                    255   2e-78    
gb|KDQ65010.1|  hypothetical protein JAAARDRAFT_167849                  259   2e-78    
ref|XP_007565432.1|  PREDICTED: nucleolar protein 58 isoform X1         259   2e-78    
ref|XP_009641816.1|  PREDICTED: nucleolar protein 58                    259   2e-78    
ref|XP_006130811.1|  PREDICTED: nucleolar protein 58                    258   2e-78    
gb|KFP74755.1|  Nucleolar protein 58                                    258   2e-78    
ref|XP_009544187.1|  hypothetical protein HETIRDRAFT_416211             258   4e-78    
gb|EGU11242.1|  Nucleolar protein 58                                    258   5e-78    
ref|XP_009282980.1|  PREDICTED: nucleolar protein 58                    260   5e-78    
gb|EMS19643.1|  nucleolar protein NOP58                                 258   5e-78    
ref|XP_009067494.1|  PREDICTED: nucleolar protein 58                    257   6e-78    
gb|KGL80295.1|  Nucleolar protein 58                                    256   9e-78    
ref|XP_004990291.1|  nucleolar protein 5                                256   1e-77    
gb|KFV86118.1|  Nucleolar protein 58                                    256   1e-77    
emb|CCA71243.1|  probable NOP58-required for pre-18S rRNA processing    258   1e-77    
ref|XP_007327844.1|  hypothetical protein AGABI1DRAFT_112235            257   1e-77    
ref|XP_009019750.1|  hypothetical protein HELRODRAFT_94516              261   1e-77    
ref|XP_010217344.1|  PREDICTED: nucleolar protein 58                    257   1e-77    
ref|XP_009267103.1|  Nucleolar protein 58                               256   1e-77    
ref|XP_006459734.1|  hypothetical protein AGABI2DRAFT_191593            257   1e-77    
ref|XP_009682520.1|  PREDICTED: nucleolar protein 58                    256   2e-77    
ref|XP_008494188.1|  PREDICTED: nucleolar protein 58                    258   2e-77    
ref|XP_007303110.1|  Nop domain-containing protein                      256   2e-77    
ref|XP_011190691.1|  PREDICTED: nucleolar protein 58                    254   3e-77    
ref|XP_003286800.1|  hypothetical protein DICPUDRAFT_31443              255   5e-77    
ref|XP_011213731.1|  PREDICTED: nucleolar protein 58                    254   8e-77    
gb|EPQ02705.1|  Nucleolar protein 58                                    255   8e-77    
ref|XP_005185902.1|  PREDICTED: nucleolar protein 58                    254   1e-76    
ref|XP_001970090.1|  GG23571                                            253   2e-76    
ref|XP_002172012.1|  U3 snoRNP protein Nop58                            252   2e-76    
gb|KDQ20622.1|  hypothetical protein BOTBODRAFT_124315                  254   3e-76    



>dbj|BAB41076.1| MAR-binding protein [Nicotiana tabacum]
Length=555

 Score =   441 bits (1133),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 211/225 (94%), Positives = 218/225 (97%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFST D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTTDSARKVVKLKAFSKFENTSEALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFL++HCDG+TL VADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLGVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELITGLG QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR
Sbjct  121  LTELITGLGSQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YAK VKLMGDR NAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKAVKLMGDRVNAAKLDFSEILP  225



>ref|XP_009769588.1| PREDICTED: probable nucleolar protein 5-2 [Nicotiana sylvestris]
Length=559

 Score =   440 bits (1131),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 210/225 (93%), Positives = 218/225 (97%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFS+ D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSSTDSARKVVKLKAFSKFENTSEALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFL++HCDG+TL VADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLGVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELITGLG QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR
Sbjct  121  LTELITGLGSQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YAK VKLMGDR NAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKAVKLMGDRVNAAKLDFSEILP  225



>ref|XP_009591833.1| PREDICTED: probable nucleolar protein 5-2 [Nicotiana tomentosiformis]
Length=559

 Score =   439 bits (1130),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 210/225 (93%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFST D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTTDSARKVVKLKAFSKFENTSEALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFL++HCDG+TL VADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLGVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELITGLG QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGSQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YAK VKLMGDR NAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKAVKLMGDRVNAAKLDFSEILP  225



>ref|XP_006362168.1| PREDICTED: probable nucleolar protein 5-2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006362169.1| PREDICTED: probable nucleolar protein 5-2-like isoform X2 [Solanum 
tuberosum]
Length=548

 Score =   437 bits (1123),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 208/225 (92%), Positives = 218/225 (97%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+FS+ D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFSSTDSARKVVKLKAFSKFENTSEALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFL++HCDG+TLAVADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLAVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLASQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YAK VKLMGDRTNAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKAVKLMGDRTNAAKLDFSEILP  225



>ref|XP_004247627.1| PREDICTED: probable nucleolar protein 5-2 [Solanum lycopersicum]
Length=547

 Score =   437 bits (1123),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 208/225 (92%), Positives = 218/225 (97%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+FS+ D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFSSTDSARKVVKLKAFSKFENTSEALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFL++HCDG+TL VADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLGVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR
Sbjct  121  LTELISGLASQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YAK VKLMGDRTNAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKAVKLMGDRTNAAKLDFSEILP  225



>emb|CBI34244.3| unnamed protein product [Vitis vinifera]
Length=474

 Score =   432 bits (1112),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 205/225 (91%), Positives = 219/225 (97%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFS++++AR+VVKLKAFSKFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSSSESARQVVKLKAFSKFENTTEALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFLR HCDG+TLAVADSKLGNAIKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRVHCDGETLAVADSKLGNAIKEKLQIECVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YAK VKLMG+RTNAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKAVKLMGNRTNAAKLDFSEILP  225



>emb|CAN73717.1| hypothetical protein VITISV_038844 [Vitis vinifera]
Length=472

 Score =   432 bits (1112),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 205/225 (91%), Positives = 219/225 (97%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFST+++AR+VVKLKAFSKFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTSESARQVVKLKAFSKFENTTEALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFLR HCDG+TLAVADSKLGNAIKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRVHCDGETLAVADSKLGNAIKEKLQIECVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI Y+K VKLMG+RTNAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIVQDNILYSKAVKLMGNRTNAAKLDFSEILP  225



>ref|XP_002273273.2| PREDICTED: probable nucleolar protein 5-2 [Vitis vinifera]
 ref|XP_010659961.1| PREDICTED: probable nucleolar protein 5-2 [Vitis vinifera]
Length=573

 Score =   433 bits (1113),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 205/225 (91%), Positives = 219/225 (97%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFS++++AR+VVKLKAFSKFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSSSESARQVVKLKAFSKFENTTEALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFLR HCDG+TLAVADSKLGNAIKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRVHCDGETLAVADSKLGNAIKEKLQIECVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YAK VKLMG+RTNAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKAVKLMGNRTNAAKLDFSEILP  225



>emb|CDP04715.1| unnamed protein product [Coffea canephora]
Length=422

 Score =   427 bits (1099),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 201/225 (89%), Positives = 216/225 (96%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML LFETPAGFALFKVLDEGKLSKVEDLWKEFSTAD+ARK+VKLKAFSKF+NTSEALSAA
Sbjct  1    MLALFETPAGFALFKVLDEGKLSKVEDLWKEFSTADSARKIVKLKAFSKFDNTSEALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFLR+HC+G+ LAVADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRAHCEGEALAVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            L+ELI+GL  QDL+PMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDD+DKELNTYAMR
Sbjct  121  LSELISGLAAQDLSPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDIDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YAK  KLMGDR+NAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKAAKLMGDRSNAAKLDFSEILP  225



>ref|XP_004239682.1| PREDICTED: probable nucleolar protein 5-2 [Solanum lycopersicum]
 ref|XP_010321330.1| PREDICTED: probable nucleolar protein 5-2 [Solanum lycopersicum]
Length=513

 Score =   430 bits (1106),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 205/225 (91%), Positives = 216/225 (96%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDL KEF+T+D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLSKEFTTSDSARKVVKLKAFSKFENTSEALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFL++HCDG+TL +ADSKLGNAIKEKLQI+CVHN+ VMELMRGLR+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLGIADSKLGNAIKEKLQIECVHNNVVMELMRGLRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YAK VKLMGDR NAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKAVKLMGDRVNAAKLDFSEILP  225



>ref|XP_010243588.1| PREDICTED: probable nucleolar protein 5-1 [Nelumbo nucifera]
Length=577

 Score =   432 bits (1111),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 204/225 (91%), Positives = 218/225 (97%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFST+++ARK+VKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTSESARKMVKLKAFSKFENTSEALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSK LRKFLR+HCDG+TLAVADSK GNAIKEKL+I+CVHN+TVMELMRG+R+Q
Sbjct  61   TLLIDSKPSKALRKFLRAHCDGETLAVADSKFGNAIKEKLKIECVHNNTVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YAK VKLMG R+NAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIVQDNIHYAKAVKLMGSRSNAAKLDFSEILP  225



>ref|XP_010097360.1| hypothetical protein L484_010238 [Morus notabilis]
 gb|EXB67670.1| hypothetical protein L484_010238 [Morus notabilis]
Length=514

 Score =   429 bits (1103),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 204/225 (91%), Positives = 216/225 (96%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETPAGFALFKVLDEGKLSKVEDLW+EFSTAD+AR+VVKLKAFSKFENTSEAL A 
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVEDLWREFSTADSARQVVKLKAFSKFENTSEALEAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFLR+HCDG+TLAVADSKLGN IKEKLQ++CVHN+ VMELMRG+RNQ
Sbjct  61   TLLIDSKPSKGLRKFLRAHCDGETLAVADSKLGNIIKEKLQVECVHNNAVMELMRGVRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YAKTVKLMGDR NAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKTVKLMGDRVNAAKLDFSEILP  225



>ref|XP_006345813.1| PREDICTED: probable nucleolar protein 5-2-like [Solanum tuberosum]
Length=541

 Score =   427 bits (1097),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 205/224 (92%), Positives = 215/224 (96%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDL KEF+T+D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLSKEFTTSDSARKVVKLKAFSKFENTSEALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFL++HCDG+TL VADSKLGNAIKEKLQI+CVHN+ VMELMRGLR+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLGVADSKLGNAIKEKLQIECVHNNVVMELMRGLRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKIVQDNI YAK VKLMGDR NAAKLDFSEIL
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKAVKLMGDRVNAAKLDFSEIL  224



>ref|XP_009382561.1| PREDICTED: probable nucleolar protein 5-2 [Musa acuminata subsp. 
malaccensis]
Length=585

 Score =   427 bits (1099),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 200/224 (89%), Positives = 217/224 (97%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFK+LDEGKL KVEDLWKEF+T+++ARK+VKLKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKILDEGKLDKVEDLWKEFATSESARKIVKLKAFNKFENTSDALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFLR+HCDG+TLAVADSKLGNAIKEKL+IDC+HN+ VMELMRGLRNQ
Sbjct  61   TLLIDSKPSKGLRKFLRTHCDGETLAVADSKLGNAIKEKLKIDCLHNNAVMELMRGLRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKIVQDNIQYAK VKLMG+RTNA  LDFSE+L
Sbjct  181  VREWYGWHFPELAKIVQDNIQYAKVVKLMGNRTNAVNLDFSEVL  224



>ref|XP_010241493.1| PREDICTED: probable nucleolar protein 5-2 isoform X2 [Nelumbo 
nucifera]
Length=580

 Score =   427 bits (1098),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 202/225 (90%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETPAGFALFKVLDEGKLSKVEDLWKEFST+++ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVEDLWKEFSTSESARKVVKLKAFSKFENTSEALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSK LRKFLR+HCDG+TLAVADSK GNAIKEKL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKALRKFLRAHCDGETLAVADSKFGNAIKEKLKIECVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YAK VKLMG+R+NA KLDFSEILP
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKAVKLMGNRSNAGKLDFSEILP  225



>ref|XP_010904781.1| PREDICTED: probable nucleolar protein 5-2 [Elaeis guineensis]
Length=588

 Score =   426 bits (1095),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 200/224 (89%), Positives = 215/224 (96%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEF+T+++AR+VVKLKAFSKFENT++ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFATSESARQVVKLKAFSKFENTTDALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLID KPSKGLRKFLR+HCDG+TLAVADSKLGNAIKEKL+IDC+HN+ VMELMRGLRNQ
Sbjct  61   TLLIDGKPSKGLRKFLRAHCDGETLAVADSKLGNAIKEKLKIDCLHNNAVMELMRGLRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL KI+QDNIQYAK VKLMG R NAA LDFSEIL
Sbjct  181  VREWYGWHFPELGKIIQDNIQYAKAVKLMGSRVNAANLDFSEIL  224



>ref|XP_011099778.1| PREDICTED: probable nucleolar protein 5-2 [Sesamum indicum]
 ref|XP_011099779.1| PREDICTED: probable nucleolar protein 5-2 [Sesamum indicum]
 ref|XP_011099780.1| PREDICTED: probable nucleolar protein 5-2 [Sesamum indicum]
Length=585

 Score =   425 bits (1092),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 203/224 (91%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETPAGFALFKVLDEGKLSKVEDL KEF+T D+AR+VVKLKAFSKFENTSEALSAA
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVEDLGKEFATPDSARQVVKLKAFSKFENTSEALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFLRSHC+GD LAVADSKLGN IKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRSHCEGDILAVADSKLGNTIKEKLQIECVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELNTYAMR
Sbjct  121  LTELISGLASQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKI+QDNI YAKTVKLMG+RTNAAKLDFSEIL
Sbjct  181  VREWYGWHFPELAKIIQDNILYAKTVKLMGNRTNAAKLDFSEIL  224



>ref|XP_008799299.1| PREDICTED: probable nucleolar protein 5-2 [Phoenix dactylifera]
 ref|XP_008799300.1| PREDICTED: probable nucleolar protein 5-2 [Phoenix dactylifera]
Length=497

 Score =   421 bits (1083),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 199/224 (89%), Positives = 215/224 (96%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEF+T+++AR+VVKLKAFSKFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFATSESARQVVKLKAFSKFENTAEALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLID KPSKGLRKFLR+HCDG+TLAVADSKLGNAIKEKL+IDC+H++ VMELMRGLR+Q
Sbjct  61   TLLIDGKPSKGLRKFLRAHCDGETLAVADSKLGNAIKEKLKIDCLHSNAVMELMRGLRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKI+QDNIQYAK VKLMG R NA  LDFSEIL
Sbjct  181  VREWYGWHFPELAKIIQDNIQYAKAVKLMGCRANAVNLDFSEIL  224



>tpg|DAA45361.1| TPA: hypothetical protein ZEAMMB73_906298 [Zea mays]
Length=450

 Score =   419 bits (1078),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 197/224 (88%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TL+IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL KIV DNIQYAK VK+MG+RTNA  LDFSEIL
Sbjct  181  VREWYGWHFPELTKIVTDNIQYAKVVKMMGNRTNAVNLDFSEIL  224



>ref|XP_011099781.1| PREDICTED: probable nucleolar protein 5-2 [Sesamum indicum]
Length=583

 Score =   424 bits (1090),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 202/224 (90%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETPAGFALFKVLDEGKLSKVEDL KEF++ D+AR+VVKLKAFSKFENTSEALSAA
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVEDLGKEFASPDSARQVVKLKAFSKFENTSEALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFLRSHC+GD LAVADSKLGN IKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRSHCEGDILAVADSKLGNTIKEKLQIECVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELNTYAMR
Sbjct  121  LTELISGLASQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKI+QDNI YAKTVKLMG+RTNAAKLDFSEIL
Sbjct  181  VREWYGWHFPELAKIIQDNILYAKTVKLMGNRTNAAKLDFSEIL  224



>ref|XP_009411704.1| PREDICTED: probable nucleolar protein 5-1 [Musa acuminata subsp. 
malaccensis]
Length=588

 Score =   424 bits (1089),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 198/224 (88%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAG ALFKVLDEGKL KVEDLWKEF+T+++AR++VKLKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGLALFKVLDEGKLDKVEDLWKEFATSESARQIVKLKAFNKFENTSDALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFLR+HCDG+TLAVADSKLGNAIKEKL+IDC+HN+ VMELMRGLRNQ
Sbjct  61   TLLIDSKPSKGLRKFLRAHCDGETLAVADSKLGNAIKEKLKIDCLHNNAVMELMRGLRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL+KIVQDNIQYAK VKLMG+RTNA  LDFSE+L
Sbjct  181  VREWYGWHFPELSKIVQDNIQYAKVVKLMGNRTNAVNLDFSEVL  224



>ref|XP_010687356.1| PREDICTED: probable nucleolar protein 5-2 [Beta vulgaris subsp. 
vulgaris]
Length=572

 Score =   423 bits (1087),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 197/225 (88%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLS++EDLWKEF++ D+ARKVVKLKAF KFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSQIEDLWKEFTSVDSARKVVKLKAFDKFENTAEALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFL++HC G+TLAVADSKLGNAIKEKLQI+CVHN++VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCKGETLAVADSKLGNAIKEKLQIECVHNNSVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            L+ELI+GLG QDLAPMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGAQDLAPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YAK VKLMG+R NAAKLDFSE+LP
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKAVKLMGNRVNAAKLDFSEVLP  225



>ref|XP_008796213.1| PREDICTED: probable nucleolar protein 5-2 isoform X2 [Phoenix 
dactylifera]
Length=583

 Score =   422 bits (1086),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 199/224 (89%), Positives = 214/224 (96%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL +VEDLWKEFST+++ARKVVKLKAFSKFENTSEALS  
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDRVEDLWKEFSTSESARKVVKLKAFSKFENTSEALSTV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLID KPSKGLRKFLR+HC+G+TLAVADSKLGNAIKEKL+IDC+H+S VMELMRGLR+Q
Sbjct  61   TLLIDGKPSKGLRKFLRAHCEGETLAVADSKLGNAIKEKLKIDCLHSSAVMELMRGLRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKI+QDNIQYAK VKLMG+RTNA  LDFSEIL
Sbjct  181  VREWYGWHFPELAKIIQDNIQYAKAVKLMGNRTNAVDLDFSEIL  224



>ref|XP_008796212.1| PREDICTED: probable nucleolar protein 5-2 isoform X1 [Phoenix 
dactylifera]
Length=564

 Score =   422 bits (1084),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 199/224 (89%), Positives = 214/224 (96%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL +VEDLWKEFST+++ARKVVKLKAFSKFENTSEALS  
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDRVEDLWKEFSTSESARKVVKLKAFSKFENTSEALSTV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLID KPSKGLRKFLR+HC+G+TLAVADSKLGNAIKEKL+IDC+H+S VMELMRGLR+Q
Sbjct  61   TLLIDGKPSKGLRKFLRAHCEGETLAVADSKLGNAIKEKLKIDCLHSSAVMELMRGLRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKI+QDNIQYAK VKLMG+RTNA  LDFSEIL
Sbjct  181  VREWYGWHFPELAKIIQDNIQYAKAVKLMGNRTNAVDLDFSEIL  224



>ref|XP_010025094.1| PREDICTED: probable nucleolar protein 5-2 [Eucalyptus grandis]
 gb|KCW61686.1| hypothetical protein EUGRSUZ_H04416 [Eucalyptus grandis]
Length=579

 Score =   422 bits (1084),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 198/225 (88%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGK+SKVEDLW+EFS+A++A+KVVKLKAFSKFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKVSKVEDLWQEFSSAESAKKVVKLKAFSKFENTAEALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T LI+SKP KGLRKFLR+HCDG++LAVADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TCLIESKPYKGLRKFLRAHCDGESLAVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKI+QDNI YAKTVKLMG+RTNA+KLDFS ILP
Sbjct  181  VREWYGWHFPELAKIIQDNILYAKTVKLMGNRTNASKLDFSGILP  225



>emb|CAK22424.1| matrix attachment region binding protein [Beta vulgaris]
Length=572

 Score =   421 bits (1083),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/225 (87%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLS++EDLWKEF++ D+ARKVVKLKAF KFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSQIEDLWKEFTSVDSARKVVKLKAFDKFENTAEALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFL++HC G+TLAVADSKLGNAIKEKLQI+CVHN++VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCKGETLAVADSKLGNAIKEKLQIECVHNNSVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            L+ELI+GLG QDLAPMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGAQDLAPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPEL+KIVQDNI YAK VKLMG+R NAAKLDFSE+LP
Sbjct  181  VREWYGWHFPELSKIVQDNILYAKAVKLMGNRVNAAKLDFSEVLP  225



>ref|XP_008655653.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
 ref|XP_008655660.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
 tpg|DAA45362.1| TPA: hypothetical protein ZEAMMB73_906298 [Zea mays]
Length=564

 Score =   421 bits (1082),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 197/224 (88%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TL+IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL KIV DNIQYAK VK+MG+RTNA  LDFSEIL
Sbjct  181  VREWYGWHFPELTKIVTDNIQYAKVVKMMGNRTNAVNLDFSEIL  224



>ref|XP_010241470.1| PREDICTED: probable nucleolar protein 5-2 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010241474.1| PREDICTED: probable nucleolar protein 5-2 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010241483.1| PREDICTED: probable nucleolar protein 5-2 isoform X1 [Nelumbo 
nucifera]
Length=584

 Score =   422 bits (1084),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 202/229 (88%), Positives = 217/229 (95%), Gaps = 4/229 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVE----DLWKEFSTADTARKVVKLKAFSKFENTSEA  315
            ML+LFETPAGFALFKVLDEGKLSKVE    DLWKEFST+++ARKVVKLKAFSKFENTSEA
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVESGLQDLWKEFSTSESARKVVKLKAFSKFENTSEA  60

Query  316  LSAATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  495
            LSAATLLIDSKPSK LRKFLR+HCDG+TLAVADSK GNAIKEKL+I+CVHN+ VMELMRG
Sbjct  61   LSAATLLIDSKPSKALRKFLRAHCDGETLAVADSKFGNAIKEKLKIECVHNNAVMELMRG  120

Query  496  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  675
            +R+QLTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNT
Sbjct  121  VRSQLTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNT  180

Query  676  YAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            YAMRVREWYGWHFPELAKIVQDNI YAK VKLMG+R+NA KLDFSEILP
Sbjct  181  YAMRVREWYGWHFPELAKIVQDNILYAKAVKLMGNRSNAGKLDFSEILP  229



>ref|XP_007208461.1| hypothetical protein PRUPE_ppa003941mg [Prunus persica]
 gb|EMJ09660.1| hypothetical protein PRUPE_ppa003941mg [Prunus persica]
Length=539

 Score =   419 bits (1078),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 199/225 (88%), Positives = 214/225 (95%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVL+EGKLS+VEDLWKEFS+A++AR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLNEGKLSQVEDLWKEFSSAESARQVVKLKAFSKFENTSEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFLR+HC G+TLAVADSKLGN IKEKL+IDCVHN++VMELMRG+RNQ
Sbjct  61   TLLIDSKPSKGLRKFLRAHCSGETLAVADSKLGNVIKEKLKIDCVHNNSVMELMRGVRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI GL VQDLAPMSLGLSHSLSRYKLKFS +KVDTM++QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLQVQDLAPMSLGLSHSLSRYKLKFSAEKVDTMVIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YAK VKLMG R NAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKAVKLMGYRANAAKLDFSEILP  225



>ref|XP_008218165.1| PREDICTED: probable nucleolar protein 5-2 [Prunus mume]
Length=538

 Score =   419 bits (1077),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 199/225 (88%), Positives = 214/225 (95%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVL+EGKLS+VEDLWKEFS+A++AR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLNEGKLSQVEDLWKEFSSAESARQVVKLKAFSKFENTSEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFLR+HC G+TLAVADSKLGN IKEKL+IDCVHN++VMELMRG+RNQ
Sbjct  61   TLLIDSKPSKGLRKFLRAHCSGETLAVADSKLGNVIKEKLKIDCVHNNSVMELMRGVRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI GL VQDLAPMSLGLSHSLSRYKLKFS +KVDTM++QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLQVQDLAPMSLGLSHSLSRYKLKFSAEKVDTMVIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YAK VKLMG R NAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKAVKLMGYRANAAKLDFSEILP  225



>ref|XP_010938712.1| PREDICTED: probable nucleolar protein 5-2 [Elaeis guineensis]
Length=600

 Score =   421 bits (1082),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 198/224 (88%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEFST+++ARKVVKLKAFSKFENTSEALS A
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFSTSESARKVVKLKAFSKFENTSEALSTA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLID KPSKGLRKFLR+HC+G+ LAVADSKLGNAIKEKL+IDC+HN+ VMELMRGLR+Q
Sbjct  61   TLLIDGKPSKGLRKFLRAHCEGEALAVADSKLGNAIKEKLKIDCLHNNAVMELMRGLRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKI+ DNIQYAK VKLMG+R NA +LDFSEIL
Sbjct  181  VREWYGWHFPELAKIIPDNIQYAKAVKLMGNRANAVQLDFSEIL  224



>ref|NP_001050112.1| Os03g0350100 [Oryza sativa Japonica Group]
 dbj|BAF12026.1| Os03g0350100, partial [Oryza sativa Japonica Group]
Length=556

 Score =   419 bits (1078),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 196/224 (88%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL KIV DNIQYAK VK+MGDRTNA  LDFSEIL
Sbjct  181  VREWYGWHFPELTKIVADNIQYAKVVKMMGDRTNAESLDFSEIL  224



>ref|XP_002456868.1| hypothetical protein SORBIDRAFT_03g044260 [Sorghum bicolor]
 gb|EES01988.1| hypothetical protein SORBIDRAFT_03g044260 [Sorghum bicolor]
Length=568

 Score =   419 bits (1078),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 196/224 (88%), Positives = 212/224 (95%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TL+IDSKPSKGLRKFL+ HC+G+TLAVADSKLGN+IKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNSIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL KIV DNIQYAK VK+MGDR NA  LDFSEIL
Sbjct  181  VREWYGWHFPELTKIVTDNIQYAKVVKMMGDRANAVNLDFSEIL  224



>ref|XP_006650080.1| PREDICTED: probable nucleolar protein 5-2-like [Oryza brachyantha]
Length=565

 Score =   419 bits (1077),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 196/224 (88%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL KIV DNIQYAK VK+MGDRTNA  LDFSEIL
Sbjct  181  VREWYGWHFPELTKIVADNIQYAKVVKMMGDRTNAVDLDFSEIL  224



>ref|XP_008671899.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
Length=425

 Score =   414 bits (1065),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 195/224 (87%), Positives = 212/224 (95%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T++IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TMIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL KIV DNIQYAK VK+MG+R NA  LDFSEIL
Sbjct  181  VREWYGWHFPELTKIVTDNIQYAKVVKMMGNRVNAVNLDFSEIL  224



>ref|NP_001050113.1| Os03g0350300 [Oryza sativa Japonica Group]
 gb|ABF95928.1| Nucleolar protein NOP5, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12027.1| Os03g0350300 [Oryza sativa Japonica Group]
 gb|EAZ26910.1| hypothetical protein OsJ_10837 [Oryza sativa Japonica Group]
 dbj|BAG93321.1| unnamed protein product [Oryza sativa Japonica Group]
Length=568

 Score =   419 bits (1077),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 196/224 (88%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL KIV DNIQYAK VK+MGDRTNA  LDFSEIL
Sbjct  181  VREWYGWHFPELTKIVADNIQYAKVVKMMGDRTNAESLDFSEIL  224



>gb|ABF95925.1| Nucleolar protein NOP5, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF95926.1| Nucleolar protein NOP5, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF95927.1| Nucleolar protein NOP5, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAY89998.1| hypothetical protein OsI_11565 [Oryza sativa Indica Group]
 dbj|BAG94281.1| unnamed protein product [Oryza sativa Japonica Group]
Length=568

 Score =   419 bits (1077),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 196/224 (88%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL KIV DNIQYAK VK+MGDRTNA  LDFSEIL
Sbjct  181  VREWYGWHFPELTKIVADNIQYAKVVKMMGDRTNAESLDFSEIL  224



>ref|XP_008660157.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
 ref|XP_008660158.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
 gb|AFW88396.1| hypothetical protein ZEAMMB73_019419 [Zea mays]
 gb|AFW88397.1| hypothetical protein ZEAMMB73_019419 [Zea mays]
 gb|AFW88398.1| hypothetical protein ZEAMMB73_019419 [Zea mays]
Length=562

 Score =   418 bits (1075),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 196/224 (88%), Positives = 212/224 (95%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TL+IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL KIV DNIQYAK VK+MG+R NA  LDFSEIL
Sbjct  181  VREWYGWHFPELTKIVTDNIQYAKVVKMMGNRVNAVNLDFSEIL  224



>dbj|BAN15014.1| SAR DNA binding protein [Bromus inermis]
Length=539

 Score =   417 bits (1072),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 195/224 (87%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVL+EGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLNEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TL+IDSKP+KGLRKFL+ HCDG+TLAVADSKLGNAIKEKL+IDCVHNS VMELMRGL+NQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCDGETLAVADSKLGNAIKEKLKIDCVHNSVVMELMRGLKNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            L+ELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGTQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL KIV DNIQYAK VKLMG+RTNA  LDFSEIL
Sbjct  181  VREWYGWHFPELTKIVTDNIQYAKVVKLMGNRTNAVNLDFSEIL  224



>ref|XP_003557835.1| PREDICTED: probable nucleolar protein 5-2 [Brachypodium distachyon]
Length=560

 Score =   417 bits (1073),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 195/224 (87%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLD+GKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDQGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDCVHNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCVHNSAVMELMRGLRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGTQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL KIV DNI+YAK VKLMG+RTNA  LDFSEIL
Sbjct  181  VREWYGWHFPELTKIVTDNIEYAKVVKLMGNRTNAVNLDFSEIL  224



>ref|XP_008649917.1| PREDICTED: LOW QUALITY PROTEIN: probable nucleolar protein 5-2 
[Zea mays]
Length=329

 Score =   409 bits (1052),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 194/224 (87%), Positives = 211/224 (94%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TL+IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDT+I+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTIIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYG HFPEL KIV DNIQYAK VK+MG+R NA  LDFSEIL
Sbjct  181  VREWYGXHFPELTKIVIDNIQYAKVVKMMGNRVNAVNLDFSEIL  224



>ref|XP_004984388.1| PREDICTED: probable nucleolar protein 5-2-like [Setaria italica]
Length=567

 Score =   418 bits (1074),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 195/224 (87%), Positives = 211/224 (94%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+AR+VV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARRVVELKAFNKFENTSDALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TL+ID KPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDGKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELITGLG Q+L PMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQELGPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL KIV DNIQYAK VK+MGDR NA  LDFSEIL
Sbjct  181  VREWYGWHFPELTKIVTDNIQYAKVVKMMGDRANAVNLDFSEIL  224



>dbj|BAA31260.1| SAR DNA binding protein [Oryza sativa]
Length=485

 Score =   415 bits (1066),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 195/224 (87%), Positives = 212/224 (95%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMR LRNQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRRLRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL KIV DNIQYAK VK+MGDRTNA  LDFSEIL
Sbjct  181  VREWYGWHFPELTKIVADNIQYAKVVKMMGDRTNAESLDFSEIL  224



>gb|EEC75255.1| hypothetical protein OsI_11566 [Oryza sativa Indica Group]
Length=657

 Score =   421 bits (1081),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 198/229 (86%), Positives = 215/229 (94%), Gaps = 0/229 (0%)
 Frame = +1

Query  133  R*AEEMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSE  312
            R   EMLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+
Sbjct  85   RAVREMLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSD  144

Query  313  ALSAATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  492
            ALSAATL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMR
Sbjct  145  ALSAATLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMR  204

Query  493  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  672
            GLRNQLTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELN
Sbjct  205  GLRNQLTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELN  264

Query  673  TYAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            TYAMRVREWYGWHFPEL KIV DNIQYAK VK+MGDRTNA  LDFSEIL
Sbjct  265  TYAMRVREWYGWHFPELTKIVADNIQYAKVVKMMGDRTNAESLDFSEIL  313



>ref|XP_002533223.1| nucleolar protein nop56, putative [Ricinus communis]
 gb|EEF29163.1| nucleolar protein nop56, putative [Ricinus communis]
Length=558

 Score =   417 bits (1072),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 199/225 (88%), Positives = 213/225 (95%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDL KEF+ AD+ARKVVKLKAFSKFENTS+AL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLSKEFANADSARKVVKLKAFSKFENTSKALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T L+DS PSKGLRKFL+SHCDG+TLAVADSKLGNAIK+KL+IDCVHN+ VMELMRGLR+Q
Sbjct  61   TKLLDSAPSKGLRKFLKSHCDGETLAVADSKLGNAIKDKLKIDCVHNNAVMELMRGLRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LT+LI+GLG QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTDLISGLGAQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YAK+VKLMG R NA KLDFSEILP
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKSVKLMGSRDNATKLDFSEILP  225



>gb|EYU23803.1| hypothetical protein MIMGU_mgv1a003693mg [Erythranthe guttata]
Length=569

 Score =   417 bits (1072),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 198/224 (88%), Positives = 213/224 (95%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETPAGFALFKVLDE K+SK+EDL KEFS+ D+AR++VKLKAFSKFENTSEALSAA
Sbjct  27   MLLLFETPAGFALFKVLDERKVSKIEDLGKEFSSPDSARQIVKLKAFSKFENTSEALSAA  86

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFLRSHCD D LAVADSKLGN IKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  87   TLLIDSKPSKGLRKFLRSHCDDDVLAVADSKLGNIIKEKLQIECVHNNAVMELMRGVRSQ  146

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELNTYAMR
Sbjct  147  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNTYAMR  206

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKI+ DNIQYAKTVKLMG+RTNAA LDFSEIL
Sbjct  207  VREWYGWHFPELAKIIADNIQYAKTVKLMGNRTNAATLDFSEIL  250



>ref|XP_004984387.1| PREDICTED: probable nucleolar protein 5-2-like [Setaria italica]
Length=568

 Score =   417 bits (1071),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 194/224 (87%), Positives = 211/224 (94%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+AR+VV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARRVVELKAFNKFENTSDALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TL+ID KPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDGKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELITGLG Q+L PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQELGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL KIV DNIQYAK VK+MGDR NA  LDFSEIL
Sbjct  181  VREWYGWHFPELTKIVTDNIQYAKVVKMMGDRANAVNLDFSEIL  224



>gb|EYU23804.1| hypothetical protein MIMGU_mgv1a003941mg [Erythranthe guttata]
Length=553

 Score =   415 bits (1066),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 198/224 (88%), Positives = 211/224 (94%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETPAGFALFKVLDE KLSK EDL KEFS+ D+AR++VKLKAFSKFENTSEALSAA
Sbjct  1    MLLLFETPAGFALFKVLDEAKLSKAEDLGKEFSSPDSARQIVKLKAFSKFENTSEALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFLRSHCD D LAVADSKLGN IKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRSHCDDDILAVADSKLGNIIKEKLQIECVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKI+ DNI YAKTVKLMG+RTNAA LDFSEIL
Sbjct  181  VREWYGWHFPELAKIIADNIHYAKTVKLMGNRTNAATLDFSEIL  224



>ref|XP_012089180.1| PREDICTED: probable nucleolar protein 5-1 [Jatropha curcas]
 ref|XP_012089181.1| PREDICTED: probable nucleolar protein 5-1 [Jatropha curcas]
 gb|KDP23603.1| hypothetical protein JCGZ_23436 [Jatropha curcas]
Length=577

 Score =   416 bits (1068),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 197/225 (88%), Positives = 211/225 (94%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTAD+ARKVVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADSARKVVKLKAFSKFENTSEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T +I+   SKGLRKFLR+HC+G+ LAVADSKLGNAIKEKL+I+CVHN+ +MELMRG+R+Q
Sbjct  61   TKIIEGTASKGLRKFLRAHCEGEILAVADSKLGNAIKEKLKIECVHNNAIMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELITGLG QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNT+AMR
Sbjct  121  LTELITGLGAQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTFAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YAK VKLMG R NA KLDFSEILP
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKAVKLMGSRENAVKLDFSEILP  225



>gb|KJB26511.1| hypothetical protein B456_004G245100 [Gossypium raimondii]
Length=450

 Score =   411 bits (1056),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 194/225 (86%), Positives = 210/225 (93%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDC+HN++VMEL+RG+R Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCIHNTSVMELLRGVRTQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            +REWYGWHFPEL +IVQDNI YAKTVKLMGDR NAAKLDFSEILP
Sbjct  181  IREWYGWHFPELTRIVQDNIHYAKTVKLMGDRANAAKLDFSEILP  225



>ref|XP_008666415.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
Length=420

 Score =   410 bits (1053),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 193/225 (86%), Positives = 210/225 (93%), Gaps = 0/225 (0%)
 Frame = +1

Query  145  EMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSA  324
            EMLVLFETPAGF LFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSA
Sbjct  21   EMLVLFETPAGFTLFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSA  80

Query  325  ATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  504
            ATL+IDSKPSKGLRKFL+ HC+G+TL VADSKLGNAIKEKL+IDC+HNS VMELMRGLRN
Sbjct  81   ATLIIDSKPSKGLRKFLQKHCEGETLVVADSKLGNAIKEKLKIDCLHNSVVMELMRGLRN  140

Query  505  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  684
            QLTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+Q I LLDDLDKELNTYAM
Sbjct  141  QLTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQDIGLLDDLDKELNTYAM  200

Query  685  RVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            RVREWYGWHFPEL KIV DNIQYAK VK+MG+R NA  LDFS+IL
Sbjct  201  RVREWYGWHFPELTKIVTDNIQYAKVVKMMGNRVNAVNLDFSKIL  245



>ref|XP_008388628.1| PREDICTED: probable nucleolar protein 5-2 [Malus domestica]
Length=552

 Score =   414 bits (1064),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 198/225 (88%), Positives = 212/225 (94%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+FS+AD AR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFSSADKARQVVKLKAFSKFENTSEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFL++HC G+TLAV+DSKLGN IKEKL+IDCVHN+ VMELMRG+R Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCSGETLAVSDSKLGNIIKEKLKIDCVHNNAVMELMRGVRAQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI GL VQDLAPMSLGLSHSLSR+KLKFS DKVDTM++QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLQVQDLAPMSLGLSHSLSRFKLKFSADKVDTMVIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YAK VKLMG R+NAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKVVKLMGYRSNAAKLDFSEILP  225



>ref|XP_009342020.1| PREDICTED: probable nucleolar protein 5-2 [Pyrus x bretschneideri]
Length=552

 Score =   414 bits (1064),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 198/225 (88%), Positives = 212/225 (94%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+FS+AD AR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFSSADKARQVVKLKAFSKFENTSEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFL++HC G+TLAV+DSKLGN IKEKL+IDCVHN+ VMELMRG+R Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCSGETLAVSDSKLGNIIKEKLKIDCVHNNAVMELMRGVRAQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI GL VQDLAPMSLGLSHSLSR+KLKFS DKVDTM++QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLQVQDLAPMSLGLSHSLSRFKLKFSADKVDTMVIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YAK VKLMG R+NAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKAVKLMGYRSNAAKLDFSEILP  225



>ref|XP_009364569.1| PREDICTED: probable nucleolar protein 5-2 [Pyrus x bretschneideri]
Length=550

 Score =   414 bits (1063),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 198/225 (88%), Positives = 211/225 (94%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+FS AD AR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFSNADKARQVVKLKAFSKFENTSEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFL++HC G+TLAV+DSKLGN IKEKL+IDCVHN+ VMELMRG+R Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCSGETLAVSDSKLGNIIKEKLKIDCVHNNAVMELMRGVRAQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI GL VQDLAPMSLGLSHSLSR+KLKFS DKVDTM++QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLQVQDLAPMSLGLSHSLSRFKLKFSADKVDTMVIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YAK VKLMG R+NAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKVVKLMGYRSNAAKLDFSEILP  225



>ref|XP_008455669.1| PREDICTED: probable nucleolar protein 5-2 [Cucumis melo]
 gb|ADN33903.1| MAR-binding protein [Cucumis melo subsp. melo]
Length=554

 Score =   414 bits (1063),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 197/225 (88%), Positives = 211/225 (94%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AGFALFKVLDEGKLSKVEDL K+FS A++AR++VKLKAFSKFEN SEAL A 
Sbjct  1    MLVLFETSAGFALFKVLDEGKLSKVEDLSKDFSNAESARQIVKLKAFSKFENMSEALEAT  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFLR++CDG+TL VADSKLGN IKEKLQIDCVHN++VMEL+RGLRNQ
Sbjct  61   TLLIDSKPSKGLRKFLRANCDGETLGVADSKLGNIIKEKLQIDCVHNNSVMELIRGLRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            L ELI GL VQDLAPMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LNELIAGLAVQDLAPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKI+QDNIQYAKTVKLMG+R NAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIIQDNIQYAKTVKLMGNRENAAKLDFSEILP  225



>ref|XP_004139213.1| PREDICTED: probable nucleolar protein 5-2 [Cucumis sativus]
 gb|KGN60839.1| hypothetical protein Csa_2G012710 [Cucumis sativus]
Length=544

 Score =   413 bits (1062),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 197/225 (88%), Positives = 211/225 (94%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AGFALFKVLDEGKLSKVEDL K+FS A++AR++VKLKAFSKFEN SEAL A 
Sbjct  1    MLVLFETSAGFALFKVLDEGKLSKVEDLSKDFSNAESARQIVKLKAFSKFENMSEALEAT  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFLR++CDG+TL VADSKLGN IKEKLQIDCVHN++VMEL+RGLRNQ
Sbjct  61   TLLIDSKPSKGLRKFLRANCDGETLGVADSKLGNIIKEKLQIDCVHNNSVMELIRGLRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            L ELI GL VQDLAPMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LNELIAGLAVQDLAPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKI+QDNIQYAKTVKLMG+R NAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIIQDNIQYAKTVKLMGNRENAAKLDFSEILP  225



>gb|KJB45049.1| hypothetical protein B456_007G287100 [Gossypium raimondii]
Length=414

 Score =   409 bits (1050),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 194/225 (86%), Positives = 209/225 (93%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV L+AFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLQAFSKFENTAEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNNAVMELLRGVRTQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            +REWYGWHFPEL KI+QDNIQYAK VKLMGDR NAAKLDFSEILP
Sbjct  181  IREWYGWHFPELTKIIQDNIQYAKAVKLMGDRANAAKLDFSEILP  225



>ref|XP_008370662.1| PREDICTED: probable nucleolar protein 5-2 [Malus domestica]
Length=553

 Score =   413 bits (1062),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 198/225 (88%), Positives = 212/225 (94%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+FS+AD AR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFSSADKARQVVKLKAFSKFENTSEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFL++HC G+TLAV+DSKLGN IKEKL+IDCVHN+ VMELMRG+R Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCSGETLAVSDSKLGNIIKEKLKIDCVHNNXVMELMRGVRAQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI GL VQDLAPMSLGLSHSLSR+KLKFS DKVDTM++QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLQVQDLAPMSLGLSHSLSRFKLKFSADKVDTMVIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YAK VKLMG R+NAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKAVKLMGYRSNAAKLDFSEILP  225



>ref|XP_002512277.1| nucleolar protein nop56, putative [Ricinus communis]
 gb|EEF49729.1| nucleolar protein nop56, putative [Ricinus communis]
Length=575

 Score =   413 bits (1062),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 196/225 (87%), Positives = 210/225 (93%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDL KEFSTAD+ARKVVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLSKEFSTADSARKVVKLKAFSKFENTSEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T +I+   SKGLRKFLR+HCDG+ L VADSKLGNAIKEKL+I+CVH++ VMELMRG+R+Q
Sbjct  61   TKIIEGTASKGLRKFLRAHCDGEILGVADSKLGNAIKEKLKIECVHSNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YAK VKLMG R NA KLDFSE+LP
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKAVKLMGSRNNAVKLDFSEVLP  225



>ref|XP_003537858.1| PREDICTED: probable nucleolar protein 5-2-like [Glycine max]
 gb|KHN39811.1| Putative nucleolar protein 5-2 [Glycine soja]
Length=551

 Score =   412 bits (1059),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 195/225 (87%), Positives = 208/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK FS+ADTAR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKNFSSADTARQVVKLKAFSKFENTSEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLID K SKGLRKFLR HC+ +TL VADSKLGN IKEKL+IDC+HN+ VMELMRG+RNQ
Sbjct  61   TLLIDGKASKGLRKFLRVHCENETLGVADSKLGNVIKEKLKIDCIHNNAVMELMRGVRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL VQD+APMSLGLSHSLSRYKLKFS +KVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDMAPMSLGLSHSLSRYKLKFSAEKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPEL KI+QDNI YA+ VKLMGDR NAA LDFSEILP
Sbjct  181  VREWYGWHFPELTKIIQDNILYARAVKLMGDRVNAASLDFSEILP  225



>gb|KHN25404.1| Putative nucleolar protein 5-2 [Glycine soja]
Length=553

 Score =   412 bits (1058),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 195/225 (87%), Positives = 208/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK FS+ADTAR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKNFSSADTARQVVKLKAFSKFENTSEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLID K SKGLRKFLR HC+ +TL VADSKLGN IKEKL+IDC+HN+ VMELMRG+RNQ
Sbjct  61   TLLIDGKASKGLRKFLRVHCENETLGVADSKLGNVIKEKLKIDCIHNNAVMELMRGVRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL VQD+APMSLGLSHSLSRYKLKFS +KVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDMAPMSLGLSHSLSRYKLKFSAEKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPEL KI+QDNI YA+ VKLMGDR NAA LDFSEILP
Sbjct  181  VREWYGWHFPELTKIIQDNILYARAVKLMGDRVNAANLDFSEILP  225



>ref|XP_003540996.1| PREDICTED: probable nucleolar protein 5-2-like [Glycine max]
Length=556

 Score =   412 bits (1058),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 195/225 (87%), Positives = 208/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK FS+ADTAR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKNFSSADTARQVVKLKAFSKFENTSEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLID K SKGLRKFLR HC+ +TL VADSKLGN IKEKL+IDC+HN+ VMELMRG+RNQ
Sbjct  61   TLLIDGKASKGLRKFLRVHCENETLGVADSKLGNVIKEKLKIDCIHNNAVMELMRGVRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL VQD+APMSLGLSHSLSRYKLKFS +KVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDMAPMSLGLSHSLSRYKLKFSAEKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPEL KI+QDNI YA+ VKLMGDR NAA LDFSEILP
Sbjct  181  VREWYGWHFPELTKIIQDNILYARAVKLMGDRVNAANLDFSEILP  225



>gb|EMS65034.1| hypothetical protein TRIUR3_04158 [Triticum urartu]
Length=560

 Score =   411 bits (1057),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 193/225 (86%), Positives = 209/225 (93%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLS VEDLWK+F+++D ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSSVEDLWKDFASSDKARKVVELKAFNKFENTSDALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFL+ HCDG+TLAVADSKLGNAIKEKLQIDC+HNS VMELMRGLRNQ
Sbjct  61   TLLIDSKPSKGLRKFLQKHCDGETLAVADSKLGNAIKEKLQIDCLHNSAVMELMRGLRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTEL++GL   DL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELMSGLAEHDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPEL KIV DNI YAK VK+MG+R NA  LDFSEILP
Sbjct  181  VREWYGWHFPELTKIVADNIHYAKAVKMMGNRVNAVNLDFSEILP  225



>gb|KJB26509.1| hypothetical protein B456_004G245100 [Gossypium raimondii]
Length=567

 Score =   411 bits (1057),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 194/225 (86%), Positives = 210/225 (93%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDC+HN++VMEL+RG+R Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCIHNTSVMELLRGVRTQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            +REWYGWHFPEL +IVQDNI YAKTVKLMGDR NAAKLDFSEILP
Sbjct  181  IREWYGWHFPELTRIVQDNIHYAKTVKLMGDRANAAKLDFSEILP  225



>gb|KJB45047.1| hypothetical protein B456_007G287100 [Gossypium raimondii]
 gb|KJB45048.1| hypothetical protein B456_007G287100 [Gossypium raimondii]
Length=567

 Score =   411 bits (1057),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 194/225 (86%), Positives = 209/225 (93%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV L+AFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLQAFSKFENTAEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNNAVMELLRGVRTQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            +REWYGWHFPEL KI+QDNIQYAK VKLMGDR NAAKLDFSEILP
Sbjct  181  IREWYGWHFPELTKIIQDNIQYAKAVKLMGDRANAAKLDFSEILP  225



>gb|KJB82563.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
Length=416

 Score =   405 bits (1041),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 193/225 (86%), Positives = 207/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF   D+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAPDSARKVVSLKAFSKFENTAEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESAPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNNAVMELLRGVRTQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPEL KI+QDNI YAK VKLMGDR NAAKLDFSE+LP
Sbjct  181  VREWYGWHFPELTKIIQDNIMYAKAVKLMGDRANAAKLDFSEVLP  225



>ref|XP_012075114.1| PREDICTED: probable nucleolar protein 5-1 [Jatropha curcas]
 gb|KDP35364.1| hypothetical protein JCGZ_10348 [Jatropha curcas]
Length=565

 Score =   410 bits (1054),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 198/225 (88%), Positives = 209/225 (93%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDL KEF++ADTARKVVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLSKEFTSADTARKVVKLKAFSKFENTSEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T L+DS  SKGLRKFL+SHCDG+ LAVADSKLGNAIK+KL+I+CVHN+ VMELMRGLR Q
Sbjct  61   TKLLDSTTSKGLRKFLKSHCDGEILAVADSKLGNAIKDKLKIECVHNNAVMELMRGLRAQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELITGL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLHAQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPEL+KIVQDNI YAK VKLMG R NA KLDFSEILP
Sbjct  181  VREWYGWHFPELSKIVQDNILYAKAVKLMGSRDNAIKLDFSEILP  225



>ref|XP_004507477.1| PREDICTED: probable nucleolar protein 5-1-like [Cicer arietinum]
Length=553

 Score =   410 bits (1053),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 196/224 (88%), Positives = 207/224 (92%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFA+FKVLDEGKLSKVEDL  EF+TAD ARKVVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFAIFKVLDEGKLSKVEDLSNEFATADAARKVVKLKAFSKFENTSEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLID K SKGLRKFLR+HCD +TL VADSKLGN IKEKL+IDCVHN+ VMELMRG+R Q
Sbjct  61   TLLIDGKASKGLRKFLRAHCDNETLGVADSKLGNIIKEKLKIDCVHNNAVMELMRGVRYQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            L ELI+GL VQD+APMSLGLSHSLSRYKLKFS +KVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LNELISGLAVQDMAPMSLGLSHSLSRYKLKFSAEKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL KI+QDNIQYAK VKLMGDRTNAAKLDFSEIL
Sbjct  181  VREWYGWHFPELTKIIQDNIQYAKAVKLMGDRTNAAKLDFSEIL  224



>ref|XP_006491841.1| PREDICTED: probable nucleolar protein 5-1-like [Citrus sinensis]
Length=551

 Score =   409 bits (1052),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 192/225 (85%), Positives = 213/225 (95%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVE LW+EF++A++AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEGLWQEFNSAESARQIVKLKAFSKFENTSEALKAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T L++SKPSK LRKFLR+HCDG+TLAVADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPSKDLRKFLRTHCDGETLAVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL  QDL PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAGQDLQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKI+QDNI YAK VKLMGDR+NAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIIQDNILYAKAVKLMGDRSNAAKLDFSEILP  225



>ref|XP_007131795.1| hypothetical protein PHAVU_011G042200g [Phaseolus vulgaris]
 gb|ESW03789.1| hypothetical protein PHAVU_011G042200g [Phaseolus vulgaris]
Length=556

 Score =   409 bits (1052),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 195/224 (87%), Positives = 207/224 (92%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDLW  FS+ADTAR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWTNFSSADTARQVVKLKAFSKFENTSEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLID K SKGLRKFLR HC+ +TL VADSKLGN IKEKL+IDCVHN+ VMELMRG+RNQ
Sbjct  61   TLLIDGKASKGLRKFLRVHCENETLGVADSKLGNVIKEKLKIDCVHNNAVMELMRGVRNQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL VQD+APMSLGLSHSLSRYKLKFS +KVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDMAPMSLGLSHSLSRYKLKFSAEKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL KI+QDNIQYA+ VKLMGDR NAA LDFSEIL
Sbjct  181  VREWYGWHFPELTKIIQDNIQYARAVKLMGDRVNAAVLDFSEIL  224



>ref|XP_007030688.1| NOP56-like pre RNA processing ribonucleoprotein isoform 3 [Theobroma 
cacao]
 gb|EOY11190.1| NOP56-like pre RNA processing ribonucleoprotein isoform 3 [Theobroma 
cacao]
Length=443

 Score =   404 bits (1039),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 193/224 (86%), Positives = 209/224 (93%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T L++S PSKGLRKFLR+HCDG+T+AVADSKLGNAIKEKL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETVAVADSKLGNAIKEKLKIECVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL  QDLAPMSLGLSHSLSR+KLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAAQDLAPMSLGLSHSLSRFKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            +REWYGWHFPEL KIVQDNI YAKTVKLMGDR NAAKLDFSEIL
Sbjct  181  IREWYGWHFPELTKIVQDNILYAKTVKLMGDRANAAKLDFSEIL  224



>gb|KHG01423.1| putative nucleolar 5-2 -like protein [Gossypium arboreum]
Length=567

 Score =   408 bits (1049),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 193/225 (86%), Positives = 208/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV L+AFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLQAFSKFENTAEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNNAVMELLRGVRTQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            +REWYGWHFPEL KI+QDNIQYAK VKLMGDR NAAKLD SEILP
Sbjct  181  IREWYGWHFPELTKIIQDNIQYAKAVKLMGDRANAAKLDLSEILP  225



>ref|XP_006432265.1| hypothetical protein CICLE_v10000758mg [Citrus clementina]
 gb|ESR45505.1| hypothetical protein CICLE_v10000758mg [Citrus clementina]
Length=551

 Score =   407 bits (1046),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 191/225 (85%), Positives = 213/225 (95%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVE LW+EF++A++AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEGLWQEFNSAESARQIVKLKAFSKFENTSEALKAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T L++SKPSK LRKFLR+HCDG+TLAVADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPSKDLRKFLRTHCDGETLAVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL  QDL PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAGQDLQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKI+QDNI YAK VKLMG+R+NAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIIQDNIVYAKAVKLMGNRSNAAKLDFSEILP  225



>gb|KJB82560.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82561.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82562.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82564.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82565.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82566.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
Length=564

 Score =   407 bits (1047),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 193/225 (86%), Positives = 207/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF   D+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAPDSARKVVSLKAFSKFENTAEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESAPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNNAVMELLRGVRTQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPEL KI+QDNI YAK VKLMGDR NAAKLDFSE+LP
Sbjct  181  VREWYGWHFPELTKIIQDNIMYAKAVKLMGDRANAAKLDFSEVLP  225



>gb|KHG00213.1| putative nucleolar 5-2 -like protein [Gossypium arboreum]
 gb|KHG00214.1| putative nucleolar 5-2 -like protein [Gossypium arboreum]
Length=562

 Score =   407 bits (1046),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 193/225 (86%), Positives = 207/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF   D+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAPDSARKVVSLKAFSKFENTAEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESAPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNNAVMELLRGVRTQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPEL KI+QDNI YAK VKLMGDR NAAKLDFSE+LP
Sbjct  181  VREWYGWHFPELTKIIQDNIMYAKAVKLMGDRANAAKLDFSEVLP  225



>ref|XP_006838803.1| PREDICTED: probable nucleolar protein 5-2 [Amborella trichopoda]
 gb|ERN01372.1| hypothetical protein AMTR_s00002p00260990 [Amborella trichopoda]
Length=591

 Score =   407 bits (1046),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 193/225 (86%), Positives = 209/225 (93%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFK+LDEGKL KV+DLWKEF+T D A+K+VKLKAFSKFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKLLDEGKLDKVDDLWKEFTTVDNAKKIVKLKAFSKFENTAEALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFLR+HCD + LAVADSKLG+ IK+KLQI+C+HN+ V ELMR LR Q
Sbjct  61   TLLIDSKPSKGLRKFLRAHCDNEILAVADSKLGSVIKDKLQIECIHNNAVTELMRCLRAQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI GLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIVGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            V+EWYGWHFPELAKIVQDNIQYAK VKLMG R NAA+LDF EILP
Sbjct  181  VKEWYGWHFPELAKIVQDNIQYAKVVKLMGHRANAAELDFLEILP  225



>ref|XP_003562489.1| PREDICTED: probable nucleolar protein 5-2 [Brachypodium distachyon]
Length=560

 Score =   406 bits (1043),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 191/225 (85%), Positives = 209/225 (93%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+F+++D ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFASSDKARKVVELKAFNKFENTSDALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSKPSKGLRKFL+ HCDG+TLAVADSKLGNAIKEKL+IDC H+S VMELMRGLR+Q
Sbjct  61   TLLIDSKPSKGLRKFLQKHCDGETLAVADSKLGNAIKEKLKIDCRHDSAVMELMRGLRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTEL++GL   DL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELMSGLAEHDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPEL KIV DNI YAK VK+MG+R NA  LDFSEILP
Sbjct  181  VREWYGWHFPELTKIVADNIHYAKAVKMMGNRVNAVNLDFSEILP  225



>ref|XP_007030689.1| NOP56-like pre RNA processing ribonucleoprotein isoform 4, partial 
[Theobroma cacao]
 gb|EOY11191.1| NOP56-like pre RNA processing ribonucleoprotein isoform 4, partial 
[Theobroma cacao]
Length=388

 Score =   398 bits (1023),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 190/221 (86%), Positives = 206/221 (93%), Gaps = 0/221 (0%)
 Frame = +1

Query  157  LFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAATLL  336
            LFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV LKAFSKFENT+EAL AAT L
Sbjct  1    LFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAATKL  60

Query  337  IDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQLTE  516
            ++S PSKGLRKFLR+HCDG+T+AVADSKLGNAIKEKL+I+CVHN+ VMELMRG+R+QLTE
Sbjct  61   LESTPSKGLRKFLRAHCDGETVAVADSKLGNAIKEKLKIECVHNNAVMELMRGVRSQLTE  120

Query  517  LITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMRVRE  696
            LI+GL  QDLAPMSLGLSHSLSR+KLKFS DKVDTMIVQAI LLDDLDKELNTYAMR+RE
Sbjct  121  LISGLAAQDLAPMSLGLSHSLSRFKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMRIRE  180

Query  697  WYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            WYGWHFPEL KIVQDNI YAKTVKLMGDR NAAKLDFSEIL
Sbjct  181  WYGWHFPELTKIVQDNILYAKTVKLMGDRANAAKLDFSEIL  221



>ref|XP_002319598.1| hypothetical protein POPTR_0013s03260g [Populus trichocarpa]
 gb|EEE95521.1| hypothetical protein POPTR_0013s03260g [Populus trichocarpa]
Length=561

 Score =   404 bits (1039),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 192/225 (85%), Positives = 211/225 (94%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETPAGFALFKVLDEGKLSKVEDL KEFS+ D+ARKVVKLKAFSKFENTSEAL + 
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVEDLGKEFSSPDSARKVVKLKAFSKFENTSEALESV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T +I+S  SKGLRKFLR++CDG+TLAVADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKIIESSTSKGLRKFLRANCDGETLAVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YA++VKLMG R NAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIVQDNILYARSVKLMGSRDNAAKLDFSEILP  225



>gb|KHG01259.1| putative nucleolar 5-2 -like protein [Gossypium arboreum]
Length=548

 Score =   404 bits (1037),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 192/225 (85%), Positives = 206/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFE PAGFALFKVLDEGKL+ VEDL KEF  AD+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFEIPAGFALFKVLDEGKLNNVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNTYVMELLRGVRTQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            +REWYGWHFPEL +IVQDNI YAKTVKLM DR NAAKLDFSEILP
Sbjct  181  IREWYGWHFPELTRIVQDNIHYAKTVKLMSDRANAAKLDFSEILP  225



>ref|XP_007030686.1| NOP56-like pre RNA processing ribonucleoprotein isoform 1 [Theobroma 
cacao]
 gb|EOY11188.1| NOP56-like pre RNA processing ribonucleoprotein isoform 1 [Theobroma 
cacao]
Length=565

 Score =   404 bits (1038),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 193/224 (86%), Positives = 209/224 (93%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T L++S PSKGLRKFLR+HCDG+T+AVADSKLGNAIKEKL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETVAVADSKLGNAIKEKLKIECVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL  QDLAPMSLGLSHSLSR+KLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAAQDLAPMSLGLSHSLSRFKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            +REWYGWHFPEL KIVQDNI YAKTVKLMGDR NAAKLDFSEIL
Sbjct  181  IREWYGWHFPELTKIVQDNILYAKTVKLMGDRANAAKLDFSEIL  224



>ref|XP_010674932.1| PREDICTED: probable nucleolar protein 5-2 [Beta vulgaris subsp. 
vulgaris]
Length=581

 Score =   404 bits (1037),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 192/225 (85%), Positives = 210/225 (93%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AGFALFKVLDEGKLS++EDLWKEF+  D+A+KVVKLKAF KFENT+EALSAA
Sbjct  1    MLVLFETCAGFALFKVLDEGKLSQIEDLWKEFADVDSAKKVVKLKAFDKFENTAEALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLL +SKPSKGLRKFL++HC GDTLAVADSKLG+AIKEKLQIDC+HN+ VMELMRG+R+Q
Sbjct  61   TLLSESKPSKGLRKFLKAHCKGDTLAVADSKLGSAIKEKLQIDCLHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFSPDKVDTM+VQAI LLDDLDKELNTY MR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSPDKVDTMVVQAIGLLDDLDKELNTYGMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             +EWYGWHFPELAKIV DNI YAK VKLMG+R NAAKLDFSEILP
Sbjct  181  GQEWYGWHFPELAKIVPDNILYAKVVKLMGNRVNAAKLDFSEILP  225



>gb|EPS70798.1| hypothetical protein M569_03961, partial [Genlisea aurea]
Length=392

 Score =   397 bits (1019),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 185/224 (83%), Positives = 211/224 (94%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETPAGFALFKVLDEGKLSKVEDL KEFST +++R+VVKLKAFSKFENT+EAL+AA
Sbjct  4    MLLLFETPAGFALFKVLDEGKLSKVEDLGKEFSTPESSRQVVKLKAFSKFENTAEALTAA  63

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLI+SKPSKGLRKFLRSHC+G+ L VADSKLG++IKEKLQI+CVHN+ V ELMRG+R+Q
Sbjct  64   TLLIESKPSKGLRKFLRSHCEGEILGVADSKLGSSIKEKLQIECVHNNVVSELMRGIRSQ  123

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL +QDLAPMSLGLSHSLSRYKLKF+PDK+DTMI+Q I+LLDDLDKELN Y MR
Sbjct  124  LTELISGLALQDLAPMSLGLSHSLSRYKLKFTPDKIDTMIIQGIALLDDLDKELNIYVMR  183

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKI+QDN+ Y KTVKLMGDR+NAA LDFSE+L
Sbjct  184  VREWYGWHFPELAKILQDNMLYTKTVKLMGDRSNAADLDFSEML  227



>ref|XP_011013586.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
 ref|XP_011013588.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
Length=562

 Score =   402 bits (1033),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 191/225 (85%), Positives = 209/225 (93%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETP GFALFKVLDEGKLSKVEDL KEFS+ D+ARKVVKLKAFSKFENT+EAL AA
Sbjct  1    MLLLFETPGGFALFKVLDEGKLSKVEDLGKEFSSPDSARKVVKLKAFSKFENTAEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T +I+S  SKGLRKFLR++CDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKIIESSTSKGLRKFLRANCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKI+QDNI YAK VKLMG R NAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIIQDNILYAKAVKLMGCRDNAAKLDFSEILP  225



>ref|XP_011032532.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
 ref|XP_011032533.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
 ref|XP_011032534.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
Length=562

 Score =   402 bits (1032),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 191/225 (85%), Positives = 209/225 (93%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETP GFALFKVLDEGKLSKVEDL KEFS+ D+ARKVVKLKAFSKFENT+EAL AA
Sbjct  1    MLLLFETPGGFALFKVLDEGKLSKVEDLGKEFSSPDSARKVVKLKAFSKFENTAEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T +I+S  SKGLRKFLR++CDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKIIESSTSKGLRKFLRANCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKI+QDNI YAK VKLMG R NAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIIQDNILYAKAVKLMGCRDNAAKLDFSEILP  225



>ref|XP_006382714.1| hypothetical protein POPTR_0005s04710g [Populus trichocarpa]
 ref|XP_006382715.1| hypothetical protein POPTR_0005s04710g [Populus trichocarpa]
 gb|ERP60511.1| hypothetical protein POPTR_0005s04710g [Populus trichocarpa]
 gb|ERP60512.1| hypothetical protein POPTR_0005s04710g [Populus trichocarpa]
Length=562

 Score =   402 bits (1032),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 191/225 (85%), Positives = 209/225 (93%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETP GFALFKVLDEGKLSKVEDL KEFS+ D+ARKVVKLKAFSKFENT+EAL AA
Sbjct  1    MLLLFETPGGFALFKVLDEGKLSKVEDLGKEFSSPDSARKVVKLKAFSKFENTAEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T +I+S  SKGLRKFLR++CDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKIIESSTSKGLRKFLRANCDGETLGVADSKLGNAIKDKLKIECVHNNGVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKI+QDNI YAK VKLMG R NAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIIQDNILYAKAVKLMGCRDNAAKLDFSEILP  225



>ref|XP_011003824.1| PREDICTED: probable nucleolar protein 5-2 [Populus euphratica]
Length=563

 Score =   401 bits (1031),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 191/225 (85%), Positives = 210/225 (93%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETPAGFALFKVLDEGKLSKVEDL KEFS+ D+ARKVVKLKAFSKFENTSEAL + 
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVEDLGKEFSSPDSARKVVKLKAFSKFENTSEALESV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T +I+S  SKGLRKFLR++CDG+ LAVADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKIIESSTSKGLRKFLRANCDGEMLAVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YA++VKLMG R NAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIVQDNILYARSVKLMGSRDNAAKLDFSEILP  225



>ref|XP_010546633.1| PREDICTED: probable nucleolar protein 5-2 [Tarenaya hassleriana]
Length=563

 Score =   400 bits (1029),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 191/225 (85%), Positives = 210/225 (93%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDL  EF TAD+ARKVVKLKAF+KF+NTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLGNEFLTADSARKVVKLKAFNKFDNTSEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L++  PSKGLRKFL+++C+G+ LAVADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLMEGAPSKGLRKFLKANCEGEALAVADSKLGNAIKEKLKIDCVHNTAVMELLRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLAPMSLGLSHSLARYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YAK VKLMG+RTNAAKLDFSEILP
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKAVKLMGNRTNAAKLDFSEILP  225



>ref|XP_003611088.1| SAR DNA-binding protein-1 [Medicago truncatula]
 gb|AES94046.1| NOP56-like pre RNA processing ribonucleoprotein [Medicago truncatula]
Length=590

 Score =   400 bits (1029),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 189/224 (84%), Positives = 206/224 (92%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVL+EGKLS+V+DLWKEFS+AD ARKVVKLK F KFEN SEA  AA
Sbjct  1    MLVLFETPAGFALFKVLNEGKLSEVQDLWKEFSSADAARKVVKLKGFQKFENISEATEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            +LLID K SKGLRKFLR+HCD +TLAVAD+KLG  IKEKL+IDCVH++ VME+MRG+R Q
Sbjct  61   SLLIDGKASKGLRKFLRAHCDNETLAVADTKLGTIIKEKLKIDCVHSNAVMEIMRGIRYQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELITGL VQD+APMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLAVQDMAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL KI+QDNIQYA++VKLMGDR NAAKLDFSEIL
Sbjct  181  VREWYGWHFPELTKIIQDNIQYARSVKLMGDRINAAKLDFSEIL  224



>ref|XP_010550954.1| PREDICTED: probable nucleolar protein 5-2 [Tarenaya hassleriana]
 ref|XP_010550955.1| PREDICTED: probable nucleolar protein 5-2 [Tarenaya hassleriana]
Length=539

 Score =   399 bits (1024),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 190/225 (84%), Positives = 209/225 (93%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVEDL  +F TAD+ARKVVKLKAF+KFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLGTDFLTADSARKVVKLKAFNKFENTSEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L++  PSKGLRKFL+++C+G+ LAVADSKLGN IKEKL+I+CVHNS VMEL+RG+R+Q
Sbjct  61   AKLMEGAPSKGLRKFLKANCEGEALAVADSKLGNVIKEKLKIECVHNSAVMELLRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL  QDLAPMSLGLSHSL+RYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLADQDLAPMSLGLSHSLARYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPELAKIVQDNI YAKTVKLMG+RTNAAKLD SEILP
Sbjct  181  VREWYGWHFPELAKIVQDNIMYAKTVKLMGNRTNAAKLDLSEILP  225



>gb|AAC16330.1| SAR DNA-binding protein-1 [Pisum sativum]
Length=560

 Score =   398 bits (1023),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 191/224 (85%), Positives = 207/224 (92%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVL+EGKLS+V+DL  +FSTAD ARKVVKLKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLNEGKLSEVQDLSLDFSTADAARKVVKLKAFSKFENTAEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            + LID K SKGLRKFLR+HCD + LAVADSKLGN IKEKL+IDCVHN+ VMELMRG+R Q
Sbjct  61   SCLIDGKTSKGLRKFLRAHCDDEILAVADSKLGNIIKEKLKIDCVHNNAVMELMRGVRYQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL VQD+APMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDMAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL KI+QDNIQYA++VKLMGDR NAAKLDFSEIL
Sbjct  181  VREWYGWHFPELTKIIQDNIQYARSVKLMGDRINAAKLDFSEIL  224



>ref|XP_008650437.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
Length=451

 Score =   394 bits (1012),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 189/224 (84%), Positives = 205/224 (92%), Gaps = 5/224 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPA F LFKVLD     KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPARFTLFKVLD-----KVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  55

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TL+IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  56   TLIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSVVMELMRGLRNQ  115

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+Q I LLDDLDKELNTYAMR
Sbjct  116  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQDIGLLDDLDKELNTYAMR  175

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL KIV DNIQYAK VK+MG+R NA  LDFSEIL
Sbjct  176  VREWYGWHFPELTKIVTDNIQYAKVVKMMGNRVNAVNLDFSEIL  219



>ref|XP_007030687.1| NOP56-like pre RNA processing ribonucleoprotein isoform 2, partial 
[Theobroma cacao]
 gb|EOY11189.1| NOP56-like pre RNA processing ribonucleoprotein isoform 2, partial 
[Theobroma cacao]
Length=536

 Score =   396 bits (1018),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 190/221 (86%), Positives = 206/221 (93%), Gaps = 0/221 (0%)
 Frame = +1

Query  157  LFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAATLL  336
            LFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV LKAFSKFENT+EAL AAT L
Sbjct  1    LFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAATKL  60

Query  337  IDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQLTE  516
            ++S PSKGLRKFLR+HCDG+T+AVADSKLGNAIKEKL+I+CVHN+ VMELMRG+R+QLTE
Sbjct  61   LESTPSKGLRKFLRAHCDGETVAVADSKLGNAIKEKLKIECVHNNAVMELMRGVRSQLTE  120

Query  517  LITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMRVRE  696
            LI+GL  QDLAPMSLGLSHSLSR+KLKFS DKVDTMIVQAI LLDDLDKELNTYAMR+RE
Sbjct  121  LISGLAAQDLAPMSLGLSHSLSRFKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMRIRE  180

Query  697  WYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            WYGWHFPEL KIVQDNI YAKTVKLMGDR NAAKLDFSEIL
Sbjct  181  WYGWHFPELTKIVQDNILYAKTVKLMGDRANAAKLDFSEIL  221



>ref|XP_006468094.1| PREDICTED: probable nucleolar protein 5-2-like isoform X1 [Citrus 
sinensis]
Length=549

 Score =   395 bits (1014),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 185/225 (82%), Positives = 207/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AGFALFKVLDEGKLSK E L +EF++ D+AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETAAGFALFKVLDEGKLSKFEGLGQEFNSPDSARQIVKLKAFSKFENTSEALKAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T L++SKP+K LRKFLR+HCDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPTKDLRKFLRAHCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL VQD+ PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDIQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPEL KI+QDNI YAK VK MG+RTNAAKLDFSEILP
Sbjct  181  VREWYGWHFPELTKIIQDNILYAKAVKFMGNRTNAAKLDFSEILP  225



>ref|XP_006468095.1| PREDICTED: probable nucleolar protein 5-2-like isoform X2 [Citrus 
sinensis]
Length=573

 Score =   395 bits (1015),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 185/225 (82%), Positives = 207/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AGFALFKVLDEGKLSK E L +EF++ D+AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETAAGFALFKVLDEGKLSKFEGLGQEFNSPDSARQIVKLKAFSKFENTSEALKAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T L++SKP+K LRKFLR+HCDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPTKDLRKFLRAHCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL VQD+ PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDIQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPEL KI+QDNI YAK VK MG+RTNAAKLDFSEILP
Sbjct  181  VREWYGWHFPELTKIIQDNILYAKAVKFMGNRTNAAKLDFSEILP  225



>ref|XP_006468096.1| PREDICTED: probable nucleolar protein 5-2-like isoform X3 [Citrus 
sinensis]
Length=565

 Score =   395 bits (1014),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 185/225 (82%), Positives = 207/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AGFALFKVLDEGKLSK E L +EF++ D+AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETAAGFALFKVLDEGKLSKFEGLGQEFNSPDSARQIVKLKAFSKFENTSEALKAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T L++SKP+K LRKFLR+HCDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPTKDLRKFLRAHCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL VQD+ PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDIQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPEL KI+QDNI YAK VK MG+RTNAAKLDFSEILP
Sbjct  181  VREWYGWHFPELTKIIQDNILYAKAVKFMGNRTNAAKLDFSEILP  225



>ref|XP_006468097.1| PREDICTED: probable nucleolar protein 5-2-like isoform X4 [Citrus 
sinensis]
Length=588

 Score =   395 bits (1015),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 185/225 (82%), Positives = 207/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AGFALFKVLDEGKLSK E L +EF++ D+AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETAAGFALFKVLDEGKLSKFEGLGQEFNSPDSARQIVKLKAFSKFENTSEALKAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T L++SKP+K LRKFLR+HCDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPTKDLRKFLRAHCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL VQD+ PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDIQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPEL KI+QDNI YAK VK MG+RTNAAKLDFSEILP
Sbjct  181  VREWYGWHFPELTKIIQDNILYAKAVKFMGNRTNAAKLDFSEILP  225



>ref|XP_006436388.1| hypothetical protein CICLE_v10031140mg [Citrus clementina]
 gb|ESR49628.1| hypothetical protein CICLE_v10031140mg [Citrus clementina]
Length=552

 Score =   394 bits (1011),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/225 (82%), Positives = 206/225 (92%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AGFALFKVLDEGKLSK E L +EF+  D+AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETAAGFALFKVLDEGKLSKFEGLGQEFNRPDSARQIVKLKAFSKFENTSEALKAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T L++SKP+K LRKFLR+HCDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPTKDLRKFLRAHCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GL VQD+ PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDIQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            VREWYGWHFPEL KI+QDNI YAK VK MG+RTNAAKLDFSEILP
Sbjct  181  VREWYGWHFPELTKIIQDNILYAKAVKFMGNRTNAAKLDFSEILP  225



>ref|XP_003606983.1| SAR DNA-binding protein-1 [Medicago truncatula]
 gb|AES89180.1| NOP56-like pre RNA processing ribonucleoprotein [Medicago truncatula]
Length=553

 Score =   392 bits (1007),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 187/224 (83%), Positives = 204/224 (91%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETPAGFA+FKVL+EGKLSKVEDL  EF+TAD ARKVVKLKAF+KF NTSEAL AA
Sbjct  1    MLLLFETPAGFAIFKVLNEGKLSKVEDLQNEFTTADAARKVVKLKAFNKFANTSEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSK SKGLRKFLR HC+ +TL VADSKLGN IKEKL+I+CVHN+ VMELMRG+R Q
Sbjct  61   TLLIDSKASKGLRKFLRVHCENETLGVADSKLGNIIKEKLKIECVHNNAVMELMRGVRYQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            L ELI GL VQD+APMSLGLSHSLSRY+LKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LNELIAGLAVQDMAPMSLGLSHSLSRYRLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL KI+ DNIQYA++VKLMG+R NAAKLDFSEIL
Sbjct  181  VREWYGWHFPELTKIIVDNIQYARSVKLMGNRINAAKLDFSEIL  224



>gb|ACJ85748.1| unknown [Medicago truncatula]
 gb|AFK40384.1| unknown [Medicago truncatula]
 gb|AFK49114.1| unknown [Medicago truncatula]
Length=553

 Score =   390 bits (1001),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 186/224 (83%), Positives = 203/224 (91%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETPAGFA+FKVL+EGKLSKVEDL  EF+TAD ARKVVKLKAF+KF NTSEAL AA
Sbjct  1    MLLLFETPAGFAIFKVLNEGKLSKVEDLQNEFTTADAARKVVKLKAFNKFANTSEALEAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLIDSK SKGLRKFLR HC+ +TL VADSKLGN IKEKL+I+CVHN+ VMELMRG+R Q
Sbjct  61   TLLIDSKASKGLRKFLRVHCENETLGVADSKLGNIIKEKLKIECVHNNAVMELMRGVRYQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            L ELI GL VQD+APMSLGL HSLSRY+LKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LNELIAGLAVQDMAPMSLGLPHSLSRYRLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL KI+ DNIQYA++VKLMG+R NAAKLDFSEIL
Sbjct  181  VREWYGWHFPELTKIIVDNIQYARSVKLMGNRINAAKLDFSEIL  224



>ref|XP_006408115.1| hypothetical protein EUTSA_v10020473mg [Eutrema salsugineum]
 gb|ESQ49568.1| hypothetical protein EUTSA_v10020473mg [Eutrema salsugineum]
Length=541

 Score =   385 bits (989),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/224 (81%), Positives = 205/224 (92%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETP GFALFKVLDEG+LS VEDL KEF++ D+ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLVLFETPGGFALFKVLDEGRLSNVEDLGKEFASPDSARKMVKLKAFDKFDNTSEALEAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGAPSKGLRKFLKANCEGETLAVADSKLGNVIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
             TELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  FTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKI+QDNI YAK+VKLMG+R NAAKLDFSEIL
Sbjct  181  VREWYGWHFPELAKIIQDNILYAKSVKLMGNRINAAKLDFSEIL  224



>tpg|DAA47456.1| TPA: hypothetical protein ZEAMMB73_782083 [Zea mays]
Length=309

 Score =   377 bits (967),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 199/225 (88%), Gaps = 12/225 (5%)
 Frame = +1

Query  145  EMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSA  324
            +MLVLFETPAGF LFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSA
Sbjct  94   KMLVLFETPAGFTLFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSA  153

Query  325  ATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  504
            ATL+IDSKPSKGLRKFL+ HC+G+TL VADSKLGNAIKEKL            LMRGLRN
Sbjct  154  ATLIIDSKPSKGLRKFLQKHCEGETLVVADSKLGNAIKEKL------------LMRGLRN  201

Query  505  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  684
            QLTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+Q I LLDDLDKELNTYAM
Sbjct  202  QLTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQDIGLLDDLDKELNTYAM  261

Query  685  RVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            RVREWYGWHFPEL KIV DNIQYAK VK+MG+R NA  LDFS+++
Sbjct  262  RVREWYGWHFPELTKIVTDNIQYAKVVKMMGNRVNAVNLDFSKVI  306



>ref|XP_010421656.1| PREDICTED: probable nucleolar protein 5-1 isoform X2 [Camelina 
sativa]
Length=529

 Score =   383 bits (984),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 184/224 (82%), Positives = 201/224 (90%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETP GFALFKVL EGKLS  EDL  EF TA++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLVLFETPGGFALFKVLKEGKLSNAEDLGNEFMTAESARKMVKLKAFDKFDNTSEALEAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L+D  PSKGLRKFL+++CDG+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLDGTPSKGLRKFLKANCDGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG  DLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDNDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKIVQDNI YAK VKLMGDR NAAKLDFSEIL
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKAVKLMGDRINAAKLDFSEIL  224



>gb|AAC16331.1| SAR DNA-binding protein-2 [Pisum sativum]
Length=550

 Score =   384 bits (985),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 188/224 (84%), Positives = 198/224 (88%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFET AGFALFKVLDEGKLSKVEDL + FS+ADTARKVVKLKAFSKFENTSEAL +A
Sbjct  1    MLLLFETAAGFALFKVLDEGKLSKVEDLQQSFSSADTARKVVKLKAFSKFENTSEALKSA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
             LLID K SK LRKFL  HC  +TL VAD+KL + IKEKLQIDCVHN  VMELMRG+R Q
Sbjct  61   NLLIDGKASKDLRKFLSVHCQNETLGVADTKLASIIKEKLQIDCVHNVGVMELMRGVRYQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI GL VQD+APMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLAVQDMAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL KI+ DNIQYAK VKLMGDR NAAKLDFSEIL
Sbjct  181  VREWYGWHFPELTKIILDNIQYAKAVKLMGDRINAAKLDFSEIL  224



>ref|XP_010455156.1| PREDICTED: probable nucleolar protein 5-1 [Camelina sativa]
Length=529

 Score =   382 bits (981),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 183/224 (82%), Positives = 202/224 (90%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETP GFALFKVL EGKLS VEDL  EF TA++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLVLFETPGGFALFKVLKEGKLSNVEDLGNEFMTAESARKMVKLKAFDKFDNTSEALEAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L++  PSKGLRKFL+++CDG+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCDGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG  DLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDNDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKIVQDNI YAK VKLMG+R NAAKLDFSEIL
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKAVKLMGNRINAAKLDFSEIL  224



>emb|CDX80674.1| BnaC07g27700D [Brassica napus]
Length=536

 Score =   382 bits (981),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 181/224 (81%), Positives = 204/224 (91%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETP GFALFKVLDEGKLS VEDL   FS+AD+ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLVLFETPGGFALFKVLDEGKLSNVEDLGNVFSSADSARKMVKLKAFDKFDNTSEALEAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGAPSKGLRKFLKANCEGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            L+ELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKI+ DNI YAK+VKLMG+R NAAKLDFSEIL
Sbjct  181  VREWYGWHFPELAKIISDNILYAKSVKLMGNRINAAKLDFSEIL  224



>tpg|DAA47457.1| TPA: hypothetical protein ZEAMMB73_782083 [Zea mays]
Length=469

 Score =   379 bits (974),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 199/225 (88%), Gaps = 12/225 (5%)
 Frame = +1

Query  145  EMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSA  324
            +MLVLFETPAGF LFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSA
Sbjct  94   KMLVLFETPAGFTLFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSA  153

Query  325  ATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  504
            ATL+IDSKPSKGLRKFL+ HC+G+TL VADSKLGNAIKEKL            LMRGLRN
Sbjct  154  ATLIIDSKPSKGLRKFLQKHCEGETLVVADSKLGNAIKEKL------------LMRGLRN  201

Query  505  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  684
            QLTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+Q I LLDDLDKELNTYAM
Sbjct  202  QLTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQDIGLLDDLDKELNTYAM  261

Query  685  RVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            RVREWYGWHFPEL KIV DNIQYAK VK+MG+R NA  LDFS+IL
Sbjct  262  RVREWYGWHFPELTKIVTDNIQYAKVVKMMGNRVNAVNLDFSKIL  306



>ref|XP_009151230.1| PREDICTED: probable nucleolar protein 5-1 [Brassica rapa]
 emb|CDX86179.1| BnaA06g28960D [Brassica napus]
Length=537

 Score =   381 bits (979),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 181/224 (81%), Positives = 203/224 (91%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETP GFALFKVLDEGKLS VEDL   FS+AD ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLVLFETPGGFALFKVLDEGKLSNVEDLGNVFSSADAARKMVKLKAFDKFDNTSEALEAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGAPSKGLRKFLKANCEGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            L+ELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKI+ DNI YAK+VKLMG+R NAAKLDFSEIL
Sbjct  181  VREWYGWHFPELAKIISDNILYAKSVKLMGNRINAAKLDFSEIL  224



>ref|XP_010494044.1| PREDICTED: probable nucleolar protein 5-1 [Camelina sativa]
Length=531

 Score =   380 bits (977),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 182/224 (81%), Positives = 202/224 (90%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETP GFALFKVL EGKLS VEDL  EF TA++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLVLFETPGGFALFKVLKEGKLSNVEDLGNEFMTAESARKMVKLKAFDKFDNTSEALEAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L++  PSKGLRKFL+++CDG+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCDGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTEL++GLG  DLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELLSGLGDNDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKIVQDNI YAK VKLMG+R NAAKLDFSEIL
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKAVKLMGNRINAAKLDFSEIL  224



>emb|CDY19706.1| BnaA09g03590D [Brassica napus]
Length=535

 Score =   381 bits (978),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 180/224 (80%), Positives = 205/224 (92%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETPAGFA+FKVLDEGKLS VEDL   FS+A++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLLLFETPAGFAVFKVLDEGKLSNVEDLGNVFSSAESARKMVKLKAFDKFDNTSEALEAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCEGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKI+ DNI YAK+VKLMG+R NAAKLDFSEIL
Sbjct  181  VREWYGWHFPELAKIISDNILYAKSVKLMGNRINAAKLDFSEIL  224



>emb|CDY00004.1| BnaC09g02970D [Brassica napus]
Length=536

 Score =   381 bits (978),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 180/224 (80%), Positives = 205/224 (92%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETPAGFA+FKVLDEGKLS VEDL   FS+A++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLLLFETPAGFAVFKVLDEGKLSNVEDLGNVFSSAESARKMVKLKAFDKFDNTSEALEAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCEGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKI+ DNI YAK+VKLMG+R NAAKLDFSEIL
Sbjct  181  VREWYGWHFPELAKIISDNILYAKSVKLMGNRINAAKLDFSEIL  224



>ref|XP_006394992.1| hypothetical protein EUTSA_v10003966mg [Eutrema salsugineum]
 gb|ESQ32278.1| hypothetical protein EUTSA_v10003966mg [Eutrema salsugineum]
Length=536

 Score =   379 bits (972),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 180/224 (80%), Positives = 203/224 (91%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLS VEDL   FS+A +ARK+VKL+AF KF+NTSEAL A 
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSNVEDLGNLFSSAASARKMVKLQAFDKFDNTSEALEAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L++  PSKGLRKFL+++C+G+ LAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGAPSKGLRKFLKANCEGEALAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
             TELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  FTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKI+QDNI YAK+VKLMG+R NAAKLDFSEIL
Sbjct  181  VREWYGWHFPELAKIIQDNILYAKSVKLMGNRINAAKLDFSEIL  224



>gb|AFW84118.1| hypothetical protein ZEAMMB73_870642 [Zea mays]
Length=586

 Score =   379 bits (974),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 190/229 (83%), Positives = 208/229 (91%), Gaps = 5/229 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            +LVL ETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  8    LLVLLETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  67

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TL+IDSKPSKGL KFL+ HC G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  68   TLIIDSKPSKGLHKFLQKHCQGETLAVADSKLGNAIKEKLKIDCLHNSVVMELMRGLRNQ  127

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDK-----VDTMIVQAISLLDDLDKELN  672
            LTELITG G QDL PMSLGLSHSLSRYKLKFSP+K     VDTMI+QAI LLDDLDK+LN
Sbjct  128  LTELITGFGAQDLGPMSLGLSHSLSRYKLKFSPEKACLISVDTMIIQAIGLLDDLDKDLN  187

Query  673  TYAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            T+AMRVREWYGWHFPEL KIV DNIQYAK VK+MG+R NA  LDFSEIL
Sbjct  188  TFAMRVREWYGWHFPELTKIVSDNIQYAKVVKMMGNRANAVNLDFSEIL  236



>gb|KFK37913.1| hypothetical protein AALP_AA3G046300 [Arabis alpina]
Length=529

 Score =   377 bits (968),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 181/224 (81%), Positives = 200/224 (89%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            M+VLFETPAGFALFKV DEGKLS VE L KEFST D ARK+VKL AF KF+NTSEAL A 
Sbjct  1    MIVLFETPAGFALFKVKDEGKLSDVESLGKEFSTPDLARKMVKLIAFDKFDNTSEALEAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L+D  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLDGTPSKGLRKFLKANCQGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
             TELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  FTELISGLGDQDLAPMSLGLSHSLARYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKI+ DNI YAK+VKLMG+R NAAKLDFSEIL
Sbjct  181  VREWYGWHFPELAKIISDNILYAKSVKLMGNRINAAKLDFSEIL  224



>ref|XP_009111930.1| PREDICTED: probable nucleolar protein 5-1 [Brassica rapa]
Length=536

 Score =   376 bits (966),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 179/224 (80%), Positives = 204/224 (91%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETPAGFA+FKVLDEGKLS VEDL   FS+A++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLLLFETPAGFAVFKVLDEGKLSNVEDLGNVFSSAESARKMVKLKAFDKFDNTSEALEAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCEGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKI+ DNI  AK+VKLMG+R NAAKLDFSEIL
Sbjct  181  VREWYGWHFPELAKIISDNILDAKSVKLMGNRINAAKLDFSEIL  224



>gb|AAN72071.1| SAR DNA-binding protein - like [Arabidopsis thaliana]
Length=423

 Score =   371 bits (952),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 199/224 (89%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETP GFA+FKVL+EGKLS VEDL  EFSTA  ARK+VKL AF KF+NT+EAL A 
Sbjct  1    MLILFETPGGFAIFKVLNEGKLSNVEDLGNEFSTAKLARKMVKLVAFDKFDNTAEALEAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L++  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+I CVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCVGETLAVADSKLGNIIKEKLKIVCVHNNAVMELLRGIRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG QDL PMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLGPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREW+GWHFPELAKIVQDNI YAK VKLMG+R NAAKLDFSEIL
Sbjct  181  VREWFGWHFPELAKIVQDNILYAKAVKLMGNRINAAKLDFSEIL  224



>emb|CDY52494.1| BnaAnng11410D [Brassica napus]
Length=531

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 201/224 (90%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETP GFA+FKVLDEGKLS VEDL   FS+A++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLLLFETPGGFAIFKVLDEGKLSNVEDLGNVFSSAESARKMVKLKAFDKFDNTSEALEAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L++  PSKGLRKFL+++C  +TLAVADSKLGN IKEKL IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLVEGTPSKGLRKFLKANCKDETLAVADSKLGNIIKEKLTIDCVHNNAVMELLRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            L+ELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGEQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKI+ DNI YAK+VKLMG+R NAAKLDFSEIL
Sbjct  181  VREWYGWHFPELAKIISDNILYAKSVKLMGNRINAAKLDFSEIL  224



>ref|XP_002884489.1| hypothetical protein ARALYDRAFT_896572 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60748.1| hypothetical protein ARALYDRAFT_896572 [Arabidopsis lyrata subsp. 
lyrata]
Length=531

 Score =   374 bits (960),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 201/224 (90%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            +LVL+ET AGFALFKV DEGK++ VEDL KEF T D+ARK+VKLKAF KF+NTSEAL A 
Sbjct  2    VLVLYETAAGFALFKVKDEGKMANVEDLCKEFDTPDSARKMVKLKAFEKFDNTSEALEAV  61

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L++  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+IDC+HN+ VMEL+RG+R+Q
Sbjct  62   AKLLEGAPSKGLRKFLKANCQGETLAVADSKLGNVIKEKLKIDCIHNNAVMELLRGVRSQ  121

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
             TELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  122  FTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  181

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKI+ DNI YAK+VKLMG+R NAAKLDFSEIL
Sbjct  182  VREWYGWHFPELAKIISDNILYAKSVKLMGNRVNAAKLDFSEIL  225



>ref|NP_187157.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
 sp|Q9MAB3.1|NOP5B_ARATH RecName: Full=Probable nucleolar protein 5-2; AltName: Full=MAR-binding 
NOP56/58 homolog 2; AltName: Full=Nucleolar protein 
58-2 [Arabidopsis thaliana]
 gb|AAF27012.1|AC009177_2 putative SAR DNA-binding protein-1 [Arabidopsis thaliana]
 gb|AAG40837.1|AF302491_1 NOP58-like protein [Arabidopsis thaliana]
 gb|AAL06533.1|AF412080_1 AT3g05060/T12H1_2 [Arabidopsis thaliana]
 gb|AEE74181.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
Length=533

 Score =   374 bits (960),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 201/224 (90%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            +LVL+ET AGFALFKV DEGK++ VEDL KEF T D+ARK+VKLKAF KF+NTSEAL A 
Sbjct  2    VLVLYETAAGFALFKVKDEGKMANVEDLCKEFDTPDSARKMVKLKAFEKFDNTSEALEAV  61

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L++  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+IDC+HN+ VMEL+RG+R+Q
Sbjct  62   AKLLEGAPSKGLRKFLKANCQGETLAVADSKLGNVIKEKLKIDCIHNNAVMELLRGVRSQ  121

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
             TELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  122  FTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  181

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKI+ DNI YAK+VKLMG+R NAAKLDFSEIL
Sbjct  182  VREWYGWHFPELAKIISDNILYAKSVKLMGNRVNAAKLDFSEIL  225



>gb|AAB61073.1| similar to S. cerevisiae SIK1P (PID:g984964) [Arabidopsis thaliana]
Length=439

 Score =   370 bits (950),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 199/224 (89%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETP GFA+FKVL+EGKLS VEDL  EFSTA  ARK+VKL AF KF+NT+EAL A 
Sbjct  1    MLILFETPGGFAIFKVLNEGKLSNVEDLGNEFSTAKLARKMVKLVAFDKFDNTAEALEAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L++  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+I CVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCVGETLAVADSKLGNIIKEKLKIVCVHNNAVMELLRGIRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG QDL PMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLGPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREW+GWHFPELAKIVQDNI YAK VKLMG+R NAAKLDFSEIL
Sbjct  181  VREWFGWHFPELAKIVQDNILYAKAVKLMGNRINAAKLDFSEIL  224



>ref|XP_001756465.1| predicted protein [Physcomitrella patens]
 gb|EDQ78861.1| predicted protein [Physcomitrella patens]
Length=558

 Score =   374 bits (961),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 200/224 (89%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML LFETPAGFALFKVL+EGKL   E+L+KEF TAD ARK+VKLKAF KFENT++AL+AA
Sbjct  1    MLALFETPAGFALFKVLNEGKLDASEELYKEFETADAARKMVKLKAFDKFENTTDALNAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            + L+DSK  KGLRKFL+  C G+TLA+ADSKLG AI +KL+I+CV+N+ V ELMRGLR+Q
Sbjct  61   SHLVDSKLPKGLRKFLKKQCQGETLAIADSKLGKAISDKLEINCVNNAAVAELMRGLRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            L+ELI+GL   D+APMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLAGHDMAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKIVQDN+QYAK+VKLMG RTNAA LDFS IL
Sbjct  181  VREWYGWHFPELAKIVQDNVQYAKSVKLMGSRTNAADLDFSGIL  224



>ref|XP_010485906.1| PREDICTED: probable nucleolar protein 5-2 [Camelina sativa]
 ref|XP_010485908.1| PREDICTED: probable nucleolar protein 5-2 [Camelina sativa]
Length=535

 Score =   371 bits (953),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 200/224 (89%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            M+VL ETPAGFALFKV DEGKL+ +EDL KEF T D+ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MIVLVETPAGFALFKVKDEGKLANLEDLAKEFETPDSARKIVKLKAFDKFDNTSEALEAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L +  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   VKLHEGTPSKGLRKFLKANCEGETLAVADSKLGNVIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
             TEL++GLG QD+APM LGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  FTELLSGLGDQDMAPMRLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKI+ DNI YAK+VKLMG+R NAAKLDFSEIL
Sbjct  181  VREWYGWHFPELAKIISDNILYAKSVKLMGNRINAAKLDFSEIL  224



>ref|XP_010422824.1| PREDICTED: probable nucleolar protein 5-2 [Camelina sativa]
Length=554

 Score =   372 bits (954),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 200/224 (89%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            M++L ETPAGFALFKV DEGKL+ +EDL KEF T D+ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MIILVETPAGFALFKVKDEGKLANIEDLAKEFETPDSARKIVKLKAFDKFDNTSEALEAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L +  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   VKLHEGTPSKGLRKFLKANCEGETLAVADSKLGNVIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
             TEL++GLG QD+APM LGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  FTELLSGLGDQDMAPMRLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKI+ DNI YAK+VKLMG+R NAAKLDFSEIL
Sbjct  181  VREWYGWHFPELAKIISDNILYAKSVKLMGNRINAAKLDFSEIL  224



>ref|NP_198064.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
 sp|O04658.2|NOP5A_ARATH RecName: Full=Probable nucleolar protein 5-1; AltName: Full=MAR-binding 
NOP56/58 homolog 1; AltName: Full=NOP58-like protein 
F108; AltName: Full=Nucleolar protein 58-1 [Arabidopsis 
thaliana]
 gb|AAG40836.1|AF302490_1 NOP58-like protein F108 [Arabidopsis thaliana]
 gb|AAL66978.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
 gb|AAM20318.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
 gb|AED93652.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
Length=533

 Score =   370 bits (951),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 199/224 (89%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETP GFA+FKVL+EGKLS VEDL  EFSTA  ARK+VKL AF KF+NT+EAL A 
Sbjct  1    MLILFETPGGFAIFKVLNEGKLSNVEDLGNEFSTAKLARKMVKLVAFDKFDNTAEALEAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L++  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+I CVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCVGETLAVADSKLGNIIKEKLKIVCVHNNAVMELLRGIRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG QDL PMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLGPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREW+GWHFPELAKIVQDNI YAK VKLMG+R NAAKLDFSEIL
Sbjct  181  VREWFGWHFPELAKIVQDNILYAKAVKLMGNRINAAKLDFSEIL  224



>ref|XP_001753892.1| predicted protein [Physcomitrella patens]
 gb|EDQ81214.1| predicted protein [Physcomitrella patens]
Length=578

 Score =   372 bits (954),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 200/224 (89%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML LFETPAGFALFKVL+EGKL   E+L+KEF TAD ARK+VKLKAF KFENT++AL+AA
Sbjct  1    MLALFETPAGFALFKVLNEGKLDASEELYKEFETADLARKMVKLKAFEKFENTTDALNAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            + L++SK  KGLRKFL+  C G+TLA+ADSKLG AI +KL+I+CV+N+ V ELMRGLR+Q
Sbjct  61   SHLVESKLPKGLRKFLKKECQGETLAIADSKLGKAISDKLEINCVNNAAVAELMRGLRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            L+ELI+GL   D+APMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLAGHDMAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKIVQDN+QYAK+VKLMG RTNAA LDFS IL
Sbjct  181  VREWYGWHFPELAKIVQDNVQYAKSVKLMGSRTNAADLDFSGIL  224



>ref|XP_002874406.1| hypothetical protein ARALYDRAFT_489610 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50665.1| hypothetical protein ARALYDRAFT_489610 [Arabidopsis lyrata subsp. 
lyrata]
Length=532

 Score =   370 bits (950),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 200/224 (89%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            M +LFETP GFA+FKVLDEGKLS VED+  EF TA +ARK+VKL AF KF+NT+EAL A 
Sbjct  1    MHILFETPGGFAIFKVLDEGKLSNVEDIGNEFLTAKSARKMVKLVAFDKFDNTAEALEAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L++  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCVGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            L+ELI+GLG +DLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGDKDLAPMSLGLSHSLARYKLKFSTDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKIVQDNI YAK VKLMG+R NAAKLDFSEIL
Sbjct  181  VREWYGWHFPELAKIVQDNILYAKAVKLMGNRVNAAKLDFSEIL  224



>emb|CAE45597.1| SAR DNA-binding protein-like protein [Lotus japonicus]
Length=537

 Score =   369 bits (948),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 180/221 (81%), Positives = 192/221 (87%), Gaps = 14/221 (6%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVE              VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVE--------------VVKLKAFSKFENTSEALEAA  46

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            TLLID K SKGLRKFLR+HC+ + LAVADSKLGN IKEKL+IDCVHN+ VMELMRG+RNQ
Sbjct  47   TLLIDGKASKGLRKFLRAHCEDEMLAVADSKLGNMIKEKLKIDCVHNNAVMELMRGVRNQ  106

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            L ELI+GL VQD+APMSLGLSHSLSRYKLKFS +KVDTM+VQAI LLDDLDKELNTYAMR
Sbjct  107  LNELISGLAVQDMAPMSLGLSHSLSRYKLKFSAEKVDTMVVQAIGLLDDLDKELNTYAMR  166

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFS  810
            VREWYGWHFPEL KI+QDNIQYAK VKLMGDR NAA+ DFS
Sbjct  167  VREWYGWHFPELTKIIQDNIQYAKAVKLMGDRVNAAQTDFS  207



>ref|XP_010464014.1| PREDICTED: probable nucleolar protein 5-2 [Camelina sativa]
Length=553

 Score =   368 bits (945),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 200/224 (89%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+L ETPAGFA+FK+ DEGKL+ +EDL KEF TA++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLILVETPAGFAVFKLKDEGKLANIEDLAKEFETAESARKIVKLKAFDKFDNTSEALEAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L +  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   VKLHEGTPSKGLRKFLKANCEGETLAVADSKLGNVIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
             TEL++GLG  D+APM LGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  FTELLSGLGDHDMAPMRLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKI+ DNI YAK+VKLMG+R NAAKLDFSEIL
Sbjct  181  VREWYGWHFPELAKIISDNILYAKSVKLMGNRINAAKLDFSEIL  224



>ref|XP_006287421.1| hypothetical protein CARUB_v10000627mg, partial [Capsella rubella]
 gb|EOA20319.1| hypothetical protein CARUB_v10000627mg, partial [Capsella rubella]
Length=551

 Score =   368 bits (944),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = +1

Query  145  EMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSA  324
            +ML LFETP GFALFKVL EGKLS VEDL  EF TA++ARK+V+LKAF KF+NTS+AL A
Sbjct  20   KMLALFETPGGFALFKVLKEGKLSNVEDLGNEFLTAESARKMVQLKAFDKFDNTSDALEA  79

Query  325  ATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  504
               L +   SK LRKFL+S+CDG+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+
Sbjct  80   VAKLREGTASKSLRKFLKSNCDGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRS  139

Query  505  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  684
            Q TELI+GLG  DLAPMSLGLSHSL+RY LKFS DKVDTMI+QAI LLDDLDKELNTYAM
Sbjct  140  QFTELISGLGDNDLAPMSLGLSHSLARYTLKFSSDKVDTMIIQAIGLLDDLDKELNTYAM  199

Query  685  RVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            RVREWYGWHFPELAKIVQDNI YAK VKLMGDR NAAKLDFSEIL
Sbjct  200  RVREWYGWHFPELAKIVQDNILYAKAVKLMGDRINAAKLDFSEIL  244



>ref|XP_011457678.1| PREDICTED: probable nucleolar protein 5-2 [Fragaria vesca subsp. 
vesca]
Length=548

 Score =   367 bits (942),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 175/227 (77%), Positives = 200/227 (88%), Gaps = 3/227 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVL-DEGKLSKVE--DLWKEFSTADTARKVVKLKAFSKFENTSEAL  318
            ML+LFE P GF LFKVL D+GK +K E  D+ KEF T ++ARKVVKLKAFSKFEN SEAL
Sbjct  1    MLLLFENPGGFMLFKVLKDDGKFTKAEAHDIAKEFETGESARKVVKLKAFSKFENMSEAL  60

Query  319  SAATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
             AAT+LIDSKP+K LRKFL+ HC+G+ L VADSKLGN IKEKL+I+CVH++ VMELMRG+
Sbjct  61   EAATMLIDSKPTKDLRKFLKKHCEGEILGVADSKLGNIIKEKLKIECVHDNAVMELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R+QL +++TGL +QD+APMSLGLSHSLSRYKLKFS DKVDTM++QAI LLDDLDKELNTY
Sbjct  121  RSQLNDVVTGLQLQDMAPMSLGLSHSLSRYKLKFSADKVDTMVIQAIGLLDDLDKELNTY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            AMRVREWYGWHFPELAKI+QDNI YAK VKLMG R NAAKLDFSEIL
Sbjct  181  AMRVREWYGWHFPELAKIIQDNIAYAKAVKLMGFRVNAAKLDFSEIL  227



>gb|KFK23538.1| hypothetical protein AALP_AAs63573U000200 [Arabis alpina]
Length=483

 Score =   364 bits (934),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 180/240 (75%), Positives = 200/240 (83%), Gaps = 16/240 (7%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            M+VLFETPAGFALFKV DEGKLS VE L KEFST D ARK+VKL AF KF+NTSEAL A 
Sbjct  1    MIVLFETPAGFALFKVKDEGKLSDVESLGKEFSTPDLARKMVKLIAFDKFDNTSEALEAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L+D  PSKGLRKFL+++C G+TLAVADSKLGN IK+KL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLDGSPSKGLRKFLKANCQGETLAVADSKLGNVIKDKLKIDCVHNNAVMELLRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDK----------------VDTMIVQAI  639
             TELI+GLG QDLAPMSLGLSHSL+RYKLKFS DK                VDTMI+QAI
Sbjct  121  FTELISGLGDQDLAPMSLGLSHSLARYKLKFSVDKGYLTSVPTSYVGLFYLVDTMIIQAI  180

Query  640  SLLDDLDKELNTYAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
             LLDDLDKELNTYAMRVREWYGWH+PELAKIV DNI YAK+VKLMG+R NAAKLDFSEIL
Sbjct  181  GLLDDLDKELNTYAMRVREWYGWHYPELAKIVSDNILYAKSVKLMGNRINAAKLDFSEIL  240



>ref|XP_006297275.1| hypothetical protein CARUB_v10013290mg, partial [Capsella rubella]
 gb|EOA30173.1| hypothetical protein CARUB_v10013290mg, partial [Capsella rubella]
Length=593

 Score =   365 bits (938),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = +1

Query  145  EMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSA  324
            +M++L ETPAGF LFKV D GKLS VEDL KEF T D+ARK+VKL AF KF+NTSEAL A
Sbjct  35   KMILLVETPAGFGLFKVKDVGKLSNVEDLGKEFDTPDSARKMVKLLAFDKFDNTSEALEA  94

Query  325  ATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  504
               L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+I+CVHN+ VMEL+RG+R+
Sbjct  95   VAKLLEGTPSKGLRKFLKANCEGETLAVADSKLGNVIKEKLKIECVHNNAVMELLRGVRS  154

Query  505  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  684
            Q TELI+GLG QD+APM LGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAM
Sbjct  155  QFTELISGLGDQDMAPMRLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAM  214

Query  685  RVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            RVREWYGWHFPELAKI+ DNI YAK+VKLMG+R NAAKLDFSEIL
Sbjct  215  RVREWYGWHFPELAKIISDNILYAKSVKLMGNRINAAKLDFSEIL  259



>ref|XP_002970093.1| hypothetical protein SELMODRAFT_146841 [Selaginella moellendorffii]
 gb|EFJ29217.1| hypothetical protein SELMODRAFT_146841 [Selaginella moellendorffii]
Length=575

 Score =   356 bits (914),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 167/224 (75%), Positives = 192/224 (86%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVL ETPAGFALFK+LDE KL++V+D+WKEF T   AR++VKLK+F KFENT+EAL AA
Sbjct  1    MLVLVETPAGFALFKLLDEAKLNQVDDIWKEFETPAAARQIVKLKSFHKFENTAEALGAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T +++SK SKGL+KFL++ C G TLA+ADSKLG  I EKL+I C+HN+ VMEL+RG+R+Q
Sbjct  61   TAIVESKLSKGLKKFLKAECQGQTLAIADSKLGRIITEKLEISCIHNNGVMELLRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            L +L+ GL  QDLA MSLGLSHSL RY LKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LADLVEGLSNQDLASMSLGLSHSLCRYTLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKIV DNIQYAK+VKLM  R NA  LDFSEIL
Sbjct  181  VREWYGWHFPELAKIVTDNIQYAKSVKLMKKRVNAPDLDFSEIL  224



>ref|XP_002985284.1| hypothetical protein SELMODRAFT_121625 [Selaginella moellendorffii]
 gb|EFJ13778.1| hypothetical protein SELMODRAFT_121625 [Selaginella moellendorffii]
Length=576

 Score =   351 bits (901),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 165/224 (74%), Positives = 191/224 (85%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVL ETPAGFALFK+LDE KL++V+D+WKEF T   AR++VKLK+F KFENT+EAL AA
Sbjct  1    MLVLVETPAGFALFKLLDEAKLNQVDDIWKEFETPAAARQIVKLKSFHKFENTAEALGAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T +++SK SKGL+KFL++ C G  LA+ADSKLG  I EKL+I C+H++ VMEL+RG+R+Q
Sbjct  61   TAIVESKLSKGLKKFLKAECQGQILAIADSKLGRIITEKLEISCIHSNGVMELLRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            L +L+ GL  QDLA MSLGLSHSL RY LKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LADLVEGLSNQDLASMSLGLSHSLCRYTLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPELAKIV DNIQYAK+VKLM  R NA  LDFSEIL
Sbjct  181  VREWYGWHFPELAKIVTDNIQYAKSVKLMKKRVNAPDLDFSEIL  224



>gb|KJB26512.1| hypothetical protein B456_004G245100 [Gossypium raimondii]
Length=531

 Score =   345 bits (884),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = +1

Query  265  KVVKLKAFSKFENTSEALSAATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEK  444
            KVV LKAFSKFENT+EAL AAT L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEK
Sbjct  4    KVVSLKAFSKFENTAEALEAATKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEK  63

Query  445  LQIDCVHNSTVMELMRGLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTM  624
            L+IDC+HN++VMEL+RG+R QLTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTM
Sbjct  64   LKIDCIHNTSVMELLRGVRTQLTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTM  123

Query  625  IVQAISLLDDLDKELNTYAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLD  804
            IVQAI LLDDLDKELNTYAMR+REWYGWHFPEL +IVQDNI YAKTVKLMGDR NAAKLD
Sbjct  124  IVQAIGLLDDLDKELNTYAMRIREWYGWHFPELTRIVQDNIHYAKTVKLMGDRANAAKLD  183

Query  805  FSEILP  822
            FSEILP
Sbjct  184  FSEILP  189



>ref|XP_005850162.1| hypothetical protein CHLNCDRAFT_57124 [Chlorella variabilis]
 gb|EFN58060.1| hypothetical protein CHLNCDRAFT_57124 [Chlorella variabilis]
Length=1332

 Score =   355 bits (911),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 192/226 (85%), Gaps = 2/226 (1%)
 Frame = +1

Query  148   MLVLFETPAGFALFKVLDEGKLSKVE--DLWKEFSTADTARKVVKLKAFSKFENTSEALS  321
             ML+LFE+ AGFALFKVLDEGKL + E  D+W +F T + A+KVVKLKAFSKFENT+EAL 
Sbjct  918   MLLLFESSAGFALFKVLDEGKLREAETKDVWSDFETPEAAKKVVKLKAFSKFENTTEALQ  977

Query  322   AATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  501
             AA  L+DSK SKGL+KFL+ H +GDTLAV D+KLGN IKEKL I+C+++S VMEL RG+R
Sbjct  978   AAASLVDSKISKGLKKFLKKHAEGDTLAVLDAKLGNVIKEKLGINCLYSSGVMELTRGIR  1037

Query  502   NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  681
             NQLT L+ GL  QDL PMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYA
Sbjct  1038  NQLTNLVGGLSAQDLRPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYA  1097

Query  682   MRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
             MRVREWYGWHFPE+ KIV DNI YAKTVKLMG R  AA +DFS+ L
Sbjct  1098  MRVREWYGWHFPEMTKIVADNIAYAKTVKLMGTRDQAAGIDFSDFL  1143



>emb|CDY50583.1| BnaC02g39570D [Brassica napus]
Length=525

 Score =   329 bits (844),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = +1

Query  226  DLWKEFSTADTARKVVKLKAFSKFENTSEALSAATLLIDSKPSKGLRKFLRSHCDGDTLA  405
            DL   FS+ ++ARK+VKLKAF KF+NTS+AL A   L++  PSKGLRKFL+++C G+TLA
Sbjct  17   DLGNVFSSPESARKMVKLKAFDKFDNTSDALEAVAKLVEGTPSKGLRKFLKANCKGETLA  76

Query  406  VADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQLTELITGLGVQDLAPMSLGLSHSLSR  585
            VADSKLGN IKEKL IDCVHN+ VMEL+RG+R+QL+ELITGLG QDLAPMSLGLSHSL+R
Sbjct  77   VADSKLGNIIKEKLTIDCVHNNAVMELLRGVRSQLSELITGLGEQDLAPMSLGLSHSLAR  136

Query  586  YKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMRVREWYGWHFPELAKIVQDNIQYAKTV  765
            YKLKFS DKVDTMI+QAI LLDDLDKELNTYAMRVREWYGWHFPELAKI+ DNI YAK+V
Sbjct  137  YKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMRVREWYGWHFPELAKIISDNILYAKSV  196

Query  766  KLMGDRTNAAKLDFSEIL  819
            KLMG+R NAAKLDFSEIL
Sbjct  197  KLMGNRINAAKLDFSEIL  214



>ref|XP_005650009.1| Nop-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25465.1| Nop-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=554

 Score =   326 bits (836),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/224 (72%), Positives = 185/224 (83%), Gaps = 1/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFET AGFALFKVL E K+ + EDLW++F T D A+KVVKLKAFSKFE+T +AL+AA
Sbjct  1    MLLLFETAAGFALFKVLQENKIQETEDLWQDFQTLDAAQKVVKLKAFSKFESTIDALAAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T L DSK SK L+KFL+ + DG TL VAD+KLG+ IKEKL I C++++ V EL RG+R+Q
Sbjct  61   TALGDSKLSKDLKKFLKKNADGKTLGVADAKLGSIIKEKLGIPCIYSNGVQELTRGVRSQ  120

Query  508  LTELITGL-GVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  684
            +  LI+GL G QDL PMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAM
Sbjct  121  IEGLISGLAGGQDLTPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAM  180

Query  685  RVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEI  816
            RVREWYGWHFPE+ KIV DNI YAK +KLMG R NA   DFS I
Sbjct  181  RVREWYGWHFPEMTKIVTDNIVYAKVIKLMGTRENAVDKDFSGI  224



>emb|CEF96991.1| NOSIC [Ostreococcus tauri]
Length=476

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/224 (73%), Positives = 187/224 (83%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETPAG++LFKV DE KL  VE L   FST + A+K+V +KAFSKFENT+EAL+AA
Sbjct  1    MLLLFETPAGYSLFKVKDEKKLGDVEKLQDAFSTVEGAKKMVSMKAFSKFENTTEALAAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L+DSK  K L+KFL  H +G+TLAVADSKLG AIKEKL I+CV +S VMELMRG+R Q
Sbjct  61   ATLVDSKVGKSLKKFLTKHAEGETLAVADSKLGAAIKEKLGINCVADSGVMELMRGVRYQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            L ELI GL   DLAPM+LGLSHSLSRYKLKFSPDKVDTM++QAI LLD+LDKELNTY+MR
Sbjct  121  LNELIGGLTDADLAPMALGLSHSLSRYKLKFSPDKVDTMVIQAIGLLDELDKELNTYSMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL KI+ DN+QYAK  KLMGDR NAA LDFS IL
Sbjct  181  VREWYGWHFPELTKIIADNMQYAKAAKLMGDRANAANLDFSGIL  224



>gb|KIY95194.1| putative nucleolar protein NOP5-2 [Monoraphidium neglectum]
Length=313

 Score =   315 bits (807),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/224 (72%), Positives = 187/224 (83%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML LFET AG+ALFKV+ EGKL K EDL+K+F T D A+KVVKLKAFSKF+NT+EAL+AA
Sbjct  1    MLFLFETAAGYALFKVVKEGKLEKSEDLYKDFETLDAAQKVVKLKAFSKFQNTTEALAAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T L+DSK  KGL+KFL+ +  G+TLAV D+KLG+ IK+KL I CV++  V EL RG+R Q
Sbjct  61   TALVDSKLDKGLKKFLKKNATGETLAVLDAKLGSLIKDKLDIPCVYSGAVQELARGVRAQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            L+ LI+GL   DL PMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LSGLISGLAGADLTPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPE+ KIV DNIQYAK +KLMG R  +A LDFS +L
Sbjct  181  VREWYGWHFPEMTKIVGDNIQYAKAIKLMGTRDRSAGLDFSGVL  224



>gb|AAZ31075.2| MAR-binding protein [Dunaliella salina]
Length=541

 Score =   319 bits (817),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/224 (69%), Positives = 181/224 (81%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            +LVLFET  G ALFKVL EGKL + ED+  +F T + A+K+VKLKAFSKF++T+EA+ AA
Sbjct  2    VLVLFETAGGLALFKVLQEGKLKQTEDVSADFGTLEQAQKMVKLKAFSKFQDTTEAMEAA  61

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T L+DSK SK ++KFLR + DG+ LA+ D KLG  ++EKL I CV+++ V+EL RG+RNQ
Sbjct  62   TALVDSKLSKPMKKFLRKNVDGEELAILDKKLGGIVQEKLGIPCVYSNAVLELTRGIRNQ  121

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            L  LI+GL   DL PMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  122  LQGLISGLSGVDLKPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  181

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPE+ KIV DNI YAK VKLMG R  AA  DFS I+
Sbjct  182  VREWYGWHFPEMTKIVNDNIAYAKVVKLMGTRDQAASHDFSGII  225



>gb|ACA96503.1| MAR-binding protein [Dunaliella salina]
Length=541

 Score =   319 bits (817),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/224 (69%), Positives = 181/224 (81%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            +LVLFET  G ALFKVL EGKL + ED+  +F T + A+K+VKLKAFSKF++T+EA+ AA
Sbjct  2    VLVLFETAGGLALFKVLQEGKLKQTEDVSADFGTLEQAQKMVKLKAFSKFQDTTEAMEAA  61

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T L+DSK SK ++KFLR + DG+ LA+ D KLG  ++EKL I CV+++ V+EL RG+RNQ
Sbjct  62   TALVDSKLSKPMKKFLRKNVDGEELAILDKKLGGIVQEKLGIPCVYSNAVLELTRGIRNQ  121

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            L  LI+GL   DL PMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  122  LQGLISGLSGVDLKPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  181

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPE+ KIV DNI YAK VKLMG R  AA  DFS I+
Sbjct  182  VREWYGWHFPEMTKIVNDNIAYAKVVKLMGTRDQAASHDFSGII  225



>ref|XP_001416562.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94855.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=474

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 160/224 (71%), Positives = 184/224 (82%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETPAG++LFKV  E KL   E L   FST + A+K+V +KAFSKFENT+EAL+AA
Sbjct  1    MLLLFETPAGYSLFKVKAEKKLQDAEKLQDAFSTVEGAKKMVSMKAFSKFENTTEALAAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L+DSK  K L+KFL  H +G+TLAVADSKLG AIKEKL I+CV +S VMELMRG+R Q
Sbjct  61   ATLVDSKVGKNLKKFLSKHAEGETLAVADSKLGAAIKEKLGINCVADSGVMELMRGVRYQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            L ELI GL   DLAPM+LGLSHSLSRYKLKFSPDKVDTM++QAI LLD+LDKELNTY+MR
Sbjct  121  LNELIGGLTDADLAPMALGLSHSLSRYKLKFSPDKVDTMVIQAIGLLDELDKELNTYSMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPEL KI+ DN+QYAK  KLMGDR  AA +DFS IL
Sbjct  181  VREWYGWHFPELTKIIADNMQYAKAAKLMGDRAKAAGIDFSGIL  224



>ref|XP_006681446.1| hypothetical protein BATDEDRAFT_33621 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77866.1| hypothetical protein BATDEDRAFT_33621 [Batrachochytrium dendrobatidis 
JAM81]
Length=518

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/229 (67%), Positives = 182/229 (79%), Gaps = 4/229 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAG+ALFK+LD+GK+S  +D+++ F T+  A K VKLKAFSKFENT++ALSA 
Sbjct  1    MLVLFETPAGYALFKLLDDGKMSAPDDIYQSFETSQAANKTVKLKAFSKFENTTDALSAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCDG----DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  495
            T L++ K SK L+ FL     G    DTLAV DSKLG AI +KL I  V ++ V EL RG
Sbjct  61   TALVEGKISKNLKSFLSKEIAGKDLSDTLAVGDSKLGAAIAKKLNIKVVSDNAVNELFRG  120

Query  496  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  675
            +R+QL+ LITGL   D+  M LGLSHSLSRYKLKFSPDKVDTMI+QAI+LLDDLDKELNT
Sbjct  121  IRSQLSSLITGLAESDMNAMVLGLSHSLSRYKLKFSPDKVDTMIIQAIALLDDLDKELNT  180

Query  676  YAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            YAMR +EWYGWHFPELAKI+ DN+ +AKTVKLMG RTNA+  DFS ILP
Sbjct  181  YAMRAKEWYGWHFPELAKIIVDNLAFAKTVKLMGVRTNASSTDFSAILP  229



>ref|XP_007512606.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17206.1| predicted protein [Bathycoccus prasinos]
Length=482

 Score =   314 bits (804),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/223 (69%), Positives = 186/223 (83%), Gaps = 0/223 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETPAG++LFKV DE KL  ++ L K FS+A++A+KVV +KAF KFENT++AL+AA
Sbjct  1    MLLLFETPAGYSLFKVKDEDKLKDIDALAKSFSSAESAKKVVSMKAFGKFENTTDALAAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              +++SK  K L+ FL+ H   +TLA+ADSKLG AIKEKL I+CV+++ VMELMRG+R+Q
Sbjct  61   ATMVESKVGKSLKTFLKKHVKDETLAIADSKLGVAIKEKLGIECVYSNNVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            L ELI GL   D+APM+LGLSHSLSRYKLKFSP+KVDTM+VQAI LLD+LDKELNTYAMR
Sbjct  121  LNELIGGLTDADIAPMALGLSHSLSRYKLKFSPEKVDTMVVQAIGLLDELDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEI  816
            VREWYGWHFPEL KI+ DN  YAK  KLMGDR NAA +DFS I
Sbjct  181  VREWYGWHFPELTKIISDNYAYAKAAKLMGDRANAANIDFSGI  223



>tpg|DAA42144.1| TPA: hypothetical protein ZEAMMB73_016967 [Zea mays]
Length=343

 Score =   306 bits (784),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +1

Query  331  LLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQL  510
            ++IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQL
Sbjct  1    MIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQL  60

Query  511  TELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMRV  690
            TELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMRV
Sbjct  61   TELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMRV  120

Query  691  REWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            REWYGWHFPEL KIV DNIQYAK VK+MG+R NA  LDFSEIL
Sbjct  121  REWYGWHFPELTKIVTDNIQYAKVVKMMGNRVNAVNLDFSEIL  163



>ref|XP_002507734.1| nucleolar RNA binding protein [Micromonas sp. RCC299]
 gb|ACO68992.1| nucleolar RNA binding protein [Micromonas sp. RCC299]
Length=471

 Score =   310 bits (793),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 178/221 (81%), Gaps = 3/221 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETPAG+ALFKV DEG L  VE   K FS+++ A+ +V L AFSKF+NTS+AL+A 
Sbjct  1    MLLLFETPAGYALFKVKDEGILENVE---KAFSSSEKAQNIVSLAAFSKFDNTSDALAAT  57

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              ++DSK  K L+KFL+ H  G+TLA+AD+KLG  IK+KL I C+ NS +MELMRG+R Q
Sbjct  58   AAMVDSKIGKDLKKFLKKHAIGETLALADAKLGGLIKDKLGISCISNSGIMELMRGVRRQ  117

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            + ELI GL   D+APM+LGLSHSLSRYKLKFSPDKVDTM+VQAI LLD+LDKELNTYAMR
Sbjct  118  VNELIGGLTDADVAPMALGLSHSLSRYKLKFSPDKVDTMVVQAIGLLDELDKELNTYAMR  177

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFS  810
            VREWYGWHFPEL KI+QDN+ YAK V  MGDR  AA+ D S
Sbjct  178  VREWYGWHFPELTKIIQDNMLYAKVVVQMGDRATAAQHDLS  218



>gb|EEE59058.1| hypothetical protein OsJ_10836 [Oryza sativa Japonica Group]
Length=525

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 162/189 (86%), Gaps = 17/189 (9%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF             
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAF-------------  47

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
                ++KP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  48   ----NNKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  103

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKE N YAMR
Sbjct  104  LTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKEFNIYAMR  163

Query  688  VREWYGWHF  714
              EWYGW+F
Sbjct  164  FSEWYGWYF  172



>gb|AAY34142.1| Nop58p [Physarum polycephalum]
Length=474

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 183/229 (80%), Gaps = 4/229 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AGFALFKVLDEGKL + +D+WKEF T   A K+V LK+FSKF+NT++AL++A
Sbjct  1    MLVLFETAAGFALFKVLDEGKLKQTDDIWKEFETPSKAGKMVSLKSFSKFDNTADALASA  60

Query  328  TLLIDSKPSKGLRKFL-RSHCDG---DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  495
            T L++SK SK L+KFL ++  D    +TLAVAD  LG+AIK+KL I CV+++ V EL+RG
Sbjct  61   TALVESKVSKDLKKFLTKNIVDAGAKETLAVADKLLGSAIKDKLNIKCVYDTAVQELIRG  120

Query  496  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  675
            +R QL+ L+ G+   D+  M+LGLSHSLSRYKLKFSPDKVDTMIVQAISLLDD+DKELN 
Sbjct  121  IRQQLSNLVAGMTESDVTTMALGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDMDKELNI  180

Query  676  YAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            YAMRVREWYGWHFPEL KIV +N+ YA+ VK+MG R NA   D   +LP
Sbjct  181  YAMRVREWYGWHFPELGKIVTENLMYARLVKVMGVRENAPTADLDSVLP  229



>emb|CAJ82550.1| nucleolar protein 5 [Xenopus (Silurana) tropicalis]
Length=482

 Score =   306 bits (783),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 179/228 (79%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A +VVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANRVVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SK L+K LR   +    + LA+AD+KLG  IK+K  I CVH+S V ELMRG+
Sbjct  61   TALVEGKLSKNLKKVLRKIAAKEAHEQLAIADAKLGGVIKDKANISCVHSSMVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQIDGLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KI+ DN+ Y K ++ +GDR N A  D SEILP
Sbjct  181  IMRCREWYGWHFPELGKIITDNLAYCKCLRAVGDRINFATFDLSEILP  228



>ref|NP_989298.1| NOP58 ribonucleoprotein [Xenopus (Silurana) tropicalis]
 gb|AAH64169.1| nucleolar protein 5 [Xenopus (Silurana) tropicalis]
Length=533

 Score =   306 bits (784),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 179/228 (79%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A +VVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANRVVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SK L+K LR   +    + LA+AD+KLG  IK+K  I CVH+S V ELMRG+
Sbjct  61   TALVEGKLSKNLKKVLRKIAAKEAHEQLAIADAKLGGVIKDKANISCVHSSMVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQIDGLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KI+ DN+ Y K ++ +GDR N A  D SEILP
Sbjct  181  IMRCREWYGWHFPELGKIITDNLAYCKCLRAVGDRINFATFDLSEILP  228



>gb|AAI30064.1| LOC398558 protein [Xenopus laevis]
 gb|AAI60690.1| LOC398558 protein [Xenopus laevis]
Length=488

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 177/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A KVVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANKVVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K  K L+K LR     +    LA+AD+KLG  IK+K+ I CV+ S V ELMRG+
Sbjct  61   TALVEGKLGKNLKKALRKIAAKEAHEQLAIADAKLGGVIKDKVNIGCVYTSMVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMDSLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KI+ DN+ Y K V+ +GDR N A  D SEILP
Sbjct  181  IMRCREWYGWHFPELGKIITDNLAYCKCVRAVGDRINFATFDLSEILP  228



>gb|AAH44082.1| LOC398558 protein, partial [Xenopus laevis]
Length=489

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 177/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A KVVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANKVVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K  K L+K LR     +    LA+AD+KLG  IK+K+ I CV+ S V ELMRG+
Sbjct  61   TALVEGKLGKNLKKALRKIAAKEAHEQLAIADAKLGGVIKDKVNIGCVYTSMVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMDSLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KI+ DN+ Y K V+ +GDR N A  D SEILP
Sbjct  181  IMRCREWYGWHFPELGKIITDNLAYCKCVRAVGDRINFATFDLSEILP  228



>gb|AAH77204.1| MGC78950 protein [Xenopus laevis]
Length=533

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 178/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A KVVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANKVVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K  K L+K LR   +    + LA+AD+KLG  IK+K+ I CVH S V ELMRG+
Sbjct  61   TALVEGKIGKNLKKVLRKIAAKEAHEQLAIADAKLGGVIKDKVNISCVHTSMVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQVDGLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL K++ DN+ Y K V+ +GDR N A  D SE+LP
Sbjct  181  IMRCREWYGWHFPELGKVITDNLAYCKCVRAVGDRINFATFDLSELLP  228



>ref|NP_001086628.1| NOP58 ribonucleoprotein [Xenopus laevis]
 gb|AAI22513.1| MGC78950 protein [Xenopus laevis]
Length=534

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 178/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A KVVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANKVVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K  K L+K LR   +    + LA+AD+KLG  IK+K+ I CVH S V ELMRG+
Sbjct  61   TALVEGKIGKNLKKVLRKIAAKEAHEQLAIADAKLGGVIKDKVNISCVHTSMVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQVDGLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL K++ DN+ Y K V+ +GDR N A  D SE+LP
Sbjct  181  IMRCREWYGWHFPELGKVITDNLAYCKCVRAVGDRINFATFDLSELLP  228



>gb|AAI06292.1| LOC398558 protein, partial [Xenopus laevis]
Length=526

 Score =   305 bits (780),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 177/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A KVVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANKVVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K  K L+K LR     +    LA+AD+KLG  IK+K+ I CV+ S V ELMRG+
Sbjct  61   TALVEGKLGKNLKKALRKIAAKEAHEQLAIADAKLGGVIKDKVNIGCVYTSMVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMDSLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KI+ DN+ Y K V+ +GDR N A  D SEILP
Sbjct  181  IMRCREWYGWHFPELGKIITDNLAYCKCVRAVGDRINFATFDLSEILP  228



>ref|XP_011399356.1| putative nucleolar protein 5-2 [Auxenochlorella protothecoides]
 gb|KFM26424.1| putative nucleolar protein 5-2 [Auxenochlorella protothecoides]
Length=496

 Score =   303 bits (776),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 165/227 (73%), Positives = 187/227 (82%), Gaps = 3/227 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVE--DLWKEFSTADTARKVVKLKAFSKFENTSEALS  321
            +L+LFE+ AGFALFKVLDEGKL + E  D+W  F T D A+KVVKLKAFSKFENT++AL 
Sbjct  2    VLLLFESAAGFALFKVLDEGKLKEAETQDVWSSFETLDAAKKVVKLKAFSKFENTADALQ  61

Query  322  AATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  501
            AA  L+DSK SK L+KFL+ H   DTLAV D+KLGN IKEKL+I CV+++ V EL RG+R
Sbjct  62   AAASLVDSKVSKSLKKFLKKHAGSDTLAVLDAKLGNVIKEKLEIPCVYSTGVSELTRGVR  121

Query  502  NQLTELITGLGVQ-DLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            NQL  L+ GLG + DL PMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTY
Sbjct  122  NQLGGLLAGLGHEADLRPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTY  181

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            AMRVREWYGWHFPE+ KIV DNI YAKTVKLMG R  AA LDFS+ L
Sbjct  182  AMRVREWYGWHFPEMTKIVGDNIAYAKTVKLMGTREKAADLDFSDFL  228



>ref|XP_005995462.1| PREDICTED: nucleolar protein 58 isoform X1 [Latimeria chalumnae]
Length=531

 Score =   304 bits (778),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 178/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVLDE KL +V+ LWKEF T + A K+VKLK F KF +T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFLDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SKGL+K L+     +    LA+AD+KLG  IKEKL + CVH+  V ELMRG+
Sbjct  61   TALVEGKLSKGLKKVLKKIAAKEAHEQLAIADAKLGGVIKEKLNLSCVHSPAVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R Q+  LITGL  ++++ MSLGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RTQIEGLITGLPSREMSAMSLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KI+ DN+ Y K V+ +GDRTN A  D S+ILP
Sbjct  181  IMRCREWYGWHFPELGKIITDNLAYCKCVRKVGDRTNVAASDLSDILP  228



>ref|XP_005995463.1| PREDICTED: nucleolar protein 58 isoform X2 [Latimeria chalumnae]
Length=530

 Score =   303 bits (777),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 178/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVLDE KL +V+ LWKEF T + A K+VKLK F KF +T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFLDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SKGL+K L+     +    LA+AD+KLG  IKEKL + CVH+  V ELMRG+
Sbjct  61   TALVEGKLSKGLKKVLKKIAAKEAHEQLAIADAKLGGVIKEKLNLSCVHSPAVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R Q+  LITGL  ++++ MSLGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RTQIEGLITGLPSREMSAMSLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KI+ DN+ Y K V+ +GDRTN A  D S+ILP
Sbjct  181  IMRCREWYGWHFPELGKIITDNLAYCKCVRKVGDRTNVAASDLSDILP  228



>ref|XP_009496003.1| hypothetical protein H696_03867 [Fonticula alba]
 gb|KCV69438.1| hypothetical protein H696_03867 [Fonticula alba]
Length=447

 Score =   301 bits (770),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 147/229 (64%), Positives = 177/229 (77%), Gaps = 4/229 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+ALF V +E KL+  + +WKEF TAD A K+VKL+AF KF+NT+EALSAA
Sbjct  1    MLVLFETSAGYALFSVKNESKLADTDSIWKEFETADKANKLVKLQAFGKFQNTTEALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCD----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  495
            T L+D+K  K L+ FL+S        D LAVAD+KLG  IKEKL I C HN  + ELMRG
Sbjct  61   TALLDNKVPKELKNFLKSEVLKKNLTDELAVADAKLGGVIKEKLGIACKHNDAINELMRG  120

Query  496  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  675
            +R+Q + L++GL  ++L  M LGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT
Sbjct  121  IRSQFSSLMSGLPEEELVAMQLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  180

Query  676  YAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            YAMR++EWYGWHFPE+ K++ DN+ YAKTV+ +  R  AA  D S ILP
Sbjct  181  YAMRIKEWYGWHFPEMGKVIIDNLAYAKTVRTITTRDKAATTDLSAILP  229



>gb|KHN07217.1| Putative nucleolar protein 5-2, partial [Glycine soja]
Length=190

 Score =   290 bits (742),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 156/192 (81%), Gaps = 14/192 (7%)
 Frame = +1

Query  226  DLWKEFSTADTARKVVKLKAFSKFENTSEALSAATLLIDSKPSKGLRKFLRSHCDGDTLA  405
            DLWK FS  DTAR+VVKLKAFSKFENT EAL AATLLID K SKGLRKFLR +C+ +TL 
Sbjct  1    DLWKNFSCVDTARQVVKLKAFSKFENTLEALEAATLLIDGKASKGLRKFLRVYCENETLG  60

Query  406  VADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQLTELITGLGVQDLAPMSLGLSHSLSR  585
                          +IDC+HN+ +M LMRG+RNQLTELI+GL VQD+APMSLGLSHSLSR
Sbjct  61   --------------KIDCIHNNAIMNLMRGVRNQLTELISGLPVQDMAPMSLGLSHSLSR  106

Query  586  YKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMRVREWYGWHFPELAKIVQDNIQYAKTV  765
            YKLKF+ +KVDTMIVQAI LLDDL KELNTYAMRV EWYGWHFPEL KI+QDNI YA+ V
Sbjct  107  YKLKFTREKVDTMIVQAIDLLDDLGKELNTYAMRVLEWYGWHFPELTKIIQDNILYARAV  166

Query  766  KLMGDRTNAAKL  801
            KLMGDR NAA +
Sbjct  167  KLMGDRVNAASM  178



>ref|XP_001690352.1| nucleolar protein, component of C/D snoRNPs [Chlamydomonas reinhardtii]
 gb|EDP05611.1| nucleolar protein, component of C/D snoRNPs [Chlamydomonas reinhardtii]
Length=508

 Score =   300 bits (769),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 159/225 (71%), Positives = 185/225 (82%), Gaps = 1/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFET AGFALFKVL E KL + EDL  +F+T + A+KVVKLKAFSKFENT+EAL+AA
Sbjct  1    MLLLFETAAGFALFKVLKEKKLEEAEDLASDFATLEAAQKVVKLKAFSKFENTTEALAAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGD-TLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  504
            T L+DSK SKGL+KFL+ H D D  LA+ D KLG+ ++EKL ++ + ++ V+EL RG+R+
Sbjct  61   TALVDSKLSKGLKKFLKKHVDEDEKLALLDKKLGSIVQEKLGLNVLWSNQVLELSRGIRS  120

Query  505  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  684
            QLT LI+GL   DL PMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAM
Sbjct  121  QLTGLISGLAGADLRPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAM  180

Query  685  RVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            RVREWYGWHFPE+ KIV DNIQYAK V  MG R  +A LDFS IL
Sbjct  181  RVREWYGWHFPEMTKIVTDNIQYAKCVVFMGTREKSAGLDFSAIL  225



>emb|CDS04923.1| hypothetical protein LRAMOSA07453 [Absidia idahoensis var. thermophila]
Length=496

 Score =   300 bits (768),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 146/230 (63%), Positives = 176/230 (77%), Gaps = 5/230 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVL+ET AG+ALFK++D+GKL K +D+WK F TA+ A + VKLKAFSKFENT++ALSA 
Sbjct  1    MLVLYETAAGYALFKLVDDGKLEKPDDIWKHFETAEKANQTVKLKAFSKFENTTDALSAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCD-----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  492
            T +++ K  K L+KFL S         + L V D KLG+A+ +KL I+ V +STVM+L R
Sbjct  61   TGIVEGKIPKNLKKFLSSEISEKEMKKEKLVVGDPKLGSAVNKKLGINVVSDSTVMDLYR  120

Query  493  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  672
            G+R Q   L++GL   DL  MSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELN
Sbjct  121  GIREQFESLVSGLSHHDLNAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELN  180

Query  673  TYAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            TY+MRV+EWYGWHFPE+ KI+ DN+ YAK VK MG RTNA   D S ILP
Sbjct  181  TYSMRVKEWYGWHFPEMGKIIVDNLAYAKVVKAMGFRTNAQSTDLSSILP  230



>emb|CDH51673.1| loc398558 protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=497

 Score =   300 bits (767),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/230 (63%), Positives = 176/230 (77%), Gaps = 5/230 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVL+ET AG+ALFK++D+GKL K +D+WK F TA+ A + VKLKAFSKFENT++ALSA 
Sbjct  1    MLVLYETAAGYALFKLVDDGKLEKPDDIWKHFETAEKANQTVKLKAFSKFENTTDALSAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCD-----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  492
            T +++ K  K L+KFL S         + L V D KLG+A+ +KL I+ V +STVM+L R
Sbjct  61   TGIVEGKIPKNLKKFLSSEISEKEMKKEKLVVGDPKLGSAVNKKLGINVVSDSTVMDLYR  120

Query  493  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  672
            G+R Q   L++GL   DL  MSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELN
Sbjct  121  GIREQFESLVSGLSHHDLNAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELN  180

Query  673  TYAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            TY+MRV+EWYGWHFPE+ KI+ DN+ YAK VK MG RTNA   D S ILP
Sbjct  181  TYSMRVKEWYGWHFPEMGKIIVDNLAYAKVVKTMGFRTNAQSTDLSTILP  230



>gb|KDD76960.1| putative snoRNA binding domain-containing protein [Helicosporidium 
sp. ATCC 50920]
Length=481

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 183/226 (81%), Gaps = 2/226 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKL--SKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALS  321
            +LVLFE+PAG ALFKVL EGKL  ++ ED+W  F T + A+KVVKLKAFS+FE+T+EAL 
Sbjct  2    VLVLFESPAGLALFKVLKEGKLKEAETEDVWSNFETLEAAQKVVKLKAFSRFESTAEALQ  61

Query  322  AATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  501
            +A  L++SK SKGL+K L+ H  G+TLAV D+KLG+ IKEKL I CV ++ V EL RG+R
Sbjct  62   SAASLVESKVSKGLKKLLKKHAAGETLAVLDAKLGSVIKEKLDIPCVFSAGVGELSRGIR  121

Query  502  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  681
            +Q+  L+ GL   +L PMSLGL+HSLSRYKLKFSPDKVDTM+VQAI LLDDLDKELNTYA
Sbjct  122  HQMEGLLGGLSSAELRPMSLGLAHSLSRYKLKFSPDKVDTMVVQAIGLLDDLDKELNTYA  181

Query  682  MRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            MRVREWYGWHFPE+ KIV DN+ YA+ V+LM  R  AA+LDFS +L
Sbjct  182  MRVREWYGWHFPEMTKIVADNVAYARAVRLMRTRERAAELDFSGVL  227



>ref|XP_009054674.1| hypothetical protein LOTGIDRAFT_144966 [Lottia gigantea]
 gb|ESO94640.1| hypothetical protein LOTGIDRAFT_144966 [Lottia gigantea]
Length=471

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 177/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FK+L E KL K E+L+ +F + +TA KVVKLK F KF + +EALSAA
Sbjct  1    MLVLFETAAGYAVFKLLSEKKLQKAENLFNDFESPETASKVVKLKHFQKFGDMTEALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T  ++ K SK L+K ++     D    LAV+D+KLGN IKEK Q+ CV NS++ ELMR +
Sbjct  61   TAAVEGKMSKTLKKVMKKLVAADAQEELAVSDAKLGNIIKEKYQLPCVSNSSIQELMRCI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R+Q+  LITGL  +++  MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQVDSLITGLPQKEIMAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL K++ DN+ +AK VKLMGDRT AA  DFS ILP
Sbjct  181  TMRAREWYGWHFPELGKLISDNLAFAKVVKLMGDRTEAASTDFSNILP  228



>ref|XP_002166198.2| PREDICTED: nucleolar protein 58-like, partial [Hydra vulgaris]
Length=358

 Score =   294 bits (753),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 177/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAG+A+FK+LDE KLS+V+DL+K+F T + A K+VKLK F KFE+T+EALSA 
Sbjct  1    MLVLFETPAGYAIFKLLDEKKLSQVDDLFKDFETPELASKIVKLKHFKKFEDTTEALSAV  60

Query  328  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T  I+ K SK L+K ++   S    + LAVAD+K+GN IK+K  I+CV ++ V ELMRG+
Sbjct  61   TASIEGKMSKSLKKIMKKVASKEMHEELAVADAKIGNLIKDKFDINCVCSTAVNELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R Q+  LITG+  ++   MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RTQMNGLITGITDKEFTAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KIV DN+ YAKTVK +G +   A  D S ILP
Sbjct  181  IMRCREWYGWHFPELGKIVTDNLAYAKTVKAIGFKVKTASTDLSSILP  228



>ref|XP_003056558.1| nucleolar RNA binding protein [Micromonas pusilla CCMP1545]
 gb|EEH59934.1| nucleolar RNA binding protein [Micromonas pusilla CCMP1545]
Length=469

 Score =   298 bits (762),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 183/224 (82%), Gaps = 0/224 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            ML+LFETPAG++LFK+ DE  +   E +    +T + A+ +V LKAFSKF+NT+EAL+AA
Sbjct  1    MLLLFETPAGYSLFKIKDERNIDDAEAIENALNTTEGAKNLVSLKAFSKFDNTAEALAAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
              L+DSK  K L+KFL+ + +G+ LAVAD+KLG  IKEKL I C++++ VMELMRG+R+Q
Sbjct  61   ASLVDSKLGKDLKKFLKKNAEGEILAVADAKLGGHIKEKLGIACIYSANVMELMRGVRHQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            L +LI GL   D+APMSLGLSHSLSRYKLKFSPDKVDTM+VQAI LLD+LDKELNTYAMR
Sbjct  121  LNDLIGGLDDIDVAPMSLGLSHSLSRYKLKFSPDKVDTMVVQAIGLLDELDKELNTYAMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            VREWYGWHFPE+ K++ DN+QYAKTV  MGDR+ AA+ DFS +L
Sbjct  181  VREWYGWHFPEMTKVIVDNVQYAKTVIHMGDRSTAAEHDFSVVL  224



>ref|XP_002598583.1| hypothetical protein BRAFLDRAFT_113716 [Branchiostoma floridae]
 gb|EEN54595.1| hypothetical protein BRAFLDRAFT_113716 [Branchiostoma floridae]
Length=517

 Score =   298 bits (764),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 142/231 (61%), Positives = 183/231 (79%), Gaps = 9/231 (4%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAG+A+FK+L+E KL + E+L+K+F T + A K+VKLK F KF++T+EALSAA
Sbjct  1    MLVLFETPAGYAIFKLLNEKKLQETEELFKDFETPEKASKIVKLKHFQKFDDTTEALSAA  60

Query  328  TLLIDSKPSKGLRKFLR------SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELM  489
            T  ++ K SK ++K L+      +H   + LAVAD+KLGNAIK+KL + CVHN+ + ELM
Sbjct  61   TAAVEGKMSKTMKKMLKKIVAKEAH---EELAVADAKLGNAIKDKLDLQCVHNTAIAELM  117

Query  490  RGLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKEL  669
            R +++Q+  LITGL  +++A M+LGL+H LSRYKLKFSPDKVDTMI+QAI LLDDLDKEL
Sbjct  118  RCIKSQVNNLITGLPNKEMAAMALGLAHGLSRYKLKFSPDKVDTMIIQAICLLDDLDKEL  177

Query  670  NTYAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            N Y MR +EWYGWHFPEL+K+V DN+ YAKTVK +G+R N AK D S ILP
Sbjct  178  NNYIMRCKEWYGWHFPELSKVVTDNLAYAKTVKAIGNRLNTAKTDLSHILP  228



>ref|XP_005777664.1| hypothetical protein EMIHUDRAFT_206438 [Emiliania huxleyi CCMP1516]
 gb|EOD25235.1| hypothetical protein EMIHUDRAFT_206438 [Emiliania huxleyi CCMP1516]
Length=368

 Score =   293 bits (751),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 177/228 (78%), Gaps = 4/228 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAG ALF++LD GKL K + L + FS+ D  RK+VKLKAF KFE+T+EA+ +A
Sbjct  1    MLVLFETPAGHALFQLLDAGKLKKPDSLRESFSSPDKTRKLVKLKAFKKFEDTAEAVQSA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDG----DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  495
            T L++ K S  ++KFL+ +  G    ++LAV D+KLG  IKEKL I CVH+  VMELMRG
Sbjct  61   TALVEGKLSATMKKFLKKNVAGQDLKESLAVCDAKLGATIKEKLNIACVHDEGVMELMRG  120

Query  496  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  675
            LR Q+ EL+T     ++  M++GL+HSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNT
Sbjct  121  LRAQVEELVTAATPAEMRSMAIGLAHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNT  180

Query  676  YAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            YAMR++EWYGWHFPE+ KIV DN+ YAKT++ MG RT    LD S+IL
Sbjct  181  YAMRLKEWYGWHFPEMGKIVPDNLMYAKTIQKMGVRTKCKGLDLSDIL  228



>ref|XP_005771074.1| hypothetical protein EMIHUDRAFT_75659 [Emiliania huxleyi CCMP1516]
 gb|EOD18645.1| hypothetical protein EMIHUDRAFT_75659 [Emiliania huxleyi CCMP1516]
Length=390

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 177/228 (78%), Gaps = 4/228 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAG ALF++LD GKL K + L + FS+ D  RK+VKLKAF KFE+T+EA+ +A
Sbjct  1    MLVLFETPAGHALFQLLDAGKLKKPDSLRESFSSPDKTRKLVKLKAFKKFEDTAEAVQSA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDG----DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  495
            T L++ K S  ++KFL+ +  G    ++LAV D+KLG  IKEKL I CVH+  VMELMRG
Sbjct  61   TALVEGKLSATMKKFLKKNVAGQDLKESLAVCDAKLGATIKEKLNIACVHDEGVMELMRG  120

Query  496  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  675
            LR Q+ EL+T     ++  M++GL+HSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNT
Sbjct  121  LRAQVEELVTAATPAEMRSMAIGLAHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNT  180

Query  676  YAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            YAMR++EWYGWHFPE+ KIV DN+ YAKT++ MG RT    LD S+IL
Sbjct  181  YAMRLKEWYGWHFPEMGKIVPDNLMYAKTIQKMGVRTKCKGLDLSDIL  228



>emb|CEP14638.1| hypothetical protein [Parasitella parasitica]
Length=494

 Score =   296 bits (759),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/230 (61%), Positives = 181/230 (79%), Gaps = 5/230 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVL+ET AG+ALFK++D+GK+ K ++++KEF + D A + VKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETAAGYALFKLVDDGKMEKPDEIYKEFESVDKANQAVKLKAFKKFENTTDALSAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCD-----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  492
            T +++ K  K L+KFL S         + L ++D KLG+++ +KL I+ + +STV +L R
Sbjct  61   TGIVEGKMPKNLKKFLESEISEKEMKKEKLVISDPKLGSSVNKKLGINVLSDSTVQDLYR  120

Query  493  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  672
            G+R Q   L++GL   DL+ MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELN
Sbjct  121  GIRQQFESLVSGLSQSDLSAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELN  180

Query  673  TYAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            TYAMRV+EWYGWHFPE+ KI+ DN+ YAK VK MG RTNA ++DFS+ILP
Sbjct  181  TYAMRVKEWYGWHFPEMTKIIVDNLAYAKVVKAMGFRTNAHEIDFSDILP  230



>gb|EFX84998.1| hypothetical protein DAPPUDRAFT_300779 [Daphnia pulex]
Length=515

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 179/228 (79%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAG+A+FK+LDE KL + ++L+++F T + A KVVKLK F KF +T+EALSA 
Sbjct  1    MLVLFETPAGYAVFKLLDEKKLQQTDNLFQDFQTPEGASKVVKLKHFKKFTDTTEALSAT  60

Query  328  TLLIDSKPSKGLRKFLRS---HCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T  I+ K SK LRK L+S       + LAVAD+KLG+AIKEKLQI+C+ NS + ELMR +
Sbjct  61   TAAIEGKLSKTLRKTLKSLFAEEAHEALAVADAKLGSAIKEKLQINCLSNSAIQELMRCI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R+Q   L+ GL  Q++  M+LGL+HSLSRYKLKFSPDK+DTMIVQA+SLLDDLDKELN Y
Sbjct  121  RSQADSLMGGLPKQEMMAMALGLAHSLSRYKLKFSPDKIDTMIVQAVSLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPE+ KIV DN+ + +TV+ MG RTNAA  D SEILP
Sbjct  181  VMRCREWYGWHFPEMGKIVTDNLAFVRTVQKMGIRTNAATTDLSEILP  228



>ref|XP_006567771.1| PREDICTED: nucleolar protein 58-like [Apis mellifera]
Length=578

 Score =   298 bits (764),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/227 (60%), Positives = 176/227 (78%), Gaps = 2/227 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAG+A+FK+LDE KL++VE+L+ EF T + A K+VKLK F KF +T+EAL A 
Sbjct  1    MLVLFETPAGYAIFKLLDENKLTEVENLYHEFETPEAASKIVKLKHFEKFADTTEALVAT  60

Query  328  TLLIDSKPSKGLRKFLRSHCD--GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  501
            T  ++ K  K L+K L+ HC+   + LAVAD+KLGNAIK+KL + CV N+ + ELMR +R
Sbjct  61   TAAVEGKLCKSLKKILKKHCNELQEQLAVADAKLGNAIKDKLSLSCVSNTAIQELMRCIR  120

Query  502  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  681
            +Q+  L+ GL  +++  M+LGL+HSLSRYKLKFSPDK+DTMI+QA+ LLDDLDKELN Y 
Sbjct  121  SQIDSLLAGLPKKEITAMALGLAHSLSRYKLKFSPDKIDTMIIQAVCLLDDLDKELNNYV  180

Query  682  MRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            MR REWYGWHFPEL KI+ DNI + KTVK++G R N    D S+ILP
Sbjct  181  MRCREWYGWHFPELGKIITDNIAFVKTVKIIGTRENTINSDLSDILP  227



>ref|XP_006618628.1| PREDICTED: nucleolar protein 58-like [Apis dorsata]
Length=578

 Score =   298 bits (763),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/227 (60%), Positives = 176/227 (78%), Gaps = 2/227 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAG+A+FK+LDE KL++VE+L+ EF T + A K+VKLK F KF +T+EAL A 
Sbjct  1    MLVLFETPAGYAIFKLLDENKLTEVENLYHEFETPEAASKIVKLKHFEKFADTTEALVAT  60

Query  328  TLLIDSKPSKGLRKFLRSHCD--GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  501
            T  ++ K  K L+K L+ HC+   + LAVAD+KLGNAIK+KL + CV N+ + ELMR +R
Sbjct  61   TAAVEGKLCKSLKKILKKHCNELQEQLAVADAKLGNAIKDKLSLSCVSNTAIQELMRCIR  120

Query  502  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  681
            +Q+  L+ GL  +++  M+LGL+HSLSRYKLKFSPDK+DTMI+QA+ LLDDLDKELN Y 
Sbjct  121  SQIDSLLAGLPKKEITAMALGLAHSLSRYKLKFSPDKIDTMIIQAVCLLDDLDKELNNYV  180

Query  682  MRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            MR REWYGWHFPEL KI+ DNI + KTVK++G R N    D S+ILP
Sbjct  181  MRCREWYGWHFPELGKIITDNIAFVKTVKIIGTRENTINSDLSDILP  227



>ref|XP_012061459.1| PREDICTED: nucleolar protein 58 [Atta cephalotes]
Length=645

 Score =   299 bits (766),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 179/226 (79%), Gaps = 2/226 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVLDE KL++ EDL K+F T + A +++KLK F KFE+T+EAL AA
Sbjct  1    MLVLFETSAGYAIFKVLDENKLAQSEDLHKDFETPEAASRLLKLKYFHKFEDTTEALCAA  60

Query  328  TLLIDSKPSKGLRKFLRSHC--DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  501
            T L++SK SK L+K LR+ C    + LAVAD+KLG AIK+KLQ+ CV N+ V ELMR +R
Sbjct  61   TALVNSKLSKSLKKTLRNCCIEAHEQLAVADAKLGCAIKDKLQLSCVSNTAVQELMRCIR  120

Query  502  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  681
            +QL  LI+G+  ++   M+LGL+HSLSRYKLKFSPDKVDTM++QA+ LLDDLDKELN Y 
Sbjct  121  SQLDSLISGVTEKERTAMTLGLAHSLSRYKLKFSPDKVDTMVIQAVCLLDDLDKELNNYI  180

Query  682  MRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            MR REWYGWHFPEL KIV DN+QY KT+ ++G R NA K D S+IL
Sbjct  181  MRAREWYGWHFPELGKIVTDNLQYIKTMHILGQRENAIKCDLSDIL  226



>ref|XP_008618047.1| hypothetical protein SDRG_13728 [Saprolegnia diclina VS20]
 gb|EQC28399.1| hypothetical protein SDRG_13728 [Saprolegnia diclina VS20]
Length=492

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 174/228 (76%), Gaps = 4/228 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG ALFKV DEGKL+ V+D+ K F+++D A +VVKLKAF+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEGKLANVDDIHKHFASSDKASQVVKLKAFNAFKDTTEAVAAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCD----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  495
                D    K L+KFL+ H       D LAV D   G  IKEKL I CVH+ +V ELMRG
Sbjct  61   ADCTDGTVGKSLKKFLKKHVKDAGVSDKLAVMDKAFGGIIKEKLGIQCVHDKSVDELMRG  120

Query  496  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  675
            +R  ++ LI+GL  QDL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRTHMSSLISGLEDQDLKNMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  676  YAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            YAMRVREW+GWHFPE+ KIV DN+QYA+TV  MG RTN   LDFS+IL
Sbjct  181  YAMRVREWFGWHFPEMGKIVTDNLQYARTVVKMGIRTNVKSLDFSDIL  228



>gb|KDO24106.1| hypothetical protein SPRG_10894 [Saprolegnia parasitica CBS 223.65]
Length=492

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 173/228 (76%), Gaps = 4/228 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG ALFKV DEGKL+ V+D+ K F+++D A +VVKLKAF+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEGKLANVDDIHKHFASSDKASQVVKLKAFNAFKDTTEAVAAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCD----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  495
                D    K L+KFL+ H       D LAV D   G  IKEKL I CVH+ +V ELMRG
Sbjct  61   ADCTDGTVGKSLKKFLKKHVKDAGVSDKLAVMDKAFGGIIKEKLGIQCVHDKSVDELMRG  120

Query  496  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  675
            +R  +  LI+GL  QDL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRTHMNSLISGLEDQDLKNMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  676  YAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            YAMRVREW+GWHFPE+ KIV DN+QYA+TV  MG RTN   LDFS+IL
Sbjct  181  YAMRVREWFGWHFPEMGKIVTDNLQYARTVVKMGVRTNVKSLDFSDIL  228



>ref|XP_002874404.1| hypothetical protein ARALYDRAFT_326985 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50663.1| hypothetical protein ARALYDRAFT_326985 [Arabidopsis lyrata subsp. 
lyrata]
Length=453

 Score =   291 bits (744),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 169/225 (75%), Gaps = 26/225 (12%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET  GFALFKVLDEGKLS VEDL  EFS+A++AR+                    
Sbjct  1    MLVLFETSGGFALFKVLDEGKLSNVEDLGDEFSSAESARR--------------------  40

Query  328  TLLIDSKPSKGLRKFLRSHC-DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  504
                    SKGLRKFL+++C DG+TLAVADS +GN I EKL + CVHN+ VMEL+RG+R+
Sbjct  41   -----GTSSKGLRKFLKNNCGDGETLAVADSNIGNIITEKLDVQCVHNNAVMELLRGVRS  95

Query  505  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  684
            QLTEL++GL   DLAPMSL LSH L+RYKLK + DKV+TMI+Q I LLDDLDKE NTYAM
Sbjct  96   QLTELLSGLDDNDLAPMSLELSHILARYKLKITSDKVETMIIQVIGLLDDLDKERNTYAM  155

Query  685  RVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            RVRE YG HFPELAKIVQDNI YAK VKLMG+R NAA LDFSEIL
Sbjct  156  RVRELYGLHFPELAKIVQDNILYAKAVKLMGNRINAANLDFSEIL  200



>ref|XP_007501981.1| PREDICTED: nucleolar protein 58 isoform X4 [Monodelphis domestica]
Length=533

 Score =   293 bits (750),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 141/227 (62%), Positives = 177/227 (78%), Gaps = 3/227 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SK L+K L+   +    + LAVAD+KLG  IK+KL + C+H+ T+ ELMRG+
Sbjct  61   TALVEGKLSKNLKKVLKKIAAKEAHEQLAVADAKLGGVIKDKLNLSCIHSPTITELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFS DKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSADKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
             MR REWYGWHFPEL KI+ DN+ Y K ++ +GDR N A  D SEIL
Sbjct  181  IMRCREWYGWHFPELGKIITDNLTYCKCLRKVGDRQNFASSDLSEIL  227



>ref|XP_007501980.1| PREDICTED: nucleolar protein 58 isoform X3 [Monodelphis domestica]
Length=534

 Score =   293 bits (750),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 141/227 (62%), Positives = 177/227 (78%), Gaps = 3/227 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SK L+K L+   +    + LAVAD+KLG  IK+KL + C+H+ T+ ELMRG+
Sbjct  61   TALVEGKLSKNLKKVLKKIAAKEAHEQLAVADAKLGGVIKDKLNLSCIHSPTITELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFS DKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSADKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
             MR REWYGWHFPEL KI+ DN+ Y K ++ +GDR N A  D SEIL
Sbjct  181  IMRCREWYGWHFPELGKIITDNLTYCKCLRKVGDRQNFASSDLSEIL  227



>ref|XP_007501979.1| PREDICTED: nucleolar protein 58 isoform X2 [Monodelphis domestica]
Length=535

 Score =   293 bits (750),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 141/227 (62%), Positives = 177/227 (78%), Gaps = 3/227 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SK L+K L+   +    + LAVAD+KLG  IK+KL + C+H+ T+ ELMRG+
Sbjct  61   TALVEGKLSKNLKKVLKKIAAKEAHEQLAVADAKLGGVIKDKLNLSCIHSPTITELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFS DKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSADKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
             MR REWYGWHFPEL KI+ DN+ Y K ++ +GDR N A  D SEIL
Sbjct  181  IMRCREWYGWHFPELGKIITDNLTYCKCLRKVGDRQNFASSDLSEIL  227



>ref|XP_001371978.1| PREDICTED: nucleolar protein 58 isoform X1 [Monodelphis domestica]
Length=540

 Score =   293 bits (750),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/227 (62%), Positives = 177/227 (78%), Gaps = 3/227 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SK L+K L+   +    + LAVAD+KLG  IK+KL + C+H+ T+ ELMRG+
Sbjct  61   TALVEGKLSKNLKKVLKKIAAKEAHEQLAVADAKLGGVIKDKLNLSCIHSPTITELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFS DKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSADKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
             MR REWYGWHFPEL KI+ DN+ Y K ++ +GDR N A  D SEIL
Sbjct  181  IMRCREWYGWHFPELGKIITDNLTYCKCLRKVGDRQNFASSDLSEIL  227



>gb|EIE91295.1| hypothetical protein RO3G_16006 [Rhizopus delemar RA 99-880]
Length=493

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 178/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVL+ET AG+ALFK++ + KL+K E+++KEF  A+TA  VVKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETSAGYALFKLVKDSKLNKPEEIYKEFQDAETANNVVKLKAFEKFENTTDALSAV  60

Query  328  TLLIDSKPSKGLRKFLRSHC---DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T +++ K  K L+KFL+S     + + L ++D KLG++I +KL I  + +STV EL RG+
Sbjct  61   TGIVEGKMPKNLKKFLQSEIKDMNKEQLIISDPKLGSSISKKLGIKVLSDSTVQELYRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R Q   L+TGL   DL+ MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELNTY
Sbjct  121  REQFESLVTGLSHSDLSAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELNTY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            AMR +EWYGWHFPE+ KI+ DN+ +AK VK MG RTNA + D S ILP
Sbjct  181  AMRCKEWYGWHFPEMNKIIVDNLAFAKVVKAMGYRTNAQEADLSSILP  228



>ref|XP_011064344.1| PREDICTED: nucleolar protein 58-like [Acromyrmex echinatior]
 gb|EGI59331.1| Nucleolar protein 58 [Acromyrmex echinatior]
Length=644

 Score =   295 bits (756),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 178/226 (79%), Gaps = 2/226 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVL+E KL++ EDL K+F T + A +++KL  F KFE+T+EAL AA
Sbjct  1    MLVLFETSAGYAIFKVLNENKLAQSEDLHKDFETPEAASRLLKLTYFHKFEDTTEALCAA  60

Query  328  TLLIDSKPSKGLRKFLRSHC--DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  501
            T L++SK SK L+K LR+ C    + LAVAD+KLG AIK+KLQ+ CV N+ V ELMR +R
Sbjct  61   TALVNSKLSKSLKKTLRNCCIEAHEQLAVADAKLGCAIKDKLQLSCVSNTAVQELMRCIR  120

Query  502  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  681
            +QL  LI+G+  ++   M+LGL+HSLSRYKLKFSPDKVDTM++QA+ LLDDLDKELN Y 
Sbjct  121  SQLDSLISGVTEKERTAMTLGLAHSLSRYKLKFSPDKVDTMVIQAVCLLDDLDKELNNYI  180

Query  682  MRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            MR REWYGWHFPEL KIV DN+QY KT+ ++G R NA K D S+IL
Sbjct  181  MRAREWYGWHFPELGKIVTDNLQYIKTMHILGQRENAIKCDLSDIL  226



>ref|XP_003491528.1| PREDICTED: nucleolar protein 58-like [Bombus impatiens]
Length=588

 Score =   293 bits (749),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 175/226 (77%), Gaps = 2/226 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAG+A+FK+LDE KL++VE+L+ +F T + A K+VKLK F KF +T+EAL A 
Sbjct  1    MLVLFETPAGYAIFKLLDEDKLTEVENLYHDFETPEAASKIVKLKHFEKFADTTEALVAT  60

Query  328  TLLIDSKPSKGLRKFLRSHCD--GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  501
            T  ++ K  K L+K L+ HC+   + LAVAD+KLGNAIK+KL + CV N+ + ELMR +R
Sbjct  61   TAAVEGKLCKSLKKILKKHCNELQEQLAVADAKLGNAIKDKLSLSCVSNTAIQELMRCIR  120

Query  502  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  681
            +Q+  L+ GL  +++  M+LGL+HSLSRYKLKFSPDK+DTMI+QA+ LLDDLDKELN Y 
Sbjct  121  SQMDSLLAGLPKKEITAMALGLAHSLSRYKLKFSPDKIDTMIIQAVCLLDDLDKELNNYV  180

Query  682  MRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            MR REWYGWHFPEL KI+ DNI + KTVK++G R N    D S+IL
Sbjct  181  MRCREWYGWHFPELGKIITDNIAFVKTVKVIGTRENTINSDLSDIL  226



>gb|EPB89396.1| hypothetical protein HMPREF1544_03765 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=501

 Score =   290 bits (742),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 137/230 (60%), Positives = 179/230 (78%), Gaps = 5/230 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVL+ET AG+ALFK++D+GK+ K E+++K+F + + A + VKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETAAGYALFKLVDDGKMEKPEEIYKDFESVEKANQAVKLKAFKKFENTTDALSAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCD-----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  492
            T +++ K  K L+KFL +         + L ++D KLG++I +KL I+ + +STV +L R
Sbjct  61   TGIVEGKMPKNLKKFLETEISEKEMKKEKLVISDPKLGSSINKKLGINVLSDSTVQDLYR  120

Query  493  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  672
            G+R Q   L++GL   DL+ MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELN
Sbjct  121  GIRQQFESLVSGLSQSDLSAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELN  180

Query  673  TYAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            TYAMRV+EWYGWHFPE+ KI+ DN+ YAK VK MG RTNA  +D ++ILP
Sbjct  181  TYAMRVKEWYGWHFPEMTKIIVDNLAYAKVVKAMGFRTNAHAIDMADILP  230



>ref|XP_001641027.1| predicted protein [Nematostella vectensis]
 gb|EDO48964.1| predicted protein [Nematostella vectensis]
Length=514

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 156/228 (68%), Positives = 185/228 (81%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAG+A+FK+LDE KL  V+DL+K+F + D A KVVKLK F KFE+T+EAL+AA
Sbjct  1    MLVLFETPAGYAVFKLLDEKKLKNVDDLYKDFESPDAASKVVKLKHFHKFEDTTEALAAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T  I+ K SKGL+K L+     D    LAV+D+KLGN IKEKL ++CV ++ V ELMRG+
Sbjct  61   TAAIEGKMSKGLKKLLKKVVAKDAHEQLAVSDAKLGNIIKEKLSVNCVASTAVHELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            RNQ+  LITGL  ++++ M+LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMNNLITGLQDREMSAMALGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KIV DN+ YAKTVK MG RT A +LDFSEILP
Sbjct  181  VMRCREWYGWHFPELGKIVTDNLAYAKTVKKMGMRTKAGELDFSEILP  228



>dbj|GAN04212.1| nop-domain-containing protein [Mucor ambiguus]
Length=499

 Score =   288 bits (738),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/230 (60%), Positives = 178/230 (77%), Gaps = 5/230 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVL+ET AG+ALFK++D+GK+ K E+++K+F + + A + VKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETAAGYALFKLVDDGKMEKPEEIYKDFESVEKANQAVKLKAFKKFENTTDALSAV  60

Query  328  TLLIDSKPSKGLRKFLRSHCD-----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  492
            T +++ K  K L+KFL +         + L ++D KLG++I +KL I+ + +STV +L R
Sbjct  61   TGIVEGKMPKNLKKFLETEISEKEMKKEKLVISDPKLGSSINKKLGINVLSDSTVQDLYR  120

Query  493  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  672
            G+R Q   L++GL   DL+ MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELN
Sbjct  121  GIRQQFESLVSGLSQSDLSAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELN  180

Query  673  TYAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            TYAMRV+EWYGWHFPE+ KI+ DN+ YAK VK MG RTNA   D ++ILP
Sbjct  181  TYAMRVKEWYGWHFPEMTKIIVDNLAYAKVVKAMGFRTNAHATDMADILP  230



>ref|XP_001750802.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ84401.1| predicted protein [Monosiga brevicollis MX1]
Length=492

 Score =   287 bits (734),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 173/229 (76%), Gaps = 5/229 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAG+ALFKV    KLS+  DL   F+T D A + VKLK F KFE+T EAL+AA
Sbjct  1    MLVLFETPAGYALFKVKKGVKLSEA-DLADVFATPDAANEAVKLKGFHKFEDTVEALTAA  59

Query  328  TLLIDSKPSKGLRKFLRSHCDG----DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  495
            T L + K SKGL+ FL+ +       DTLAV ++KLG  IKEKL I CV++S V ELMRG
Sbjct  60   TALTEGKLSKGLKSFLKDNIISKEVQDTLAVPEAKLGTVIKEKLGIQCVYDSGVQELMRG  119

Query  496  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  675
            +R+QL+ +I+GL   DL  M+LGL+HSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELNT
Sbjct  120  IRSQLSAVISGLRESDLTAMTLGLAHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELNT  179

Query  676  YAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            Y MRVREWYGWHFPEL KI+ DN  + +TV   G+R N +  D SEILP
Sbjct  180  YTMRVREWYGWHFPELGKIITDNNAFVRTVLTTGNRKNMSSTDLSEILP  228



>emb|CEI87149.1| Putative U3 snoRNP protein Nop58 [Rhizopus microsporus]
Length=377

 Score =   283 bits (725),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 139/228 (61%), Positives = 174/228 (76%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVL+ET AG+ALFK++ + KL K E+L+KEF  A++A  VVKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETSAGYALFKLVKDNKLDKPEELYKEFQDAESANNVVKLKAFEKFENTTDALSAV  60

Query  328  TLLIDSKPSKGLRKFLRSHC---DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T +++ K  K L+KFL+S     + + L ++D KL +++ +KL I  + + TV +L RG+
Sbjct  61   TGIVEGKMPKNLKKFLQSEIKDMNKEQLIISDPKLASSVSKKLGIKVLSDGTVQDLFRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R Q   L+TGL   DLA MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELNTY
Sbjct  121  REQFESLVTGLSHSDLAAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELNTY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            AMR +EWYGWHFPE+ KI+ DN+ +AK VK MG RTNA   D S ILP
Sbjct  181  AMRCKEWYGWHFPEMNKIIVDNLAFAKVVKAMGYRTNAKDTDLSAILP  228



>ref|XP_011267939.1| PREDICTED: nucleolar protein 58 [Camponotus floridanus]
 gb|EFN60271.1| Nucleolar protein 5 [Camponotus floridanus]
Length=675

 Score =   291 bits (746),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 178/226 (79%), Gaps = 1/226 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAG+A+FK+LDE KL+K E+L+K+F T + A K+VKL+ F KFE+ +EAL+A 
Sbjct  1    MLVLFETPAGYAIFKLLDENKLTKSENLYKDFETPEDASKIVKLEHFHKFEDITEALAAT  60

Query  328  TLLIDSKPSKGLRKFLR-SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  504
            T L+++K  K L+K LR S  D   LAVAD +LG+AIK+KL + CV N+ + ELMR +RN
Sbjct  61   TALVENKVPKSLKKALRQSPIDHQKLAVADLRLGHAIKDKLDVSCVSNNAIQELMRCIRN  120

Query  505  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  684
            Q+  LIT +  ++++ M+LGL+HSLSRYKLKFSPDK+DTM++QA+ LLDD+DKELN Y M
Sbjct  121  QMDSLITDVTKKEMSAMALGLAHSLSRYKLKFSPDKIDTMVIQAVCLLDDIDKELNNYIM  180

Query  685  RVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            R REWYGWHFPEL +IV DNI Y KT++++G R NA   D S+ILP
Sbjct  181  RAREWYGWHFPELGRIVTDNILYIKTMQIIGQRENAVSCDLSDILP  226



>ref|XP_005837542.1| hypothetical protein GUITHDRAFT_66997 [Guillardia theta CCMP2712]
 gb|EKX50562.1| hypothetical protein GUITHDRAFT_66997 [Guillardia theta CCMP2712]
Length=501

 Score =   287 bits (734),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 173/228 (76%), Gaps = 4/228 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVL+ETPAG+ALFKV DE KL  V+D+ + F+  D A K +KLKAF KFE+TSEAL AA
Sbjct  1    MLVLYETPAGYALFKVTDEKKLKDVDDIQEVFADPDKASKAMKLKAFQKFEDTSEALVAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCD----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  495
            T +++S  SKGL+KFL  +       + LAV ++KLG  IKEKL++ C+++  V+E+MRG
Sbjct  61   TAMLESSLSKGLKKFLEKNIVKKGLNEELAVYETKLGKVIKEKLEVPCIYDDKVLEIMRG  120

Query  496  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  675
            +R  L  L+ G   QDL  M LGL+HSL R+KLKFSPDKVDTM+VQAI LLD+LDKELNT
Sbjct  121  VRANLEVLLGGTTEQDLKTMRLGLAHSLGRHKLKFSPDKVDTMVVQAIGLLDELDKELNT  180

Query  676  YAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            YAMRVREWYGWHFPE+ KIV +N+ YAK VKLMG RTN    DFS IL
Sbjct  181  YAMRVREWYGWHFPEMGKIVTENVPYAKVVKLMGMRTNCVSCDFSSIL  228



>ref|XP_009086324.1| PREDICTED: nucleolar protein 58 [Serinus canaria]
Length=527

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 178/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SK L+K L+     D    LAVAD+KLG  IKEKL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKEKLNLSCIHSPMVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KI+ DN+ Y K V+ +GDR+N A  D S+ILP
Sbjct  181  IMRCREWYGWHFPELGKIITDNLTYCKCVRKVGDRSNFASTDVSDILP  228



>ref|XP_003230376.2| PREDICTED: nucleolar protein 58-like [Anolis carolinensis]
Length=539

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 171/224 (76%), Gaps = 3/224 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVL+E KL +++ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEIDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SK  +K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKISKNFKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R Q+  LI+GL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RTQMEGLISGLPAKEMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFS  810
             MR REWYGWHFPEL KI+ DN+ Y K V+ +GDR N +  D S
Sbjct  181  IMRCREWYGWHFPELGKIITDNLTYCKCVQEIGDRKNFSCSDLS  224



>ref|XP_010563240.1| PREDICTED: nucleolar protein 58 isoform X2 [Haliaeetus leucocephalus]
Length=485

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 178/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KI+ DN+ Y K V+ +GDRTN A  D S+ILP
Sbjct  181  IMRCREWYGWHFPELGKIITDNLTYCKCVRKVGDRTNFASSDVSDILP  228



>gb|EMC81163.1| Nucleolar protein 58, partial [Columba livia]
Length=468

 Score =   284 bits (727),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 178/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KI+ DN+ Y K V+ +GDR+N A  D S+ILP
Sbjct  181  IMRCREWYGWHFPELGKIITDNLTYCKCVRKVGDRSNFASSDVSDILP  228



>ref|XP_005519952.1| PREDICTED: nucleolar protein 58 [Pseudopodoces humilis]
Length=527

 Score =   286 bits (732),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 178/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SK L+K L+     D    LAVAD+KLG  IKEKL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKEKLNLSCIHSPMVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KI+ DN+ Y K V+ +GDR+N A  D S+ILP
Sbjct  181  IMRCREWYGWHFPELGKIITDNLMYCKCVRKVGDRSNFASSDVSDILP  228



>ref|XP_005049217.1| PREDICTED: nucleolar protein 58 [Ficedula albicollis]
Length=527

 Score =   286 bits (732),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 178/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SK L+K L+     D    LAVAD+KLG  IKEKL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKEKLNLSCIHSPMVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KI+ DN+ Y K V+ +GDR+N A  D S+ILP
Sbjct  181  IMRCREWYGWHFPELGKIITDNLMYCKCVRKVGDRSNFASSDVSDILP  228



>ref|XP_010563232.1| PREDICTED: nucleolar protein 58 isoform X1 [Haliaeetus leucocephalus]
Length=527

 Score =   286 bits (731),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 178/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KI+ DN+ Y K V+ +GDRTN A  D S+ILP
Sbjct  181  IMRCREWYGWHFPELGKIITDNLTYCKCVRKVGDRTNFASSDVSDILP  228



>ref|XP_011575167.1| PREDICTED: nucleolar protein 58 [Aquila chrysaetos canadensis]
Length=527

 Score =   286 bits (731),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 178/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KI+ DN+ Y K V+ +GDRTN A  D S+ILP
Sbjct  181  IMRCREWYGWHFPELGKIITDNLTYCKCVRKVGDRTNFASSDVSDILP  228



>ref|XP_007422082.1| PREDICTED: nucleolar protein 58 [Python bivittatus]
Length=538

 Score =   286 bits (732),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 177/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVLDE KL ++++LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDEKKLQEIDNLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K  K L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKIGKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R+Q+  LI+GL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLISGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KI+ DN+ Y K V+ +GDR N +  D SEILP
Sbjct  181  IMRCREWYGWHFPELGKIITDNLAYCKCVQKIGDRINFSSSDLSEILP  228



>emb|CCA22673.1| nucleolar protein NOP5 putative [Albugo laibachii Nc14]
Length=497

 Score =   285 bits (728),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 140/227 (62%), Positives = 176/227 (78%), Gaps = 3/227 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG ALFKV DE KL+KVE + K+F T D A +++KLK F  F++T++A++A 
Sbjct  1    MLVLFETAAGHALFKVQDESKLAKVETITKQFETIDQANQLIKLKGFHAFKDTTQAVAAV  60

Query  328  TLLIDSKPSKGLRKFLRSH-CDG--DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
               +D+K  KGLRKFL+ +  DG  + LAV+D  LG+ IKEKL I CV+++ V ELMRG+
Sbjct  61   ADTLDAKIGKGLRKFLKKNISDGIKEKLAVSDKALGSMIKEKLGIPCVYDACVFELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R  +  LITGL ++DL  M+LGLSHSLSRYKLKFS DKVDTMI+QAI LLD+LDKE+N Y
Sbjct  121  RTHMNSLITGLEIEDLKSMTLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDELDKEINAY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            +MRVREW+GWHFPE+ KIV DN+QYAKTV  MG R+    LDFS+IL
Sbjct  181  SMRVREWFGWHFPEMGKIVTDNLQYAKTVLKMGVRSEIKSLDFSDIL  227



>ref|XP_011341650.1| PREDICTED: nucleolar protein 58 [Cerapachys biroi]
 gb|EZA52528.1| Nucleolar protein [Cerapachys biroi]
Length=667

 Score =   289 bits (740),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 177/226 (78%), Gaps = 2/226 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAG+A+FK+LDE KL+K E+L+ +F T + A KVVKLK F KFE+T+EAL+A+
Sbjct  1    MLVLFETPAGYAIFKLLDENKLAKSENLYLDFKTVEGANKVVKLKYFHKFEDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLRSHCDG--DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  501
            T +I+ K SK L+K L+S C    + LAVAD+KLGN+IK KLQ+ CV N+ + ELMR +R
Sbjct  61   TAIIEGKLSKSLKKTLKSCCSDLHEQLAVADAKLGNSIKNKLQVPCVSNTAIHELMRCIR  120

Query  502  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  681
            +Q   L+T +  +D+  M+LGL+HSLSRYKLKFSPDKVD M++QA+ LLD+LDK+LN Y 
Sbjct  121  SQAESLVTEVNSKDMTAMALGLAHSLSRYKLKFSPDKVDIMVIQAVCLLDELDKQLNNYM  180

Query  682  MRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            M+ REWYGWHFPEL+KI++DN+ Y +TV  MG R N+   D S+I+
Sbjct  181  MKTREWYGWHFPELSKIIKDNLSYIRTVNTMGQRENSIACDLSDIM  226



>emb|CEG70655.1| Putative Nucleolar protein 58 [Rhizopus microsporus]
Length=494

 Score =   284 bits (727),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 139/228 (61%), Positives = 174/228 (76%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVL+ET AG+ALFK++ + KL K E+L+KEF  A++A  VVKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETSAGYALFKLVKDNKLDKPEELYKEFQDAESANNVVKLKAFEKFENTTDALSAV  60

Query  328  TLLIDSKPSKGLRKFLRSHC---DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T +++ K  K L+KFL+S     + + L ++D KL +++ +KL I  + + TV +L RG+
Sbjct  61   TGIVEGKMPKNLKKFLQSEIKDMNKEQLIISDPKLASSVSKKLGIKVLSDGTVQDLFRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R Q   L+TGL   DLA MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELNTY
Sbjct  121  REQFESLVTGLSHSDLAAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELNTY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            AMR +EWYGWHFPE+ KI+ DN+ +AK VK MG RTNA   D S ILP
Sbjct  181  AMRCKEWYGWHFPEMNKIIVDNLAFAKVVKAMGYRTNAKDADLSAILP  228



>emb|CEI96131.1| Putative Nucleolar protein 58 [Rhizopus microsporus]
Length=494

 Score =   284 bits (727),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 139/228 (61%), Positives = 174/228 (76%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVL+ET AG+ALFK++ + KL K E+L+KEF  A++A  VVKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETSAGYALFKLVKDNKLDKPEELYKEFQDAESANNVVKLKAFEKFENTTDALSAV  60

Query  328  TLLIDSKPSKGLRKFLRSHC---DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T +++ K  K L+KFL+S     + + L ++D KL +++ +KL I  + + TV +L RG+
Sbjct  61   TGIVEGKMPKNLKKFLQSEIKDMNKEQLIISDPKLASSVSKKLGIKVLSDGTVQDLFRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R Q   L+TGL   DLA MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELNTY
Sbjct  121  REQFESLVTGLSHSDLAAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELNTY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            AMR +EWYGWHFPE+ KI+ DN+ +AK VK MG RTNA   D S ILP
Sbjct  181  AMRCKEWYGWHFPEMNKIIVDNLAFAKVVKAMGYRTNAKDADLSAILP  228



>ref|XP_421942.1| PREDICTED: nucleolar protein 58 [Gallus gallus]
Length=527

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 177/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KI+ DN+ Y K V+ +GDR N A  D S+ILP
Sbjct  181  IMRCREWYGWHFPELGKIITDNLTYCKCVRKVGDRRNFASSDVSDILP  228



>ref|XP_010711773.1| PREDICTED: nucleolar protein 58 [Meleagris gallopavo]
Length=528

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 177/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KI+ DN+ Y K V+ +GDR N A  D S+ILP
Sbjct  181  IMRCREWYGWHFPELGKIITDNLTYCKCVRKVGDRRNFASSDVSDILP  228



>gb|ESA16249.1| hypothetical protein GLOINDRAFT_158776 [Rhizophagus irregularis 
DAOM 181602]
Length=430

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/230 (60%), Positives = 172/230 (75%), Gaps = 5/230 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+ALF+VL EGKL + ++LWK+F T + A+K VKL  F KFEN SEA+++ 
Sbjct  1    MLVLFETAAGYALFEVLKEGKLREPDELWKDFETPEAAKKTVKLVDFQKFENMSEAVASV  60

Query  328  TLLIDSKPSKGLRKFLRS-----HCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  492
            + L++ K SK L+KFL+          + LAV + K+G  I +K  I  + N TV+EL R
Sbjct  61   SDLLEGKLSKDLKKFLKESFEKIEVSSEKLAVMEPKIGATISKKFGIQVISNETVVELYR  120

Query  493  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  672
            G++ QL  LITG+   D++ MSLGLSHSLSR+KLKFSPDKVD MI+QAI LLDDLDKELN
Sbjct  121  GIKQQLDSLITGIKSDDISQMSLGLSHSLSRHKLKFSPDKVDNMIIQAIGLLDDLDKELN  180

Query  673  TYAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            TYAMRV+EWYGWHFPE++KIV DN+ YAK +K MG R+NA   D SEILP
Sbjct  181  TYAMRVKEWYGWHFPEMSKIVVDNLAYAKVIKTMGFRSNAQTTDLSEILP  230



>ref|XP_006273562.1| PREDICTED: nucleolar protein 58 [Alligator mississippiensis]
Length=525

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 177/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVLDE KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SK L+K L+     D    LA+AD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAIADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KI+ DN+ Y K V+ +GDR N +  D S+ILP
Sbjct  181  IMRCREWYGWHFPELGKIITDNLTYCKCVQKVGDRKNFSSSDLSDILP  228



>ref|XP_005144700.1| PREDICTED: nucleolar protein 58 [Melopsittacus undulatus]
Length=528

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 178/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KI+ DN+ Y K V+ +GDR+N A  D S+ILP
Sbjct  181  IMRCREWYGWHFPELGKIITDNLTYCKCVRKVGDRSNFASSDVSDILP  228



>ref|XP_005306283.1| PREDICTED: nucleolar protein 58 isoform X1 [Chrysemys picta bellii]
Length=526

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 176/228 (77%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVLDE KL +V+ LW+EF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETAAGYAVFKVLDEKKLQEVDSLWREFETPEKANKIVKLKHFEKFQDTTEALAAC  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SK L+K L+     D    LA+AD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAIADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KIV DN+ Y K V+ +GDR N +  D SE+LP
Sbjct  181  IMRCREWYGWHFPELGKIVADNLTYCKCVRKVGDRRNFSTSDLSEVLP  228



>ref|XP_011629518.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar protein 58 [Pogonomyrmex 
barbatus]
Length=635

 Score =   287 bits (734),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/227 (60%), Positives = 181/227 (80%), Gaps = 2/227 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAG+A+FK+LDE KLS+ E+L+ +F + + A K+++LK F KFE+T+EAL+A 
Sbjct  1    MLVLFETPAGYAIFKLLDESKLSRSENLYLDFESPENASKLIQLKHFHKFEDTTEALAAT  60

Query  328  TLLIDSKPSKGLRKFLRSHCD--GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  501
            T +++ K SK L+K LR+ C    + LAV+D+KLGN IK+KLQ+ CV N+ + ELMR +R
Sbjct  61   TAIVEGKLSKSLKKTLRNSCTEAHEQLAVSDAKLGNVIKDKLQLSCVSNTAIQELMRCIR  120

Query  502  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  681
            +Q+  LITG+  +++  M+LGL+HSLSRYKLKFSPDKVDTM++QA+ LLDDLDKELN Y 
Sbjct  121  SQMDSLITGVTKKEMTAMALGLAHSLSRYKLKFSPDKVDTMVIQAVCLLDDLDKELNNYI  180

Query  682  MRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            MR REWYGWHFPEL KIV DN+QY KT++L+G R NA   D S+ILP
Sbjct  181  MRAREWYGWHFPELGKIVTDNLQYIKTMQLIGQRENAVNCDLSDILP  227



>ref|XP_005511378.1| PREDICTED: nucleolar protein 58 [Columba livia]
Length=527

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 178/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KI+ DN+ Y K V+ +GDR+N A  D S+ILP
Sbjct  181  IMRCREWYGWHFPELGKIITDNLTYCKCVRKVGDRSNFASSDVSDILP  228



>ref|XP_002189225.1| PREDICTED: nucleolar protein 58 [Taeniopygia guttata]
Length=527

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 177/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SK L+K L+     D    LAVAD+KLG  IKEKL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKEKLNLSCIHSPMVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R+Q+  LI GL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQVEGLIAGLPSREMAAMRLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KI+ DN+ Y K V+ +GDR+N A  D S+ILP
Sbjct  181  IMRCREWYGWHFPELGKIITDNLTYCKCVRKVGDRSNFASSDVSDILP  228



>ref|XP_006017720.1| PREDICTED: nucleolar protein 58 [Alligator sinensis]
Length=525

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 177/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVLDE KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETGAGYAIFKVLDEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SK L+K L+     D    LA+AD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAIADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KI+ DN+ Y K V+ +GDR N +  D S+ILP
Sbjct  181  IMRCREWYGWHFPELGKIITDNLTYCKCVQKVGDRKNFSSSDLSDILP  228



>ref|XP_002903084.1| nucleolar protein NOP5 [Phytophthora infestans T30-4]
 gb|EEY55508.1| nucleolar protein NOP5 [Phytophthora infestans T30-4]
Length=519

 Score =   282 bits (722),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 174/228 (76%), Gaps = 4/228 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG ALFKV DE KL+  +D++K FST + A KV+KLK F+ F++T+EA++AA
Sbjct  24   MLVLFETAAGHALFKVQDEAKLANADDVFKHFSTPEKAAKVLKLKGFNAFKDTTEAVAAA  83

Query  328  TLLIDSKPSKGLRKFLRSHCDG----DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  495
            T ++D K  K L+KFL+ +       D LAV+D  LG+ IKEKL I CV++S V E+MRG
Sbjct  84   TDMVDGKMGKTLKKFLKKNVVDVGLKDKLAVSDKALGSLIKEKLSIACVNDSAVNEVMRG  143

Query  496  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  675
            +R  +  LITGL   DL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  144  IRANMDTLITGLEDDDLKAMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  203

Query  676  YAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            Y+MRVREW+GWHFPE+ KIV DN+QYAK V  MG RT    LDFS+IL
Sbjct  204  YSMRVREWFGWHFPEMGKIVTDNLQYAKCVLKMGMRTQVKSLDFSDIL  251



>ref|XP_004367446.1| matrix attachment region binding protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR20421.1| matrix attachment region binding protein [Acanthamoeba castellanii 
str. Neff]
Length=525

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 143/225 (64%), Positives = 178/225 (79%), Gaps = 1/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAG+ALFKV +EGKL +  ++ K+F+T + A+KVV LKAF KF NT+EAL+A 
Sbjct  1    MLVLFETPAGYALFKVHNEGKLQEA-NIAKDFATLEGAQKVVSLKAFQKFGNTTEALAAT  59

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T +++SK  K L+KFL+    G+ L V+D KL   IK+K+ + C+HNS V EL+RG+R Q
Sbjct  60   TAIVESKLGKDLKKFLKKQAKGEQLGVSDPKLAGIIKDKIGVQCLHNSMVNELLRGIRLQ  119

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
            +T+LITGLG  +L+ M LGLSHSL RYKLKFSPDKVD MI+QAI+LLDDLDKE NTYAMR
Sbjct  120  MTDLITGLGEGELSNMVLGLSHSLCRYKLKFSPDKVDHMIIQAIALLDDLDKESNTYAMR  179

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            V+EWYGWHFPELAK+V DNI +AK VK MG R +AA   F+ ILP
Sbjct  180  VKEWYGWHFPELAKVVNDNILFAKCVKAMGTRDHAAATSFAGILP  224



>ref|XP_003743589.1| PREDICTED: nucleolar protein 58 [Metaseiulus occidentalis]
Length=545

 Score =   282 bits (722),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/225 (64%), Positives = 177/225 (79%), Gaps = 0/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFE+PAGFA+FKVLDE K+ K E+L+KEF  A  A K++KLK F KFE+ ++ALSAA
Sbjct  1    MLVLFESPAGFAVFKVLDEKKIQKSENLFKEFEDASDASKILKLKHFQKFEDMTQALSAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T  I+ K +K L+K L+     +TLAVAD+KLGN IKEK+ I CV NS++ ELMR +R+Q
Sbjct  61   TGAIEGKLTKPLKKILKKLEATETLAVADAKLGNIIKEKMDISCVANSSIQELMRCIRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  687
               LITGL  +++  M+LGL+HSLSRYKLKFSPDKVDTMI+QA+SLLDDLDKELN Y MR
Sbjct  121  QEALITGLSQKEVTAMALGLAHSLSRYKLKFSPDKVDTMIIQAVSLLDDLDKELNNYVMR  180

Query  688  VREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             +EWYGWHFPE+ K+V DN+ Y KTV  MG R+NA  LD S+ILP
Sbjct  181  CKEWYGWHFPEMGKVVTDNMLYVKTVCKMGMRSNAITLDLSDILP  225



>ref|XP_003966575.1| PREDICTED: nucleolar protein 58 [Takifugu rubripes]
Length=525

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/231 (63%), Positives = 178/231 (77%), Gaps = 9/231 (4%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVLDE KL +V+ L KEF T + A KVVKLK F KF++T+EAL+AA
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQQVDSLHKEFETPEKANKVVKLKHFEKFQDTTEALAAA  60

Query  328  TLLIDSKPSKGLRKFLR------SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELM  489
            T L++ K  K L+K L+      +H   + LA++D KLG  IKEKL + C+H+  V ELM
Sbjct  61   TALVEGKIGKNLKKVLKKIVAKEAH---EQLAISDVKLGGVIKEKLDLSCIHSPAVCELM  117

Query  490  RGLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKEL  669
            R +R+Q+  LITGL  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKEL
Sbjct  118  RCIRSQVESLITGLPSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKEL  177

Query  670  NTYAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            N Y MR REWYGWHFPEL KI+ DN+ Y K+V+ +GDRTN A  D SEILP
Sbjct  178  NNYIMRCREWYGWHFPELGKIITDNLAYCKSVRHVGDRTNVATTDLSEILP  228



>ref|XP_004378293.1| PREDICTED: nucleolar protein 58 [Trichechus manatus latirostris]
Length=533

 Score =   281 bits (719),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 136/230 (59%), Positives = 174/230 (76%), Gaps = 8/230 (3%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  328  TLLIDSKPSKGLRKFLR-----SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  492
            T L++ K +K L++ L+     +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKRVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  493  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  672
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  673  TYAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             Y MR REWYGWHFPEL KI+ DN+ Y K ++ +GDR N A    SE+LP
Sbjct  178  NYIMRCREWYGWHFPELGKIISDNLTYCKCLQKVGDRKNYASATLSELLP  227



>ref|XP_008911207.1| hypothetical protein PPTG_15671 [Phytophthora parasitica INRA-310]
 gb|ETN03434.1| hypothetical protein PPTG_15671 [Phytophthora parasitica INRA-310]
Length=496

 Score =   280 bits (715),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 175/228 (77%), Gaps = 4/228 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG ALFKV DE K++  +D++K FST + A KV+KLK F+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEAKVASADDVFKHFSTPEKAAKVLKLKGFNAFKDTTEAVAAA  60

Query  328  TLLIDSKPSKGLRKFLRSHC-DG---DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  495
            T ++D K  K L+KFL+ +  D    D LAV+D  LG+ IKEKL I CV++S V E+MRG
Sbjct  61   TDMVDGKMGKTLKKFLKKNVVDAGLKDKLAVSDKALGSLIKEKLNIACVNDSAVNEVMRG  120

Query  496  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  675
            +R  +  LITGL   DL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRANMDTLITGLEDDDLKAMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  676  YAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            Y+MRVREW+GWHFPE+ KIV DN+QYAK V  MG R+    LDFS+IL
Sbjct  181  YSMRVREWFGWHFPEMGKIVTDNLQYAKCVLKMGVRSQVKTLDFSDIL  228



>ref|XP_008113176.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar protein 58 [Anolis 
carolinensis]
Length=424

 Score =   277 bits (709),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 138/224 (62%), Positives = 172/224 (77%), Gaps = 3/224 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVL+E KL +++ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEIDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKISKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R Q+  LI+GL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RTQMEGLISGLPAKEMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFS  810
             MR REWYGWHFPEL KI+ DN+ Y K V+ +GDR N +  D S
Sbjct  181  IMRCREWYGWHFPELGKIITDNLTYCKCVQKIGDRKNFSCSDLS  224



>gb|ETL31667.1| hypothetical protein L916_15560 [Phytophthora parasitica]
 gb|ETL84897.1| hypothetical protein L917_15383 [Phytophthora parasitica]
Length=496

 Score =   280 bits (715),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 175/228 (77%), Gaps = 4/228 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG ALFKV DE K++  +D++K FST + A KV+KLK F+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEAKVASADDVFKHFSTPEKAAKVLKLKGFNAFKDTTEAVAAA  60

Query  328  TLLIDSKPSKGLRKFLRSHC-DG---DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  495
            T ++D K  K L+KFL+ +  D    D LAV+D  LG+ IKEKL I CV++S V E+MRG
Sbjct  61   TDMVDGKMGKTLKKFLKKNVVDAGLKDKLAVSDKALGSLIKEKLNIACVNDSAVNEVMRG  120

Query  496  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  675
            +R  +  LITGL   DL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRANMDTLITGLEDDDLKAMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  676  YAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            Y+MRVREW+GWHFPE+ KIV DN+QYAK V  MG R+    LDFS+IL
Sbjct  181  YSMRVREWFGWHFPEMGKIVTDNLQYAKCVLKMGVRSQVKTLDFSDIL  228



>gb|ETI38018.1| hypothetical protein F443_16119 [Phytophthora parasitica P1569]
 gb|ETK78232.1| hypothetical protein L915_15665 [Phytophthora parasitica]
 gb|ETM38080.1| hypothetical protein L914_15515 [Phytophthora parasitica]
 gb|ETO66787.1| hypothetical protein F444_16104 [Phytophthora parasitica P1976]
 gb|ETP07908.1| hypothetical protein F441_15948 [Phytophthora parasitica CJ01A1]
 gb|ETP35975.1| hypothetical protein F442_15972 [Phytophthora parasitica P10297]
Length=496

 Score =   280 bits (715),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 175/228 (77%), Gaps = 4/228 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG ALFKV DE K++  +D++K FST + A KV+KLK F+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEAKVASADDVFKHFSTPEKAAKVLKLKGFNAFKDTTEAVAAA  60

Query  328  TLLIDSKPSKGLRKFLRSHC-DG---DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  495
            T ++D K  K L+KFL+ +  D    D LAV+D  LG+ IKEKL I CV++S V E+MRG
Sbjct  61   TDMVDGKMGKTLKKFLKKNVVDAGLKDKLAVSDKALGSLIKEKLNIACVNDSAVNEVMRG  120

Query  496  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  675
            +R  +  LITGL   DL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRANMDTLITGLEDDDLKAMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  676  YAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            Y+MRVREW+GWHFPE+ KIV DN+QYAK V  MG R+    LDFS+IL
Sbjct  181  YSMRVREWFGWHFPEMGKIVTDNLQYAKCVLKMGVRSQVKTLDFSDIL  228



>ref|XP_003701979.1| PREDICTED: nucleolar protein 58 [Megachile rotundata]
Length=589

 Score =   282 bits (722),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 136/227 (60%), Positives = 177/227 (78%), Gaps = 2/227 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAG+A+FK+LDE KL++VE+L+ +F T + A ++VKLK F KF +T+EAL+A 
Sbjct  1    MLVLFETPAGYAIFKLLDEQKLAEVENLYHDFETPEAASQIVKLKHFEKFADTTEALAAT  60

Query  328  TLLIDSKPSKGLRKFLRSHCD--GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  501
            T  ++ K  K L+K L+ HC    + LAVAD+KLGNAIK+KL + CV N+ + ELMR +R
Sbjct  61   TAAVEGKLCKSLKKILKKHCSELQEQLAVADTKLGNAIKDKLSLSCVSNTAIQELMRCIR  120

Query  502  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  681
            +Q+  L+ GL  +++  M+LGL+HSLSRYKLKFSPDK+DTMI+QA+ LLDDLDKELN Y 
Sbjct  121  SQIDSLLAGLPKKEMTAMALGLAHSLSRYKLKFSPDKIDTMIIQAVCLLDDLDKELNNYV  180

Query  682  MRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            MR REWYGWHFPEL KI+ DNI + KTVK++G R NA   D S+ILP
Sbjct  181  MRCREWYGWHFPELGKIITDNIAFVKTVKIIGTRENAINSDLSDILP  227



>ref|XP_009836884.1| hypothetical protein H257_11594 [Aphanomyces astaci]
 gb|ETV73458.1| hypothetical protein H257_11594 [Aphanomyces astaci]
Length=510

 Score =   280 bits (715),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 139/228 (61%), Positives = 171/228 (75%), Gaps = 4/228 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG ALFKV DEGKL+ V+D+ K F+TAD A   VKLKAF+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEGKLTNVDDIHKHFATADKANSFVKLKAFNAFKDTTEAVAAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCD----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  495
               +D+   K L+KFL+ H       D LAV D   G  IKEKL I CVH++++ EL+RG
Sbjct  61   ADCVDNTVGKSLKKFLKKHVKDAGLSDKLAVVDKAFGGVIKEKLGIQCVHDASIQELLRG  120

Query  496  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  675
            +R  +  LI+GL  QDL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRTHMNSLISGLDDQDLKSMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  676  YAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            Y+MRVREW+GWHFPE+ KIV DN+QYA+ V   G R +   LDFS+IL
Sbjct  181  YSMRVREWFGWHFPEMGKIVTDNLQYARVVLKTGTRPHVKNLDFSDIL  228



>ref|XP_007908792.1| PREDICTED: nucleolar protein 58 [Callorhinchus milii]
Length=543

 Score =   280 bits (717),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 147/228 (64%), Positives = 184/228 (81%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVLDE KL +V++LW+EF TA+ A K+VKLK F KF++T+EAL+AA
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDNLWREFETAEKAHKIVKLKQFEKFQDTTEALAAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K SK L+K L+     +    LA+AD+KLG  IK+KL + CVHN+ + ELMRG+
Sbjct  61   TALVEGKLSKSLKKILKKIVAKEAHEQLAIADAKLGGVIKDKLNLSCVHNAAIAELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R+Q++ LITGL  ++++ MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQMSGLITGLQPREMSAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KIV DN+ Y K+V+ +GDRTN A  D S+ILP
Sbjct  181  IMRCREWYGWHFPELGKIVSDNLAYCKSVQKLGDRTNTATTDLSDILP  228



>gb|KDO50620.1| hypothetical protein CISIN_1g0088522mg, partial [Citrus sinensis]
Length=155

 Score =   267 bits (683),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAGFALFKVLDEGKLSKVE LW+EF++A++AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEGLWQEFNSAESARQIVKLKAFSKFENTSEALKAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  507
            T L++SKPSK LRKFLR+HCDG+TLAVADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPSKDLRKFLRTHCDGETLAVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  508  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDK  612
            LTELI+GL  QDL PMSLGLSHSLSRYKLKFS DK
Sbjct  121  LTELISGLAGQDLQPMSLGLSHSLSRYKLKFSADK  155



>ref|XP_009530825.1| hypothetical protein PHYSODRAFT_246404 [Phytophthora sojae]
 gb|EGZ13396.1| hypothetical protein PHYSODRAFT_246404 [Phytophthora sojae]
Length=489

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 175/228 (77%), Gaps = 4/228 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG ALFKV DE KL+  +D++K F+T + A KV+KLK F+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEAKLANADDVFKHFATPEKAAKVLKLKGFNAFKDTTEAVAAA  60

Query  328  TLLIDSKPSKGLRKFLRSHC-DG---DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  495
            T ++D K  K L+KFL+ +  D    D LAV+D  LG+ IK+KL I CV++S V E+MRG
Sbjct  61   TDMVDGKMGKTLKKFLKKNVVDAGLKDKLAVSDKALGSLIKDKLSISCVNDSAVNEVMRG  120

Query  496  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  675
            +R  +  LITGL   DL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRANMDTLITGLEDDDLKAMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  676  YAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            Y+MRVREW+GWHFPE+ KIV DN+QYAK V  MG R+    LDFS+IL
Sbjct  181  YSMRVREWFGWHFPEMGKIVTDNLQYAKCVLKMGVRSKVKSLDFSDIL  228



>ref|XP_008187145.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar protein 58 [Acyrthosiphon 
pisum]
Length=487

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/225 (59%), Positives = 169/225 (75%), Gaps = 1/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FK+LDE KL  V DL+  F + +   K++KLK F KF++T+EAL++A
Sbjct  1    MLVLFETSAGYAIFKLLDENKLKNVSDLYSHFESPEATSKIIKLKHFQKFDDTTEALASA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDG-DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  504
              LI+ K  K L+K ++SH +  D+L VAD KLG AIKEK  I CV +S+  +L+R +R+
Sbjct  61   ASLIEGKLCKSLKKVIKSHVNSSDSLMVADPKLGAAIKEKFNISCVSSSSAADLLRCIRS  120

Query  505  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  684
            Q   L+ GL  +DL  MSLGL+HSLSRYKLKFSPDK+DTMIVQAI LLD+LDKE+N Y M
Sbjct  121  QFENLLVGLPKKDLTAMSLGLAHSLSRYKLKFSPDKIDTMIVQAIGLLDELDKEVNNYIM  180

Query  685  RVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            R REWYGWHFPEL KI+ DN++Y KT+K +G R NA  +D S IL
Sbjct  181  RCREWYGWHFPELGKILTDNLEYVKTIKTLGMRENAKSIDLSSIL  225



>ref|XP_006636806.1| PREDICTED: nucleolar protein 58-like [Lepisosteus oculatus]
Length=527

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 178/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVL+E KL +V+ LW+EF T + A K+VKLK F KF++T+EAL+AA
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDKLWEEFQTPERANKIVKLKHFEKFQDTTEALAAA  60

Query  328  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K  K L+K L+   +    + LA++D+KLG  IK+KL + CVH+  V ELMRG+
Sbjct  61   TALVEGKIGKSLKKVLKRVVAKEAHEQLAISDAKLGGVIKDKLNLSCVHSPAVAELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            RNQ+  LITGL  ++++ M+LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMEGLITGLPPREMSAMALGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KI+ DN+ Y K ++ +G RTN A  D S+ILP
Sbjct  181  IMRCREWYGWHFPELGKIITDNLAYCKAIRKIGARTNVASTDLSDILP  228



>ref|XP_008872332.1| hypothetical protein H310_08394 [Aphanomyces invadans]
 gb|ETV98904.1| hypothetical protein H310_08394 [Aphanomyces invadans]
Length=494

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 172/228 (75%), Gaps = 4/228 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG ALFKV DEGKL+ V+D+ K+F+TAD A   +KLKAF+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEGKLANVDDIHKQFATADKANSFLKLKAFNAFKDTTEAVAAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCD----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  495
               +D+   K L+KFL+ H       D LAV D   G  IKEKL I CVH++++ EL+RG
Sbjct  61   ADCVDNTVGKSLKKFLKKHVKDAGLSDKLAVVDKAFGGVIKEKLGIQCVHDASIQELLRG  120

Query  496  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  675
            +R  +  LI+GL  QDL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRTHMNSLISGLDDQDLKNMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  676  YAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            Y+MRVREW+GWHFPE+ KIV DN+QYA+ V   G R +   LDFS+IL
Sbjct  181  YSMRVREWFGWHFPEMGKIVTDNLQYARVVLKTGTRPHVKNLDFSDIL  228



>ref|XP_002407966.1| ribosome biogenesis protein - Nop58p/Nop5p, putative [Ixodes 
scapularis]
 gb|EEC12380.1| ribosome biogenesis protein - Nop58p/Nop5p, putative [Ixodes 
scapularis]
Length=515

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/230 (61%), Positives = 181/230 (79%), Gaps = 9/230 (4%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFE+PAG+A+FKVLDE KL + ++L+K+F T D A +VVKLK F KFE+ ++AL+AA
Sbjct  1    MLVLFESPAGYAIFKVLDEKKLQQTDNLFKDFETPDKASRVVKLKHFEKFEDMTQALAAA  60

Query  328  TLLIDSKPSKGLRKFL------RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELM  489
            T  I+ K SK L+K L       +H   ++LAVAD+KLGN IK+K  I CV NS++ ELM
Sbjct  61   TSAIEGKMSKTLKKVLKKVVAKEAH---ESLAVADAKLGNVIKDKFDISCVANSSIQELM  117

Query  490  RGLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKEL  669
            R +R+Q+  LITGL  +++  M+LGL+HSLSRYKLKFSPDKVDTMI+QA+SLLDDLDKEL
Sbjct  118  RCIRSQVDGLITGLPRKEMTAMALGLAHSLSRYKLKFSPDKVDTMIIQAVSLLDDLDKEL  177

Query  670  NTYAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            N Y MR +EWYGWHFPEL+KIV DN+QY +TV+ +G RTNA + D S+IL
Sbjct  178  NNYIMRCKEWYGWHFPELSKIVTDNLQYVRTVQKVGLRTNAIETDLSDIL  227



>ref|XP_001601436.1| PREDICTED: nucleolar protein 58 [Nasonia vitripennis]
Length=572

 Score =   280 bits (716),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/227 (60%), Positives = 177/227 (78%), Gaps = 2/227 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAG+A+FK+LDE KL+K ++L+ +F T + A KV+KLK F KF +T+EAL+A 
Sbjct  1    MLVLFETPAGYAVFKLLDENKLAKTDNLYLDFETPEGASKVLKLKHFEKFADTTEALAAT  60

Query  328  TLLIDSKPSKGLRKFLRSHCD--GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  501
            T  ++ K  K L+K L+ HC    + LAVAD+KLGNAIK+KL + CV N+ V ELMR +R
Sbjct  61   TAAVEGKLCKSLKKMLKKHCSEVQEQLAVADAKLGNAIKDKLSLPCVSNTAVQELMRCIR  120

Query  502  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  681
            +Q+  L+ GL  +++  M+LGL+HSLSRYKLKFSPDK+DTMI+QA+ LLDDLDKELN Y 
Sbjct  121  SQMDSLLAGLPKKEITAMALGLAHSLSRYKLKFSPDKIDTMIIQAVCLLDDLDKELNNYV  180

Query  682  MRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            MR REWYGWHFPEL KI+ DNI + KTVK++G R NA + D S+ILP
Sbjct  181  MRCREWYGWHFPELGKIITDNIAFVKTVKIIGTRENAIQSDLSDILP  227



>gb|AAH44394.1| Nop58 protein [Danio rerio]
 gb|AAH65674.1| Nop58 protein [Danio rerio]
Length=519

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 177/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVLDE KL +V+ LWKEF T + A KVVKLK F KF++T+EAL+AA
Sbjct  1    MLVLFETAAGYAIFKVLDEQKLQQVDSLWKEFETPEKANKVVKLKHFEKFQDTTEALAAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T +++ K  K L+K L+     +    LA+ D+KLG  IKEKL + CVH+  V ELMRG+
Sbjct  61   TAMVEGKLGKSLKKVLKKVVAKEAHEQLAITDAKLGGVIKEKLNLSCVHSPAVAELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            RNQ+  LITGL  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMEGLITGLPAREIAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPE+ KI+ DN+ Y KTV+ +GDRTN A  + SE LP
Sbjct  181  IMRCREWYGWHFPEIGKIITDNLAYCKTVRKIGDRTNVATTELSEFLP  228



>ref|XP_011154526.1| PREDICTED: nucleolar protein 58 [Harpegnathos saltator]
 gb|EFN88003.1| Nucleolar protein 5 [Harpegnathos saltator]
Length=675

 Score =   282 bits (722),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 176/226 (78%), Gaps = 1/226 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FK+LD  KL + E+L+++F+T + A  ++ L+ F KFE+T+EAL A 
Sbjct  1    MLVLFETAAGYAIFKLLDNNKLEQSENLYQDFATPEDAHGIISLQHFYKFEDTTEALLAI  60

Query  328  TLLIDSKPSKGLRKFLRSHCD-GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  504
            T  ++ K  K L+K LR HC+  + +AVAD KLGNAIK+KL ++ + N+ V ELMRG+R+
Sbjct  61   TAAVEGKLCKSLKKALRKHCEMHEQIAVADVKLGNAIKDKLGLNFISNTAVQELMRGIRS  120

Query  505  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  684
            QL  L+ G+  +++  M LGL+HSLSRYKLKFSPDKVDTM++QA++LLD+LDKELN Y M
Sbjct  121  QLDSLLGGVPKKEMTAMRLGLAHSLSRYKLKFSPDKVDTMVIQAVNLLDELDKELNNYMM  180

Query  685  RVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            R REWYGWHFPEL+KI+QDN+ Y KTV+++G R NA   D S+ILP
Sbjct  181  RCREWYGWHFPELSKIIQDNMAYVKTVQIIGIRDNAVDCDLSDILP  226



>ref|NP_001009889.1| nucleolar protein 58 [Danio rerio]
 gb|AAT68134.1| NOP5/NOP58 [Danio rerio]
Length=529

 Score =   278 bits (712),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 177/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVLDE KL +V+ LWKEF T + A KVVKLK F KF++T+EAL+AA
Sbjct  1    MLVLFETAAGYAIFKVLDEQKLQQVDSLWKEFETPEKANKVVKLKHFEKFQDTTEALAAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T +++ K  K L+K L+     +    LA+ D+KLG  IKEKL + CVH+  V ELMRG+
Sbjct  61   TAMVEGKLGKSLKKVLKKVVAKEAHEQLAITDAKLGGVIKEKLNLSCVHSPAVAELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            RNQ+  LITGL  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMEGLITGLPAREIAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPE+ KI+ DN+ Y KTV+ +GDRTN A  + SE LP
Sbjct  181  IMRCREWYGWHFPEIGKIITDNLAYCKTVRKIGDRTNVATTELSEFLP  228



>gb|AAI55195.1| Nop58 protein [Danio rerio]
Length=547

 Score =   279 bits (713),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 177/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVLDE KL +V+ LWKEF T + A KVVKLK F KF++T+EAL+AA
Sbjct  1    MLVLFETAAGYAIFKVLDEQKLQQVDSLWKEFETPEKANKVVKLKHFEKFQDTTEALAAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T +++ K  K L+K L+     +    LA+ D+KLG  IKEKL + CVH+  V ELMRG+
Sbjct  61   TAMVEGKLGKSLKKVLKKVVAKEAHEQLAITDAKLGGVIKEKLNLSCVHSPAVAELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            RNQ+  LITGL  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMEGLITGLPAREIAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPE+ KI+ DN+ Y KTV+ +GDRTN A  + SE LP
Sbjct  181  IMRCREWYGWHFPEIGKIITDNLAYCKTVRKIGDRTNVATTELSEFLP  228



>ref|XP_005165784.1| PREDICTED: nucleolar protein 58 isoform X1 [Danio rerio]
 gb|AAH61961.1| Nop58 protein [Danio rerio]
Length=553

 Score =   279 bits (713),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 177/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVLDE KL +V+ LWKEF T + A KVVKLK F KF++T+EAL+AA
Sbjct  1    MLVLFETAAGYAIFKVLDEQKLQQVDSLWKEFETPEKANKVVKLKHFEKFQDTTEALAAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T +++ K  K L+K L+     +    LA+ D+KLG  IKEKL + CVH+  V ELMRG+
Sbjct  61   TAMVEGKLGKSLKKVLKKVVAKEAHEQLAITDAKLGGVIKEKLNLSCVHSPAVAELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            RNQ+  LITGL  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMEGLITGLPAREIAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPE+ KI+ DN+ Y KTV+ +GDRTN A  + SE LP
Sbjct  181  IMRCREWYGWHFPEIGKIITDNLAYCKTVRKIGDRTNVATTELSEFLP  228



>emb|CBJ32359.1| conserved unknown protein [Ectocarpus siliculosus]
Length=559

 Score =   279 bits (713),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 139/228 (61%), Positives = 173/228 (76%), Gaps = 4/228 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAG+ALFK+ +E  L   + ++ EFST + A + VKLKAF  F +T++A++A+
Sbjct  1    MLVLFETPAGYALFKMTNESILKDADGIYDEFSTPEKAAESVKLKAFMTFADTADAVAAS  60

Query  328  TLLIDSKPSKGLRKFLRSHCDG----DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  495
            T +IDSK  K L+KFL  +       D LAV+DSKL NAIK+KL I CV++S VMELMRG
Sbjct  61   TEMIDSKMGKSLKKFLTKNIVKKELKDKLAVSDSKLANAIKDKLSIKCVNDSGVMELMRG  120

Query  496  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  675
            +R QL  L+T +G  +L  M LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRGQLDGLLTSVGDDNLKAMRLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  676  YAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            YAMRV+EW+GWHFPE+AKI+ DN+ YAK V  MG RT     DFS+I+
Sbjct  181  YAMRVKEWFGWHFPEMAKIINDNMMYAKVVVRMGVRTECKNCDFSDIM  228



>gb|AAI51885.1| Nop58 protein [Danio rerio]
Length=553

 Score =   278 bits (712),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 177/228 (78%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVLDE KL +V+ LWKEF T + A KVVKLK F KF++T+EAL+AA
Sbjct  1    MLVLFETAAGYAIFKVLDEQKLQQVDSLWKEFETPEKANKVVKLKHFEKFQDTTEALAAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T +++ K  K L+K L+     +    LA+ D+KLG  IKEKL + CVH+  V ELMRG+
Sbjct  61   TAMVEGKLGKSLKKVLKKVVAKEAHEQLAITDAKLGGVIKEKLNLSCVHSPAVAELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            RNQ+  LITGL  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMEGLITGLPAREIAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPE+ KI+ DN+ Y KTV+ +GDRTN A  + SE LP
Sbjct  181  IMRCREWYGWHFPEIGKIITDNLAYCKTVRKIGDRTNVATTELSEFLP  228



>dbj|BAJ91724.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=607

 Score =   280 bits (716),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 132/225 (59%), Positives = 169/225 (75%), Gaps = 1/225 (0%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FK+LDE KL  V DL+  F + +   K++KLK F KF++T+EAL++A
Sbjct  1    MLVLFETSAGYAIFKLLDENKLKNVSDLYSHFESPEATTKIIKLKHFQKFDDTTEALASA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDG-DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  504
              LI+ K  K L+K ++SH +  D+L VAD KLG AIKEK  I CV +S+  +L+R +R+
Sbjct  61   ASLIEGKLCKSLKKVIKSHVNSSDSLMVADPKLGAAIKEKFNISCVSSSSAADLLRCIRS  120

Query  505  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  684
            Q   L+ GL  +DL  MSLGL+HSLSRYKLKFSPDK+DTMIVQAI LLD+LDKE+N Y M
Sbjct  121  QFENLLVGLPKKDLTAMSLGLAHSLSRYKLKFSPDKIDTMIVQAIGLLDELDKEVNNYIM  180

Query  685  RVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            R REWYGWHFPEL KI+ DN++Y KT+K +G R NA  +D S IL
Sbjct  181  RCREWYGWHFPELGKILTDNLEYVKTIKTLGMRENAKSIDLSSIL  225



>gb|EXX52337.1| Nop58p [Rhizophagus irregularis DAOM 197198w]
Length=681

 Score =   281 bits (720),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 137/230 (60%), Positives = 172/230 (75%), Gaps = 5/230 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+ALF+VL EGKL + ++LWK+F T + A+K VKL  F KFEN SEA+++ 
Sbjct  1    MLVLFETAAGYALFEVLKEGKLREPDELWKDFETPEAAKKTVKLVDFQKFENMSEAVASV  60

Query  328  TLLIDSKPSKGLRKFLRS-----HCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  492
            + L++ K SK L+KFL+          + LAV + K+G  I +K  I  + N TV+EL R
Sbjct  61   SDLLEGKLSKDLKKFLKESFEKIEVSSEKLAVMEPKIGATISKKFGIQVISNETVVELYR  120

Query  493  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  672
            G++ QL  LITG+   D++ MSLGLSHSLSR+KLKFSPDKVD MI+QAI LLDDLDKELN
Sbjct  121  GIKQQLDSLITGIKSDDISQMSLGLSHSLSRHKLKFSPDKVDNMIIQAIGLLDDLDKELN  180

Query  673  TYAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            TYAMRV+EWYGWHFPE++KIV DN+ YAK +K MG R+NA   D SEILP
Sbjct  181  TYAMRVKEWYGWHFPEMSKIVVDNLAYAKVIKTMGFRSNAQTTDLSEILP  230



>ref|XP_007248939.1| PREDICTED: nucleolar protein 58-like [Astyanax mexicanus]
Length=560

 Score =   278 bits (711),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 179/228 (79%), Gaps = 3/228 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVLDE KL +V++LWKEF T + A KVVKLK F KF++T+EAL+AA
Sbjct  1    MLVLFETAAGYAIFKVLDEQKLQQVDNLWKEFETPEKANKVVKLKHFEKFQDTTEALAAA  60

Query  328  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
            T L++ K  K L+K L+     D    LA+ D+KLG  IKEKL + CVH+  V ELMRG+
Sbjct  61   TALVEGKLGKSLKKVLKKVVAKDAHEQLAITDAKLGGVIKEKLNLSCVHSPAVAELMRGI  120

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            RNQ+  LITGL  ++++ MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMEGLITGLPPREISAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KI+ DN+ Y KTV+ +GDRTN A  D S++LP
Sbjct  181  IMRCREWYGWHFPELGKIITDNLAYCKTVRKIGDRTNVAITDLSDVLP  228



>ref|XP_011308274.1| PREDICTED: nucleolar protein 58 [Fopius arisanus]
Length=568

 Score =   278 bits (712),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/227 (59%), Positives = 177/227 (78%), Gaps = 2/227 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFETPAG+A+FK+LDE KL+K E+L+ +F T + A K++KLK F KF +T+EAL+A 
Sbjct  1    MLVLFETPAGYAIFKLLDENKLAKTENLYHDFETPEAASKLLKLKHFEKFADTTEALAAT  60

Query  328  TLLIDSKPSKGLRKFLRSHCD--GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  501
            T  ++ K  K L+K L+ HC    + LAVAD+KLGNAIK+KL + CV N+++ ELMR +R
Sbjct  61   TAAVEGKLCKSLKKMLKKHCSEVQEQLAVADAKLGNAIKDKLSLSCVSNTSIQELMRCIR  120

Query  502  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  681
            +QL  L+ GL  +++  M+LGL+HSLSRYKLKFSPDKVDTMI+QA+ LLDDLDKELN Y 
Sbjct  121  SQLDSLLAGLPKKEMTAMALGLAHSLSRYKLKFSPDKVDTMIIQAVCLLDDLDKELNNYV  180

Query  682  MRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
            MR REWYGWHFPEL K++ DN+ + KTVK++G R +  K D S+ILP
Sbjct  181  MRCREWYGWHFPELGKLITDNVAFVKTVKIIGTREHTIKSDLSDILP  227



>ref|XP_003907873.1| PREDICTED: nucleolar protein 58 isoform X1 [Papio anubis]
Length=423

 Score =   274 bits (700),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/230 (58%), Positives = 170/230 (74%), Gaps = 8/230 (3%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  328  TLLIDSKPSK-----GLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  492
            T L++ K +K       +    +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  493  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  672
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  673  TYAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             Y MR REWYGWHFPEL KI+ DN+ Y K ++ +GDR N A    SE+LP
Sbjct  178  NYIMRCREWYGWHFPELGKIISDNLTYCKCLQKVGDRKNYASAKLSELLP  227



>ref|XP_011696387.1| PREDICTED: nucleolar protein 58 [Wasmannia auropunctata]
Length=683

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 175/226 (77%), Gaps = 2/226 (1%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AGFA+FKVLDE ++ + +DL+K+F T + A +++KLK F KFE+T+EAL+A 
Sbjct  1    MLVLFETSAGFAIFKVLDENRIVQSDDLFKDFETPEAASRLIKLKYFHKFEDTNEALAAT  60

Query  328  TLLIDSKPSKGLRKFLRSHCDG--DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  501
              L + K SK L+K L+S C    + LAVAD++LG+AI++KLQ+ C+ N+ V ELMR +R
Sbjct  61   RALAEGKLSKSLKKTLKSSCTEAREQLAVADARLGSAIRDKLQLSCISNTAVQELMRCIR  120

Query  502  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  681
            +Q+  LI+ +   ++  M+LGL+HS SRYK+KFSPDK+DTM++QA+ LLDDLDKE+N Y 
Sbjct  121  SQMDSLISDVTKGEMGRMTLGLAHSYSRYKMKFSPDKIDTMVIQAVCLLDDLDKEINNYI  180

Query  682  MRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEIL  819
            MR REWYGWHFPEL KIV DNIQY +T+ ++G R NA K D S+IL
Sbjct  181  MRAREWYGWHFPELGKIVSDNIQYIRTMLIIGQRENAVKCDLSDIL  226



>ref|XP_008323109.1| PREDICTED: nucleolar protein 58 [Cynoglossus semilaevis]
Length=569

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 174/228 (76%), Gaps = 5/228 (2%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET AG+A+FKVLDE KL +V+ L+KEF T + A K+VKLK F KF++T+EAL   
Sbjct  1    MLVLFETAAGYAIFKVLDESKLKQVDSLYKEFETIEKANKIVKLKHFEKFQDTTEAL--L  58

Query  328  TLLIDSK---PSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  498
             LL++ K     K + K + +    + LA++D+KLG  IKEKL + CV++  V ELMR +
Sbjct  59   PLLVEGKINKNLKKVLKKVVAKEAHEQLAISDAKLGGVIKEKLDVSCVYSPAVAELMRCI  118

Query  499  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  678
            R+Q+  LITGL  ++++ MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  119  RSQMEGLITGLPAREISAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  178

Query  679  AMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             MR REWYGWHFPEL KIV DN+ Y KTV+ +GDRTN A  D SE+LP
Sbjct  179  IMRCREWYGWHFPELGKIVADNLAYCKTVRKIGDRTNVAGSDLSELLP  226



>ref|XP_005574023.1| PREDICTED: nucleolar protein 58 isoform X4 [Macaca fascicularis]
Length=431

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/230 (58%), Positives = 170/230 (74%), Gaps = 8/230 (3%)
 Frame = +1

Query  148  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  327
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  328  TLLIDSKPSK-----GLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  492
            T L++ K +K       +    +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  493  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  672
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  673  TYAMRVREWYGWHFPELAKIVQDNIQYAKTVKLMGDRTNAAKLDFSEILP  822
             Y MR REWYGWHFPEL KI+ DN+ Y K ++ +GDR N A    SE+LP
Sbjct  178  NYIMRCREWYGWHFPELGKIISDNLTYCKCLQKVGDRKNYASAKLSELLP  227



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1752198629708