BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3666

Length=872
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010068694.1|  PREDICTED: leucine-rich repeat receptor prot...    102   1e-20   Eucalyptus grandis [rose gum]
gb|KCW64519.1|  hypothetical protein EUGRSUZ_G02120                     102   2e-20   Eucalyptus grandis [rose gum]
ref|XP_008807618.1|  PREDICTED: LRR receptor-like serine/threonin...    102   3e-20   
ref|XP_008218761.1|  PREDICTED: LRR receptor-like serine/threonin...    100   8e-20   Prunus mume [ume]
gb|KCW64528.1|  hypothetical protein EUGRSUZ_G02130                   99.8    1e-19   Eucalyptus grandis [rose gum]
ref|XP_008775355.1|  PREDICTED: receptor-like protein 12              99.0    3e-19   Phoenix dactylifera
ref|XP_004980222.1|  PREDICTED: probable leucine-rich repeat rece...  98.6    3e-19   
ref|XP_011460549.1|  PREDICTED: probably inactive leucine-rich re...  96.7    5e-19   Fragaria vesca subsp. vesca
ref|XP_010068697.1|  PREDICTED: leucine-rich repeat receptor-like...  96.7    5e-19   
gb|KCW62328.1|  hypothetical protein EUGRSUZ_H049701                  94.0    6e-19   Eucalyptus grandis [rose gum]
ref|XP_010918709.1|  PREDICTED: receptor-like protein 12              97.4    8e-19   Elaeis guineensis
gb|KCW64526.1|  hypothetical protein EUGRSUZ_G02127                   97.1    9e-19   Eucalyptus grandis [rose gum]
emb|CAN63882.1|  hypothetical protein VITISV_002032                   96.7    1e-18   Vitis vinifera
gb|EMT13998.1|  LRR receptor-like serine/threonine-protein kinase...  97.1    1e-18   
gb|EEE54949.1|  hypothetical protein OsJ_02519                        96.3    1e-18   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD52658.1|  HcrVf2 protein-like                                  96.7    1e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002265946.1|  PREDICTED: receptor-like protein kinase 2        96.3    2e-18   Vitis vinifera
ref|XP_004301719.2|  PREDICTED: LRR receptor-like serine/threonin...  96.3    2e-18   Fragaria vesca subsp. vesca
ref|XP_008226203.1|  PREDICTED: receptor-like protein 12              95.9    3e-18   Prunus mume [ume]
ref|XP_009405134.1|  PREDICTED: LRR receptor-like serine/threonin...  95.5    3e-18   
gb|KDO40442.1|  hypothetical protein CISIN_1g048006mg                 95.1    3e-18   Citrus sinensis [apfelsine]
ref|XP_011462017.1|  PREDICTED: probable LRR receptor-like serine...  95.5    3e-18   Fragaria vesca subsp. vesca
ref|XP_006450003.1|  hypothetical protein CICLE_v10027645mg           95.5    3e-18   
gb|KJB45901.1|  hypothetical protein B456_007G3361002                 92.0    4e-18   Gossypium raimondii
gb|EEE52293.1|  hypothetical protein OsJ_34286                        95.5    4e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003631328.1|  PREDICTED: probable leucine-rich repeat rece...  95.1    4e-18   Vitis vinifera
gb|ABA94375.1|  Leucine Rich Repeat family protein                    95.5    4e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010656643.1|  PREDICTED: uncharacterized protein LOC104880714  95.5    4e-18   
gb|KDO55605.1|  hypothetical protein CISIN_1g038320mg                 93.6    4e-18   Citrus sinensis [apfelsine]
ref|XP_002274461.1|  PREDICTED: LRR receptor-like serine/threonin...  95.1    5e-18   Vitis vinifera
ref|XP_010655653.1|  PREDICTED: receptor-like protein 12              94.7    5e-18   Vitis vinifera
ref|XP_009368771.1|  PREDICTED: receptor-like protein kinase 5        93.6    6e-18   Pyrus x bretschneideri [bai li]
gb|KEH16821.1|  LRR receptor-like kinase family protein               90.9    7e-18   Medicago truncatula
ref|XP_003636151.1|  Receptor protein kinase-like protein             93.6    7e-18   
ref|XP_006470121.1|  PREDICTED: LRR receptor-like serine/threonin...  94.4    7e-18   
ref|XP_010068699.1|  PREDICTED: LRR receptor-like serine/threonin...  94.4    8e-18   
ref|XP_010662758.1|  PREDICTED: receptor-like protein 12 isoform X2   94.0    1e-17   Vitis vinifera
ref|XP_003631327.1|  PREDICTED: LRR receptor-like serine/threonin...  94.0    1e-17   Vitis vinifera
ref|XP_010662757.1|  PREDICTED: receptor-like protein 12 isoform X1   94.0    1e-17   Vitis vinifera
ref|XP_006600047.1|  PREDICTED: probably inactive leucine-rich re...  90.1    1e-17   
ref|XP_008231480.1|  PREDICTED: LRR receptor-like serine/threonin...  93.6    1e-17   Prunus mume [ume]
ref|XP_010246690.1|  PREDICTED: probable leucine-rich repeat rece...  93.6    1e-17   Nelumbo nucifera [Indian lotus]
gb|KEH16824.1|  leucine-rich receptor-like kinase family protein,...  93.6    1e-17   Medicago truncatula
ref|XP_010655798.1|  PREDICTED: probable leucine-rich repeat rece...  93.2    1e-17   
ref|XP_002450414.1|  hypothetical protein SORBIDRAFT_05g004935        93.2    2e-17   
ref|XP_010918705.1|  PREDICTED: LRR receptor-like serine/threonin...  93.2    2e-17   
ref|XP_008218738.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  92.8    2e-17   
ref|XP_006600052.1|  PREDICTED: LRR receptor-like serine/threonin...  92.4    2e-17   
ref|XP_009610906.1|  PREDICTED: LRR receptor-like serine/threonin...  92.8    3e-17   Nicotiana tomentosiformis
ref|XP_010662668.1|  PREDICTED: leucine-rich repeat receptor-like...  90.5    3e-17   Vitis vinifera
ref|XP_007220831.1|  hypothetical protein PRUPE_ppa027090mg           92.4    3e-17   
ref|XP_007030466.1|  Disease resistance family protein / LRR fami...  92.4    3e-17   
ref|XP_010910632.1|  PREDICTED: probably inactive leucine-rich re...  91.3    5e-17   
ref|XP_009352118.1|  PREDICTED: LRR receptor-like serine/threonin...  91.7    5e-17   
gb|KDO56838.1|  hypothetical protein CISIN_1g0483512mg                88.2    5e-17   Citrus sinensis [apfelsine]
ref|XP_008376669.1|  PREDICTED: probable leucine-rich repeat rece...  91.7    5e-17   Malus domestica [apple tree]
ref|XP_007220272.1|  hypothetical protein PRUPE_ppa000998mg           91.7    5e-17   
gb|KJB72425.1|  hypothetical protein B456_011G177700                  91.7    5e-17   Gossypium raimondii
ref|XP_009375612.1|  PREDICTED: probable LRR receptor-like serine...  91.7    6e-17   
ref|NP_001172452.1|  Os01g0601675                                     91.7    6e-17   
ref|XP_009354357.1|  PREDICTED: LRR receptor-like serine/threonin...  91.7    6e-17   
ref|XP_011462016.1|  PREDICTED: LRR receptor-like serine/threonin...  91.3    7e-17   Fragaria vesca subsp. vesca
ref|XP_008804946.1|  PREDICTED: probable LRR receptor-like serine...  91.3    8e-17   
ref|NP_001172453.1|  Os01g0601700                                     87.8    8e-17   
ref|XP_006600066.1|  PREDICTED: probable LRR receptor-like serine...  90.1    9e-17   
ref|XP_010908803.1|  PREDICTED: probable leucine-rich repeat rece...  90.9    9e-17   
ref|XP_006475701.1|  PREDICTED: LRR receptor-like serine/threonin...  90.1    1e-16   
ref|XP_010249628.1|  PREDICTED: receptor-like protein 12              90.5    1e-16   Nelumbo nucifera [Indian lotus]
ref|XP_009352122.1|  PREDICTED: probable leucine-rich repeat rece...  90.5    1e-16   Pyrus x bretschneideri [bai li]
ref|XP_003549056.1|  PREDICTED: LRR receptor-like serine/threonin...  90.5    1e-16   
ref|XP_008338558.1|  PREDICTED: receptor-like protein 12              90.5    1e-16   
ref|XP_003636149.1|  Leucine-rich repeat receptor-like protein ki...  89.7    1e-16   
ref|XP_007030464.1|  Disease resistance family protein / LRR fami...  90.1    1e-16   
ref|XP_009375566.1|  PREDICTED: LRR receptor-like serine/threonin...  90.5    1e-16   Pyrus x bretschneideri [bai li]
gb|KEH16825.1|  LRR receptor-like kinase family protein               90.1    1e-16   Medicago truncatula
gb|KDO62592.1|  hypothetical protein CISIN_1g045210mg                 90.1    1e-16   Citrus sinensis [apfelsine]
ref|XP_006452262.1|  hypothetical protein CICLE_v10010520mg           90.1    1e-16   
ref|XP_006452276.1|  hypothetical protein CICLE_v10007373mg           90.1    1e-16   
ref|XP_006607060.1|  PREDICTED: probable leucine-rich repeat rece...  90.1    1e-16   
gb|KEH16828.1|  LRR receptor-like kinase family protein               89.7    2e-16   Medicago truncatula
ref|XP_010662805.1|  PREDICTED: LRR receptor-like serine/threonin...  90.1    2e-16   
ref|XP_010646800.1|  PREDICTED: receptor-like protein 12              89.0    2e-16   
gb|KHG06604.1|  DNA-damage-repair/toleration protein                  86.7    2e-16   Gossypium arboreum [tree cotton]
ref|XP_010111049.1|  LRR receptor-like serine/threonine-protein k...  90.1    2e-16   Morus notabilis
emb|CDP16273.1|  unnamed protein product                              90.1    2e-16   Coffea canephora [robusta coffee]
ref|XP_009618939.1|  PREDICTED: probably inactive leucine-rich re...  89.7    2e-16   Nicotiana tomentosiformis
ref|XP_011005448.1|  PREDICTED: receptor-like protein 12 isoform X1   89.7    2e-16   Populus euphratica
ref|XP_006599582.1|  PREDICTED: LRR receptor-like serine/threonin...  89.7    2e-16   
gb|KDO37541.1|  hypothetical protein CISIN_1g045139mg                 89.7    2e-16   Citrus sinensis [apfelsine]
gb|KHN45763.1|  LRR receptor-like serine/threonine-protein kinase...  89.7    2e-16   Glycine soja [wild soybean]
ref|XP_009618938.1|  PREDICTED: probable LRR receptor-like serine...  89.7    2e-16   Nicotiana tomentosiformis
ref|XP_008362832.1|  PREDICTED: probable LRR receptor-like serine...  89.7    2e-16   
ref|XP_009405132.1|  PREDICTED: LRR receptor-like serine/threonin...  89.7    2e-16   
emb|CAN76220.1|  hypothetical protein VITISV_020133                   89.7    2e-16   Vitis vinifera
ref|XP_006599588.1|  PREDICTED: LRR receptor-like serine/threonin...  89.7    2e-16   
ref|XP_010323160.1|  PREDICTED: EIX receptor 1 isoform X1             89.7    2e-16   
gb|EEC71039.1|  hypothetical protein OsI_02753                        89.4    2e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_009398960.1|  PREDICTED: LRR receptor-like serine/threonin...  89.7    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006599589.1|  PREDICTED: LRR receptor-like serine/threonin...  89.0    3e-16   
ref|XP_011080440.1|  PREDICTED: probable LRR receptor-like serine...  89.4    3e-16   Sesamum indicum [beniseed]
gb|KEH25182.1|  LRR receptor-like kinase family protein               89.4    3e-16   Medicago truncatula
gb|ACJ03068.1|  HB04p                                                 89.4    3e-16   Malus floribunda [Japanese crab apple]
gb|AGO64661.1|  receptor-like protein                                 89.4    3e-16   Pyrus communis
gb|AEQ27754.1|  receptor-like protein                                 89.4    3e-16   Malus sieversii
gb|KCW64537.1|  hypothetical protein EUGRSUZ_G02140                   89.0    3e-16   Eucalyptus grandis [rose gum]
gb|AAR28378.1|  EIX receptor 2                                        89.4    3e-16   Solanum lycopersicum
ref|XP_008361472.1|  PREDICTED: leucine-rich repeat receptor-like...  89.4    3e-16   
gb|KJB72455.1|  hypothetical protein B456_011G179600                  89.0    3e-16   Gossypium raimondii
ref|XP_009405133.1|  PREDICTED: LRR receptor-like serine/threonin...  89.4    3e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009338728.1|  PREDICTED: receptor-like protein 12              89.4    3e-16   
gb|AEQ27749.1|  receptor-like protein                                 89.4    3e-16   Malus micromalus [Kaido crab apple]
ref|XP_008461894.1|  PREDICTED: probable leucine-rich repeat rece...  89.4    3e-16   Cucumis melo [Oriental melon]
gb|KDO39729.1|  hypothetical protein CISIN_1g044082mg                 85.5    3e-16   Citrus sinensis [apfelsine]
ref|XP_010253421.1|  PREDICTED: LRR receptor-like serine/threonin...  89.0    4e-16   Nelumbo nucifera [Indian lotus]
ref|XP_006600036.1|  PREDICTED: LRR receptor-like serine/threonin...  89.0    4e-16   
ref|XP_004978847.1|  PREDICTED: LRR receptor-like serine/threonin...  89.0    4e-16   Setaria italica
gb|ACM89598.1|  leucine-rich repeat protein                           88.6    4e-16   Glycine max [soybeans]
gb|AEQ27756.1|  receptor-like protein                                 89.0    4e-16   Malus domestica [apple tree]
ref|XP_009346363.1|  PREDICTED: probable leucine-rich repeat rece...  88.6    4e-16   
emb|CBI22735.3|  unnamed protein product                              88.2    5e-16   Vitis vinifera
ref|XP_009389805.1|  PREDICTED: LRR receptor-like serine/threonin...  88.6    5e-16   
ref|XP_008222139.1|  PREDICTED: LRR receptor-like serine/threonin...  88.2    5e-16   
ref|XP_004296198.1|  PREDICTED: probable leucine-rich repeat rece...  88.6    5e-16   Fragaria vesca subsp. vesca
ref|XP_010266617.1|  PREDICTED: probable LRR receptor-like serine...  88.2    6e-16   
ref|XP_002318355.2|  hypothetical protein POPTR_0012s01080g           88.2    6e-16   
ref|XP_002273399.2|  PREDICTED: probable leucine-rich repeat rece...  88.2    7e-16   
ref|XP_008382520.1|  PREDICTED: LRR receptor-like serine/threonin...  88.2    7e-16   
gb|ACJ03067.1|  AL07-2p                                               88.2    7e-16   Malus floribunda [Japanese crab apple]
ref|XP_009387594.1|  PREDICTED: leucine-rich repeat receptor-like...  85.9    7e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO56170.1|  hypothetical protein CISIN_1g040379mg                 86.3    7e-16   Citrus sinensis [apfelsine]
ref|XP_006600054.1|  PREDICTED: probable LRR receptor-like serine...  87.8    8e-16   
ref|XP_007226165.1|  hypothetical protein PRUPE_ppa015243mg           87.8    9e-16   
ref|XP_007045500.1|  Serine-threonine protein kinase, plant-type,...  87.8    9e-16   
ref|XP_002437796.1|  hypothetical protein SORBIDRAFT_10g002735        87.8    9e-16   
gb|EMT21339.1|  DNA-damage-repair/toleration protein                  84.7    9e-16   
gb|AEQ27753.1|  receptor-like protein                                 87.4    1e-15   Malus micromalus [Kaido crab apple]
ref|XP_002273469.1|  PREDICTED: receptor-like protein 12              87.4    1e-15   Vitis vinifera
ref|XP_009389804.1|  PREDICTED: leucine-rich repeat receptor-like...  87.4    1e-15   
gb|KJB45928.1|  hypothetical protein B456_007G338700                  87.4    1e-15   Gossypium raimondii
ref|XP_006490685.1|  PREDICTED: probable LRR receptor-like serine...  87.4    1e-15   Citrus sinensis [apfelsine]
gb|EAY74833.1|  hypothetical protein OsI_02725                        87.4    1e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_010910868.1|  PREDICTED: putative leucine-rich repeat rece...  85.5    1e-15   
ref|XP_009388094.1|  PREDICTED: probably inactive leucine-rich re...  83.2    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011470503.1|  PREDICTED: receptor-like protein 12              84.0    1e-15   Fragaria vesca subsp. vesca
emb|CBI22733.3|  unnamed protein product                              86.7    1e-15   Vitis vinifera
ref|XP_009375609.1|  PREDICTED: probable LRR receptor-like serine...  87.0    1e-15   
ref|XP_007220752.1|  hypothetical protein PRUPE_ppa025491mg           86.7    2e-15   
ref|XP_008670802.1|  PREDICTED: leucine-rich repeat receptor-like...  86.7    2e-15   Zea mays [maize]
ref|XP_010920367.1|  PREDICTED: receptor-like protein 12              86.7    2e-15   
gb|KEH25178.1|  LRR receptor-like kinase family protein               86.7    2e-15   Medicago truncatula
ref|XP_003634127.2|  PREDICTED: LRR receptor-like serine/threonin...  86.7    2e-15   Vitis vinifera
ref|XP_010660819.1|  PREDICTED: receptor-like protein 12              86.7    2e-15   
ref|XP_002276171.1|  PREDICTED: receptor-like protein 12              86.7    2e-15   Vitis vinifera
ref|XP_009405127.1|  PREDICTED: probable leucine-rich repeat rece...  86.3    3e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009389802.1|  PREDICTED: leucine-rich repeat receptor-like...  86.3    3e-15   
ref|XP_006422087.1|  hypothetical protein CICLE_v10007014mg           86.3    3e-15   
gb|KHG30701.1|  hypothetical protein F383_11023                       82.8    3e-15   Gossypium arboreum [tree cotton]
ref|XP_006490687.1|  PREDICTED: probable LRR receptor-like serine...  86.3    3e-15   Citrus sinensis [apfelsine]
ref|XP_010910624.1|  PREDICTED: probable LRR receptor-like serine...  85.9    3e-15   Elaeis guineensis
ref|XP_008218592.1|  PREDICTED: probable leucine-rich repeat rece...  86.3    3e-15   Prunus mume [ume]
ref|NP_001174592.1|  Os06g0140000                                     86.3    3e-15   
ref|XP_007024895.1|  Disease resistance family protein / LRR fami...  85.9    4e-15   
gb|KGN50335.1|  hypothetical protein Csa_5G168740                     85.9    4e-15   
gb|KEH16822.1|  LRR receptor-like kinase family protein               85.9    4e-15   Medicago truncatula
gb|KJB26590.1|  hypothetical protein B456_004G248900                  85.9    4e-15   Gossypium raimondii
gb|EEC68383.1|  hypothetical protein OsI_36529                        85.1    4e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_004143731.2|  PREDICTED: receptor-like protein 12              85.9    4e-15   Cucumis sativus [cucumbers]
ref|XP_003633794.1|  PREDICTED: LRR receptor-like serine/threonin...  85.9    4e-15   Vitis vinifera
ref|XP_009375610.1|  PREDICTED: LRR receptor-like serine/threonin...  85.9    4e-15   
ref|XP_011651766.1|  PREDICTED: LRR receptor-like serine/threonin...  85.9    4e-15   Cucumis sativus [cucumbers]
ref|XP_011001953.1|  PREDICTED: probable LRR receptor-like serine...  85.9    4e-15   Populus euphratica
gb|KGN58575.1|  hypothetical protein Csa_3G687760                     85.5    4e-15   
ref|XP_006490688.1|  PREDICTED: leucine-rich repeat receptor prot...  84.7    4e-15   Citrus sinensis [apfelsine]
ref|XP_002458109.1|  hypothetical protein SORBIDRAFT_03g027070        85.9    4e-15   Sorghum bicolor [broomcorn]
emb|CDP12881.1|  unnamed protein product                              85.5    4e-15   Coffea canephora [robusta coffee]
ref|XP_004149737.1|  PREDICTED: leucine-rich repeat receptor prot...  85.5    4e-15   Cucumis sativus [cucumbers]
ref|XP_009405129.1|  PREDICTED: LRR receptor-like serine/threonin...  85.5    5e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009352119.1|  PREDICTED: LRR receptor-like serine/threonin...  84.7    5e-15   
ref|XP_011001954.1|  PREDICTED: probable LRR receptor-like serine...  85.5    5e-15   Populus euphratica
ref|XP_008357614.1|  PREDICTED: receptor-like protein kinase 2        85.5    6e-15   
ref|XP_008218771.1|  PREDICTED: receptor-like protein 12              85.1    6e-15   
ref|XP_007212880.1|  hypothetical protein PRUPE_ppa021661mg           85.1    6e-15   
ref|XP_010650370.1|  PREDICTED: polygalacturonase inhibitor-like      82.8    6e-15   
gb|KHG16201.1|  DNA-damage-repair/toleration protein                  83.2    6e-15   Gossypium arboreum [tree cotton]
ref|XP_006481843.1|  PREDICTED: receptor-like protein 12-like         85.5    6e-15   
gb|EMT14344.1|  LRR receptor-like serine/threonine-protein kinase...  85.1    6e-15   
ref|XP_006446689.1|  hypothetical protein CICLE_v10017769mg           85.1    6e-15   Citrus clementina [clementine]
gb|KCW64523.1|  hypothetical protein EUGRSUZ_G02124                   84.7    6e-15   Eucalyptus grandis [rose gum]
ref|XP_009394666.1|  PREDICTED: uncharacterized protein LOC103980107  85.5    6e-15   
ref|XP_006424163.1|  hypothetical protein CICLE_v10029837mg           85.1    6e-15   
emb|CDP04895.1|  unnamed protein product                              84.7    7e-15   Coffea canephora [robusta coffee]
ref|XP_004298186.1|  PREDICTED: probable leucine-rich repeat rece...  84.3    8e-15   Fragaria vesca subsp. vesca
ref|XP_004969084.1|  PREDICTED: receptor-like protein kinase 5-like   84.7    8e-15   
gb|AEQ27758.1|  receptor-like protein                                 84.7    8e-15   Malus domestica [apple tree]
ref|XP_007214523.1|  hypothetical protein PRUPE_ppa015660mg           84.7    8e-15   
ref|XP_010910550.1|  PREDICTED: probable LRR receptor-like serine...  84.0    8e-15   Elaeis guineensis
ref|XP_004971980.1|  PREDICTED: LRR receptor-like serine/threonin...  82.8    8e-15   
gb|KDO39365.1|  hypothetical protein CISIN_1g047152mg                 84.7    8e-15   Citrus sinensis [apfelsine]
gb|EMS60635.1|  LRR receptor-like serine/threonine-protein kinase...  84.7    9e-15   Triticum urartu
ref|XP_009385818.1|  PREDICTED: LRR receptor-like serine/threonin...  84.7    9e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO50225.1|  hypothetical protein CISIN_1g0032002mg                84.3    9e-15   Citrus sinensis [apfelsine]
ref|XP_007214101.1|  hypothetical protein PRUPE_ppa016834mg           84.7    9e-15   
ref|XP_007214083.1|  hypothetical protein PRUPE_ppa015322mg           84.7    9e-15   
ref|XP_010655310.1|  PREDICTED: leucine-rich repeat receptor-like...  82.4    9e-15   
ref|XP_002315907.2|  scab resistance family protein                   84.7    1e-14   
ref|XP_006424167.1|  hypothetical protein CICLE_v10030038mg           84.3    1e-14   
ref|XP_010662760.1|  PREDICTED: LRR receptor-like serine/threonin...  84.3    1e-14   Vitis vinifera
gb|KJB45924.1|  hypothetical protein B456_007G338300                  84.3    1e-14   Gossypium raimondii
ref|XP_006452209.1|  hypothetical protein CICLE_v10007386mg           84.3    1e-14   
ref|XP_008349566.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...  84.3    1e-14   
ref|XP_006452275.1|  hypothetical protein CICLE_v10007379mg           84.3    1e-14   
gb|EEC71023.1|  hypothetical protein OsI_02720                        84.3    1e-14   Oryza sativa Indica Group [Indian rice]
gb|EMS60645.1|  Leucine-rich repeat receptor protein kinase EXS       84.3    1e-14   Triticum urartu
ref|XP_006452261.1|  hypothetical protein CICLE_v10010776mg           84.3    1e-14   
ref|XP_009378842.1|  PREDICTED: probable LRR receptor-like serine...  84.0    1e-14   Pyrus x bretschneideri [bai li]
gb|KDO58288.1|  hypothetical protein CISIN_1g002600mg                 84.0    1e-14   Citrus sinensis [apfelsine]
ref|XP_009385819.1|  PREDICTED: probable leucine-rich repeat rece...  84.0    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009394655.1|  PREDICTED: probable leucine-rich repeat rece...  84.3    1e-14   
ref|XP_008343845.1|  PREDICTED: probable LRR receptor-like serine...  84.0    1e-14   
emb|CBI25207.3|  unnamed protein product                              84.0    2e-14   Vitis vinifera
ref|XP_009367839.1|  PREDICTED: LRR receptor-like serine/threonin...  84.0    2e-14   Pyrus x bretschneideri [bai li]
ref|XP_010918701.1|  PREDICTED: receptor-like protein 12              84.0    2e-14   
ref|XP_010646018.1|  PREDICTED: probably inactive leucine-rich re...  83.2    2e-14   Vitis vinifera
ref|XP_002315858.2|  scab resistance family protein                   84.0    2e-14   Populus trichocarpa [western balsam poplar]
emb|CAN71011.1|  hypothetical protein VITISV_002381                   83.6    2e-14   Vitis vinifera
gb|KJB45923.1|  hypothetical protein B456_007G338100                  83.6    2e-14   Gossypium raimondii
ref|XP_010655112.1|  PREDICTED: LRR receptor-like serine/threonin...  83.6    2e-14   Vitis vinifera
ref|XP_011654866.1|  PREDICTED: receptor-like protein 12              83.6    2e-14   Cucumis sativus [cucumbers]
ref|XP_002274689.1|  PREDICTED: receptor-like protein 12              83.6    2e-14   Vitis vinifera
ref|XP_010040211.1|  PREDICTED: probable leucine-rich repeat rece...  83.6    2e-14   
gb|KCW45386.1|  hypothetical protein EUGRSUZ_L00930                   83.6    2e-14   Eucalyptus grandis [rose gum]
ref|XP_009378848.1|  PREDICTED: uncharacterized protein LOC103967297  84.0    2e-14   
ref|XP_002273824.2|  PREDICTED: probable leucine-rich repeat rece...  83.6    2e-14   Vitis vinifera
ref|XP_010908126.1|  PREDICTED: LRR receptor-like serine/threonin...  83.6    2e-14   
ref|XP_011467021.1|  PREDICTED: LRR receptor-like serine/threonin...  83.2    2e-14   Fragaria vesca subsp. vesca
ref|XP_010087192.1|  putative LRR receptor-like serine/threonine-...  82.8    2e-14   
gb|EMT13563.1|  LRR receptor-like serine/threonine-protein kinase...  83.2    2e-14   
ref|XP_007021417.1|  Disease resistance family protein / LRR fami...  83.2    2e-14   
ref|XP_003633783.1|  PREDICTED: probable leucine-rich repeat rece...  83.2    2e-14   Vitis vinifera
gb|EAY74858.1|  hypothetical protein OsI_02750                        83.2    2e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_009607039.1|  PREDICTED: LRR receptor-like serine/threonin...  83.2    3e-14   Nicotiana tomentosiformis
gb|KCW64534.1|  hypothetical protein EUGRSUZ_G02136                   82.8    3e-14   Eucalyptus grandis [rose gum]
ref|XP_009388219.1|  PREDICTED: LRR receptor-like serine/threonin...  81.6    3e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009348759.1|  PREDICTED: receptor-like protein 12              83.2    3e-14   
emb|CAN75074.1|  hypothetical protein VITISV_026259                   82.4    3e-14   Vitis vinifera
ref|XP_007030467.1|  Disease resistance family protein / LRR fami...  83.2    3e-14   
ref|XP_006490686.1|  PREDICTED: LRR receptor-like serine/threonin...  82.8    3e-14   
ref|XP_009624409.1|  PREDICTED: receptor-like protein 12              83.2    3e-14   Nicotiana tomentosiformis
gb|KCW64345.1|  hypothetical protein EUGRSUZ_G019722                  82.4    3e-14   Eucalyptus grandis [rose gum]
ref|XP_009389814.1|  PREDICTED: LRR receptor-like serine/threonin...  82.8    3e-14   
gb|EMS55248.1|  LRR receptor-like serine/threonine-protein kinase...  82.8    3e-14   Triticum urartu
ref|XP_010911631.1|  PREDICTED: LRR receptor-like serine/threonin...  81.3    3e-14   
ref|XP_010907956.1|  PREDICTED: LRR receptor-like serine/threonin...  82.8    3e-14   
ref|XP_010231995.1|  PREDICTED: probable LRR receptor-like serine...  82.8    4e-14   Brachypodium distachyon [annual false brome]
ref|XP_009374463.1|  PREDICTED: LRR receptor-like serine/threonin...  82.8    4e-14   
gb|EMT23135.1|  hypothetical protein F775_52148                       82.8    4e-14   
emb|CAC40826.1|  HcrVf2 protein                                       82.8    4e-14   Malus floribunda [Japanese crab apple]
gb|AEQ27747.1|  receptor-like protein                                 82.8    4e-14   Malus baccata [shan jing zi]
ref|XP_010671566.1|  PREDICTED: receptor-like protein 12              82.8    4e-14   Beta vulgaris subsp. vulgaris [field beet]
gb|AEQ27746.1|  receptor-like protein                                 82.8    4e-14   Malus baccata [shan jing zi]
ref|XP_009394674.1|  PREDICTED: receptor-like protein 12              82.8    4e-14   
ref|XP_006485564.1|  PREDICTED: receptor-like protein kinase HSL1...  82.4    5e-14   
emb|CBI40047.3|  unnamed protein product                              82.4    5e-14   Vitis vinifera
ref|XP_010910714.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...  82.4    5e-14   
gb|ACJ03064.1|  AM19-5p                                               82.4    5e-14   Malus floribunda [Japanese crab apple]
gb|KJB45948.1|  hypothetical protein B456_007G339900                  82.4    5e-14   Gossypium raimondii
gb|KDO52973.1|  hypothetical protein CISIN_1g036642mg                 82.4    5e-14   Citrus sinensis [apfelsine]
ref|XP_010253789.1|  PREDICTED: LRR receptor-like serine/threonin...  82.0    5e-14   Nelumbo nucifera [Indian lotus]
gb|ACJ03072.1|  HB06p                                                 82.4    5e-14   Malus floribunda [Japanese crab apple]
ref|XP_010671922.1|  PREDICTED: receptor-like protein 12              82.4    6e-14   
gb|EMT01934.1|  LRR receptor-like serine/threonine-protein kinase...  82.0    6e-14   
ref|XP_008240708.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...  82.0    6e-14   
ref|XP_006475198.1|  PREDICTED: brassinosteroid LRR receptor kina...  82.0    6e-14   
gb|ABA94322.1|  Leucine Rich Repeat family protein                    82.0    6e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010249615.1|  PREDICTED: probable leucine-rich repeat rece...  82.0    6e-14   Nelumbo nucifera [Indian lotus]
ref|XP_008341680.1|  PREDICTED: probable LRR receptor-like serine...  82.0    6e-14   
emb|CAN71913.1|  hypothetical protein VITISV_032859                   82.0    7e-14   Vitis vinifera
ref|XP_006663530.1|  PREDICTED: probable leucine-rich repeat rece...  82.0    7e-14   
ref|XP_010650298.1|  PREDICTED: LRR receptor-like serine/threonin...  82.0    7e-14   Vitis vinifera
gb|EMT29341.1|  Leucine-rich repeat receptor protein kinase EXS       82.0    7e-14   
gb|KCW62343.1|  hypothetical protein EUGRSUZ_H04985                   82.0    7e-14   
ref|XP_008346112.1|  PREDICTED: probable leucine-rich repeat rece...  81.6    7e-14   
ref|XP_008362740.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...  81.6    7e-14   
ref|XP_009363245.1|  PREDICTED: probable leucine-rich repeat rece...  81.6    8e-14   
ref|XP_008361473.1|  PREDICTED: LRR receptor-like serine/threonin...  81.6    8e-14   
ref|XP_010025624.1|  PREDICTED: probable LRR receptor-like serine...  81.6    8e-14   
ref|XP_002436946.1|  hypothetical protein SORBIDRAFT_10g012050        81.6    8e-14   
gb|KJB45896.1|  hypothetical protein B456_007G335800                  81.6    8e-14   
ref|XP_009340169.1|  PREDICTED: receptor-like protein 12              81.6    9e-14   
ref|XP_009362739.1|  PREDICTED: leucine-rich repeat receptor-like...  81.6    9e-14   
ref|XP_010646028.1|  PREDICTED: probably inactive leucine-rich re...  81.3    9e-14   
ref|XP_009362738.1|  PREDICTED: receptor-like protein 12 isoform X1   81.6    9e-14   
ref|XP_008356142.1|  PREDICTED: leucine-rich repeat receptor prot...  81.6    9e-14   
gb|KDO36276.1|  hypothetical protein CISIN_1g047285mg                 80.9    9e-14   
gb|KEH25184.1|  LRR receptor-like kinase family protein               81.6    9e-14   
emb|CAC40825.1|  HcrVf1 protein                                       81.6    9e-14   
ref|XP_008346103.1|  PREDICTED: probable LRR receptor-like serine...  81.3    9e-14   
gb|KJB45902.1|  hypothetical protein B456_007G336200                  81.3    9e-14   
ref|XP_008240709.1|  PREDICTED: probable LRR receptor-like serine...  81.3    1e-13   
emb|CDO98599.1|  unnamed protein product                              81.3    1e-13   
ref|XP_004974894.1|  PREDICTED: probable LRR receptor-like serine...  81.3    1e-13   
gb|EMT19054.1|  Leucine-rich repeat receptor protein kinase EXS       81.3    1e-13   
ref|XP_009781238.1|  PREDICTED: LRR receptor-like serine/threonin...  81.3    1e-13   
emb|CDP18520.1|  unnamed protein product                              81.3    1e-13   
ref|XP_006475703.1|  PREDICTED: LRR receptor-like serine/threonin...  80.9    1e-13   
ref|XP_009362690.1|  PREDICTED: LRR receptor-like serine/threonin...  81.3    1e-13   
ref|XP_008372136.1|  PREDICTED: LRR receptor-like serine/threonin...  81.3    1e-13   
ref|XP_007035259.1|  Disease resistance family protein / LRR fami...  81.3    1e-13   
ref|XP_002268170.2|  PREDICTED: probable LRR receptor-like serine...  81.3    1e-13   
ref|XP_003593779.1|  Receptor-like protein kinase                     81.3    1e-13   
gb|EAY85345.1|  hypothetical protein OsI_06723                        81.3    1e-13   
gb|KEH29514.1|  LRR receptor-like kinase family protein               81.3    1e-13   
gb|EMS35655.1|  LRR receptor-like serine/threonine-protein kinase...  81.3    1e-13   
ref|XP_006494716.1|  PREDICTED: LRR receptor-like serine/threonin...  80.9    1e-13   
ref|XP_010068268.1|  PREDICTED: probably inactive leucine-rich re...  81.3    1e-13   
ref|XP_008353907.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...  80.9    1e-13   
ref|XP_003621481.1|  Receptor-like protein kinase                     80.9    1e-13   
ref|XP_010087503.1|  Probably inactive leucine-rich repeat recept...  79.7    1e-13   
gb|KJB45925.1|  hypothetical protein B456_007G338400                  80.9    1e-13   
ref|XP_007144181.1|  hypothetical protein PHAVU_007G135200g           80.9    1e-13   
ref|XP_006493981.1|  PREDICTED: LRR receptor-like serine/threonin...  80.9    1e-13   
ref|XP_010918678.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  80.9    1e-13   
ref|XP_009395538.1|  PREDICTED: receptor-like protein 12              80.9    2e-13   
gb|EMT00043.1|  LRR receptor-like serine/threonine-protein kinase...  80.9    2e-13   
emb|CBI24590.3|  unnamed protein product                              79.7    2e-13   
ref|XP_007214009.1|  hypothetical protein PRUPE_ppa014796mg           80.9    2e-13   
gb|KCW45177.1|  hypothetical protein EUGRSUZ_L011922                  80.5    2e-13   
ref|XP_007219128.1|  hypothetical protein PRUPE_ppa015868mg           77.4    2e-13   
ref|XP_009389817.1|  PREDICTED: receptor-like protein 12              80.9    2e-13   
emb|CDP08516.1|  unnamed protein product                              80.9    2e-13   
gb|EEC68371.1|  hypothetical protein OsI_36508                        80.5    2e-13   
ref|XP_011020398.1|  PREDICTED: receptor-like protein 12              80.9    2e-13   
ref|XP_008354989.1|  PREDICTED: probable LRR receptor-like serine...  80.9    2e-13   
ref|XP_010646954.1|  PREDICTED: receptor-like protein 12              80.1    2e-13   
ref|XP_010040482.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...  80.5    2e-13   
gb|EMS60284.1|  LRR receptor-like serine/threonine-protein kinase...  80.5    2e-13   
ref|XP_008347020.1|  PREDICTED: probable LRR receptor-like serine...  80.5    2e-13   
gb|KJB45942.1|  hypothetical protein B456_007G339300                  80.5    2e-13   
dbj|BAG90139.1|  unnamed protein product                              80.5    2e-13   
ref|XP_002268246.1|  PREDICTED: LRR receptor-like serine/threonin...  80.5    2e-13   
gb|ABA94357.1|  Leucine Rich Repeat family protein                    80.5    2e-13   
gb|EEE54946.1|  hypothetical protein OsJ_02516                        80.5    2e-13   
gb|KJB45913.1|  hypothetical protein B456_007G3374001                 80.1    2e-13   
ref|XP_010662800.1|  PREDICTED: leucine-rich repeat receptor prot...  80.5    2e-13   
dbj|BAD52656.1|  HcrVf3 protein-like                                  80.1    2e-13   
ref|XP_010231989.1|  PREDICTED: probable leucine-rich repeat rece...  80.5    2e-13   
ref|XP_010033401.1|  PREDICTED: receptor-like protein 12              80.5    2e-13   
gb|EEE52285.1|  hypothetical protein OsJ_34275                        80.5    2e-13   
ref|XP_003579434.1|  PREDICTED: probable LRR receptor-like serine...  80.5    2e-13   
ref|XP_008218773.1|  PREDICTED: probable leucine-rich repeat rece...  80.5    2e-13   
tpg|DAA59209.1|  TPA: hypothetical protein ZEAMMB73_309165            80.5    2e-13   
ref|XP_002450813.1|  hypothetical protein SORBIDRAFT_05g018970        80.1    2e-13   
gb|KCW86893.1|  hypothetical protein EUGRSUZ_B03476                   80.5    2e-13   
gb|EMT18287.1|  LRR receptor-like serine/threonine-protein kinase...  80.5    2e-13   
gb|KDO36772.1|  hypothetical protein CISIN_1g041155mg                 79.7    2e-13   
ref|XP_002444056.1|  hypothetical protein SORBIDRAFT_07g006470        80.1    2e-13   
ref|XP_008467299.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  80.1    2e-13   
ref|XP_002265750.2|  PREDICTED: LRR receptor-like serine/threonin...  80.1    2e-13   
gb|EEC71026.1|  hypothetical protein OsI_02728                        80.1    2e-13   
ref|XP_009363364.1|  PREDICTED: LRR receptor-like serine/threonin...  80.1    2e-13   
ref|XP_002264905.3|  PREDICTED: LRR receptor-like serine/threonin...  80.1    2e-13   
ref|XP_010034664.1|  PREDICTED: LRR receptor-like serine/threonin...  80.1    2e-13   
ref|XP_009365382.1|  PREDICTED: LRR receptor-like serine/threonin...  80.1    3e-13   
ref|XP_009365389.1|  PREDICTED: leucine-rich repeat receptor-like...  77.4    3e-13   
gb|KHN42550.1|  LRR receptor-like serine/threonine-protein kinase...  80.1    3e-13   
ref|XP_008676404.1|  PREDICTED: LRR receptor-like serine/threonin...  80.1    3e-13   
gb|EMS56534.1|  Leucine-rich repeat receptor-like protein kinase ...  79.7    3e-13   
ref|XP_007021422.1|  Disease resistance family protein / LRR fami...  80.1    3e-13   
ref|XP_008375200.1|  PREDICTED: LRR receptor-like serine/threonin...  80.1    3e-13   
gb|EYU34801.1|  hypothetical protein MIMGU_mgv1a023857mg              80.1    3e-13   
ref|XP_007214288.1|  hypothetical protein PRUPE_ppb000367mg           80.1    3e-13   
ref|XP_007213541.1|  hypothetical protein PRUPE_ppa019519mg           80.1    3e-13   
ref|XP_008779794.1|  PREDICTED: probable LRR receptor-like serine...  79.7    3e-13   
emb|CDP20351.1|  unnamed protein product                              79.3    3e-13   
ref|XP_010046668.1|  PREDICTED: leucine-rich repeat receptor-like...  80.1    3e-13   
ref|XP_011470029.1|  PREDICTED: receptor-like protein 12              79.7    3e-13   
emb|CAC40827.1|  HcrVf3 protein                                       79.7    3e-13   
gb|KDO62586.1|  hypothetical protein CISIN_1g035852mg                 79.7    3e-13   
gb|AEQ27752.1|  receptor-like protein                                 79.7    3e-13   
gb|AEQ27748.1|  receptor-like protein                                 79.7    3e-13   
ref|XP_004513677.1|  PREDICTED: LRR receptor-like serine/threonin...  79.7    3e-13   
ref|XP_008375503.1|  PREDICTED: probable LRR receptor-like serine...  79.7    3e-13   
gb|ACJ03074.1|  HcrVf4                                                79.7    3e-13   
gb|EAZ22557.1|  hypothetical protein OsJ_06223                        79.7    3e-13   
ref|XP_009418861.1|  PREDICTED: receptor-like protein 12              79.7    3e-13   
gb|KDO55604.1|  hypothetical protein CISIN_1g0373251mg                79.0    3e-13   
gb|EMS54105.1|  LRR receptor-like serine/threonine-protein kinase...  79.7    3e-13   
ref|XP_010908117.1|  PREDICTED: probable leucine-rich repeat rece...  79.7    3e-13   
ref|NP_001172894.1|  Os02g0274200                                     79.7    3e-13   
emb|CAN61943.1|  hypothetical protein VITISV_017886                   79.7    3e-13   
ref|XP_012065989.1|  PREDICTED: receptor-like protein 12              79.7    3e-13   
gb|KDP43139.1|  hypothetical protein JCGZ_26672                       79.7    3e-13   
ref|XP_009394664.1|  PREDICTED: probable LRR receptor-like serine...  79.3    4e-13   
ref|XP_009347195.1|  PREDICTED: leucine-rich repeat receptor-like...  79.7    4e-13   
gb|AEQ27742.1|  receptor-like protein                                 79.7    4e-13   
gb|AEQ27755.1|  receptor-like protein                                 79.7    4e-13   
ref|XP_002458027.1|  hypothetical protein SORBIDRAFT_03g025650        79.7    4e-13   
ref|XP_010672176.1|  PREDICTED: LRR receptor-like serine/threonin...  79.7    4e-13   
dbj|BAD21834.1|  putative HcrVf2 protein                              79.7    4e-13   
ref|XP_009362749.1|  PREDICTED: probable LRR receptor-like serine...  79.7    4e-13   
gb|ACJ03073.1|  HB09p                                                 79.7    4e-13   
emb|CDM85725.1|  unnamed protein product                              79.7    4e-13   
emb|CAN75075.1|  hypothetical protein VITISV_026260                   79.7    4e-13   
ref|XP_008780090.1|  PREDICTED: probable LRR receptor-like serine...  79.0    4e-13   
ref|XP_008358100.1|  PREDICTED: receptor-like protein 12              79.7    4e-13   
dbj|BAJ93154.1|  predicted protein                                    79.7    4e-13   
emb|CBI22711.3|  unnamed protein product                              79.7    4e-13   
ref|XP_008437704.1|  PREDICTED: probable LRR receptor-like serine...  79.3    4e-13   
ref|XP_009355165.1|  PREDICTED: LRR receptor-like serine/threonin...  79.3    4e-13   
ref|XP_006599584.1|  PREDICTED: leucine-rich repeat receptor prot...  79.3    4e-13   
ref|XP_010662661.1|  PREDICTED: LRR receptor-like serine/threonin...  79.3    4e-13   
ref|XP_008437709.1|  PREDICTED: LRR receptor-like serine/threonin...  76.3    4e-13   
gb|EMT06742.1|  LRR receptor-like serine/threonine-protein kinase...  79.3    4e-13   
ref|XP_009418866.1|  PREDICTED: LRR receptor-like serine/threonin...  79.0    4e-13   
gb|AAS48162.1|  LRR protein WM1.2                                     79.3    4e-13   
ref|XP_004308368.2|  PREDICTED: probable LRR receptor-like serine...  79.3    4e-13   
ref|XP_008372146.1|  PREDICTED: LRR receptor-like serine/threonin...  79.3    4e-13   
ref|XP_009418858.1|  PREDICTED: probable leucine-rich repeat rece...  79.3    4e-13   
ref|XP_012085109.1|  PREDICTED: receptor-like protein 12              79.3    5e-13   
gb|KCW45659.1|  hypothetical protein EUGRSUZ_L00586                   79.3    5e-13   
ref|XP_003549094.2|  PREDICTED: probable leucine-rich repeat rece...  79.3    5e-13   
ref|XP_007038269.1|  Disease resistance family protein / LRR fami...  79.3    5e-13   
ref|XP_010910225.1|  PREDICTED: probable leucine-rich repeat rece...  78.6    5e-13   
ref|XP_009394657.1|  PREDICTED: LRR receptor-like serine/threonin...  79.0    5e-13   
ref|XP_006424157.1|  hypothetical protein CICLE_v10029857mg           79.0    5e-13   
ref|XP_008362544.1|  PREDICTED: receptor-like protein 12              79.3    5e-13   
gb|EMT21342.1|  LRR receptor-like serine/threonine-protein kinase...  79.0    5e-13   
ref|XP_008225908.1|  PREDICTED: LRR receptor-like serine/threonin...  79.0    5e-13   
gb|EMS49415.1|  LRR receptor-like serine/threonine-protein kinase...  79.0    5e-13   
ref|XP_006420959.1|  hypothetical protein CICLE_v10006793mg           79.0    6e-13   
ref|XP_010671582.1|  PREDICTED: receptor-like protein 12              79.0    6e-13   
gb|EMT08468.1|  LRR receptor-like serine/threonine-protein kinase...  79.0    6e-13   
ref|XP_009394656.1|  PREDICTED: LRR receptor-like serine/threonin...  79.0    6e-13   
dbj|BAJ89112.1|  predicted protein                                    79.0    6e-13   
ref|XP_008673613.1|  PREDICTED: probable LRR receptor-like serine...  79.0    7e-13   
gb|EEC68373.1|  hypothetical protein OsI_36511                        78.6    7e-13   
ref|XP_006452200.1|  hypothetical protein CICLE_v10010467mg           79.0    7e-13   
ref|XP_008348513.1|  PREDICTED: probable LRR receptor-like serine...  78.6    7e-13   
gb|EMT03821.1|  LRR receptor-like serine/threonine-protein kinase...  79.0    7e-13   
dbj|BAJ98786.1|  predicted protein                                    78.6    7e-13   
ref|XP_012085837.1|  PREDICTED: LRR receptor-like serine/threonin...  78.6    7e-13   
gb|EMS67398.1|  Receptor-like protein 12                              78.6    7e-13   
ref|XP_008344651.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...  78.6    7e-13   
gb|EMT24090.1|  Somatic embryogenesis receptor kinase 1               75.5    8e-13   
ref|XP_009365388.1|  PREDICTED: leucine-rich repeat receptor-like...  77.0    8e-13   
ref|XP_006584418.1|  PREDICTED: receptor-like protein 12-like         78.2    8e-13   
gb|EMS65463.1|  LRR receptor-like serine/threonine-protein kinase...  78.6    8e-13   
ref|XP_008372020.1|  PREDICTED: receptor-like protein 12 isoform X2   77.8    9e-13   
gb|AEQ27751.1|  receptor-like protein                                 78.6    9e-13   
ref|XP_006475187.1|  PREDICTED: LRR receptor-like serine/threonin...  78.6    9e-13   
gb|KJB45216.1|  hypothetical protein B456_007G295800                  78.6    9e-13   
ref|XP_004507279.1|  PREDICTED: probable leucine-rich repeat rece...  78.2    1e-12   
ref|XP_011091762.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  78.2    1e-12   
ref|XP_011463260.1|  PREDICTED: receptor-like protein 12              78.2    1e-12   
gb|EMT24091.1|  LRR receptor-like serine/threonine-protein kinase...  78.2    1e-12   
gb|EAY81350.1|  hypothetical protein OsI_36522                        77.8    1e-12   
gb|EMS45946.1|  LRR receptor-like serine/threonine-protein kinase...  78.2    1e-12   
emb|CDP05584.1|  unnamed protein product                              78.2    1e-12   
gb|EAY74841.1|  hypothetical protein OsI_02733                        77.0    1e-12   
gb|EMT02482.1|  LRR receptor-like serine/threonine-protein kinase...  78.2    1e-12   
gb|AAS48164.1|  LRR protein WM1.10                                    78.2    1e-12   
gb|AAS48163.1|  LLR protein WM1.1                                     78.2    1e-12   
gb|EMT18236.1|  LRR receptor-like serine/threonine-protein kinase...  78.2    1e-12   
gb|EMT19055.1|  LRR receptor-like serine/threonine-protein kinase...  77.8    1e-12   
gb|EMT15994.1|  LRR receptor-like serine/threonine-protein kinase...  77.8    1e-12   
ref|XP_009760943.1|  PREDICTED: LRR receptor-like serine/threonin...  77.8    1e-12   
ref|XP_009363262.1|  PREDICTED: LRR receptor-like serine/threonin...  77.8    1e-12   
ref|XP_006452205.1|  hypothetical protein CICLE_v100104712mg          77.4    1e-12   
ref|XP_009365374.1|  PREDICTED: leucine-rich repeat receptor prot...  77.8    1e-12   
ref|XP_008375192.1|  PREDICTED: LRR receptor-like serine/threonin...  77.8    1e-12   
gb|ACJ03065.1|  HB03p                                                 77.8    1e-12   
ref|XP_002273126.2|  PREDICTED: leucine-rich repeat receptor prot...  77.8    1e-12   
ref|XP_009386420.1|  PREDICTED: leucine-rich repeat receptor-like...  76.6    1e-12   
ref|NP_001056750.2|  Os06g0140200                                     77.8    1e-12   
gb|ABI15898.1|  predicted leucine rich repeat protein                 77.8    1e-12   
emb|CDP18524.1|  unnamed protein product                              77.4    2e-12   
dbj|BAD68677.1|  putative HcrVf3 protein                              77.8    2e-12   
gb|KEH25161.1|  LRR receptor-like kinase family protein               77.0    2e-12   
ref|XP_002298417.2|  hypothetical protein POPTR_0001s27000g           77.8    2e-12   
ref|NP_001068100.1|  Os11g0558900                                     77.4    2e-12   
gb|EEC68364.1|  hypothetical protein OsI_36499                        77.4    2e-12   
gb|KDO41142.1|  hypothetical protein CISIN_1g0401092mg                76.6    2e-12   
ref|XP_011005452.1|  PREDICTED: receptor-like protein 12 isoform X2   77.4    2e-12   
gb|ABA94303.1|  Leucine Rich Repeat family protein                    77.4    2e-12   
ref|XP_004980614.1|  PREDICTED: leucine-rich repeat receptor-like...  77.4    2e-12   
ref|XP_009418863.1|  PREDICTED: LRR receptor-like serine/threonin...  77.4    2e-12   
gb|KJB45910.1|  hypothetical protein B456_007G3372001                 77.0    2e-12   
ref|XP_002445768.1|  hypothetical protein SORBIDRAFT_07g025500        77.0    2e-12   
emb|CAN82211.1|  hypothetical protein VITISV_027552                   77.0    2e-12   
gb|KEH29511.1|  LRR receptor-like kinase family protein               77.4    2e-12   
gb|KDO56863.1|  hypothetical protein CISIN_1g0025141mg                76.6    2e-12   
ref|XP_002510786.1|  serine-threonine protein kinase, plant-type,...  77.0    2e-12   
ref|XP_006600080.1|  PREDICTED: LRR receptor-like serine/threonin...  77.0    2e-12   
ref|XP_008779843.1|  PREDICTED: probable LRR receptor-like serine...  75.9    2e-12   
ref|XP_006421134.1|  hypothetical protein CICLE_v10006453mg           77.0    2e-12   
ref|XP_012074609.1|  PREDICTED: leucine-rich repeat receptor prot...  77.0    3e-12   
ref|XP_008467327.1|  PREDICTED: probable leucine-rich repeat rece...  77.0    3e-12   
ref|NP_001056751.1|  Os06g0140300                                     77.0    3e-12   
ref|XP_008467326.1|  PREDICTED: probable leucine-rich repeat rece...  77.0    3e-12   
ref|XP_006452331.1|  hypothetical protein CICLE_v10010475mg           77.0    3e-12   



>ref|XP_010068694.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Eucalyptus grandis]
Length=974

 Score =   102 bits (255),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 113/198 (57%), Gaps = 14/198 (7%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            SCF  ER+ALL F+  ++       S    D  CC+WKGV C +  T HV  L L  +  
Sbjct  33   SCFGTEREALLKFRQGLVDQSKRLSSWTSKD--CCEWKGVEC-SKKTGHVFKLDL--RNP  87

Query  327  CTDGSP-----CY-NPGFQGEIspsllhlpflnfldlsFNKFDR--IPSFIGslnnlvyl  482
            C + SP     C  N    G+I  SL  L  L +LDLSFNKF +  IP F GSL  L YL
Sbjct  88   CFETSPDGYISCLDNSSLAGKIHASLAELKHLKYLDLSFNKFSKPKIPQFFGSLQRLEYL  147

Query  483  nlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDL  662
            NLS   F GN+P HL N+S L+YLD+ N F G+     D L+W+S LSSL+Y N+  +DL
Sbjct  148  NLSSAGFDGNIPHHLSNLSNLQYLDLANEF-GEGYLTSDNLQWVSKLSSLKYFNLAGIDL  206

Query  663  HSVSDWLHSISKLSFLRT  716
               +DW  SI+ LS L++
Sbjct  207  WKANDWFSSINMLSSLQS  224



>gb|KCW64519.1| hypothetical protein EUGRSUZ_G02120 [Eucalyptus grandis]
Length=969

 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 113/198 (57%), Gaps = 14/198 (7%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            SCF  ER+ALL F+  ++       S    D  CC+WKGV C +  T HV  L L  +  
Sbjct  33   SCFGTEREALLKFRQGLVDQSKRLSSWTSKD--CCEWKGVEC-SKKTGHVFKLDL--RNP  87

Query  327  CTDGSP-----CY-NPGFQGEIspsllhlpflnfldlsFNKFDR--IPSFIGslnnlvyl  482
            C + SP     C  N    G+I  SL  L  L +LDLSFNKF +  IP F GSL  L YL
Sbjct  88   CFETSPDGYISCLDNSSLAGKIHASLAELKHLKYLDLSFNKFSKPKIPQFFGSLQRLEYL  147

Query  483  nlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDL  662
            NLS   F GN+P HL N+S L+YLD+ N F G+     D L+W+S LSSL+Y N+  +DL
Sbjct  148  NLSSAGFDGNIPHHLSNLSNLQYLDLANEF-GEGYLTSDNLQWVSKLSSLKYFNLAGIDL  206

Query  663  HSVSDWLHSISKLSFLRT  716
               +DW  SI+ LS L++
Sbjct  207  WKANDWFSSINMLSSLQS  224



>ref|XP_008807618.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Phoenix dactylifera]
Length=1048

 Score =   102 bits (253),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 118/196 (60%), Gaps = 15/196 (8%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            SC + ERKALL FK         +  S     +CC+W+GV CDN T   V+ + L  Q  
Sbjct  34   SCLDAERKALLQFK--SGLSDPENRLSSWQGRNCCRWRGVSCDNQT-GFVIGIDLQNQH-  89

Query  327  CTDGSPCYNP--GF---QGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvyln  485
              D  P  N   GF    G + PSLL L  L  LDLS+N F+  RIP FIGSLNNL YL+
Sbjct  90   PKDFGPVSNSRNGFWNLSGRVDPSLLQLKSLRHLDLSYNTFEGIRIPEFIGSLNNLRYLD  149

Query  486  lsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLH  665
            LS   FVG +PP LGN+S L+YLD+ +NF   +L +VD+ +WI+ LSSL +L MD VDL 
Sbjct  150  LSNAGFVGTIPPRLGNLSRLQYLDLSSNF---QLLMVDSFQWITGLSSLVHLAMDGVDLS  206

Query  666  SV-SDWLHSISKLSFL  710
             +  +W+H +++L  L
Sbjct  207  LIGPEWIHMLNRLPSL  222



>ref|XP_008218761.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Prunus mume]
Length=894

 Score =   100 bits (248),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 119/186 (64%), Gaps = 15/186 (8%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            N S  C +NER+ALL FKH +        SS G+ D CC W GV CDN T  HV+ LHL 
Sbjct  27   NLSAPCKQNERRALLKFKHDLEDPSNQLSSSAGEGD-CCNWAGVVCDNLT-GHVLELHLA  84

Query  315  RQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnl  488
                   G   + P F G+I+PSLL+L  L +LDLS N F+  +IPSF+GSL +L YLNL
Sbjct  85   -------GYMPFTPSFSGKINPSLLNLTHLTYLDLSNNHFEGMQIPSFLGSLKSLRYLNL  137

Query  489  synKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHS  668
            SY+ FVG +P  LGN+++L+ LD+G+  Y +R   V++L+WIS LS L++L+M   +L  
Sbjct  138  SYSSFVGLIPHQLGNLTSLQVLDLGD--YSER--EVESLQWISGLSQLQHLDMSGANLSK  193

Query  669  VSDWLH  686
             SDWL 
Sbjct  194  ASDWLR  199



>gb|KCW64528.1| hypothetical protein EUGRSUZ_G02130 [Eucalyptus grandis]
Length=909

 Score = 99.8 bits (247),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 108/194 (56%), Gaps = 8/194 (4%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            SCF  ER+ALL F+  +I       S    D  CC+WKGV C + TT HV  L L     
Sbjct  33   SCFGTEREALLKFRQGLIDHSKRLSSWTSKD--CCEWKGVEC-SKTTGHVFKLDLRNPCF  89

Query  327  CTDGSP-CYNPG-FQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsy  494
             TD    C N     G+I  SL  L  L +LDLS N F   +IP F G+L  L YLNLS 
Sbjct  90   ETDPDGYCLNKSSLAGQIHASLAELKHLKYLDLSLNNFSKQKIPQFFGTLQRLEYLNLSS  149

Query  495  nKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVS  674
              F GN+P HLGN+S L+Y+D+ N F G+     D L+W+S LSSL+Y  +  +DL    
Sbjct  150  AGFDGNIPHHLGNLSNLQYMDLANEF-GKGYLTSDNLQWVSKLSSLKYFLLTVIDLRKAK  208

Query  675  DWLHSISKLSFLRT  716
            DW  SI+ LS L++
Sbjct  209  DWFSSINMLSSLQS  222



>ref|XP_008775355.1| PREDICTED: receptor-like protein 12 [Phoenix dactylifera]
Length=987

 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 110/187 (59%), Gaps = 9/187 (5%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHL-GRQGL  326
            C + ER ALL FK        +   +    DDCC+W+GV C NTT  HV+ L L   Q L
Sbjct  26   CLQQERNALLGFK--ANIRDPTKKLASWVGDDCCQWRGVHCSNTT-GHVIQLDLHNPQPL  82

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsynK  500
              DGSP Y+    GEI+PSLL L  L++LDLS N F    IP FI SL  L Y+N S   
Sbjct  83   NYDGSPDYSGSLGGEINPSLLGLEHLSYLDLSLNYFVGASIPKFISSLKELTYINFSRAG  142

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F G +PP LGN+S+L++LD+   +        D ++WIS LSSL YLNM  V+L SV++W
Sbjct  143  FTGIIPPELGNLSSLRHLDL---YSLTPALYADDVQWISSLSSLRYLNMGGVNLISVTNW  199

Query  681  LHSISKL  701
            L  ++ L
Sbjct  200  LQVLNML  206



>ref|XP_004980222.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930-like [Setaria italica]
Length=951

 Score = 98.6 bits (244),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 112/192 (58%), Gaps = 14/192 (7%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHL-GRQGL  326
            C  +ER ALLS K            S    +DCC+WKGV C N T+ HVV L L G  G 
Sbjct  38   CITSERDALLSLK--AGLLDPGGQLSSWQGEDCCQWKGVHCSNRTS-HVVKLDLHGDVGH  94

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynK  500
              +          GE+S SL+ L  L +LDLS N F+   IP FIGSL NL YLNLS+ +
Sbjct  95   SENA-------LGGEMSSSLVELQHLKYLDLSCNYFNGSSIPKFIGSLKNLEYLNLSFAQ  147

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F+G +PP LGN+S L YLD+GNN+Y   L   D+L W+SHLS L+YL+M   +L +  DW
Sbjct  148  FLGRIPPQLGNLSNLVYLDLGNNYYCSYL-YSDSLIWVSHLSQLKYLDMSWANLSAAVDW  206

Query  681  LHSISKLSFLRT  716
            ++ IS L  L  
Sbjct  207  IYGISSLPSLEV  218



>ref|XP_011460549.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=485

 Score = 96.7 bits (239),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 115/198 (58%), Gaps = 25/198 (13%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            S SC E ER+ALLSFK  +        S  G D  CC+WKG+ C+N T  HVV + L   
Sbjct  72   STSCMEEERRALLSFKEDVSDRSGRLSSWVGLD--CCRWKGISCNNHT-GHVVKMDLR--  126

Query  321  GLCTDGSPCYNP--GF------QGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnn  470
                  +P Y+P  GF      +G+I+PS L L  L +LDLS N F+  RIP+F G L +
Sbjct  127  ------NPKYDPLNGFNGKTSLRGKINPSFLSLKSLYYLDLSGNDFEGRRIPNFFGKLTS  180

Query  471  lvylnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMD  650
            L YLN+SY  F G +PP LGN+S L YLD+ N   G   K    L W+SHLSSL+YLN+ 
Sbjct  181  LRYLNISYASFEGEIPPALGNLSNLNYLDLKNYVNGGYSK---NLNWLSHLSSLKYLNLG  237

Query  651  CVDLHSVS-DWLHSISKL  701
             VDL +    WLH ++ L
Sbjct  238  GVDLSNTGVSWLHDVNML  255



>ref|XP_010068697.1| PREDICTED: leucine-rich repeat receptor-like protein CLAVATA2 
[Eucalyptus grandis]
Length=534

 Score = 96.7 bits (239),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 111/196 (57%), Gaps = 12/196 (6%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            SCF  ER+ALL F+  +I       S    D  CC+WKGV C +  T HV  L L  +  
Sbjct  33   SCFGTEREALLKFRQGLIDHSKRLSSWTSKD--CCEWKGVQC-SKKTGHVFKLDL--RNP  87

Query  327  CTDGSP---CYNPG-FQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnl  488
            C + SP   C +     G+I  SL  L  L +LDLS N F   +IP F G+L  L YLNL
Sbjct  88   CFETSPDGYCLDKSSLAGKIHASLAELKHLKYLDLSLNNFSMQKIPQFFGTLQRLEYLNL  147

Query  489  synKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHS  668
            S   F GN+P HLGN+S L YLD+ + F G+     D L+W+S LSSL+Y ++  +DL  
Sbjct  148  SSAGFDGNIPHHLGNLSNLWYLDLASEF-GEGYLTSDNLQWVSKLSSLKYFHLALIDLRK  206

Query  669  VSDWLHSISKLSFLRT  716
              DWL SI+ LS L++
Sbjct  207  AKDWLSSINMLSSLQS  222



>gb|KCW62328.1| hypothetical protein EUGRSUZ_H049701, partial [Eucalyptus grandis]
Length=267

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 110/197 (56%), Gaps = 12/197 (6%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            SCF  ER+ALL F+  +I       S    D  CC+WKGV C +  T HV  L L R   
Sbjct  33   SCFGTEREALLKFRQGLIDHSKRLSSWTNKD--CCEWKGVKC-SKKTGHVFKLDL-RNPF  88

Query  327  CTDGSPCYNP-----GFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvyln  485
            C      Y+         G+I  SL  L  L +LDLS N+F   + P F G+L  L YLN
Sbjct  89   CETFPDGYDSCSDESRLAGKIHASLAELKHLKYLDLSLNEFSKQKTPQFFGTLPRLEYLN  148

Query  486  lsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLH  665
            LS+  F GN+P HLGN+S L+YLD+ N F G  L   D L+W+S LSSL+Y ++    L 
Sbjct  149  LSFAGFDGNIPRHLGNLSNLQYLDLTNGFDGDYL-TTDNLQWVSKLSSLKYFHLSHAYLR  207

Query  666  SVSDWLHSISKLSFLRT  716
            + +DWL SI+ LS L++
Sbjct  208  NATDWLSSINMLSSLQS  224



>ref|XP_010918709.1| PREDICTED: receptor-like protein 12 [Elaeis guineensis]
Length=989

 Score = 97.4 bits (241),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 110/187 (59%), Gaps = 9/187 (5%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHL-GRQGL  326
            C + ER ALL FK        ++  +    DDCC+W+GV C NTT  HVV L L   Q L
Sbjct  26   CLQQERDALLGFK--AGIKDPTNKLASWVGDDCCQWRGVHCSNTT-GHVVQLDLHNPQPL  82

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsynK  500
              DGSP Y+    GEI+PSLL L  L++LDLS N F    IP FIGSL  L Y+N S   
Sbjct  83   NYDGSPDYSGSLSGEINPSLLGLEHLSYLDLSLNYFVGATIPKFIGSLKELTYINFSRAS  142

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F G +PP LGN+S L +LD+ +      L   D ++WIS LSSL YLNM  V+L SV+ W
Sbjct  143  FAGIIPPELGNLSNLHHLDLYS--LAPTLYAKD-VQWISSLSSLRYLNMGGVNLISVTSW  199

Query  681  LHSISKL  701
            L  ++ L
Sbjct  200  LQVLNML  206



>gb|KCW64526.1| hypothetical protein EUGRSUZ_G02127 [Eucalyptus grandis]
Length=838

 Score = 97.1 bits (240),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 111/196 (57%), Gaps = 12/196 (6%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            SCF  ER+ALL F+  +I       S    D  CC+WKGV C +  T HV  L L  +  
Sbjct  33   SCFGTEREALLKFRQGLIDHSKRLSSWTSKD--CCEWKGVQC-SKKTGHVFKLDL--RNP  87

Query  327  CTDGSP---CYNPG-FQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnl  488
            C + SP   C +     G+I  SL  L  L +LDLS N F   +IP F G+L  L YLNL
Sbjct  88   CFETSPDGYCLDKSSLAGKIHASLAELKHLKYLDLSLNNFSMQKIPQFFGTLQRLEYLNL  147

Query  489  synKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHS  668
            S   F GN+P HLGN+S L YLD+ + F G+     D L+W+S LSSL+Y ++  +DL  
Sbjct  148  SSAGFDGNIPHHLGNLSNLWYLDLASEF-GEGYLTSDNLQWVSKLSSLKYFHLALIDLRK  206

Query  669  VSDWLHSISKLSFLRT  716
              DWL SI+ LS L++
Sbjct  207  AKDWLSSINMLSSLQS  222



>emb|CAN63882.1| hypothetical protein VITISV_002032 [Vitis vinifera]
Length=898

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 114/193 (59%), Gaps = 10/193 (5%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            ++ C E ERKALL FK+ +        S  G D  CCKWKGV C+N T  HVV + L   
Sbjct  38   NKGCIEVERKALLEFKNGLKDPSGRLSSWVGAD--CCKWKGVDCNNQT-GHVVKVDLKSG  94

Query  321  GLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsy  494
            G  +     ++    GEIS SLL L  L +LDLS N F    IP+F+GS   L YLNLS 
Sbjct  95   GXFSRLGGGFS-RLGGEISGSLLDLKHLTYLDLSLNDFQGIPIPNFLGSFERLRYLNLSN  153

Query  495  nKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDL-HSV  671
             +F G +PPHLGN+S L+YLDI    Y  R   V  L W+S LSSL+YL++  VDL  + 
Sbjct  154  ARFGGMIPPHLGNLSQLRYLDILGGDYPMR---VSNLNWLSGLSSLKYLDLAYVDLSKAT  210

Query  672  SDWLHSISKLSFL  710
            ++W+ +++ L FL
Sbjct  211  TNWMQAVNMLPFL  223



>gb|EMT13998.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Aegilops 
tauschii]
Length=1118

 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 111/193 (58%), Gaps = 20/193 (10%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            SC  +ER ALLSFK            S    +DCC W+GVGC N T  HVV L+L   G 
Sbjct  32   SCVAHERAALLSFK--GSLSDPVKQLSSWHGEDCCTWEGVGCSNRT-GHVVNLNLSGCG-  87

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynK  500
                   Y     G+ISPSL  L  L +LDLS N F   +IP F+ SL +L +L+LS+  
Sbjct  88   -------YEARVGGDISPSLTALHHLKYLDLSCNNFSGVQIPKFVASLKSLQHLDLSFAS  140

Query  501  FVGNVPPHLGNISTLKYLDIGNN-FYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSD  677
            FVG VPP LGN+S L +L + +N  Y       D L W+SHL+SL+YL+M  V+L +  D
Sbjct  141  FVGRVPPQLGNLSNLVFLSVSDNPLYS------DDLAWLSHLTSLQYLDMSSVNLSTSVD  194

Query  678  WLHSISKLSFLRT  716
            W+H+I+KL  L+ 
Sbjct  195  WVHAINKLPSLKV  207



>gb|EEE54949.1| hypothetical protein OsJ_02519 [Oryza sativa Japonica Group]
Length=913

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 116/197 (59%), Gaps = 11/197 (6%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C   ER ALLSFK  +++DPL  L SW    DCC+W GVGC N T  HVV L L R  L 
Sbjct  37   CIAAERAALLSFKEGVMADPLRLLDSWQGAGDCCRWNGVGCSNRT-GHVVKLDL-RNTLY  94

Query  330  TDGSPCY---NP-GFQGEIspsllhlpflnfldlsFNKFD----RIPSFIGslnnlvyln  485
             D        NP   +G++S SLL L  L +L LS N        IPSF+GSL +LVYLN
Sbjct  95   WDDQRQVRLDNPHAMRGQVSTSLLALRRLKYLYLSGNNLGGPGIAIPSFLGSLESLVYLN  154

Query  486  lsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLH  665
            LS   F G VP  LGN+S L YLD+G+ +Y  ++   D L W+  LSSL+YL+M  V+L 
Sbjct  155  LSCIDFFGEVPTQLGNLSRLSYLDVGSMYYSGQIFSSD-LSWLGRLSSLKYLDMSGVNLS  213

Query  666  SVSDWLHSISKLSFLRT  716
             VSDW H ++ L  LR 
Sbjct  214  MVSDWAHVVNMLPNLRV  230



>dbj|BAD52658.1| HcrVf2 protein-like [Oryza sativa Japonica Group]
Length=1064

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 114/196 (58%), Gaps = 9/196 (5%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C   ER ALLSFK  +++DPL  L SW    DCC+W GVGC N T  HVV L L      
Sbjct  37   CIAAERAALLSFKEGVMADPLRLLDSWQGAGDCCRWNGVGCSNRT-GHVVKLDLRNTLYW  95

Query  330  TDGSPCY--NP-GFQGEIspsllhlpflnfldlsFNKFD----RIPSFIGslnnlvylnl  488
             D       NP   +G++S SLL L  L +L LS N        IPSF+GSL +LVYLNL
Sbjct  96   DDQRQVRLDNPHAMRGQVSTSLLALRRLKYLYLSGNNLGGPGIAIPSFLGSLESLVYLNL  155

Query  489  synKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHS  668
            S   F G VP  LGN+S L YLD+G+ +Y  ++   D L W+  LSSL+YL+M  V+L  
Sbjct  156  SCIDFFGEVPTQLGNLSRLSYLDVGSMYYSGQIFSSD-LSWLGRLSSLKYLDMSGVNLSM  214

Query  669  VSDWLHSISKLSFLRT  716
            VSDW H ++ L  LR 
Sbjct  215  VSDWAHVVNMLPNLRV  230



>ref|XP_002265946.1| PREDICTED: receptor-like protein kinase 2 [Vitis vinifera]
Length=969

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 117/194 (60%), Gaps = 19/194 (10%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            ++ C E ERKALL FK+ +     +  S  G D  CCKWKGV C+N T  HVV + L   
Sbjct  38   NKGCIEVERKALLEFKNGLKEPSRTLSSWVGAD--CCKWKGVDCNNQT-GHVVKVDLKYG  94

Query  321  GLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsy  494
            GL             GEIS SLL L  LN+LDLSFN F    IP+F+GS   L YLNLS+
Sbjct  95   GL------------GGEISDSLLDLKHLNYLDLSFNDFQGIPIPNFLGSFERLRYLNLSH  142

Query  495  nKFVGNVPPHLGNISTLKYLDIGNNFYGQR-LKVVDTLEWISHLSSLEYLNMDCVDL-HS  668
              F G +PPHLGN+S L YLD+  ++Y +  L  V  L W+S LSSL+YL++  V+L  +
Sbjct  143  AAFGGMIPPHLGNLSQLCYLDLSGDYYSRAPLMRVHNLNWLSGLSSLKYLDLGNVNLSKA  202

Query  669  VSDWLHSISKLSFL  710
             ++W+ +++ L FL
Sbjct  203  TTNWMQAVNMLPFL  216



>ref|XP_004301719.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Fragaria vesca subsp. vesca]
Length=818

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 110/196 (56%), Gaps = 20/196 (10%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslssw-gddddCCKWKGVGCDNTTTAHVVALHL  311
            N +  C E+ER ALL FK  ++SD   +  +      DCC W+G+ C+N T  HV+ L L
Sbjct  35   NNTFLCLESERLALLQFKQGLLSDYKYNALATWESTKDCCDWRGIACNNHT-GHVITLDL  93

Query  312  GRQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvyln  485
                L            +GEI PSLL L +L +LDLSFN F    IP FIGSL+ L  L 
Sbjct  94   SFNFL------------RGEIHPSLLELRYLEYLDLSFNDFGGMMIPVFIGSLSQLKELK  141

Query  486  lsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLH  665
            L    F G+VPP LGN+S L  LD+ NN         + +EW+SHLSSL YLNM  V+L 
Sbjct  142  LGRANFSGHVPPQLGNLSNLHTLDLSNNENVSS----ENVEWLSHLSSLRYLNMSWVNLS  197

Query  666  SVSDWLHSISKLSFLR  713
               +W  S+SKL+ LR
Sbjct  198  EAVNWPQSLSKLTSLR  213



>ref|XP_008226203.1| PREDICTED: receptor-like protein 12 [Prunus mume]
Length=982

 Score = 95.9 bits (237),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 116/195 (59%), Gaps = 15/195 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E ERKAL+SFK  +        S  G D  CC+W+G+ C+N T  HV  + L   G  
Sbjct  36   CIEEERKALVSFKQDLTDPSGRLSSWVGHD--CCRWEGISCNNRT-GHVSQMDLRNPGPE  92

Query  330  TDGSPCYNP-GFQ-----GEIspsllhlpflnfldlsFNKFDRI--PSFIGslnnlvyln  485
            +     ++   F+     G+I+PSLL L  L +LDLS N F+RI  P+F G L  L YLN
Sbjct  93   STTDEEWDELAFEQSCLGGKINPSLLSLKHLRYLDLSLNNFERIRIPNFFGELKILRYLN  152

Query  486  lsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLH  665
            +S  +FVG +PP LGN+S L YLD+ +++          L W+SHLSSL+YLN++ V+L+
Sbjct  153  ISSTEFVGEIPPSLGNLSNLNYLDVSDSYQLSS----KNLNWLSHLSSLKYLNLNGVNLY  208

Query  666  SVSDWLHSISKLSFL  710
            S ++WLH ++ L  L
Sbjct  209  SNTNWLHVVNMLPSL  223



>ref|XP_009405134.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Musa acuminata subsp. malaccensis]
Length=953

 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 125/194 (64%), Gaps = 12/194 (6%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            ++ C + ER ALL+FK + I DP   LSSW    DCC+W GV CD++T  HVV L+L   
Sbjct  2    TKGCMDAERDALLAFK-AGIDDPSHRLSSWRRRVDCCRWSGVVCDDST-GHVVQLNLQNA  59

Query  321  GLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsy  494
            G  T  S       +GEISPSL+ L  L+ LDL+ N F+  RIP+F+GS   L YL+LS+
Sbjct  60   GNMTFES--VEAALRGEISPSLISLTHLDRLDLNHNDFEGSRIPAFLGSFPKLRYLDLSW  117

Query  495  nKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVS  674
            + F G +PP LGN+S+L+YLD+ +  Y       D L+W+S LSSL YL+M  V+L + S
Sbjct  118  SNFSGAIPPQLGNLSSLRYLDLRS--YDL---TTDGLDWLSRLSSLRYLDMSGVNLSTAS  172

Query  675  -DWLHSISKLSFLR  713
             +W+H++++L  L+
Sbjct  173  HNWIHAVNRLPSLQ  186



>gb|KDO40442.1| hypothetical protein CISIN_1g048006mg, partial [Citrus sinensis]
Length=833

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 113/193 (59%), Gaps = 16/193 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNTTTAHVVALHLGRQG  323
            C + ER+ALL+FK S++ +     S     +  DCCKW G+ C N T  HV+ L L  Q 
Sbjct  11   CIDEEREALLTFKASLVDESGVLSSWGPEDEKRDCCKWTGLRCSNKTN-HVILLDL--QP  67

Query  324  LCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsyn  497
            +  D  P      +G ISP+LL L  L  L+LSFN F    IP FIGSL+ L YL+L   
Sbjct  68   IDFDSFP-----LRGTISPALLKLHDLRHLNLSFNDFSGSPIPEFIGSLSKLRYLDLFGT  122

Query  498  KFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSD  677
             F G +PP LGN+S L++LD+G+N+    L     L+W+SHLS L YLN+D  +L + SD
Sbjct  123  VFAGPIPPQLGNLSRLQHLDLGSNY----LFSTGNLDWLSHLSYLRYLNLDESNLANSSD  178

Query  678  WLHSISKLSFLRT  716
            W   I KL  L+T
Sbjct  179  WFQVIGKLHSLKT  191



>ref|XP_011462017.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Fragaria vesca subsp. vesca]
Length=991

 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 109/198 (55%), Gaps = 20/198 (10%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            S SC E ER+ALLSFK     +  S         DCC+WKG+ C+N T  HV  + L   
Sbjct  106  SASCIEEERRALLSFK--ADVNDSSGRLLSWVGLDCCRWKGISCNNRT-GHVAKMDLR--  160

Query  321  GLCTDGSPCYNP-----GFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvy  479
                  +P Y+P        G I+PSLL L  L  LDLS N F   RIP F G L +L Y
Sbjct  161  ------NPNYDPLNGNTSLGGNINPSLLSLKKLYSLDLSGNDFGGLRIPDFFGKLTSLRY  214

Query  480  lnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVD  659
            LNLS   F G +PP LGN+S L YLD+  N+Y +     + L W+SHLSSL+YLN+  V+
Sbjct  215  LNLSSASFKGEIPPALGNLSNLNYLDLNTNYYYEGYS-SNNLNWLSHLSSLKYLNLRYVN  273

Query  660  LHSVS-DWLHSISKLSFL  710
            L S    WLH ++ L  L
Sbjct  274  LSSTGVSWLHDVNMLPSL  291



>ref|XP_006450003.1| hypothetical protein CICLE_v10027645mg [Citrus clementina]
 gb|ESR63243.1| hypothetical protein CICLE_v10027645mg [Citrus clementina]
Length=924

 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 113/193 (59%), Gaps = 16/193 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNTTTAHVVALHLGRQG  323
            C + ER+ALL+FK S++ +     S     +  DCCKW G+ C N T  HV+ L L  Q 
Sbjct  36   CIDEEREALLTFKASLVDESGVLSSWGPEDEKRDCCKWTGLRCSNKTN-HVILLDL--QP  92

Query  324  LCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsyn  497
            +  D  P      +G ISP+LL L  L  L+LSFN F    IP FIGSL+ L YL+L   
Sbjct  93   IDFDSFP-----LRGTISPALLKLHDLRHLNLSFNDFSGSPIPEFIGSLSKLRYLDLFGT  147

Query  498  KFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSD  677
             F G +PP LGN+S L++LD+G+N+    L     L+W+SHLS L YLN+D  +L + SD
Sbjct  148  VFAGPIPPQLGNLSRLQHLDLGSNY----LFSTGNLDWLSHLSYLRYLNLDESNLANSSD  203

Query  678  WLHSISKLSFLRT  716
            W   I KL  L+T
Sbjct  204  WFQVIGKLHSLKT  216



>gb|KJB45901.1| hypothetical protein B456_007G3361002, partial [Gossypium raimondii]
Length=301

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 84/201 (42%), Positives = 114/201 (57%), Gaps = 16/201 (8%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            N +  C ++ER+ALL FK+ +I       S     D CC+W GV C N+T  HV  LHL 
Sbjct  4    NSNLLCIQSEREALLKFKNHLIDPSNRLSSWVEGGD-CCEWTGVVCHNST-GHVNQLHLA  61

Query  315  R-----QGLCTDGS--PCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGsln  467
                   G  T+      YN    G+I+PSLL L  L+ LDLS+N F+   IP F G L 
Sbjct  62   APLSEPDGFATNAEMEAYYNSRLGGKINPSLLELKHLSSLDLSYNDFNSIHIPKFFGLLE  121

Query  468  nlvylnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNM  647
            +L YLNL   +F G +P +LGN+S L+YLD+G N    +     TL+W+S LSSL+YL++
Sbjct  122  SLTYLNLCRAQFQGAIPHNLGNLSKLQYLDLGGNNLKSK-----TLQWVSGLSSLQYLDL  176

Query  648  DCVDLHSVSDWLHSISKLSFL  710
               DLH+ +DW+    KL  L
Sbjct  177  SYADLHTANDWVQVTLKLPSL  197



>gb|EEE52293.1| hypothetical protein OsJ_34286 [Oryza sativa Japonica Group]
Length=1561

 Score = 95.5 bits (236),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 114/193 (59%), Gaps = 6/193 (3%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C   ER ALL FK+SI  DP+  L  W   DDCC+W+G+ C N T  HV+ L L +    
Sbjct  28   CIPRERDALLEFKNSITDDPMGQLKFWRRGDDCCQWRGIRCSNRT-GHVIKLQLWKPKFD  86

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD----RIPSFIGslnnlvylnlsyn  497
             DG      G  G ISPSLL L  L  LDLS+N        IP FIGS  NL YLNLS  
Sbjct  87   DDGMSLVGNGMVGLISPSLLSLEHLQHLDLSWNNLSGSDGHIPGFIGSFRNLRYLNLSGM  146

Query  498  KFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSD  677
             F+G VPP LGN+S L++LD+ ++  G  ++    + W+ ++  L+YLN++ VDL +V +
Sbjct  147  PFIGVVPPQLGNLSKLQFLDL-SSCIGLEMQSRSGMTWLRNIPLLQYLNLNSVDLSAVDN  205

Query  678  WLHSISKLSFLRT  716
            WLH +++L  LR 
Sbjct  206  WLHVMNQLPSLRV  218



>ref|XP_003631328.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Vitis vinifera]
 ref|XP_010655681.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Vitis vinifera]
 ref|XP_010655689.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Vitis vinifera]
Length=1001

 Score = 95.1 bits (235),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 114/193 (59%), Gaps = 10/193 (5%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            ++ C E ERKALL FK+ +        S  G D  CCKWKGV C+N T  HVV + L   
Sbjct  38   NKGCIEVERKALLEFKNGLKDPSGRLSSWVGAD--CCKWKGVDCNNQT-GHVVKVDLKSG  94

Query  321  GLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsy  494
            G  +     ++    GEIS SLL L  L +LDLS N F    IP+F+GS   L YLNLS 
Sbjct  95   GDFSRLGGGFS-RLGGEISSSLLDLKHLTYLDLSLNDFQGIPIPNFLGSFERLRYLNLSN  153

Query  495  nKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDL-HSV  671
             +F G +PPHLGN+S L+YLD+    Y  R   V  L W+S LSSL+YL++  VDL  + 
Sbjct  154  ARFGGMIPPHLGNLSQLRYLDLLGGDYPMR---VSNLNWLSGLSSLKYLDLAYVDLSKAT  210

Query  672  SDWLHSISKLSFL  710
            ++W+ +++ L FL
Sbjct  211  TNWMQAVNMLPFL  223



>gb|ABA94375.1| Leucine Rich Repeat family protein [Oryza sativa Japonica Group]
Length=1500

 Score = 95.5 bits (236),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 114/193 (59%), Gaps = 6/193 (3%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C   ER ALL FK+SI  DP+  L  W   DDCC+W+G+ C N T  HV+ L L +    
Sbjct  28   CIPRERDALLEFKNSITDDPMGQLKFWRRGDDCCQWRGIRCSNRT-GHVIKLQLWKPKFD  86

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD----RIPSFIGslnnlvylnlsyn  497
             DG      G  G ISPSLL L  L  LDLS+N        IP FIGS  NL YLNLS  
Sbjct  87   DDGMSLVGNGMVGLISPSLLSLEHLQHLDLSWNNLSGSDGHIPGFIGSFRNLRYLNLSGM  146

Query  498  KFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSD  677
             F+G VPP LGN+S L++LD+ ++  G  ++    + W+ ++  L+YLN++ VDL +V +
Sbjct  147  PFIGVVPPQLGNLSKLQFLDL-SSCIGLEMQSRSGMTWLRNIPLLQYLNLNSVDLSAVDN  205

Query  678  WLHSISKLSFLRT  716
            WLH +++L  LR 
Sbjct  206  WLHVMNQLPSLRV  218



>ref|XP_010656643.1| PREDICTED: uncharacterized protein LOC104880714 [Vitis vinifera]
Length=1782

 Score = 95.5 bits (236),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 113/194 (58%), Gaps = 19/194 (10%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            +++C E ERKALL FKH +        S  G D  CCKW GV C+N T  +VV + L  +
Sbjct  37   NKACIEEERKALLEFKHGLYDPSGRLSSWIGSD--CCKWTGVDCNNRT-GNVVKVDLRDR  93

Query  321  GLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsy  494
            G    G         GEIS SLL L  L +LDLS N F    IP+F+GS     YLNLS 
Sbjct  94   GFFLLG---------GEISGSLLDLKHLTYLDLSLNDFQGIPIPNFLGSFERFRYLNLSN  144

Query  495  nKFVGNVPPHLGNISTLKYLDI-GNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDL-HS  668
             +F G +PPHLGN+S L+YLD+ G   Y  R   V  L W+S LSSL+YL++  VDL  +
Sbjct  145  ARFGGMIPPHLGNLSQLRYLDLFGGGDYPMR---VSNLNWLSGLSSLKYLDLGYVDLSKT  201

Query  669  VSDWLHSISKLSFL  710
             ++W+ +++ L FL
Sbjct  202  TTNWMRAVNMLPFL  215



>gb|KDO55605.1| hypothetical protein CISIN_1g038320mg, partial [Citrus sinensis]
Length=467

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 115/193 (60%), Gaps = 13/193 (7%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C +NE++ALL  K        S   S    +DCCKW+GV CDN+T   VV L L    + 
Sbjct  35   CVQNEKEALLKIK--ASVTDPSGRLSSWTGEDCCKWEGVICDNST-GKVVQLKLRSPEIP  91

Query  330  ---TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsy  494
               TD    Y    +GEISPS+L L  LN+LDLS N F   RIP+F+GSL  L YLNLS 
Sbjct  92   DSFTDNGTTYQ--LEGEISPSVLDLKHLNYLDLSLNNFRGSRIPNFLGSLEKLRYLNLSG  149

Query  495  nKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSV-  671
              F GN+PP  GN+S+L+ LD+ N FY   L+  D +EW+S LSSL+YLN++ VDL    
Sbjct  150  ASFAGNIPPSFGNLSSLQILDL-NTFYYSSLE-SDDVEWLSRLSSLQYLNLEGVDLSKAG  207

Query  672  SDWLHSISKLSFL  710
            S W+ + + L  L
Sbjct  208  SSWVQATNMLPSL  220



>ref|XP_002274461.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Vitis vinifera]
Length=953

 Score = 95.1 bits (235),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 107/186 (58%), Gaps = 17/186 (9%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C   ERKAL  FK  ++       S  G+   CC WKG+GCDN T  HVV ++L R    
Sbjct  37   CSARERKALHRFKQGLVDQGNYLSSWTGEA--CCSWKGIGCDNITR-HVVKINLSR----  89

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynKF  503
               +P       GEIS SLL L  L +LDLS+N F+  +IP F+GSL  L YLNLS   F
Sbjct  90   ---NPMDGASLGGEISTSLLDLKHLQYLDLSWNSFEGLQIPEFLGSLTGLRYLNLSNAGF  146

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWL  683
             G+VP  LGN+ +L+YLDIG N        ++ L+WIS LS LE L+M  VDL   S+WL
Sbjct  147  TGDVPRQLGNLLSLQYLDIGGNSLN-----IENLDWISPLSVLEVLDMSWVDLSKASNWL  201

Query  684  HSISKL  701
              ++ L
Sbjct  202  QGMNML  207



>ref|XP_010655653.1| PREDICTED: receptor-like protein 12 [Vitis vinifera]
Length=993

 Score = 94.7 bits (234),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 114/193 (59%), Gaps = 18/193 (9%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            ++ C E ERKALL FKH +        S  G D  CCKWKGV C+N T  HVV + L   
Sbjct  38   NKGCIEVERKALLEFKHGLKDPSGRLSSWVGAD--CCKWKGVDCNNQT-GHVVKVDLKSG  94

Query  321  GLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsy  494
            G  +           GEIS SLL L  LN+LDLSFN F    IP+F+GS   L YLNLS 
Sbjct  95   GAFSR--------LGGEISDSLLDLKHLNYLDLSFNDFQGIPIPNFLGSFERLRYLNLSR  146

Query  495  nKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDL-HSV  671
             +  G +PPHLGN+S L+YLD+ N  Y  R   V  L W+S LSSL+YL++  V+L  + 
Sbjct  147  AQLGGMIPPHLGNLSQLRYLDL-NGGYPMR---VSNLNWLSGLSSLKYLDLGHVNLSKAT  202

Query  672  SDWLHSISKLSFL  710
            ++W+ +++ L FL
Sbjct  203  TNWMQAVNMLPFL  215



>ref|XP_009368771.1| PREDICTED: receptor-like protein kinase 5 [Pyrus x bretschneideri]
Length=516

 Score = 93.6 bits (231),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 106/187 (57%), Gaps = 15/187 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C + E+ ALL FK  ++ +     S     D CC+W+G+ C N T  HVV L L      
Sbjct  30   CLQTEKTALLQFKQGLVDESNVLASWETGKD-CCEWRGIACSNET-GHVVTLDL-----Y  82

Query  330  TDGSPCYN--PGFQGEIspsllhlpflnfldlsFNKFD-RIPSFIGslnnlvylnlsynK  500
             + S  YN      G I+PSLL LP+L +LDLSFN F  +IP FIGSL+ L  L L+   
Sbjct  83   YNSSDVYNVETPLSGVIAPSLLELPYLTYLDLSFNNFKGKIPKFIGSLSRLKQLKLAGAS  142

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
              G +PP LGN+S+L  LD+  N+        + LEW+SHLSSL YLNM  ++   V +W
Sbjct  143  LSGPIPPQLGNLSSLYALDLARNYV-----TFENLEWLSHLSSLRYLNMSRLNFSEVVNW  197

Query  681  LHSISKL  701
              SISKL
Sbjct  198  PESISKL  204



>gb|KEH16821.1| LRR receptor-like kinase family protein, partial [Medicago truncatula]
Length=260

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 78/191 (41%), Positives = 110/191 (58%), Gaps = 15/191 (8%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            +  C E ER+ALL F+ +I  +     S  G+D  CCKW+G+ C+N T  HV+ L+L   
Sbjct  4    TNKCVETERRALLKFRDAINLNREFISSWKGED--CCKWEGISCNNFT-HHVIGLNLEPL  60

Query  321  GLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD-RIPSFIGslnnlvylnlsyn  497
                     Y    +G++  S+  L  L  L+L  N  + +IP  IGSL+ L+ LNL YN
Sbjct  61   N--------YTKELRGKLDSSICELKHLTSLNLYRNNLEGKIPKCIGSLDKLIELNLGYN  112

Query  498  KFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSD  677
             F G +PP LGN+S L+ LD+  N+YG      + LEW+SHLS+L YL++  V+L    D
Sbjct  113  YFDGVIPPSLGNLSNLQTLDLSENYYGMS---ANDLEWLSHLSNLRYLDLSYVNLTLAVD  169

Query  678  WLHSISKLSFL  710
            WL SISK+  L
Sbjct  170  WLSSISKIPSL  180



>ref|XP_003636151.1| Receptor protein kinase-like protein, partial [Medicago truncatula]
Length=561

 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 115/191 (60%), Gaps = 16/191 (8%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            +  C E ER+ALL F+ +I  +     S  G++  CCKW+G+ CDN T  HV+ L+L   
Sbjct  28   TNKCVEKERRALLKFRDAINLNREFISSWKGEE--CCKWEGISCDNFT-HHVIGLNLEPL  84

Query  321  GLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD-RIPSFIGslnnlvylnlsyn  497
                     Y    +G++  S+  L  L  L+L+ N+F+ +IP  IGSL+ L+ LNL +N
Sbjct  85   N--------YTKELRGKLDSSICELQHLTSLNLNGNQFEGKIPKCIGSLDKLIELNLGFN  136

Query  498  KFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSD  677
             FVG +PP LGN+S L+ LD+ +N+      + + LEW+SHLS+L YL++  V+L    D
Sbjct  137  HFVGVIPPSLGNLSNLQTLDLSSNYD----MISNDLEWLSHLSNLRYLDLSNVNLTLAVD  192

Query  678  WLHSISKLSFL  710
            WL SISK+ +L
Sbjct  193  WLSSISKIPYL  203



>ref|XP_006470121.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2-like [Citrus sinensis]
Length=978

 Score = 94.4 bits (233),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 115/193 (60%), Gaps = 13/193 (7%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C +NE++ALL  K        S   S    +DCCKW+GV CDN+T   VV L L    + 
Sbjct  35   CVQNEKEALLKIK--ASVTDPSGRLSSWTGEDCCKWEGVICDNST-GKVVQLKLRSPEIP  91

Query  330  ---TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsy  494
               TD    Y    +GEISPS+L L  LN+LDLS N F   RIP+F+GSL  L YLNLS 
Sbjct  92   DSFTDNGTTYQ--LEGEISPSVLDLKHLNYLDLSLNNFRGSRIPNFLGSLEKLRYLNLSG  149

Query  495  nKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSV-  671
              F GN+PP  GN+S+L+ LD+ N FY   L+  D +EW+S LSSL+YLN++ VDL    
Sbjct  150  ASFAGNIPPSFGNLSSLQILDL-NTFYYSSLE-SDDVEWLSRLSSLQYLNLEGVDLSKAG  207

Query  672  SDWLHSISKLSFL  710
            S W+ + + L  L
Sbjct  208  SSWVQATNMLPSL  220



>ref|XP_010068699.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Eucalyptus grandis]
Length=912

 Score = 94.4 bits (233),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 111/198 (56%), Gaps = 13/198 (7%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            SCF  ER+ALL F+  +I       S    D  CC+WKGV C +  T HV  L L    L
Sbjct  33   SCFGTEREALLKFRQGLIDHSKRLSSWTSKD--CCEWKGVEC-SKKTGHVFKLDLRNPCL  89

Query  327  CTD------GSPCYNPGFQGEIspsllhlpflnfldlsFNKFDR--IPSFIGslnnlvyl  482
             TD      GS        G+I  SL  L  L +LDLS NKF +  IP F G+L  L YL
Sbjct  90   ETDIYGDIIGSD--QSSLAGKIHASLAELKHLKYLDLSLNKFSKKKIPLFFGTLQRLEYL  147

Query  483  nlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDL  662
            NLS+  F GN+P HLGN+S L+YLD+     G     +D L+W+S LSSL+YL +   DL
Sbjct  148  NLSFAGFDGNIPHHLGNLSNLQYLDLACFGKGWGYLTIDNLQWVSKLSSLKYLRLSGNDL  207

Query  663  HSVSDWLHSISKLSFLRT  716
             + +DWL SI+ LS L++
Sbjct  208  GNATDWLSSINMLSSLQS  225



>ref|XP_010662758.1| PREDICTED: receptor-like protein 12 isoform X2 [Vitis vinifera]
Length=877

 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 111/184 (60%), Gaps = 20/184 (11%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E E++ALLSFKH+++       S    +D CC W+GV C N T A V+ L L    L 
Sbjct  7    CNEKEKQALLSFKHALLDPANQLSSWSIKED-CCGWRGVHCSNVT-ARVLKLELAEMNL-  63

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsynKF  503
                        GEISP+LL L FL+ LDLS N F    IPSF+GS+ +L YLNL+  +F
Sbjct  64   -----------GGEISPALLKLEFLDHLDLSSNDFKGSPIPSFLGSMGSLRYLNLNDARF  112

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWL  683
             G VP  LGN+STL++LD+G   Y   L  V+ L WISHL+ L+YL+MD VDLH    WL
Sbjct  113  AGLVPHQLGNLSTLRHLDLG---YNSGL-YVENLGWISHLAFLKYLSMDSVDLHREVHWL  168

Query  684  HSIS  695
             S+S
Sbjct  169  ESVS  172



>ref|XP_003631327.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Vitis vinifera]
Length=996

 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 113/194 (58%), Gaps = 19/194 (10%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            +++C E ERKALL F+H +        S  G D  CCKW GV C+N T  +VV + L  +
Sbjct  37   NKACIEEERKALLEFRHGLKDPSGRLSSWVGAD--CCKWTGVDCNNRT-GNVVKVDLRDR  93

Query  321  GLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsy  494
            G    G         GEIS SLL L  L +LDLS N F    IP+F+GS   L YLNLS 
Sbjct  94   GFFLLG---------GEISGSLLDLKHLTYLDLSLNDFQGIPIPNFLGSFERLRYLNLSN  144

Query  495  nKFVGNVPPHLGNISTLKYLDI-GNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDL-HS  668
              F G +PPHLGN+S L+YLD+ G   Y  R   V  L W+S LSSL+YL++  VDL  +
Sbjct  145  AAFGGMIPPHLGNLSQLRYLDLFGGGDYPMR---VSNLNWLSGLSSLKYLDLGYVDLSKT  201

Query  669  VSDWLHSISKLSFL  710
             ++W+ +++ L FL
Sbjct  202  TTNWMRAVNMLPFL  215



>ref|XP_010662757.1| PREDICTED: receptor-like protein 12 isoform X1 [Vitis vinifera]
Length=899

 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 111/184 (60%), Gaps = 20/184 (11%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E E++ALLSFKH+++       S    +D CC W+GV C N T A V+ L L    L 
Sbjct  29   CNEKEKQALLSFKHALLDPANQLSSWSIKED-CCGWRGVHCSNVT-ARVLKLELAEMNL-  85

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsynKF  503
                        GEISP+LL L FL+ LDLS N F    IPSF+GS+ +L YLNL+  +F
Sbjct  86   -----------GGEISPALLKLEFLDHLDLSSNDFKGSPIPSFLGSMGSLRYLNLNDARF  134

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWL  683
             G VP  LGN+STL++LD+G   Y   L  V+ L WISHL+ L+YL+MD VDLH    WL
Sbjct  135  AGLVPHQLGNLSTLRHLDLG---YNSGL-YVENLGWISHLAFLKYLSMDSVDLHREVHWL  190

Query  684  HSIS  695
             S+S
Sbjct  191  ESVS  194



>ref|XP_006600047.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790-like [Glycine max]
Length=272

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 111/190 (58%), Gaps = 15/190 (8%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            +C E ER ALLSFKH +        S     D CC W GV C+NT    V+ ++L     
Sbjct  33   TCSEKERNALLSFKHGLADPSNRLSSWSDKSD-CCTWPGVHCNNT--GKVMEINLDAPA-  88

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsynK  500
               GSP       GEISPSLL L +LN LDLS N F    IPSF+GSL +L YL+LS + 
Sbjct  89   ---GSPYRE--LSGEISPSLLELKYLNRLDLSSNYFVLTPIPSFLGSLESLRYLDLSLSG  143

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F+G +P  LGN+S L++L++G N+  Q    +D L WIS LSSLEYL++   DLH   +W
Sbjct  144  FMGLIPHQLGNLSNLQHLNLGYNYALQ----IDNLNWISRLSSLEYLDLSGSDLHKQGNW  199

Query  681  LHSISKLSFL  710
            L  +S L  L
Sbjct  200  LQVLSALPSL  209



>ref|XP_008231480.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Prunus mume]
Length=1046

 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 115/194 (59%), Gaps = 15/194 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E ER+AL+ FK  +        S  G +  CC+W G+ C+NTT+A +         L 
Sbjct  33   CLEAEREALIDFKDGLEDPENRLSSWRGSN--CCQWWGIHCNNTTSAVIEVDLRNPHPLN  90

Query  330  T-DGSPCYNPGF---QGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnls  491
            T D SP    GF    GEI  SL  L  L  LDLSFN F+   IP+F G+L NL YLNLS
Sbjct  91   TFDDSPGRY-GFWNLSGEIRRSLKMLQSLKHLDLSFNTFNGISIPAFFGTLKNLQYLNLS  149

Query  492  ynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSV  671
            +  F G +PP+LGN+S+L+YLD+ +NF       VD L+W++ + S+EYLNM+  DL  +
Sbjct  150  HAGFSGGIPPNLGNLSSLRYLDVSSNFVS-----VDNLQWVTGMRSMEYLNMNGADLSIL  204

Query  672  S-DWLHSISKLSFL  710
              +W+ +++KLS L
Sbjct  205  EPEWIETLNKLSSL  218



>ref|XP_010246690.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170 [Nelumbo nucifera]
Length=897

 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 111/197 (56%), Gaps = 17/197 (9%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslssw-gddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            C  +ER+ALL+FK  +        S      +DCC W+GVGCDN T  HVV L L  Q  
Sbjct  33   CSPSEREALLNFKKGLKDSSNRLSSWDWNGSEDCCSWEGVGCDNRT-GHVVRLEL--QNP  89

Query  327  CTDG-SPCYNPGFQ-----GEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvyl  482
              DG    Y   ++     GEI+  LL L  L  LDLS N F   RIP F+GS  +L YL
Sbjct  90   YADGYDEKYYETYERCKIGGEINSHLLELKHLKHLDLSSNDFGGSRIPEFLGSFQSLEYL  149

Query  483  nlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDL  662
            NL  + FVG VP  LGN+S L+YLD+GN +    L  V+ L+W+SHLSSL YL+M  V+L
Sbjct  150  NLFDSGFVGKVPHQLGNLSNLQYLDMGNGY----LLHVEDLQWLSHLSSLHYLDMSSVNL  205

Query  663  HSVSD-WLHSISKLSFL  710
               SD WL   + L  L
Sbjct  206  SKASDYWLQVTNTLPRL  222



>gb|KEH16824.1| leucine-rich receptor-like kinase family protein, putative [Medicago 
truncatula]
Length=992

 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 115/191 (60%), Gaps = 16/191 (8%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            +  C E ER+ALL F+ +I  +     S  G++  CCKW+G+ CDN T  HV+ L+L   
Sbjct  65   TNKCVEKERRALLKFRDAINLNREFISSWKGEE--CCKWEGISCDNFT-HHVIGLNLEPL  121

Query  321  GLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD-RIPSFIGslnnlvylnlsyn  497
                     Y    +G++  S+  L  L  L+L+ N+F+ +IP  IGSL+ L+ LNL +N
Sbjct  122  N--------YTKELRGKLDSSICELQHLTSLNLNGNQFEGKIPKCIGSLDKLIELNLGFN  173

Query  498  KFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSD  677
             FVG +PP LGN+S L+ LD+ +N+      + + LEW+SHLS+L YL++  V+L    D
Sbjct  174  HFVGVIPPSLGNLSNLQTLDLSSNYD----MISNDLEWLSHLSNLRYLDLSNVNLTLAVD  229

Query  678  WLHSISKLSFL  710
            WL SISK+ +L
Sbjct  230  WLSSISKIPYL  240



>ref|XP_010655798.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Vitis vinifera]
Length=968

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 116/198 (59%), Gaps = 17/198 (9%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            ++ C E ERKALL FK+ +I       S  G D  CCKWKGV C+N T  HVV + L   
Sbjct  2    NKGCIEVERKALLEFKNGLIDPSGRLSSWVGAD--CCKWKGVDCNNQT-GHVVKVDLKSG  58

Query  321  G--LCTDGSPCYNPGFQ---GEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvy  479
            G  L   G      GF    GEIS SLL L  LN+LDLSFN F    IP+F+GS   L Y
Sbjct  59   GDFLRLGG------GFSRLGGEISDSLLDLKHLNYLDLSFNDFQGIPIPNFMGSFERLRY  112

Query  480  lnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVD  659
            LNLS   F G +PPHLGN+S L+YLD+   +       V  L W+S LSSL+YL++  V+
Sbjct  113  LNLSNAAFGGMIPPHLGNLSQLRYLDLNGGYVNLNPMRVHNLNWLSGLSSLKYLDLGYVN  172

Query  660  L-HSVSDWLHSISKLSFL  710
            L  + ++W+ +++ L FL
Sbjct  173  LSKATTNWMQAVNMLPFL  190



>ref|XP_002450414.1| hypothetical protein SORBIDRAFT_05g004935 [Sorghum bicolor]
 gb|EES09402.1| hypothetical protein SORBIDRAFT_05g004935, partial [Sorghum bicolor]
Length=951

 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 107/192 (56%), Gaps = 12/192 (6%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C  +ER  LLS K            S    + CC+WKGV C N T+ HVV L L  +  C
Sbjct  38   CIASERDVLLSLK--ASLSDPRGQLSSWHGEGCCQWKGVQCSNRTS-HVVKLDLHGETCC  94

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFDR--IPSFIGslnnlvylnlsynKF  503
            +D +        GE+S SL+ L  L  LDLS N F    IP FIGSL +L YLNLSY  F
Sbjct  95   SDYA------LGGEMSSSLVGLQHLEHLDLSCNNFSSTSIPKFIGSLRSLEYLNLSYAAF  148

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVV-DTLEWISHLSSLEYLNMDCVDLHSVSDW  680
             G +PP LGN+S L YLDI +  +G    +  D+L W+S LSSL+YL M  ++L +  DW
Sbjct  149  GGRIPPQLGNLSKLVYLDINSACWGYHHSLYSDSLSWVSRLSSLKYLGMTWMNLSAAVDW  208

Query  681  LHSISKLSFLRT  716
            +H++S L  L  
Sbjct  209  IHAVSSLPSLEV  220



>ref|XP_010918705.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Elaeis guineensis]
Length=1052

 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 96/185 (52%), Gaps = 17/185 (9%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            SC ENER+ALL+ K            +     DCC+W+GVGCDN++  HVV L L   G 
Sbjct  67   SCIENERRALLAIK--ADIYDPHERLTSWMGPDCCQWRGVGCDNSS-GHVVKLKLRFLGP  123

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynK  500
             +      NP     I    L L          N F    IP FIGSL +L YLNLS + 
Sbjct  124  TSK----VNPSISSLIHLRHLDLS--------MNSFSGAPIPEFIGSLMHLKYLNLSNSG  171

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F G +P  +GN+S L  LD+G   YG      D L+W+S + SL+YL++  V+L   S+W
Sbjct  172  FGGPIPRQIGNLSNLHSLDLGTKMYGSYALQADDLQWLSRIPSLQYLDLSSVNLSMASNW  231

Query  681  LHSIS  695
            LH I+
Sbjct  232  LHEIN  236



>ref|XP_008218738.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein 12 [Prunus 
mume]
Length=916

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 118/194 (61%), Gaps = 21/194 (11%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            N S  C +NER+ALL FKH +        S  G+ D CC W GV CDN T  H+  LHL 
Sbjct  27   NLSAPCKQNERQALLKFKHDLEDPSNQLSSWAGEGD-CCNWTGVVCDNLT-GHIRELHLA  84

Query  315  RQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnl  488
                           + G+ISPSLL+L  L++LDLS N F   +IPSF+GSL +L YLNL
Sbjct  85   DT-------------YSGKISPSLLNLKHLSYLDLSNNDFQGMQIPSFLGSLKSLRYLNL  131

Query  489  synKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHS  668
            SY+ FVG +P  LGN+++L+ LD+G+  Y +R   V++L+WIS LS L++L+M C +L  
Sbjct  132  SYSSFVGLIPHQLGNLTSLQVLDLGD--YSER--EVESLQWISGLSKLQHLDMSCANLSK  187

Query  669  VSDWLHSISKLSFL  710
             SDWL   + L  L
Sbjct  188  ASDWLRVTNTLPSL  201



>ref|XP_006600052.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2-like [Glycine max]
Length=766

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 112/190 (59%), Gaps = 15/190 (8%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            +C E ER ALLSFKH +        S     D CC W GV C+NT    V+ ++L     
Sbjct  133  TCSEKERNALLSFKHGLADPSNRLSSWSDKSD-CCTWPGVHCNNT--GKVMEINLDTPA-  188

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsynK  500
               GSP    G  GEISPSLL L +LN LDLS N F    IPSF+GSL +L YL+LS + 
Sbjct  189  ---GSPYR--GLSGEISPSLLELKYLNRLDLSSNYFVLTPIPSFLGSLESLRYLDLSLSG  243

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F+G +P  LGN+S L++L++G N+  Q    +D L WIS LSSLEYL++   DLH   +W
Sbjct  244  FMGLIPHQLGNLSNLQHLNLGYNYALQ----IDNLNWISRLSSLEYLDLSGSDLHKQGNW  299

Query  681  LHSISKLSFL  710
            L  +S L  L
Sbjct  300  LQVLSALPSL  309



>ref|XP_009610906.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Nicotiana tomentosiformis]
Length=1032

 Score = 92.8 bits (229),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 111/192 (58%), Gaps = 11/192 (6%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNTTTAHVVALHLGRQG  323
            C E ER ALL FK  ++ D     +     D  +CCKWKG+ CD  +  HV  L L  + 
Sbjct  37   CIEKERDALLEFKRGLVDDFDRLSTWGDEEDKKECCKWKGIECDKRS-GHVTVLDLHSEV  95

Query  324  LCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFDR--IPSFIGslnnlvylnlsyn  497
             C  G  C+ P   G++SPSLL L  LN+LDLS N FDR  IP FI SL  L YLNLS +
Sbjct  96   SCP-GHACFAPILTGKLSPSLLELQHLNYLDLSVNGFDRSEIPRFISSLKRLEYLNLSSS  154

Query  498  KFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSD  677
             F G VP  L N+++L+ LD+GNN       +V  L W+SHLSSLE+L +   D  + S+
Sbjct  155  DFSGVVPTQLKNLTSLRILDLGNN----NQLIVKDLGWLSHLSSLEFLRLGGNDFQA-SN  209

Query  678  WLHSISKLSFLR  713
            W   I+K+  L+
Sbjct  210  WFQEITKVPSLK  221



>ref|XP_010662668.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL1 
[Vitis vinifera]
Length=412

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 118/199 (59%), Gaps = 16/199 (8%)
 Frame = +3

Query  138  GSRS-CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            GS++ C E ER+ALLSFK  I        S   ++  CC W+GV C NTT  HV+ L+L 
Sbjct  30   GSKALCREEEREALLSFKRGIHDPSNRLSSWASEE--CCNWEGVCCHNTT-GHVLKLNL-  85

Query  315  RQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnl  488
            R  L       Y+    GEIS SLL L  L +LDLS N F    IP F+GSL+NL YLNL
Sbjct  86   RWDLYQ-----YHGSLGGEISSSLLDLKHLQYLDLSCNDFGSLNIPKFLGSLSNLRYLNL  140

Query  489  synKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKV-VDTLEWISHLSSLEYLNMDCVDLH  665
            S   F G +P  LGN+S L YLDIGN++Y  R  +  + LEWIS  S L++L+M  V+L 
Sbjct  141  STASFGGVIPHQLGNLSKLHYLDIGNSYYDHRNSLNAEDLEWISSFSFLKFLDMTNVNLS  200

Query  666  SVSDWLHSISK---LSFLR  713
              S+WL  ++K   LS LR
Sbjct  201  KTSNWLQVMNKFHSLSVLR  219



>ref|XP_007220831.1| hypothetical protein PRUPE_ppa027090mg, partial [Prunus persica]
 gb|EMJ22030.1| hypothetical protein PRUPE_ppa027090mg, partial [Prunus persica]
Length=1025

 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 116/194 (60%), Gaps = 15/194 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHV-VALHLGRQGL  326
            C E ER+AL+ FK+ +        S  G +  CC+W G+ C+NTT+A + V LH      
Sbjct  12   CLEAEREALIDFKNGLEDPENRLSSWRGSN--CCQWWGIHCNNTTSAVIAVDLHNPHPLN  69

Query  327  CTDGSPCYNPGF---QGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnls  491
              D SP    GF    GEI  SL  L  L  LDLSFN F+   IP+F G++ NL YLNLS
Sbjct  70   PLDDSPGRY-GFWNLSGEIRRSLKILQSLKHLDLSFNTFNGISIPAFFGTMKNLEYLNLS  128

Query  492  ynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSV  671
            +  F G + P+LGN+S+L+YLD+ +NF       VD LEW++ + S+EYLNM+  DL  +
Sbjct  129  HAGFSGGILPNLGNLSSLQYLDVSSNFVS-----VDNLEWMTGMRSMEYLNMNGADLSML  183

Query  672  S-DWLHSISKLSFL  710
              +W+ +++KLS L
Sbjct  184  EPEWIETLNKLSSL  197



>ref|XP_007030466.1| Disease resistance family protein / LRR family protein, putative 
[Theobroma cacao]
 gb|EOY10968.1| Disease resistance family protein / LRR family protein, putative 
[Theobroma cacao]
Length=1163

 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 116/201 (58%), Gaps = 19/201 (9%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNTTTAHVVALHLG----  314
            C E+ER+ALL FKH +I    S  S   GD +DCC+W GV CDN T  HV  L LG    
Sbjct  205  CIESERQALLKFKHDLIDHSNSLSSWVEGDQEDCCRWVGVLCDNRT-GHVYELQLGLLSS  263

Query  315  --RQGLCTDGSPCY-----NPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGsln  467
               +       P +      P   G+I+PSLL L  L+FLDLS N F   +IP FIGSL 
Sbjct  264  SPHEPKPAPDHPKWIVAYDRPKLGGKINPSLLDLKHLSFLDLSNNDFGGIQIPEFIGSLK  323

Query  468  nlvylnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNM  647
            +L YLNLS   F G +P  LGN+S L YLD+G+N     L    TL+W+S L SL+YL++
Sbjct  324  SLTYLNLSGANFGGAIPHQLGNLSKLHYLDLGHN----SLSEAKTLQWVSGLPSLQYLDL  379

Query  648  DCVDLHSVSDWLHSISKLSFL  710
              VDL   +DWL   +KL +L
Sbjct  380  SQVDLSKATDWLQVTNKLPYL  400



>ref|XP_010910632.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 [Elaeis guineensis]
Length=564

 Score = 91.3 bits (225),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 107/199 (54%), Gaps = 25/199 (13%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            S SC E ER ALL+FK     +      +     DCC W GVGCD     HVV L L   
Sbjct  45   SSSCLELERTALLAFK--ASLNNTRIGLASWQGLDCCTWNGVGCDGA--GHVVKLRLRNP  100

Query  321  GLCTDGSPCYNPGFQ------GEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlv  476
                     YNP  Q      GEI+ SLL L  L  LDLS N F    IP F GS   L 
Sbjct  101  ---------YNPINQSQWTLGGEINSSLLALSHLKHLDLSMNDFGGILIPEFFGSFKRLE  151

Query  477  ylnlsynKFVGNVPPHLGNISTLKYLDI-GNNFYGQRLKVVDTLEWISHLSSLEYLNMDC  653
            YLNLS   F G +PPHLGN+S+++YLD+   + Y  R      L+W++HLSSL++L++  
Sbjct  152  YLNLSGANFSGLIPPHLGNLSSIRYLDLSAYSLYKTR---AYNLQWLTHLSSLKHLDLSF  208

Query  654  VDLHSVSDWLHSISKLSFL  710
            V+L + +DWL +++ L  L
Sbjct  209  VNLSTAADWLQAVNMLPSL  227



>ref|XP_009352118.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Pyrus x bretschneideri]
Length=946

 Score = 91.7 bits (226),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 106/190 (56%), Gaps = 15/190 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHL--GRQG  323
            C + E+ ALL FK  +I       S     D CCKW+G+ C+N T  HVV L L      
Sbjct  30   CLQAEKTALLQFKQGLIDQSNVLASWETGKD-CCKWRGIACNNKT-GHVVTLDLYYNYSD  87

Query  324  LCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD-RIPSFIGslnnlvylnlsynK  500
            +   G+P       G I+PSLL LP+L +LDLSFN F  +IP FIGS N L  L L+   
Sbjct  88   ISNVGTP-----LSGVIAPSLLELPYLTYLDLSFNNFQGQIPKFIGSFNRLEQLKLAGAD  142

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
              G +PP LGN+S+L  LD+  N+        + LEW+SHLSSL YLNM  ++   V +W
Sbjct  143  LSGPIPPQLGNLSSLYTLDLAWNYV-----TFENLEWLSHLSSLMYLNMSRLNFSEVVNW  197

Query  681  LHSISKLSFL  710
              SISKL  L
Sbjct  198  PESISKLPSL  207



>gb|KDO56838.1| hypothetical protein CISIN_1g0483512mg, partial [Citrus sinensis]
Length=275

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 113/203 (56%), Gaps = 14/203 (7%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNTTTAHVVALH  308
            + S  C E ERKALL FK  ++ +     S  S G+  DCC W+GV C N T  HV  L 
Sbjct  30   SSSIRCIEEERKALLKFKQGLVDEFGFLSSWGSEGEKKDCCNWRGVRCSNQT-GHVKVLD  88

Query  309  L---GRQGLCTDGSPCY--NPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGsln  467
            L   GR  +    +     N   +G ++P+LL L +L  LDLSFN F   +IP FIGSL+
Sbjct  89   LHGTGRVKVLDIQTRVMSGNASLRGTLNPALLKLHYLRHLDLSFNNFSGSQIPMFIGSLS  148

Query  468  nlvylnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNM  647
             L YL+L    F G +PP LGN+S L+YL +G N    +L     L+WIS L SL YL++
Sbjct  149  KLEYLDLFAASFSGPIPPLLGNLSRLQYLSLGYN----KLLRAGNLDWISQLFSLRYLDL  204

Query  648  DCVDLHSVSDWLHSISKLSFLRT  716
               +L   +DWL  + K+  L+T
Sbjct  205  SSCNLSKSTDWLQEVDKIPSLKT  227



>ref|XP_008376669.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170 [Malus domestica]
Length=964

 Score = 91.7 bits (226),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 108/190 (57%), Gaps = 15/190 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C + E+ ALL FK  ++ +     S     D CC+W+G+ C N T  HVV L L      
Sbjct  30   CLQTEKTALLQFKQGLVDESNVLASWETGKD-CCEWRGITCSNET-GHVVTLDL-----Y  82

Query  330  TDGSPCYN--PGFQGEIspsllhlpflnfldlsFNKFD-RIPSFIGslnnlvylnlsynK  500
             + S  YN      G I+PSLL LP+L +LDLSFN F  +IP FIGSL+ L +L L+   
Sbjct  83   YNSSDVYNVETPLSGVIAPSLLELPYLTYLDLSFNNFKGKIPKFIGSLSRLKHLKLAGAS  142

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
              G +PP LGN+S+L  LD+  NF        + LEW+SHLSSL YLNM  ++   V +W
Sbjct  143  LSGPIPPQLGNLSSLYALDLAWNFV-----TFENLEWLSHLSSLRYLNMSGLNFSEVVNW  197

Query  681  LHSISKLSFL  710
              SISKL  L
Sbjct  198  PESISKLPSL  207



>ref|XP_007220272.1| hypothetical protein PRUPE_ppa000998mg [Prunus persica]
 gb|EMJ21471.1| hypothetical protein PRUPE_ppa000998mg [Prunus persica]
Length=936

 Score = 91.7 bits (226),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 107/190 (56%), Gaps = 15/190 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E ++ ALL FK  ++ +     S     D CC+W+G+ C N T  HV  L L      
Sbjct  39   CLETQKNALLQFKQGLVDNSNVLGSWESKKD-CCQWRGITCSNQT-GHVTMLDL-----Y  91

Query  330  TDGSPCYN--PGFQGEIspsllhlpflnfldlsFNKFD-RIPSFIGslnnlvylnlsynK  500
             + S  YN      G I+PSLL L +LN+LDLSFN F+ +IP FIGSL+ L  L L+   
Sbjct  92   YNSSDIYNLETPLSGVIAPSLLELRYLNYLDLSFNNFEGKIPDFIGSLSQLKQLKLAGAS  151

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
              G VPP LGN+S L  LD+ +N         + LEW+SHLSSL YLNM  ++   V +W
Sbjct  152  LSGPVPPQLGNLSHLYTLDLAHNSV-----TFENLEWLSHLSSLRYLNMSSLNFSKVVNW  206

Query  681  LHSISKLSFL  710
             HSISKL  L
Sbjct  207  PHSISKLPSL  216



>gb|KJB72425.1| hypothetical protein B456_011G177700 [Gossypium raimondii]
Length=975

 Score = 91.7 bits (226),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 118/208 (57%), Gaps = 22/208 (11%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNTTTAHVVALH  308
            N +  C E+ER+ALL FKH +        S        DCC+W GV CDN T AHV+ LH
Sbjct  16   NINEGCIESERQALLMFKHDVTDGANRLSSWSLHHGHGDCCQWDGVVCDNVT-AHVLELH  74

Query  309  LG--RQGLCTDGSPCYNPG-----FQGEIspsllhlpflnfldlsFNKFD--RIPSFIGs  461
            L   R  L   GS   N        +G+I+PSLL+L  L++L+LS N F    IP FIG 
Sbjct  75   LANPRPLLDDYGSDAENEATERSKLRGKINPSLLNLTHLSYLNLSQNGFGGIPIPDFIGC  134

Query  462  lnnlvylnlsynKFVGNVPPHLGNISTLKYL----DIGNNFYGQRLKVVDTLEWISHLSS  629
            + +L +L+LS   F G VP  LGN+S+L+YL    DI +N Y      V  L+W+S LS 
Sbjct  135  IESLRHLDLSKAGFGGLVPNQLGNLSSLEYLNLRADIEDNLY------VTDLQWLSGLSL  188

Query  630  LEYLNMDCVDLHSVSDWLHSISKLSFLR  713
            +E+L++  VDL   S+WL  ++ L FL+
Sbjct  189  IEHLDLSAVDLAQASNWLQVLNTLPFLK  216



>ref|XP_009375612.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Pyrus x bretschneideri]
Length=964

 Score = 91.7 bits (226),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 106/190 (56%), Gaps = 15/190 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHL--GRQG  323
            C + E+ ALL FK  +I       S     D CCKW+G+ C+N T  HVV L L      
Sbjct  30   CLQAEKTALLQFKQGLIDQSNVLASWETGKD-CCKWRGIACNNKT-GHVVTLDLYYNYSD  87

Query  324  LCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD-RIPSFIGslnnlvylnlsynK  500
            +   G+P       G ISPSLL LP+L +LDLSFN F   IP FIGSL+ L  L L+   
Sbjct  88   ISHVGTP-----LSGVISPSLLELPYLTYLDLSFNNFQGEIPKFIGSLSRLEQLKLAGAD  142

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
              G +PP LGN+S+L  LD+  N+        + LEW+SHLSSL YLNM  ++   V +W
Sbjct  143  LSGPIPPQLGNLSSLYTLDLAWNYV-----TFENLEWLSHLSSLRYLNMSRLNFSEVVNW  197

Query  681  LHSISKLSFL  710
              SISKL  L
Sbjct  198  PESISKLPSL  207



>ref|NP_001172452.1| Os01g0601675 [Oryza sativa Japonica Group]
 dbj|BAB89968.1| HcrVf1 protein-like [Oryza sativa Japonica Group]
 dbj|BAB91719.1| HcrVf1 protein-like [Oryza sativa Japonica Group]
 gb|EAZ12592.1| hypothetical protein OsJ_02500 [Oryza sativa Japonica Group]
 dbj|BAH91182.1| Os01g0601675 [Oryza sativa Japonica Group]
Length=953

 Score = 91.7 bits (226),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 88/196 (45%), Positives = 116/196 (59%), Gaps = 9/196 (5%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            N +  C  +ER AL+SFK  ++       S  GDD  CC+W GV C+N T  H+V L+L 
Sbjct  31   NSTGGCIPSERSALISFKSGLLDPGNLLSSWEGDD--CCQWNGVWCNNET-GHIVELNL-  86

Query  315  RQGLCTDGSP--CYNPGFQGEIspsllhlpflnfldlsFNKFD-RIPSFIGslnnlvyln  485
              G C    P     PG  G I PSLL L  L  LDLS N F   +P F+GSL+NL  L+
Sbjct  87   PGGSCNILPPWVPLEPGLGGSIGPSLLGLKQLEHLDLSCNNFSGTLPEFLGSLHNLRSLD  146

Query  486  lsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLH  665
            LS++ FVG VPP LGN+S L+Y  +G+N     L   D + W+S LSSLE+L+M  V+L 
Sbjct  147  LSWSTFVGTVPPQLGNLSNLRYFSLGSN-DNSSLYSTD-VSWLSRLSSLEHLDMSLVNLS  204

Query  666  SVSDWLHSISKLSFLR  713
            +V DW+  ++KL  LR
Sbjct  205  AVVDWVSVVNKLPSLR  220



>ref|XP_009354357.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Pyrus x bretschneideri]
Length=1022

 Score = 91.7 bits (226),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 113/193 (59%), Gaps = 17/193 (9%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E+ER+AL+ FK  +        S  G +  CC+W+G+ C NTT A    L +      
Sbjct  27   CLESEREALIDFKKGLEDPENRLSSWKGSN--CCEWRGIHCHNTTGA---VLTVDLHNPH  81

Query  330  TDGSPCYNPGF---QGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsy  494
              GSP    GF    GEISPSL  L  L  LDLSFN F+   IP F GSL NL YLNLS+
Sbjct  82   PQGSPSRY-GFWNLSGEISPSLKMLESLRHLDLSFNTFNGIPIPEFFGSLKNLQYLNLSH  140

Query  495  nKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSV-  671
              F G + P+LGN+S+L++LD+ +NF       VD LEW++ + S+EYLNM+  DL  V 
Sbjct  141  AGFSGRILPNLGNLSSLQFLDVSSNFIS-----VDNLEWVTGMVSMEYLNMNGTDLSMVG  195

Query  672  SDWLHSISKLSFL  710
             DW+  ++KL FL
Sbjct  196  PDWIPKLNKLFFL  208



>ref|XP_011462016.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Fragaria vesca subsp. vesca]
Length=1044

 Score = 91.3 bits (225),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 88/202 (44%), Positives = 114/202 (56%), Gaps = 25/202 (12%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            S SC E ER+ALLSFK ++        S  G D  CC+WKG+ C+N T  HV  + L   
Sbjct  100  SASCIEEERQALLSFKRNVNDSSGRLSSWVGLD--CCRWKGISCNNRT-GHVAQMDLR--  154

Query  321  GLCTDGSPCYNPGFQ---------GEIspsllhlpflnfldlsFNKFD--RIPSFIGsln  467
                  +P Y+P +          G I+PSLL L  L  LDLS N F   RIP F G L 
Sbjct  155  ------NPNYHPEYDSSDQDTSLGGNINPSLLSLKKLYSLDLSGNDFRGLRIPDFFGKLT  208

Query  468  nlvylnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNM  647
            +L YLNLSY  F G +PP LGN+S L YLD+ + +Y       + L W+SHLSSL+YLN+
Sbjct  209  SLRYLNLSYASFKGEIPPTLGNLSNLNYLDLNSYYYDYCYS--NNLNWLSHLSSLKYLNL  266

Query  648  DCVDLHSVS-DWLHSISKLSFL  710
              V+L S++  WLH ++ L  L
Sbjct  267  GGVNLSSLAGSWLHDVNMLPSL  288



>ref|XP_008804946.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Phoenix dactylifera]
Length=942

 Score = 91.3 bits (225),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 96/157 (61%), Gaps = 6/157 (4%)
 Frame = +3

Query  246  CCKWKGVGCDNTTTAHVVALHLGRQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsF  425
            CC+W GV CDN T  HV+A+ L  Q L  D S  ++ G  GEI  SLL L  L +LDLS 
Sbjct  63   CCEWTGVSCDNKT-GHVIAIDLRCQHLYDDPSTDWHLG--GEIGSSLLDLKHLKYLDLSS  119

Query  426  NKFD--RIPSFIGslnnlvylnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVD  599
            N F    IP +IGS+  L YLNLS   F G +P  LGN+S L+YLD+ N+FY       D
Sbjct  120  NNFGGRSIPQYIGSMTGLRYLNLSNAAFSGRIPHQLGNLSNLEYLDL-NSFYSLYDLNAD  178

Query  600  TLEWISHLSSLEYLNMDCVDLHSVSDWLHSISKLSFL  710
             ++W+S+LSSL YL+M  V L   SDW H+++ L  L
Sbjct  179  GIQWLSNLSSLRYLDMTRVTLAKASDWFHAVNALPSL  215



>ref|NP_001172453.1| Os01g0601700 [Oryza sativa Japonica Group]
 dbj|BAH91183.1| Os01g0601700 [Oryza sativa Japonica Group]
Length=296

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 116/195 (59%), Gaps = 15/195 (8%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            S SC  +ERKALL+FK S         S  G+D  CC+WKGV CDNTT  HVV L L   
Sbjct  45   SGSCIPSERKALLTFKDSFWDRAGRLYSWRGED--CCRWKGVRCDNTT-GHVVRLDLRN-  100

Query  321  GLCTDGSPCYNPGF--QGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnl  488
               TD     N       E+SPS++ L  L +LDLS+N F+   IP F+GSL+NL YLNL
Sbjct  101  ---TDEDDWSNGLILSTSEMSPSIVDLHHLRYLDLSYNHFNFTSIPDFLGSLSNLRYLNL  157

Query  489  synKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHS  668
            S   F G +P  LGN+S L+YLD+GN+     L V D L W+  L  L YL++  VDL S
Sbjct  158  SAANFWGTLPSQLGNLSNLQYLDLGNS---HSLSVSD-LSWLMGLPFLSYLDLSTVDLSS  213

Query  669  VSDWLHSISKLSFLR  713
              +W+H+++KL  L+
Sbjct  214  ERNWVHAVNKLPSLQ  228



>ref|XP_006600066.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like [Glycine max]
Length=573

 Score = 90.1 bits (222),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 111/190 (58%), Gaps = 15/190 (8%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            +C E ER ALLSFKH +        S     D CC W GV C+NT    V+ ++L     
Sbjct  33   TCSEKERNALLSFKHGLADPSNRLSSWSDKSD-CCTWPGVHCNNT--GKVMEINLDTPA-  88

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsynK  500
               GSP       GEISPSLL L +LN LDLS N F    IPSF+GSL +L YL+LS + 
Sbjct  89   ---GSPYRE--LSGEISPSLLELKYLNRLDLSSNYFVLTPIPSFLGSLESLRYLDLSLSG  143

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F+G +P  LGN+S L++L++G N+  Q    +D L WIS LSSLEYL++   DLH   +W
Sbjct  144  FMGLIPHQLGNLSNLQHLNLGYNYALQ----IDNLNWISRLSSLEYLDLSGSDLHKQGNW  199

Query  681  LHSISKLSFL  710
            L  +S L  L
Sbjct  200  LQVLSALPSL  209



>ref|XP_010908803.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Elaeis guineensis]
Length=967

 Score = 90.9 bits (224),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 105/189 (56%), Gaps = 8/189 (4%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C ++ER ALL FK          L S     +CC W GV CDN T  HV+A+ L    L 
Sbjct  33   CIQSERLALLRFK--AGLKDPHQLLSSWMGANCCAWTGVSCDNET-GHVIAIDLRYHHLS  89

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynKF  503
             D S  +  G  GEI  SLL L  L  LDLS N F    IP +IGS+  L YLNLS   F
Sbjct  90   NDHSTDWRLG--GEIGSSLLDLKDLKHLDLSSNNFGGRTIPHYIGSMAELRYLNLSNAGF  147

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWL  683
             G +P  LGN+S L+YLD+ N+F+       D++ W+S+L+SL YL+M  V L   SDW 
Sbjct  148  SGRIPHQLGNLSNLEYLDL-NSFHSLYDLNADSIRWLSNLASLRYLDMTRVTLAKASDWF  206

Query  684  HSISKLSFL  710
            H+++ L  L
Sbjct  207  HAVNALPSL  215



>ref|XP_006475701.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Citrus sinensis]
Length=633

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 116/204 (57%), Gaps = 18/204 (9%)
 Frame = +3

Query  138  GSRSCFENERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNTTTAHVVALHLG  314
             +  C E+ER+ALLSFK  +        S +     DCCKW GV CDN T  HV+ L L 
Sbjct  31   AAAGCIESEREALLSFKQDLEDPSNRLASWNNIGVGDCCKWYGVVCDNIT-GHVLELRL-  88

Query  315  RQGLCTDGSPCYNPGFQ-----GEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnl  473
            R     DGSP     ++     G+I+PSLL L  L  LDLS+N F   +IP F+GSL NL
Sbjct  89   RNPSRDDGSPAEYEAYERSKIVGKINPSLLGLKHLIHLDLSYNDFQGIQIPRFLGSLENL  148

Query  474  vylnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDC  653
            +YLN+S   FVG +P  +GN+S L++LD+  N+ G     V+   W+SHLS L++L++  
Sbjct  149  MYLNISRAGFVGIIPHQIGNLSNLQFLDLRPNYLGGL--YVEDFGWVSHLSLLKHLDLSG  206

Query  654  VDLHSVSDW------LHSISKLSF  707
            VDL   SD       LHS+  L F
Sbjct  207  VDLSKTSDGPLITNSLHSLETLRF  230



>ref|XP_010249628.1| PREDICTED: receptor-like protein 12 [Nelumbo nucifera]
Length=906

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 85/190 (45%), Positives = 106/190 (56%), Gaps = 16/190 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            C   ERKALL+ K           S    + +DCC+WKGVGCDN T  HVV L L    L
Sbjct  31   CSTTERKALLNLKKGFKDPSNWLSSWDSNNREDCCRWKGVGCDNRT-GHVVQLKLRGSIL  89

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynK  500
                         GEI+  LL L  L +LDLS N+F+  +IP F+GSL  L YLNLS + 
Sbjct  90   IRS--------LSGEINHHLLELKHLRYLDLSGNEFEGNQIPDFLGSLQKLRYLNLSNSG  141

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F G +PP  GN+S+L+YLD+    +   L V D L W+S LSSL YL+M+ VDL    DW
Sbjct  142  FGGVIPPQFGNLSSLRYLDLR---FCNALNV-DNLHWVSRLSSLRYLDMNSVDLRLAHDW  197

Query  681  LHSISKLSFL  710
            L  I+ L  L
Sbjct  198  LQVINMLPHL  207



>ref|XP_009352122.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170 [Pyrus x bretschneideri]
Length=964

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 106/190 (56%), Gaps = 15/190 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHL--GRQG  323
            C + E+ ALL FK  +I       S     D CC+W+G+ C+N T  HV+ L L      
Sbjct  30   CLQTEKTALLQFKQGLIDKSNVLASWKTGRD-CCEWRGITCNNET-GHVITLDLYYNSSD  87

Query  324  LCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD-RIPSFIGslnnlvylnlsynK  500
            +   G+P       G I+PSLL LP+L  LDLSFN F  +IP FIGSL+ L  L L+   
Sbjct  88   ISHVGTP-----LSGVIAPSLLELPYLTNLDLSFNDFQGQIPKFIGSLSRLEQLKLAGAN  142

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
              G +PP LGN+S+L  LD+  NF        + LEW+SHLSSL YLNM  ++   V +W
Sbjct  143  LSGPIPPQLGNLSSLYTLDLAWNFV-----TFENLEWLSHLSSLRYLNMLYLNFSEVVNW  197

Query  681  LHSISKLSFL  710
              SISKL  L
Sbjct  198  PESISKLPSL  207



>ref|XP_003549056.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like [Glycine max]
Length=932

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 112/190 (59%), Gaps = 15/190 (8%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            +C E ER ALLSFKH +        S     D CC W GV C+NT    V+ ++L     
Sbjct  33   TCSEKERNALLSFKHGLADPSNRLSSWSDKSD-CCTWPGVHCNNT--GKVMEINLDTPA-  88

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsynK  500
               GSP       GEISPSLL L +LN LDLS N F    IPSF+GSL +L YL+LS + 
Sbjct  89   ---GSPYRE--LSGEISPSLLELKYLNRLDLSSNYFVLTPIPSFLGSLESLRYLDLSLSG  143

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F+G +P  LGN+S L++L++G N+  Q    +D L WIS LSSLEYL++   DLH   +W
Sbjct  144  FMGLIPHQLGNLSNLQHLNLGYNYALQ----IDNLNWISRLSSLEYLDLSGSDLHKQGNW  199

Query  681  LHSISKLSFL  710
            L  +S+L  L
Sbjct  200  LQVLSELPSL  209



>ref|XP_008338558.1| PREDICTED: receptor-like protein 12 [Malus domestica]
Length=979

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 113/189 (60%), Gaps = 9/189 (5%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            C E+ER+ALL FK  +        S    +  DCC W GV CD+ T  H+  LHL     
Sbjct  37   CKESERQALLMFKQDLKDPANRLSSWVAEEGSDCCSWTGVVCDHIT-GHIHELHLN----  91

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF-DRIPSFIGslnnlvylnlsynKF  503
             +     +N  F G+I  SLL L  LN+LDLS N+F  +IPSF+GS+ +L +LNL  + F
Sbjct  92   SSYSDWHFNSFFSGKIISSLLSLKHLNYLDLSNNEFITQIPSFLGSMTSLTHLNLGNSAF  151

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWL  683
             G +P  LGN+S+L+YL+I +N YG  LKV + L+WIS LS LE+L++  VDL   SDWL
Sbjct  152  GGVIPHKLGNLSSLRYLNI-SNIYGTSLKV-ENLKWISGLSLLEHLDLSSVDLSKASDWL  209

Query  684  HSISKLSFL  710
               + L  L
Sbjct  210  QVTNMLPSL  218



>ref|XP_003636149.1| Leucine-rich repeat receptor-like protein kinase, partial [Medicago 
truncatula]
Length=542

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 108/203 (53%), Gaps = 29/203 (14%)
 Frame = +3

Query  144  RSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHL----  311
            + C E ER+ALL FK +      S          CCKWKG+ CDN T  HV +L+L    
Sbjct  27   KKCVETERQALLRFKEAGNGSLSSWKGEE-----CCKWKGISCDNLT-GHVTSLNLHALD  80

Query  312  ---GRQGLCTDGSPCY----------NPGFQGEIspsllhlpflnfldlsFNKFD-RIPS  449
               G QG   D S C                G+I   +  L  L  L+L+FN  + +IP 
Sbjct  81   YTKGLQG-KLDSSICELQYLSSINLNRNNLHGKIPKCIGSLGQLIELNLNFNYLEGKIPK  139

Query  450  FIGslnnlvylnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSS  629
             IGSL NL+ L+LS NK V  +PP LGN+S L+ LD+G N+      + + LEW+SHLS+
Sbjct  140  SIGSLGNLIELDLSGNKLVSVIPPSLGNLSNLRTLDLGFNYD----MISNDLEWLSHLSN  195

Query  630  LEYLNMDCVDLHSVSDWLHSISK  698
            L YL++  V+L    DWL SISK
Sbjct  196  LRYLDISFVNLTLAVDWLSSISK  218



>ref|XP_007030464.1| Disease resistance family protein / LRR family protein, putative 
[Theobroma cacao]
 gb|EOY10966.1| Disease resistance family protein / LRR family protein, putative 
[Theobroma cacao]
Length=826

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 116/196 (59%), Gaps = 15/196 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            C E+ER+ALL FKH +I       S   GD +DCCKW GV CDN T  HV  LHLG   +
Sbjct  93   CIESERQALLKFKHDLIDHSNRLSSWVEGDYEDCCKWVGVLCDNRT-GHVNQLHLGFL-I  150

Query  327  CTDGSP-----CYNPGFQG-EIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvyl  482
              + +P      Y     G +I+PSLL L  L+FLDLS N FD  +IP FIGSL  L YL
Sbjct  151  PDEHAPDAVWEAYGRSKLGRKINPSLLDLKHLSFLDLSNNYFDGMQIPEFIGSLKRLTYL  210

Query  483  nlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDL  662
            NLS   F G +P  LGN+S L YLD+G+NF    L    TL+W+S L SL YL++  V+L
Sbjct  211  NLSGASFGGAIPHKLGNLSKLHYLDLGHNF----LLEAKTLQWVSSLPSLRYLDLSRVNL  266

Query  663  HSVSDWLHSISKLSFL  710
               +DWL   +KL  L
Sbjct  267  SKATDWLQVTNKLPSL  282



>ref|XP_009375566.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Pyrus x bretschneideri]
Length=964

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 105/190 (55%), Gaps = 15/190 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C + E+ ALL FK  +I       S     D CC+W+G+ C+N T  HV+ L L     C
Sbjct  30   CLQTEKTALLQFKQGLIDKSNVLASWKTGRD-CCEWRGITCNNET-GHVITLDL-----C  82

Query  330  TDGSPCYN--PGFQGEIspsllhlpflnfldlsFNKFD-RIPSFIGslnnlvylnlsynK  500
               S  YN      G I+PSLL LP+L  LDLSFN F  +IP FIGSL+ L  L L+   
Sbjct  83   YSSSDIYNGETPLTGVIAPSLLELPYLTNLDLSFNHFQGQIPKFIGSLSRLEQLKLAGAN  142

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
              G +PP L N+S+L  LD+  N+        + LEW+SHLSSL YLNM  ++   V +W
Sbjct  143  LSGPIPPQLRNLSSLHTLDLALNYV-----TFENLEWLSHLSSLRYLNMSGLNFSKVVNW  197

Query  681  LHSISKLSFL  710
              SISKL  L
Sbjct  198  PESISKLPSL  207



>gb|KEH16825.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=876

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 103/185 (56%), Gaps = 17/185 (9%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E ER+ALL FK ++I       S  G++  CCKW+G+ CDN T  HV  L L      
Sbjct  31   CVETERRALLKFKDALILGRNDLTSWKGEE--CCKWEGISCDNLT-GHVTILDLHALD--  85

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD-RIPSFIGslnnlvylnlsynKFV  506
                  Y  G QG++  S+  L  L  L+L  N+ + +IP  IGSL  L+ LNL  NK V
Sbjct  86   ------YTKGLQGKLDSSICELQHLTSLNLDNNRIEGKIPKCIGSLGKLIELNLIGNKLV  139

Query  507  GNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWLH  686
              +PP LGN+S L+ LD+G N         + LEWISHLS+L YL +  V+L    DWL 
Sbjct  140  SVIPPSLGNLSNLQTLDLGFNDL-----TANDLEWISHLSNLRYLGLSNVNLTLAVDWLS  194

Query  687  SISKL  701
            SISK+
Sbjct  195  SISKI  199



>gb|KDO62592.1| hypothetical protein CISIN_1g045210mg, partial [Citrus sinensis]
Length=873

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 116/204 (57%), Gaps = 18/204 (9%)
 Frame = +3

Query  138  GSRSCFENERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNTTTAHVVALHLG  314
             +  C E+ER+ALLSFK  +        S +     DCCKW GV CDN T  HV+ L L 
Sbjct  31   AAAGCIESEREALLSFKQDLEDPSNRLASWNNIGVGDCCKWYGVVCDNIT-GHVLELRL-  88

Query  315  RQGLCTDGSPCYNPGFQ-----GEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnl  473
            R     DGSP     ++     G+I+PSLL L  L  LDLS+N F   +IP F+GSL NL
Sbjct  89   RNPSRDDGSPAEYEAYERSKIVGKINPSLLGLKHLIHLDLSYNDFQGIQIPRFLGSLENL  148

Query  474  vylnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDC  653
            +YLN+S   FVG +P  +GN+S L++LD+  N+ G     V+   W+SHLS L++L++  
Sbjct  149  MYLNISRAGFVGIIPHQIGNLSNLQFLDLRPNYLGGL--YVEDFGWVSHLSLLKHLDLSG  206

Query  654  VDLHSVSDW------LHSISKLSF  707
            VDL   SD       LHS+  L F
Sbjct  207  VDLSKTSDGPLITNSLHSLETLRF  230



>ref|XP_006452262.1| hypothetical protein CICLE_v10010520mg [Citrus clementina]
 gb|ESR65502.1| hypothetical protein CICLE_v10010520mg [Citrus clementina]
Length=949

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 116/204 (57%), Gaps = 18/204 (9%)
 Frame = +3

Query  138  GSRSCFENERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNTTTAHVVALHLG  314
             +  C E+ER+ALLSFK  +        S +     DCCKW GV CDN T  HV+ L L 
Sbjct  31   AAAGCIESEREALLSFKQDLEDPSNRLASWNNIGVGDCCKWYGVVCDNIT-GHVLELRL-  88

Query  315  RQGLCTDGSPCYNPGFQ-----GEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnl  473
            R     DGSP     ++     G+I+PSLL L  L  LDLS+N F   +IP F+GSL NL
Sbjct  89   RNPSRDDGSPAEYEAYERSKIVGKINPSLLGLKHLIHLDLSYNDFQGIQIPRFLGSLENL  148

Query  474  vylnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDC  653
            +YLN+S   FVG +P  +GN+S L++LD+  N+ G     V+   W+SHLS L++L++  
Sbjct  149  MYLNISRAGFVGIIPHQIGNLSNLQFLDLRPNYLGGL--YVEDFGWVSHLSLLKHLDLSG  206

Query  654  VDLHSVSDW------LHSISKLSF  707
            VDL   SD       LHS+  L F
Sbjct  207  VDLSKTSDGPLITNSLHSLETLRF  230



>ref|XP_006452276.1| hypothetical protein CICLE_v10007373mg [Citrus clementina]
 gb|ESR65516.1| hypothetical protein CICLE_v10007373mg [Citrus clementina]
Length=949

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 116/204 (57%), Gaps = 18/204 (9%)
 Frame = +3

Query  138  GSRSCFENERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNTTTAHVVALHLG  314
             +  C E+ER+ALLSFK  +        S +     DCCKW GV CDN T  HV+ L L 
Sbjct  31   AAAGCIESEREALLSFKQDLEDPSNRLASWNNIGVGDCCKWYGVVCDNIT-GHVLELRL-  88

Query  315  RQGLCTDGSPCYNPGFQ-----GEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnl  473
            R     DGSP     ++     G+I+PSLL L  L  LDLS+N F   +IP F+GSL NL
Sbjct  89   RNPSRDDGSPAEYEAYERSKIVGKINPSLLGLKHLIHLDLSYNDFQGIQIPRFLGSLENL  148

Query  474  vylnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDC  653
            +YLN+S   FVG +P  +GN+S L++LD+  N+ G     V+   W+SHLS L++L++  
Sbjct  149  MYLNISRAGFVGIIPHQIGNLSNLQFLDLRPNYLGGL--YVEDFGWVSHLSLLKHLDLSG  206

Query  654  VDLHSVSDW------LHSISKLSF  707
            VDL   SD       LHS+  L F
Sbjct  207  VDLSKTSDGPLITNSLHSLETLRF  230



>ref|XP_006607060.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Glycine max]
Length=776

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 111/190 (58%), Gaps = 15/190 (8%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            +C E ER ALLSFKH +        S     D CC W GV C+NT    V+ ++L     
Sbjct  2    TCSEKERNALLSFKHGLADPSNRLSSWSDKSD-CCTWPGVHCNNT--GKVMEINLDTPA-  57

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsynK  500
               GSP       GEISPSLL L +LN LDLS N F    IPSF+GSL +L YL+LS + 
Sbjct  58   ---GSPYRE--LSGEISPSLLELKYLNRLDLSSNYFVLTPIPSFLGSLESLRYLDLSLSG  112

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F+G +P  LGN+S L++L++G N+  Q    +D L WIS LSSLEYL++   DLH   +W
Sbjct  113  FMGLIPHQLGNLSNLQHLNLGYNYALQ----IDNLNWISRLSSLEYLDLSGSDLHKQGNW  168

Query  681  LHSISKLSFL  710
            L  +S L  L
Sbjct  169  LQVLSALPSL  178



>gb|KEH16828.1| LRR receptor-like kinase family protein, partial [Medicago truncatula]
Length=658

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 113/192 (59%), Gaps = 20/192 (10%)
 Frame = +3

Query  138  GSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGR  317
            G   C E ER ALL F+ +I  +   + S  G++  CCKW+G+ CDN T  HV +LHL  
Sbjct  27   GMNKCVETERIALLKFRDAINLNREFNSSWKGEE--CCKWEGILCDNFT-HHVTSLHL--  81

Query  318  QGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD-RIPSFIGslnnlvylnlsy  494
                         GF G++  S+  L  L +L+L+ N+F+ +IP  IGSL NL+ L+L  
Sbjct  82   ----------LFFGFGGKLDSSICELKHLTYLNLNDNQFEGKIPKCIGSLGNLIELDLGG  131

Query  495  nKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVS  674
            N FVG +PP LGN+S L+ LD+G   Y       + LEW+SHLS+L YL++  V+L    
Sbjct  132  NYFVGVIPPSLGNLSNLQTLDLGVFNY----LTANDLEWLSHLSNLRYLDLSYVNLTLAV  187

Query  675  DWLHSISKLSFL  710
            DWL SISK+ +L
Sbjct  188  DWLSSISKIPYL  199



>ref|XP_010662805.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Vitis vinifera]
Length=945

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 86/184 (47%), Positives = 110/184 (60%), Gaps = 8/184 (4%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E E+ ALL FK ++        S   + D CC+W+ V C+N T   VV LHLG     
Sbjct  84   CNEKEKHALLRFKKALSDPGNRLSSWSVNQD-CCRWEAVRCNNVT-GRVVELHLGNPYDT  141

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsynKF  503
             D          GEISP+LL L FL++L+LS+N F    IPSF+GS+ +L YL+LSY  F
Sbjct  142  DDYEFYSKFELGGEISPALLELEFLSYLNLSWNDFGGSPIPSFLGSMGSLRYLDLSYAGF  201

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWL  683
             G VP  LGN+STL++LD+G N YG     V+ L WISHL  L+YL M+ VDLH    WL
Sbjct  202  GGLVPHQLGNLSTLRHLDLGRN-YGL---YVENLGWISHLVFLKYLGMNRVDLHKEVHWL  257

Query  684  HSIS  695
             S+S
Sbjct  258  ESVS  261



>ref|XP_010646800.1| PREDICTED: receptor-like protein 12 [Vitis vinifera]
Length=461

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 114/192 (59%), Gaps = 16/192 (8%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            + FE ER ALL FK  +        S  G+D  CCKW+GV C+N +  HV+ L+L  + L
Sbjct  39   ASFETERVALLKFKQGLTDPSHRLSSWVGED--CCKWRGVVCNNRS-GHVIKLNL--RSL  93

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynK  500
              DG+   +    GEIS SLL L +LN LDLS N F+  RIP FIGSL  L YLNLS   
Sbjct  94   DDDGT---HGKLGGEISHSLLDLKYLNHLDLSMNNFEGTRIPKFIGSLEKLRYLNLSGAS  150

Query  501  FVGNVPPHLGNISTLKYLDIGNNF----YGQRLKVVDTLEWISHLSSLEYLNMDCVDLHS  668
            F G +PP LGN+S L YLD+   F    Y       D L+WIS LSSL +LN++ V+L  
Sbjct  151  FSGPIPPQLGNLSRLIYLDLKEYFDFNTYPDESSQND-LQWISGLSSLRHLNLEGVNLSR  209

Query  669  VSD-WLHSISKL  701
             S  WLH++SKL
Sbjct  210  ASAYWLHAVSKL  221



>gb|KHG06604.1| DNA-damage-repair/toleration protein [Gossypium arboreum]
Length=267

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 84/201 (42%), Positives = 113/201 (56%), Gaps = 17/201 (8%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            N ++ C ++ERKALL FK+ +I       S     D CC+W GV C N+T  HV  LHL 
Sbjct  32   NSNQLCIQSERKALLKFKNDLIDPSDRLSSWVEGGD-CCEWIGVFCQNST-GHVHQLHLA  89

Query  315  RQGLCT--------DGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGsl  464
               L          +  P      +G+I+PSLL L  L+ LDLS N F   +IP F G L
Sbjct  90   APPLSAPDIYAPPAEWEPYRRSKLRGKINPSLLELKHLSSLDLSNNNFSSIQIPKFFGLL  149

Query  465  nnlvylnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLN  644
             +L YLNLS  +F G +P +LGN+S L+YLD+G N     LK  ++ +W+S LSSL YL+
Sbjct  150  ESLTYLNLSLARFQGTIPHNLGNLSKLQYLDLGYN----DLK-SESPQWVSALSSLHYLD  204

Query  645  MDCVDLHSVSDWLHSISKLSF  707
            +   DL+  +DW  S   LSF
Sbjct  205  LSSADLYEANDWDKSQQALSF  225



>ref|XP_010111049.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Morus 
notabilis]
 gb|EXC29911.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Morus 
notabilis]
Length=952

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 109/192 (57%), Gaps = 21/192 (11%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C + ER+AL+S   S  S+ L  L+       CCKW+GV C N T  HV+A+H+  Q + 
Sbjct  41   CIDKERQALVSLFQSSSSNWLPWLTEED----CCKWEGVHCSNQTN-HVIAIHIPPQQVI  95

Query  330  TDGSPCYNPGF---QGEIspsllhlpflnfldlsFNKFDRIPSFIGslnnlvylnlsynK  500
                     G+   QG I+ SL+ L  L  L+LS N   +IP F+G L NL YL+LS   
Sbjct  96   ---------GYSLAQGAINRSLIELQQLESLNLSSNYIRQIPPFLGFLGNLRYLDLSNTD  146

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
              G +P  LGN+  +KYLD+  N Y Q    V  L+W+S+LSSLEYL++  ++L    DW
Sbjct  147  VSGAIPTELGNLFNIKYLDLSGNSYAQ----VQNLKWLSNLSSLEYLDLSLLNLSKSHDW  202

Query  681  LHSISKLSFLRT  716
            L +I+ L  LRT
Sbjct  203  LQTINGLPKLRT  214



>emb|CDP16273.1| unnamed protein product [Coffea canephora]
Length=1049

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 89/199 (45%), Positives = 113/199 (57%), Gaps = 24/199 (12%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            SCFENERKALL FK  +I      +S  G+D  CC W+GVGC    T HVV L L     
Sbjct  32   SCFENERKALLEFKKCLIDKSNRLISWIGED--CCSWEGVGC-GKNTRHVVKLDLRN---  85

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynK  500
                    N  F  +ISPSL++L  L++LDLS N F    IP+FIGSL  L YLN S   
Sbjct  86   --------NVVFDRQISPSLVNLQHLHYLDLSSNYFAGIEIPTFIGSLKILRYLNFSNAG  137

Query  501  FVGNVPPHLGNISTLKYLDIGNN-------FYGQRLKVVDTLEWISHLSSLEYLNMDCVD  659
            F G +PP LGN+S L YLD+G           G +L    +L WI+ LSSL++L++   D
Sbjct  138  FSGAIPPQLGNLSALDYLDLGKKPGGFSDWISGYQLST-KSLWWITSLSSLKHLDLSGAD  196

Query  660  LHSVSDWLHSISKLSFLRT  716
            L    DWL +++KL FL +
Sbjct  197  LGEAQDWLQALNKLHFLSS  215



>ref|XP_009618939.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 isoform X2 [Nicotiana tomentosiformis]
Length=840

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 81/194 (42%), Positives = 111/194 (57%), Gaps = 20/194 (10%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            N    C E+E+ AL+ F+    +   S  S   +++ CCKWKGV CDN T  HV+AL L 
Sbjct  29   NSGIHCTESEKIALIKFRQGFRNPLQSMSSWMLEEN-CCKWKGVECDNKT-GHVIALDLH  86

Query  315  RQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnl  488
            +Q L            QGE + SLL LP L  LDLS   F   ++P FI +  NL YLNL
Sbjct  87   KQFL------------QGEFATSLLGLPHLRHLDLSQIDFLGAQVPEFISTFKNLEYLNL  134

Query  489  synKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHS  668
            S  KF G +P HLGN+S L++LD+ + F  +    VD L+WI HL S++ L++  VD+  
Sbjct  135  SKTKFRGTIPEHLGNLSRLQFLDLSDGFSLR----VDNLQWIRHLFSMKILDLSGVDMSD  190

Query  669  VSDWLHSISKLSFL  710
              +WLH I+ L+ L
Sbjct  191  AKNWLHDINLLTSL  204



>ref|XP_011005448.1| PREDICTED: receptor-like protein 12 isoform X1 [Populus euphratica]
 ref|XP_011005449.1| PREDICTED: receptor-like protein 12 isoform X1 [Populus euphratica]
 ref|XP_011005450.1| PREDICTED: receptor-like protein 12 isoform X1 [Populus euphratica]
Length=948

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 115/198 (58%), Gaps = 18/198 (9%)
 Frame = +3

Query  138  GSRSCFENERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNTTTAHVVALHL  311
            G   C E ER+ALL FK  II +     S     +  DCCKW+GVGCDN T  HV +L+L
Sbjct  37   GEIGCIERERQALLKFKEDIIDEYGVLSSWGGEEEKRDCCKWRGVGCDNVT-GHVTSLNL  95

Query  312  GRQGLCTDGSPCYNPGFQ---GEIspsllhlpflnfldlsFNKFDR-IPSFIGslnnlvy  479
                     SP Y   F    G++S SLL L  LN+LDLS N  D  I  FIGSL++L Y
Sbjct  96   -------HSSPLYEHNFTPLIGKVSNSLLELQHLNYLDLSLNNLDESIMDFIGSLSSLRY  148

Query  480  lnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVD  659
            LNLSYN F   +P HL N+S L+ LD+  +F       V+ L W+SHLSSLE+L++   D
Sbjct  149  LNLSYNLFTVTIPYHLKNLSRLQSLDLSYSFDAS----VENLGWLSHLSSLEHLDLSGSD  204

Query  660  LHSVSDWLHSISKLSFLR  713
            L  V+DWL  ++ L  L+
Sbjct  205  LSKVNDWLQVVTNLPRLK  222



>ref|XP_006599582.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2-like [Glycine max]
Length=932

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 111/190 (58%), Gaps = 15/190 (8%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            +C E ER ALLSFKH +        S     D CC W GV C+NT    V+ ++L     
Sbjct  33   TCREKERNALLSFKHGLADPSNRLSSWSDKSD-CCTWPGVHCNNT--GKVMEINLDTPA-  88

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsynK  500
               GSP       GEISPSLL L +LN LDLS N F    IPSF+GSL +L YL+LS + 
Sbjct  89   ---GSPYRE--LSGEISPSLLELKYLNRLDLSSNYFVLTPIPSFLGSLESLRYLDLSLSG  143

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F+G +P  LGN+S L++L++G N+  Q    +D L WIS LSSLEYL++   DLH   +W
Sbjct  144  FMGLIPHQLGNLSNLQHLNLGYNYALQ----IDNLNWISRLSSLEYLDLSGSDLHKQGNW  199

Query  681  LHSISKLSFL  710
            L  +S L  L
Sbjct  200  LQVLSALPSL  209



>gb|KDO37541.1| hypothetical protein CISIN_1g045139mg [Citrus sinensis]
Length=820

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 112/191 (59%), Gaps = 18/191 (9%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNTTTAHVVALHLGRQG  323
            C E ER+ALL FK  +I +     S  +  D  DCCKW+GV C N T  HV  L+L  + 
Sbjct  41   CIERERQALLMFKQGLIDEYGHLSSWGNEDDKKDCCKWRGVSCSNQT-GHVTMLNLQFRS  99

Query  324  LCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsyn  497
                    Y P  +G IS SL+ L  LN+L++ +N F   +IP+FIGSL N+ +L+LS  
Sbjct  100  --------YMP-LRGNISSSLIGLQHLNYLNMKYNDFGGKQIPAFIGSLKNIRHLDLSNA  150

Query  498  KFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSD  677
             F G VP  LGN+++L+YLD+  NF     K    LEW+S LS LEY+ ++ V+L   +D
Sbjct  151  GFTGRVPYQLGNLTSLQYLDLSFNFDMLSKK----LEWLSQLSFLEYVRLNQVNLGEATD  206

Query  678  WLHSISKLSFL  710
            WL  +S+L  L
Sbjct  207  WLQVVSQLPSL  217



>gb|KHN45763.1| LRR receptor-like serine/threonine-protein kinase FLS2 [Glycine 
soja]
Length=901

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 111/190 (58%), Gaps = 15/190 (8%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            +C E ER ALLSFKH +        S     D CC W GV C+NT    V+ ++L     
Sbjct  2    TCSEKERNALLSFKHGLADPSNRLSSWSDKSD-CCTWPGVHCNNT--GKVMEINLDTPA-  57

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsynK  500
               GSP       GEISPSLL L +LN LDLS N F    IPSF+GSL +L YL+LS + 
Sbjct  58   ---GSPYRE--LSGEISPSLLELKYLNRLDLSSNYFVLTPIPSFLGSLESLRYLDLSLSG  112

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F+G +P  LGN+S L++L++G N+  Q    +D L WIS LSSLEYL++   DLH   +W
Sbjct  113  FMGLIPHQLGNLSNLQHLNLGYNYALQ----IDNLNWISRLSSLEYLDLSGSDLHKQGNW  168

Query  681  LHSISKLSFL  710
            L  +S L  L
Sbjct  169  LQVLSALPSL  178



>ref|XP_009618938.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 isoform X1 [Nicotiana tomentosiformis]
Length=894

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 81/194 (42%), Positives = 111/194 (57%), Gaps = 20/194 (10%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            N    C E+E+ AL+ F+    +   S  S   +++ CCKWKGV CDN T  HV+AL L 
Sbjct  29   NSGIHCTESEKIALIKFRQGFRNPLQSMSSWMLEEN-CCKWKGVECDNKT-GHVIALDLH  86

Query  315  RQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnl  488
            +Q L            QGE + SLL LP L  LDLS   F   ++P FI +  NL YLNL
Sbjct  87   KQFL------------QGEFATSLLGLPHLRHLDLSQIDFLGAQVPEFISTFKNLEYLNL  134

Query  489  synKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHS  668
            S  KF G +P HLGN+S L++LD+ + F  +    VD L+WI HL S++ L++  VD+  
Sbjct  135  SKTKFRGTIPEHLGNLSRLQFLDLSDGFSLR----VDNLQWIRHLFSMKILDLSGVDMSD  190

Query  669  VSDWLHSISKLSFL  710
              +WLH I+ L+ L
Sbjct  191  AKNWLHDINLLTSL  204



>ref|XP_008362832.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Malus domestica]
Length=964

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 103/188 (55%), Gaps = 11/188 (6%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C + E+ ALL FK  +I       S     D CC+W+G+ C+N T  HVV L L      
Sbjct  30   CLQAEKTALLQFKQGLIDQSNVLASWETGKD-CCEWRGIACNNET-GHVVTLDLYHSSFD  87

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD-RIPSFIGslnnlvylnlsynKFV  506
              G         G I+PSLL LP+L +LDLSFN F  +IP FIGSL+ L  L L+     
Sbjct  88   IYG---VKTPLSGVIAPSLLELPYLTYLDLSFNHFQGQIPKFIGSLSRLEQLKLAGANLS  144

Query  507  GNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWLH  686
            G +PP LGN+S+L  LD+  N         + LEW+SHLSSL YLNM  ++   V +W  
Sbjct  145  GPIPPQLGNLSSLYTLDLARNHV-----TFENLEWLSHLSSLRYLNMSRLNFSKVVNWPE  199

Query  687  SISKLSFL  710
            SISKL  L
Sbjct  200  SISKLPSL  207



>ref|XP_009405132.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Musa acuminata subsp. malaccensis]
Length=990

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 116/195 (59%), Gaps = 16/195 (8%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            ++ C E ER ALL FK  I+ DP SSLSSW    DCC+W GV CDN T  HVV L+L   
Sbjct  35   TKGCVEGERDALLDFKTGIVKDPSSSLSSWRGRVDCCRWSGVVCDNRT-GHVVELNL---  90

Query  321  GLCTDGSPC-YNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnls  491
                +  P  Y     GEI PSLL L  L  L+LS+N F   +IP F+GSL  L YL+LS
Sbjct  91   ---QNSDPYNYETSIGGEIRPSLLLLTHLERLNLSYNDFGGIQIPKFLGSLTKLTYLDLS  147

Query  492  ynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSV  671
            ++ F G +PP LGN+S+L+YLD+ +          D L W+S L+SL YL+M   +L   
Sbjct  148  WSNFSGAIPPQLGNLSSLRYLDLNSGGLS-----TDGLHWLSRLTSLRYLDMSFGNLSMA  202

Query  672  S-DWLHSISKLSFLR  713
            S +WL +++ LS L 
Sbjct  203  SHNWLQAVNMLSSLE  217



>emb|CAN76220.1| hypothetical protein VITISV_020133 [Vitis vinifera]
Length=939

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 114/194 (59%), Gaps = 10/194 (5%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            ++ C E ERKALL FK+ +        S  G D  CCKWKGV C+N T  HVV + L   
Sbjct  38   NKGCIEVERKALLEFKNGLKDPSGWLSSWVGAD--CCKWKGVDCNNQT-GHVVKVDLKSG  94

Query  321  GLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsy  494
            G  T     ++    GEIS SLL L  LN+LDLS N F    IP+F+GS   L YL LS 
Sbjct  95   G--TSHVWXFS-RLGGEISDSLLDLKHLNYLDLSXNDFQGIPIPNFLGSFERLRYLXLSN  151

Query  495  nKFVGNVPPHLGNISTLKYLDI-GNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDL-HS  668
             +F G +PPHLGN+S L+YLD+ G   Y      V  L W+S LSSL+YL++  V+L  +
Sbjct  152  ARFGGMIPPHLGNLSQLRYLDLFGGGDYSPAPMRVSNLNWLSGLSSLKYLDLGYVNLSKA  211

Query  669  VSDWLHSISKLSFL  710
             ++W+ +++ L FL
Sbjct  212  TTNWMQAVNMLPFL  225



>ref|XP_006599588.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2-like [Glycine max]
Length=932

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 111/190 (58%), Gaps = 15/190 (8%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            +C E ER ALLSFKH +        S     D CC W GV C+NT    V+ ++L     
Sbjct  33   TCSEKERNALLSFKHGLADPSNRLSSWSDKSD-CCTWPGVHCNNT--GKVMEINLDTPA-  88

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsynK  500
               GSP       GEISPSLL L +LN LDLS N F    IPSF+GSL +L YL+LS + 
Sbjct  89   ---GSPYRE--LSGEISPSLLELKYLNRLDLSSNYFVLTPIPSFLGSLESLRYLDLSLSG  143

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F+G +P  LGN+S L++L++G N+  Q    +D L WIS LSSLEYL++   DLH   +W
Sbjct  144  FMGLIPHQLGNLSNLQHLNLGYNYALQ----IDNLNWISRLSSLEYLDLSGSDLHKQGNW  199

Query  681  LHSISKLSFL  710
            L  +S L  L
Sbjct  200  LQVLSALPSL  209



>ref|XP_010323160.1| PREDICTED: EIX receptor 1 isoform X1 [Solanum lycopersicum]
Length=1027

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 110/190 (58%), Gaps = 11/190 (6%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E ER ALL FK  +  D     +   +++ CC WKG+ CD  T  HV+ L L  +  C
Sbjct  35   CIEKERDALLEFKRGLNDDFGRLSTWGDEEE-CCNWKGIECDKRT-GHVIVLDLHSEVTC  92

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynKF  503
              G  C+ P   G++SPSLL L +LNFLDLS N F+   IP FIGSL  L YLNLS + F
Sbjct  93   P-GHACFAPILTGKVSPSLLELEYLNFLDLSVNGFENSEIPRFIGSLKRLEYLNLSSSDF  151

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWL  683
             G +P    N+++L+ LD+GNN       +V  L W+SHLSSLE+L +   D  +  +W 
Sbjct  152  SGEIPAQFQNLTSLRILDLGNNNL-----IVKDLVWLSHLSSLEFLRLGGNDFQA-RNWF  205

Query  684  HSISKLSFLR  713
              I+K+  L+
Sbjct  206  REITKVPSLK  215



>gb|EEC71039.1| hypothetical protein OsI_02753 [Oryza sativa Indica Group]
Length=671

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 114/197 (58%), Gaps = 11/197 (6%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C   E  ALLSFK  +++DPL  L SW    DC +W GVGC N T  HVV L L R  L 
Sbjct  37   CIAAEWAALLSFKEGVMADPLRLLDSWQGAGDCYRWNGVGCSNRT-GHVVKLDL-RNTLY  94

Query  330  TDGSPCY---NP-GFQGEIspsllhlpflnfldlsFNKFD----RIPSFIGslnnlvyln  485
             D        NP   +G++S SLL L  L +L LS N        IPSF+GSL +LVYLN
Sbjct  95   WDDQRQVRLDNPHAMRGQVSTSLLALRRLKYLYLSGNNLGGPGIAIPSFLGSLESLVYLN  154

Query  486  lsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLH  665
            LS   F G VP  LGN+S L YLD+G+ +Y  ++   D L W+  LSSL+YL+M  V+L 
Sbjct  155  LSCIDFFGEVPTQLGNLSRLSYLDVGSMYYSGQIFSSD-LSWLGRLSSLKYLDMSGVNLS  213

Query  666  SVSDWLHSISKLSFLRT  716
             VSDW H    ++ LRT
Sbjct  214  MVSDWAHVFWGITTLRT  230



>ref|XP_009398960.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Musa acuminata subsp. malaccensis]
Length=984

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 118/194 (61%), Gaps = 12/194 (6%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            ++ C E ER ALL+F+ + I DP   LSSW    DCC+W GV CDNTT   VV L+L   
Sbjct  27   AKGCVEVERDALLAFR-ARIVDPSHRLSSWRRRVDCCRWNGVVCDNTT-GRVVELNLENS  84

Query  321  GLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsy  494
               T  S       +GEISPSLL L  L+ LDL+ N F    IP+F+GS   L YLNLS+
Sbjct  85   ADMTFES--NQAALRGEISPSLLSLTHLDRLDLNHNDFGGSPIPAFLGSFPKLTYLNLSW  142

Query  495  nKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVS  674
            + F G +PP LGN+S+L+ LD+ +  YG      D L W+S LSSL YL+M  V+L   S
Sbjct  143  SNFSGAIPPQLGNLSSLRSLDLHS--YGLS---TDGLHWLSRLSSLRYLDMSSVNLSMAS  197

Query  675  -DWLHSISKLSFLR  713
             DWL +++ LS LR
Sbjct  198  PDWLQAVNMLSSLR  211



>ref|XP_006599589.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Glycine max]
Length=630

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 85/190 (45%), Positives = 108/190 (57%), Gaps = 15/190 (8%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            +C E ER ALLSFKH +        S     D CC W GV C+NT     + L+      
Sbjct  33   TCSEKERNALLSFKHGLADPSNRFSSWSDKSD-CCTWPGVHCNNTGKVMEINLY------  85

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsynK  500
               GSP       GEISPSLL L +LN LDLS N F    IPSF+GSL +L YL+L+ + 
Sbjct  86   TPAGSPYRE--LSGEISPSLLELKYLNRLDLSSNYFVLTPIPSFLGSLESLRYLDLNLSG  143

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F+G +P  LGN+S L +L++G N+  Q    +D L WIS LSSLEYL++   DLH   +W
Sbjct  144  FMGLIPHQLGNLSNLHHLNLGYNYALQ----IDNLNWISRLSSLEYLDLSGSDLHKQGNW  199

Query  681  LHSISKLSFL  710
            L  +S L  L
Sbjct  200  LQVLSALPSL  209



>ref|XP_011080440.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Sesamum indicum]
Length=984

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 107/186 (58%), Gaps = 18/186 (10%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E E++ALLSFK  +        S     D CC+W GV CDN T  HV  LHL      
Sbjct  29   CGEREKQALLSFKQELDDPSNLLSSWDATVD-CCEWDGVLCDNLT-GHVSELHLQ-----  81

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynKF  503
               SP    G  G+I+PSLL L  L FLDLS N F   +IP F GSL +L Y+NLSY  F
Sbjct  82   ---SPDSGSGLGGKIAPSLLSLKHLRFLDLSQNDFTGTQIPGFFGSLVSLEYVNLSYAGF  138

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWL  683
             G +P HLGN+S L+ LD+  +        VD+LEW+S LS LE+LN + V+L  V +WL
Sbjct  139  RGIIPHHLGNLSNLRTLDLSGSLE------VDSLEWLSGLSHLEFLNFNYVNLSKVPNWL  192

Query  684  HSISKL  701
              ++KL
Sbjct  193  QVVNKL  198



>gb|KEH25182.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1069

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 108/203 (53%), Gaps = 29/203 (14%)
 Frame = +3

Query  144  RSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHL----  311
            + C E ER+ALL FK +      S          CCKWKG+ CDN T  HV +L+L    
Sbjct  27   KKCVETERQALLRFKEAGNGSLSSWKGEE-----CCKWKGISCDNLT-GHVTSLNLHALD  80

Query  312  ---GRQGLCTDGSPCY----------NPGFQGEIspsllhlpflnfldlsFNKFD-RIPS  449
               G QG   D S C                G+I   +  L  L  L+L+FN  + +IP 
Sbjct  81   YTKGLQG-KLDSSICELQYLSSINLNRNNLHGKIPKCIGSLGQLIELNLNFNYLEGKIPK  139

Query  450  FIGslnnlvylnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSS  629
             IGSL NL+ L+LS NK V  +PP LGN+S L+ LD+G N+      + + LEW+SHLS+
Sbjct  140  SIGSLGNLIELDLSGNKLVSVIPPSLGNLSNLRTLDLGFNYD----MISNDLEWLSHLSN  195

Query  630  LEYLNMDCVDLHSVSDWLHSISK  698
            L YL++  V+L    DWL SISK
Sbjct  196  LRYLDISFVNLTLAVDWLSSISK  218



>gb|ACJ03068.1| HB04p [Malus floribunda]
Length=977

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 113/189 (60%), Gaps = 9/189 (5%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            C E+ER+ALL FK  +        S    +  DCC W GV CD+ T  H+  LHL     
Sbjct  37   CKESERQALLMFKQDLKDPANRLSSWVAEEGSDCCSWTGVVCDHIT-GHIHELHLN----  91

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF-DRIPSFIGslnnlvylnlsynKF  503
             +     +N  F G+I+ SLL L  LN+LDLS N+F  +IPSF GS+ +L +LNL  + F
Sbjct  92   SSYSDWHFNSFFSGKINSSLLSLKHLNYLDLSNNEFITQIPSFFGSMTSLTHLNLGNSAF  151

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWL  683
             G +P  LGN+S+L+YL+I +N YG  LKV + L+WIS LS LE+L++  VDL   SDWL
Sbjct  152  GGVIPHKLGNLSSLRYLNI-SNIYGPSLKV-ENLKWISGLSLLEHLDLSSVDLSKASDWL  209

Query  684  HSISKLSFL  710
               + L  L
Sbjct  210  QVTNMLPSL  218



>gb|AGO64661.1| receptor-like protein [Pyrus communis]
Length=1011

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 118/195 (61%), Gaps = 10/195 (5%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNTTTAHVVALHL  311
            NG   C E+ER+ALL FK  +       LS    +  DCC W GV CD+ T  H+  LHL
Sbjct  28   NGIPLCKESERQALLMFKQDLEDPTNRLLSWVAEEGSDCCSWTGVVCDHMT-GHIHELHL  86

Query  312  GRQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvyln  485
                   D + C    F G+I+PSLL L  L+FLDLS N F+  RIPSF GS+ +L +LN
Sbjct  87   NNSDFDWDCNSC----FSGKINPSLLSLKHLDFLDLSNNDFNGTRIPSFFGSMTSLTHLN  142

Query  486  lsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLH  665
            L+ + F G +P  LGN+S+L+YL++ ++FY   LKV + L+WIS LS L++L++  V+L 
Sbjct  143  LAPSSFHGVIPHKLGNLSSLRYLNL-SSFYDPNLKV-ENLQWISGLSLLKHLDLSYVNLS  200

Query  666  SVSDWLHSISKLSFL  710
              SDWL   + L  L
Sbjct  201  KASDWLQVTNMLPSL  215



>gb|AEQ27754.1| receptor-like protein [Malus sieversii]
Length=982

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 119/190 (63%), Gaps = 10/190 (5%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            C E+ER+ALL FK  +        S    +D DCC W GV CD+TT  H+  LHL     
Sbjct  37   CKESERQALLMFKQDLKDPANRLASWVAEEDSDCCSWTGVVCDHTT-GHIHELHLNN---  92

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynK  500
             TD    +   F G+I+PSLL L  LNFLDLS N F+  +IPSF GS+ +L +LNL+Y+ 
Sbjct  93   -TDSFLDFESSFGGKINPSLLSLKHLNFLDLSNNNFNGTQIPSFFGSMTSLKHLNLAYSV  151

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F G +P  LGN+S+L+YL++ ++FYG  LKV + ++WIS LS L++L++  V+L   SDW
Sbjct  152  FGGVIPHKLGNLSSLRYLNL-SSFYGSNLKV-ENIQWISGLSLLKHLDLSSVNLSKASDW  209

Query  681  LHSISKLSFL  710
            L   + L  L
Sbjct  210  LQVTNMLPSL  219



>gb|KCW64537.1| hypothetical protein EUGRSUZ_G02140, partial [Eucalyptus grandis]
Length=855

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 104/187 (56%), Gaps = 14/187 (7%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            SCF  ER+ALL FK  +I       S    D  CC+WKGV C +  T H+  L L  +  
Sbjct  33   SCFGTEREALLKFKQGLIDHSKRLSSWTSKD--CCEWKGVKC-SKKTGHIFKLDL--RNP  87

Query  327  CTDGSP-----CYNPG-FQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvyl  482
            C + SP     C +     G+I  SL  L  L +LDLS NKF   +IP F G+L  L YL
Sbjct  88   CFETSPNGYISCLDKSSLAGKIHASLAELKHLKYLDLSLNKFSKQKIPQFFGTLQRLEYL  147

Query  483  nlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDL  662
            NLS   F GN+P HLGN+S L+YLD+ + F G+     + L+W+S LSSL+Y ++  +DL
Sbjct  148  NLSSAGFDGNIPHHLGNLSNLQYLDLASRF-GEGSLTTNNLQWVSKLSSLKYFHLSSIDL  206

Query  663  HSVSDWL  683
                DW 
Sbjct  207  GKSKDWF  213



>gb|AAR28378.1| EIX receptor 2 [Solanum lycopersicum]
Length=1021

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 110/190 (58%), Gaps = 11/190 (6%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E ER ALL FK  +  D     +   +++ CC WKG+ CD   T HV+ L L  +  C
Sbjct  35   CIEKERGALLEFKRGLNDDFGRLSTWGDEEE-CCNWKGIECD-KRTGHVIVLDLHSEVTC  92

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynKF  503
              G  C+ P   G++SPSLL L +LNFLDLS N F+   IP FIGSL  L YLNLS + F
Sbjct  93   P-GHACFAPILTGKVSPSLLELEYLNFLDLSVNGFENSEIPRFIGSLKRLEYLNLSSSDF  151

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWL  683
             G +P    N+++L+ LD+GNN       +V  L W+SHLSSLE+L +   D  +  +W 
Sbjct  152  SGEIPAQFQNLTSLRILDLGNNNL-----IVKDLVWLSHLSSLEFLRLGGNDFQA-RNWF  205

Query  684  HSISKLSFLR  713
              I+K+  L+
Sbjct  206  REITKVPSLK  215



>ref|XP_008361472.1| PREDICTED: leucine-rich repeat receptor-like protein CLAVATA2 
isoform X1 [Malus domestica]
Length=1041

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 84/192 (44%), Positives = 116/192 (60%), Gaps = 11/192 (6%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            C E+ER+ALL FK  +        S    +D DCC W GV CD+ T  H+  LHL     
Sbjct  37   CKESERQALLMFKQDLKDPANRLASWVAEEDSDCCSWTGVVCDHIT-GHIHELHLNN---  92

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynK  500
             TD    +   F G+I+PSLL L  LN+LDLS+N F   +IPSF GS+ +L +LNL  +K
Sbjct  93   -TDRYFGFKSSFGGKINPSLLSLKHLNYLDLSYNNFSTTQIPSFFGSMTSLTHLNLGQSK  151

Query  501  FVGNVPPHLGNISTLKYLDIGN--NFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVS  674
            F G +P  LGN+S+L+YL++ +  NFY   L+ V+ L+WIS LS L++L++  V+L   S
Sbjct  152  FYGIIPHKLGNLSSLRYLNLNSSFNFYRSTLQ-VENLQWISGLSLLKHLDLSYVNLSKAS  210

Query  675  DWLHSISKLSFL  710
            DWL   + L  L
Sbjct  211  DWLQVTNMLPSL  222



>gb|KJB72455.1| hypothetical protein B456_011G179600 [Gossypium raimondii]
Length=727

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 116/208 (56%), Gaps = 22/208 (11%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNTTTAHVVALH  308
            N +  C E+ER+ALL FKH +        S        DCC+W GV CDN T AHV+ LH
Sbjct  16   NINEGCIESERQALLMFKHDVTDGANRLSSWSLHHGHGDCCQWDGVVCDNVT-AHVLELH  74

Query  309  LG--RQGLCTDGSPCYNPG-----FQGEIspsllhlpflnfldlsFNKFD--RIPSFIGs  461
            L   R  L   GS   N        +G+++PSLL+L  L++L+LS N F    IP FIG 
Sbjct  75   LANPRPLLDDYGSDAENEATERSKLRGKVNPSLLNLTHLSYLNLSQNGFGGIPIPEFIGC  134

Query  462  lnnlvylnlsynKFVGNVPPHLGNISTLKYL----DIGNNFYGQRLKVVDTLEWISHLSS  629
            + +L +L+L    F G VP  LGN+S+L+YL    DI +N Y         L+W+S LS 
Sbjct  135  IESLRHLDLPKAGFGGLVPNQLGNLSSLEYLNLRADIEDNLYAT------DLQWLSGLSL  188

Query  630  LEYLNMDCVDLHSVSDWLHSISKLSFLR  713
            +E+L++  VDL   S+WL  ++ L FL+
Sbjct  189  IEHLDLSDVDLAQASNWLQVLNTLPFLK  216



>ref|XP_009405133.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Musa acuminata subsp. malaccensis]
Length=972

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 115/194 (59%), Gaps = 14/194 (7%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            ++ C E ER ALL FK  ++  P S LSSW    DCC+W GV CDN T  HVV L+L   
Sbjct  35   TKGCVEGERDALLDFKTGLLGGPSSRLSSWRGRVDCCRWSGVVCDNRT-GHVVELNLNPD  93

Query  321  GLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsy  494
             L  + S        GEI PSLL L  L  L+LS N F   +IP F+GSL  L YL+LS+
Sbjct  94   YLNNETS------IGGEIRPSLLLLTHLERLNLSHNDFGGIQIPKFLGSLTELTYLDLSW  147

Query  495  nKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVS  674
            + F G +PP LGN+STL+ L++ N+ Y      +D L W+S L+SL YL+M  V L   S
Sbjct  148  SNFSGAIPPQLGNLSTLRSLNL-NSLYDL---TIDGLHWLSRLTSLRYLDMSGVKLSMAS  203

Query  675  -DWLHSISKLSFLR  713
             +WL +++ LS L 
Sbjct  204  HNWLQAVNMLSSLE  217



>ref|XP_009338728.1| PREDICTED: receptor-like protein 12 [Pyrus x bretschneideri]
Length=947

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 113/189 (60%), Gaps = 11/189 (6%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C ENER+ALL FK  +        S  G  + CC W GV CDN T  HV  LHL      
Sbjct  33   CKENERQALLLFKKDLDDPTHMLSSWGGASN-CCNWIGVACDNLT-GHVHELHLAGN---  87

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynKF  503
             D       G  G+++PSLL+L  L++L+LS N F+  +IPSF+GSL  L YL+LSY  F
Sbjct  88   YDQETGEEHGLGGKVNPSLLNLKHLSYLNLSHNNFEGLQIPSFLGSLKGLRYLDLSYAGF  147

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWL  683
             G +P  LGN+S+L+YLD+ +NF      +V+ L+W+S LS L++L+M  VDL + S WL
Sbjct  148  NGTIPHQLGNLSSLRYLDLSHNFG----SMVENLKWLSGLSLLKHLDMSSVDLTNASHWL  203

Query  684  HSISKLSFL  710
             S +  S L
Sbjct  204  QSNTLPSLL  212



>gb|AEQ27749.1| receptor-like protein [Malus micromalus]
Length=982

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 119/190 (63%), Gaps = 10/190 (5%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            C E+ER+ALL FK  +        S    +D DCC W GV CD+TT  H+  LHL     
Sbjct  37   CKESERQALLMFKQDLKDPANRLASWVAEEDSDCCSWTGVVCDHTT-GHIHELHLNN---  92

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynK  500
             TD    +   F G+I+PSLL L  LNFLDLS N F+  +IPSF GS+ +L +LNL+Y+ 
Sbjct  93   -TDSFLDFESSFGGKINPSLLSLKHLNFLDLSNNNFNGTQIPSFFGSMTSLKHLNLAYSV  151

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F G +P  LGN+S+L+YL++ ++FYG  LKV + ++WIS LS L++L++  V+L   SDW
Sbjct  152  FGGVIPHKLGNLSSLRYLNL-SSFYGSNLKV-ENIQWISGLSLLKHLDLSSVNLSKASDW  209

Query  681  LHSISKLSFL  710
            L   + L  L
Sbjct  210  LQVTNMLPSL  219



>ref|XP_008461894.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Cucumis melo]
Length=991

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 117/199 (59%), Gaps = 26/199 (13%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTA-HVVALH---  308
            S  C + +R+AL++F++ +        S  G +  CC+W+GVGC+NTT A   + LH   
Sbjct  29   SIECSKPDREALIAFRNGLNDPENRLESWKGPN--CCQWRGVGCENTTGAVTAIDLHNPY  86

Query  309  -LGRQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFDRI--PSFIGslnnlvy  479
             LG QG              GEISPSL  L  L +LDLS+N F+ I  P F GSL  L Y
Sbjct  87   PLGEQGFWN---------LSGEISPSLTKLKSLKYLDLSYNTFNDIPVPDFFGSLKKLQY  137

Query  480  lnlsynKFVGNVPPHLGNISTLKYLDIGN-NFYGQRLKVVDTLEWISHLSSLEYLNMDCV  656
            LNLS + F   +PP LGN+S+L+YLD+ N N       +VD+LEW+  L SL++L M+ V
Sbjct  138  LNLSNSGFGDMLPPSLGNMSSLQYLDMENLNL------IVDSLEWVGGLVSLKHLAMNSV  191

Query  657  DLHSV-SDWLHSISKLSFL  710
            DL SV SDW   ++KL +L
Sbjct  192  DLSSVKSDWFKILNKLRYL  210



>gb|KDO39729.1| hypothetical protein CISIN_1g044082mg, partial [Citrus sinensis]
Length=243

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 106/193 (55%), Gaps = 16/193 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNTTTAHVVALHLGRQG  323
            C E ER+ALL FK  ++ D     S  S     DCCKW GV C N T  HV+ L+L  + 
Sbjct  3    CIEKERQALLMFKQGLVDDCGYLSSWGSDEGRKDCCKWSGVQCSNRT-GHVIMLNLKYKV  61

Query  324  LCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsyn  497
                   C N   +G I+ SLL L  LN+LDLS N F  + IP FIG    L +L+LS  
Sbjct  62   ----DPVCPNRPLRGNINSSLLELQHLNYLDLSVNDFLGNPIPEFIGFFTKLRFLDLSLA  117

Query  498  KFVGNVPPHLGNISTLKYLDIG-NNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVS  674
             F G +P  LGN++ L+ L++G N+ Y      V    W+SHL+ L  L++D VDL   S
Sbjct  118  NFSGRIPYQLGNLTNLQSLNLGYNSLY------VSKFGWLSHLNKLTQLDLDFVDLSEAS  171

Query  675  DWLHSISKLSFLR  713
            DWL  I+ L+ LR
Sbjct  172  DWLQVITSLASLR  184



>ref|XP_010253421.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Nelumbo nucifera]
Length=1043

 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 112/189 (59%), Gaps = 20/189 (11%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            SC   ER+AL+ FK  +        S  G+D  CC W GVGCDNTT  HV+ L+L     
Sbjct  33   SCLRRERQALIKFKKGLHYHLSGVSSWVGED--CCAWFGVGCDNTT-GHVLKLNL-----  84

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF-DRIPSFIGslnnlvylnlsynKF  503
                   ++    GE++P LL L  LN+LDLS N F   IPSF+GS+ NL YLNLS + F
Sbjct  85   -------HSSELSGEVNPFLLDLKHLNYLDLSGNTFLGEIPSFLGSMKNLRYLNLSSSLF  137

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWL  683
             G VP HLGN+S+LK LD+G    G    ++D L+W+SHLSSL++L++       VS WL
Sbjct  138  SGVVPRHLGNLSSLKQLDLG----GNPNLIIDNLQWLSHLSSLQHLDLSTAMFQRVSGWL  193

Query  684  HSISKLSFL  710
            + I+ L  L
Sbjct  194  YIINMLPSL  202



>ref|XP_006600036.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2-like, partial [Glycine max]
Length=732

 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 110/190 (58%), Gaps = 15/190 (8%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            +C E ER ALLSFKH +        S     D CC W GV C+NT    V+ ++L     
Sbjct  33   TCSEKERNALLSFKHGLADPSNRLSSWSDKSD-CCTWPGVHCNNT--GKVMEINLDTPA-  88

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsynK  500
               GSP       GEISPSLL L +LN LDLS N F    IPSF+GSL +L YL+LS + 
Sbjct  89   ---GSPYRE--LSGEISPSLLELKYLNRLDLSSNYFVLTPIPSFLGSLESLRYLDLSLSG  143

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F+G +P  LGN+S L++L++G N+  Q    +D L WIS LSS EYL++   DLH   +W
Sbjct  144  FMGLIPHQLGNLSNLQHLNLGYNYALQ----IDNLNWISRLSSFEYLDLSGSDLHKKGNW  199

Query  681  LHSISKLSFL  710
            L  +S L  L
Sbjct  200  LQVLSALPSL  209



>ref|XP_004978847.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2-like [Setaria italica]
Length=964

 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 106/191 (55%), Gaps = 16/191 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C  +ER ALLS K            S    +DCC+WKGV C N T+ HVV L L      
Sbjct  38   CITSERDALLSLK--AGLSDPGGQLSSWQGEDCCQWKGVHCSNRTS-HVVKLDL------  88

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynKF  503
              GS  Y  G  GE++ SL+ L  L +LDLS N F+   IP FIGSL +L YLNLS   F
Sbjct  89   -HGS--YELG--GEMNSSLVGLQHLKYLDLSCNNFNGSSIPKFIGSLKSLEYLNLSKAGF  143

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWL  683
             G +PP LGN+S L YLD+  N+        D+L W+SHLS L+YL+M  + L +  DW+
Sbjct  144  GGTIPPQLGNLSKLVYLDLNLNYGRLGFLYSDSLTWVSHLSLLKYLDMSGLHLSAAVDWI  203

Query  684  HSISKLSFLRT  716
            H IS L  L  
Sbjct  204  HGISSLPSLEV  214



>gb|ACM89598.1| leucine-rich repeat protein [Glycine max]
Length=732

 Score = 88.6 bits (218),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 111/190 (58%), Gaps = 15/190 (8%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            +C E ER ALLSFKH +        S     D CC W GV C+NT    V+ ++L     
Sbjct  2    TCSEKERNALLSFKHGLADPSNRLSSWSDKSD-CCTWPGVHCNNT--GQVMEINLD----  54

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsynK  500
               GSP       GEISPSLL L +LN LDLS N F    IPSF+GSL +L YL+LS + 
Sbjct  55   TPVGSPYRE--LSGEISPSLLGLKYLNHLDLSSNYFVLTPIPSFLGSLKSLRYLDLSLSG  112

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F+G +P  LGN+S L++L++G N+  Q    +D L WIS LSSLEYL++   DLH   +W
Sbjct  113  FMGLIPHQLGNLSNLQHLNLGYNYALQ----IDNLNWISRLSSLEYLDLSGSDLHKQGNW  168

Query  681  LHSISKLSFL  710
            L  +S L  L
Sbjct  169  LQVLSALPSL  178



>gb|AEQ27756.1| receptor-like protein [Malus domestica]
Length=1041

 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 84/192 (44%), Positives = 115/192 (60%), Gaps = 11/192 (6%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            C E+ER+ALL FK  +        S    +D DCC W GV CD+ T  H+  LHL     
Sbjct  37   CKESERQALLMFKQDLKDPANRLASWVAEEDSDCCSWTGVVCDHIT-GHIHELHLNN---  92

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynK  500
             TD    +   F G I+PSLL L  LN+LDLS+N F   +IPSF GS+ +L +LNL  +K
Sbjct  93   -TDRYFGFKSSFGGRINPSLLSLKHLNYLDLSYNNFSTTQIPSFFGSMTSLTHLNLGQSK  151

Query  501  FVGNVPPHLGNISTLKYLDIGN--NFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVS  674
            F G +P  LGN+S+L+YL++ +  NFY   L+ V+ L+WIS LS L++L++  V+L   S
Sbjct  152  FYGIIPHKLGNLSSLRYLNLNSSFNFYRSTLQ-VENLQWISGLSLLKHLDLSYVNLSKAS  210

Query  675  DWLHSISKLSFL  710
            DWL   + L  L
Sbjct  211  DWLQVTNMLPSL  222



>ref|XP_009346363.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Pyrus x bretschneideri]
 ref|XP_009346364.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Pyrus x bretschneideri]
Length=921

 Score = 88.6 bits (218),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 109/182 (60%), Gaps = 14/182 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHL-GRQGL  326
            C ENER+ LL FK  +        S  G+ D CC W GV C N T  HV  LHL G Q  
Sbjct  33   CNENERQTLLMFKKDLNDSSNMLSSWDGEGD-CCNWTGVACSNLT-GHVRELHLAGYQ--  88

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynK  500
              D     N G  G+++PSLL+L  L+ LDLSFN F+  +IPSF+GSL  L YL+LS   
Sbjct  89   --DEVTGENRGLGGKVNPSLLNLKHLSHLDLSFNNFEGLQIPSFLGSLKRLRYLDLSGAG  146

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F G +P  LGN+S+L+YLD+  N     L +V+ LEW+S LS L++L+M  VDL + S W
Sbjct  147  FNGTIPHQLGNLSSLRYLDLSYN-----LLMVENLEWLSGLSLLKHLDMSRVDLTNASRW  201

Query  681  LH  686
            L 
Sbjct  202  LQ  203



>emb|CBI22735.3| unnamed protein product [Vitis vinifera]
Length=627

 Score = 88.2 bits (217),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 112/184 (61%), Gaps = 11/184 (6%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E E+ ALL FK ++ +      S   + D CC+W+ V C+N T   VV LHLG     
Sbjct  31   CNEKEKHALLRFKKALSNPGNRLSSWSVNQD-CCRWEAVRCNNVT-GRVVELHLGNP-YD  87

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsynKF  503
             D    Y  G  GEISP+LL L FL++L+LS+N F    IPSF+GS+ +L YL+L+   F
Sbjct  88   ADDYEFYRLG--GEISPALLELEFLSYLNLSWNDFGGSPIPSFLGSMGSLRYLDLTSVGF  145

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWL  683
             G VP  LGN+STL++LD+G   Y   L  V+ L WISHL+ L+YL M+ VDLH    WL
Sbjct  146  GGLVPHQLGNLSTLRHLDLG---YNNGL-YVENLGWISHLAFLKYLGMNGVDLHREVHWL  201

Query  684  HSIS  695
             S+S
Sbjct  202  ESVS  205



>ref|XP_009389805.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
RCH1 [Musa acuminata subsp. malaccensis]
Length=795

 Score = 88.6 bits (218),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 85/203 (42%), Positives = 110/203 (54%), Gaps = 17/203 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHL-GRQGL  326
            C E ER+AL+ FK  +        S  G+D  CC W+G+ C N T  HV+ LHL  R   
Sbjct  32   CQETERRALMEFKQRVRDPSHILSSWVGED--CCSWEGIRCSNDT-GHVIELHLRNRHRS  88

Query  327  CTDGSPCYNPGFQ-----------GEIspsllhlpflnfldlsFNKFD--RIPSFIGsln  467
                  C    F            G I+PSLL L  LN LDLS N F+  RIP F+GS  
Sbjct  89   DVSYMGCSETNFDDDDVGCRWALHGGITPSLLSLQHLNHLDLSGNNFEGNRIPEFLGSFG  148

Query  468  nlvylnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNM  647
             L YLNLS   F G VP  LGN+STL  LD+  NFY      ++ + WIS L+SL++LNM
Sbjct  149  RLTYLNLSGAGFGGKVPDQLGNLSTLHQLDLSYNFYLDDDLYIENIGWISRLTSLQHLNM  208

Query  648  DCVDLHSVSDWLHSISKLSFLRT  716
            + V   +VSDWL +++ LS ++ 
Sbjct  209  NQVRFRNVSDWLQALNALSRIQV  231



>ref|XP_008222139.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Prunus mume]
Length=647

 Score = 88.2 bits (217),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 111/195 (57%), Gaps = 14/195 (7%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E ERKALLSFK  +        S  G D  CC+W+G+ C+N T +HV  + L      
Sbjct  7    CIEEERKALLSFKQDLNDMSGRLSSWVGHD--CCRWEGISCNNRT-SHVAEMDLRNTYDK  63

Query  330  T------DGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvyln  485
            +      D          G+I+PSLL L  L++LDLS N F+  +IP F G L +L YLN
Sbjct  64   STTVEEWDELAYSQSRLGGKINPSLLSLKHLHYLDLSLNNFEGIQIPKFFGELKSLRYLN  123

Query  486  lsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLH  665
            +S+ +F G +P  LGN+S L YLD+G   +         L W+SHLSSL+YLN++ VDL 
Sbjct  124  ISFAEFTGEIPSSLGNLSNLNYLDVG---FSSSKIYSKNLNWLSHLSSLKYLNLNEVDLS  180

Query  666  SVSDWLHSISKLSFL  710
            S + WLH+++ L  L
Sbjct  181  SSTGWLHAVNMLPSL  195



>ref|XP_004296198.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Fragaria vesca subsp. vesca]
Length=987

 Score = 88.6 bits (218),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 77/193 (40%), Positives = 116/193 (60%), Gaps = 9/193 (5%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNTTTAHVVALHLGRQG  323
            C E ER+ALL+ K  ++ +     S  +   + DCC W+GV CD+ T  HV  LHLG + 
Sbjct  34   CVEREREALLAIKQDLVINSTRLSSWGAEAINQDCCAWEGVYCDHLT-GHVDQLHLGGEV  92

Query  324  LCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFDR--IPSFIGslnnlvylnlsyn  497
            L + G       F+G +SP L+ L  L ++DLS N      IP FIGSL+++ YL+LS  
Sbjct  93   LSSQGELLDYIPFKGTLSPKLIELQQLVYIDLSSNMLQPSPIPGFIGSLSHMRYLDLSEA  152

Query  498  KFVGNVPPH-LGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVS  674
             FVG +P H LGN++ L+YLD+ ++ +      ++   W+ HLSSL+YL++  V+L +V 
Sbjct  153  GFVGEIPYHELGNLTHLQYLDLSSSDFTNS---IEFFSWLPHLSSLKYLDLSFVNLSNVF  209

Query  675  DWLHSISKLSFLR  713
            DW  +++KL  LR
Sbjct  210  DWPETVNKLHNLR  222



>ref|XP_010266617.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Nelumbo nucifera]
Length=1000

 Score = 88.2 bits (217),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 112/191 (59%), Gaps = 9/191 (5%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E ER ALL FK ++        S  G+D  CC W+G+ C+N T   VV L LG    C
Sbjct  41   CMEMERAALLDFKENLTDRCGDLSSWVGND--CCSWRGIRCNNRT-GRVVQLDLGDP--C  95

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynKF  503
             DGS   +    GE    LL+L  LN+LDLS N F    IP+FIGS   L YLNLSY +F
Sbjct  96   QDGSWGLS-SLVGEPLNPLLNLEHLNYLDLSTNNFGGIPIPNFIGSFKKLRYLNLSYAQF  154

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSV-SDW  680
             G +P HLGN+S L++LD+    +      V+ L+W+  +SSLEYLNM  VD+  + ++W
Sbjct  155  SGTIPSHLGNLSNLRHLDLSTRLFPFYKLNVNCLDWLLGMSSLEYLNMGSVDMSKLGTNW  214

Query  681  LHSISKLSFLR  713
            L SI+KL  L+
Sbjct  215  LQSINKLGSLK  225



>ref|XP_002318355.2| hypothetical protein POPTR_0012s01080g [Populus trichocarpa]
 gb|EEE96575.2| hypothetical protein POPTR_0012s01080g [Populus trichocarpa]
Length=822

 Score = 88.2 bits (217),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 112/194 (58%), Gaps = 18/194 (9%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNTTTAHVVALHLGRQG  323
            C E ER+ALL FK  +I D     S     +  DCCKW GVGCDN T  HV  L L    
Sbjct  33   CIERERRALLQFKEDLIDDYGVLSSWGGKEEKRDCCKWIGVGCDNIT-GHVTLLDL----  87

Query  324  LCTDGSPCYNPGFQ---GEIspsllhlpflnfldlsFNKFDR-IPSFIGslnnlvylnls  491
                 SP Y   F    G++S SLL L +LN+LDLS N FD  I  FIGSL +L YLNLS
Sbjct  88   ---HSSPVYEDRFTPLIGKVSDSLLELQYLNYLDLSLNNFDESIMDFIGSLTSLRYLNLS  144

Query  492  ynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSV  671
            YN F   +P  LGN+S L+ LD+  +F G     V+ L+W+SHLSSLE L +   +L  V
Sbjct  145  YNFFTVTIPYQLGNLSRLQSLDLSYSFDGS----VENLDWLSHLSSLERLYLSGSNLSKV  200

Query  672  SDWLHSISKLSFLR  713
            +DWL  I+ L  L+
Sbjct  201  NDWLQVITNLPHLK  214



>ref|XP_002273399.2| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Vitis vinifera]
 ref|XP_010655701.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Vitis vinifera]
Length=1007

 Score = 88.2 bits (217),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 115/197 (58%), Gaps = 18/197 (9%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            ++ C E ERKALL FK+ +        S  G D  CCKWKGV C+N T  HVV + L   
Sbjct  38   NKGCIEVERKALLEFKNGLKDPSGRLSSWVGAD--CCKWKGVDCNNQT-GHVVKVDLKSG  94

Query  321  GLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsy  494
            G  +           GEIS SLL L  LN+LDLSFN F    IP+F+GS   L YL+LSY
Sbjct  95   GDFSR--------LGGEISDSLLDLKHLNYLDLSFNDFQGIPIPNFLGSFERLRYLDLSY  146

Query  495  nKFVGNVPPHLGNISTLKYLDI-GNNFY---GQRLKVVDTLEWISHLSSLEYLNMDCVDL  662
              F G +PPHLGN+S L YL++ G ++Y      L  V  L W+S LSSL+YL+M  V+L
Sbjct  147  AAFGGMIPPHLGNLSQLCYLNLSGGDYYYNFSAPLMRVHNLNWLSGLSSLKYLDMGHVNL  206

Query  663  -HSVSDWLHSISKLSFL  710
              + ++W+ + + L FL
Sbjct  207  SKATTNWMQAANMLPFL  223



>ref|XP_008382520.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Malus domestica]
Length=963

 Score = 88.2 bits (217),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 106/190 (56%), Gaps = 16/190 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C   E+ ALL FK  +    + +    G +  CC+W+G+ C+N T  HVV L L      
Sbjct  30   CLRTEKTALLQFKQGLEKSNVLASWETGKN--CCEWRGITCNNKT-GHVVTLDLNY----  82

Query  330  TDGSPCYN--PGFQGEIspsllhlpflnfldlsFNKFD-RIPSFIGslnnlvylnlsynK  500
             + S  YN      G I+PSLL LP+L +LDLSFN F  +IP FIGSL+ L  L L+   
Sbjct  83   -NSSDIYNVETPLSGVIAPSLLELPYLTYLDLSFNHFQGQIPKFIGSLSRLEQLKLAGAN  141

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
              G +PP LGN+S+L  LD+  N+        + LEW+SHLSSL YL M  ++   V +W
Sbjct  142  LSGPIPPQLGNLSSLHTLDLSLNYV-----TFENLEWLSHLSSLRYLYMSSLNFSEVVNW  196

Query  681  LHSISKLSFL  710
              SISKL  L
Sbjct  197  PESISKLPSL  206



>gb|ACJ03067.1| AL07-2p [Malus floribunda]
Length=1041

 Score = 88.2 bits (217),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 84/192 (44%), Positives = 117/192 (61%), Gaps = 11/192 (6%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            C E+ER+ALL FK  +        S    +D DCC W GV CD+ T  H+  LHL     
Sbjct  37   CKESERQALLMFKQDLKDPANRLASWVAEEDSDCCSWTGVVCDHIT-GHIHELHLNN---  92

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsynK  500
             TD    +   F G+I+PSLL L  LN+LDLS+N F   +IPSF GS+ +L +LNL ++K
Sbjct  93   -TDRYFGFKSSFGGKINPSLLSLKHLNYLDLSYNNFRTTQIPSFFGSMTSLTHLNLGHSK  151

Query  501  FVGNVPPHLGNISTLKYLDIGN--NFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVS  674
            F G +P  LGN+S+L+YL++ +  NFY   L+ V+ L+WIS LS L++L++  V+L   S
Sbjct  152  FYGIIPHKLGNLSSLRYLNLNSSYNFYRSTLQ-VENLQWISGLSLLKHLDLSWVNLSKAS  210

Query  675  DWLHSISKLSFL  710
            DWL   + L  L
Sbjct  211  DWLQVTNMLPSL  222



>ref|XP_009387594.1| PREDICTED: leucine-rich repeat receptor-like protein CLAVATA2, 
partial [Musa acuminata subsp. malaccensis]
Length=348

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 103/191 (54%), Gaps = 12/191 (6%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            CF  ER+ALL FK         +  S     DCC W+GV C   TT HVV L L    + 
Sbjct  29   CFSMEREALLDFK--AGIHDTHNRLSSWVGQDCCAWEGVIC-GATTGHVVMLDLRNTNIT  85

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynKF  503
             D    +    +G ++ SLL L  L  LDLSFN F   RIP FIGS   L YLNLS  +F
Sbjct  86   DD----WALRGEGMMNSSLLALSHLKHLDLSFNDFSGIRIPEFIGSFKKLRYLNLSSTRF  141

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWL  683
            +G +P  LGN+S+L  LD+    Y      +D L+W+SHL+SL+ L++  ++L    DW 
Sbjct  142  MGGIPARLGNLSSLYVLDLS---YALHFSSLDNLDWLSHLTSLKNLDLSWLNLTGAPDWF  198

Query  684  HSISKLSFLRT  716
             S++ L  L+ 
Sbjct  199  SSVNMLPSLQV  209



>gb|KDO56170.1| hypothetical protein CISIN_1g040379mg, partial [Citrus sinensis]
Length=373

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 108/185 (58%), Gaps = 16/185 (9%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNTTTAHVVALHLGRQG  323
            C + ER+ALL+FK S++ +     S     +  DCCKW GVGC N T  HV+ L +  Q 
Sbjct  33   CIDEEREALLTFKESLVDESGVLSSWGPEDEKRDCCKWTGVGCSNRT-GHVIKLEI--QP  89

Query  324  LCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsyn  497
            +  D  P      +G ISP+LL L  L +LDLS N F    IP FIGSL  L YL+LS+ 
Sbjct  90   IDFDSFP-----LRGTISPALLQLHRLTYLDLSLNNFSGSPIPEFIGSLTKLSYLDLSFA  144

Query  498  KFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSD  677
            +F G +P HLGN+S L++LD+  N     L     L+W+SHLSSL YL++   +L   +D
Sbjct  145  EFEGPIPSHLGNLSALQHLDLSLN----HLFSAGNLDWLSHLSSLTYLDLGSNNLSRSTD  200

Query  678  WLHSI  692
            WL  +
Sbjct  201  WLQVV  205



>ref|XP_006600054.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like [Glycine max]
Length=811

 Score = 87.8 bits (216),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 110/190 (58%), Gaps = 15/190 (8%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            +C E ER ALLSFKH +        S     D CC W GV C+NT    V+ ++L     
Sbjct  33   TCSEKERNALLSFKHGLADPSNRLSSWSDKSD-CCTWPGVHCNNT--GQVMEINLD----  85

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsynK  500
               GSP       GEISPSLL L +LN LDLS N F    IPSF+GSL +L YL+LS + 
Sbjct  86   TPVGSPYRE--LSGEISPSLLGLKYLNHLDLSSNYFVLTPIPSFLGSLESLRYLDLSLSG  143

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F+G +P  LGN+S L++L++G N+  Q    +D L WIS LSSLEYL++   DLH    W
Sbjct  144  FMGLIPHQLGNLSNLQHLNLGYNYALQ----IDNLNWISRLSSLEYLDLSGSDLHKQGKW  199

Query  681  LHSISKLSFL  710
            L  +S L  L
Sbjct  200  LQVLSALPSL  209



>ref|XP_007226165.1| hypothetical protein PRUPE_ppa015243mg [Prunus persica]
 gb|EMJ27364.1| hypothetical protein PRUPE_ppa015243mg [Prunus persica]
Length=892

 Score = 87.8 bits (216),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 114/196 (58%), Gaps = 16/196 (8%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            N S  C +NER+ALL FKH +        S  G  D CC W GV CDN T  HV  LHL 
Sbjct  25   NLSAPCKQNERQALLMFKHDLEDPSNRLSSWVGKGD-CCNWTGVVCDNLT-VHVRELHLA  82

Query  315  RQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnl  488
                       +     G+I+ SLL+L  L +LDLS N F   +IPSF+GSL +L YLNL
Sbjct  83   G----------HVDMLSGKINQSLLNLKHLTYLDLSNNDFQGMQIPSFLGSLKSLRYLNL  132

Query  489  synKFVGNVPPHLGNISTLKYLDIGNNFYGQ--RLKVVDTLEWISHLSSLEYLNMDCVDL  662
            S++ FVG +P  LGN+++L+ LD+GN  Y +   L  V++L+WIS LS L++L+M   +L
Sbjct  133  SHSWFVGLIPHQLGNLTSLQVLDLGNPPYSEIYSLLEVESLQWISGLSQLQHLDMSGANL  192

Query  663  HSVSDWLHSISKLSFL  710
               SDWL   + L  L
Sbjct  193  SKASDWLRVTNTLPSL  208



>ref|XP_007045500.1| Serine-threonine protein kinase, plant-type, putative [Theobroma 
cacao]
 gb|EOY01332.1| Serine-threonine protein kinase, plant-type, putative [Theobroma 
cacao]
Length=990

 Score = 87.8 bits (216),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 120/205 (59%), Gaps = 16/205 (8%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            N S+S  E E+KALL FK  +        S  G+D  CCKW GVGC N  T  V  L L 
Sbjct  39   NFSKSWSEIEKKALLKFKEDLTDPSDRLSSWIGED--CCKWSGVGC-NKKTGRVTKLDLR  95

Query  315  R---QGLCTDGSP--CYNPGFQGEIspsllhlpflnfldlsFNKFDR--IPSFIGslnnl  473
                Q    D SP   ++    G+++PSLL L +L++LDLS N F+   IP  IGSL  L
Sbjct  96   NPYDQIFFQDFSPLPTFDSRLGGKLNPSLLELKYLDYLDLSLNNFENNSIPKLIGSLKKL  155

Query  474  vylnlsynKFVGNVPPHLGNISTLKYLDI----GNNFYGQRLKVVDTLEWISHLSSLEYL  641
             YLNLS + FVG +PPHLGN+S L++LD+    G ++Y   + V D L WIS +SSL+YL
Sbjct  156  TYLNLSLSSFVGLIPPHLGNLSNLRFLDLQASSGFDYYPPNIWVSD-LNWISKISSLKYL  214

Query  642  NMDCVDLHSVS-DWLHSISKLSFLR  713
            N+  V+L   S  WL +++KL  L 
Sbjct  215  NLGYVNLSLASTSWLQAVNKLPSLE  239



>ref|XP_002437796.1| hypothetical protein SORBIDRAFT_10g002735 [Sorghum bicolor]
 gb|EER89163.1| hypothetical protein SORBIDRAFT_10g002735, partial [Sorghum bicolor]
Length=957

 Score = 87.8 bits (216),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 103/194 (53%), Gaps = 16/194 (8%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            + SC   ER ALL+FK                  DCC W GV C N T  HV+ L + + 
Sbjct  26   ASSCIPEERDALLAFK--AGVADPGDKLRSWQHQDCCNWNGVACSNKTL-HVIRLDVSQY  82

Query  321  GLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsy  494
            GL            +GEI+ SL  L  L +LDLS N F    IP F+GS   L YL+LS 
Sbjct  83   GLKG----------EGEINSSLAALTRLAYLDLSDNNFGGLAIPEFVGSFKKLRYLDLSR  132

Query  495  nKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVS  674
              F G VPP LGN+STL+++D+ N+F       +D+  W+S L+ L YL++  V L + S
Sbjct  133  AYFGGKVPPQLGNLSTLEHIDL-NSFGSSPTIRLDSFLWVSRLTLLTYLDLGWVYLATSS  191

Query  675  DWLHSISKLSFLRT  716
            DWL ++SKL  L+ 
Sbjct  192  DWLQALSKLPSLKV  205



>gb|EMT21339.1| DNA-damage-repair/toleration protein [Aegilops tauschii]
Length=274

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 110/191 (58%), Gaps = 12/191 (6%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C  +ER AL+ FK        ++L S    DDCCKWKGV C ++   HVV L L   G C
Sbjct  52   CIAHERSALVGFK--AGLLDPANLLSSWKGDDCCKWKGVYC-SSRNNHVVKLDLPGHG-C  107

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynKF  503
                        G IS SLL L  L +L+LS N FD  +IP FIGSL+ L Y++LS + F
Sbjct  108  DHNDDTMTQVLGGNISSSLLGLQQLKYLNLSCNGFDGVQIPKFIGSLHKLRYIDLSMSMF  167

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWL  683
             G +PP LGN+S+L+YL++ +N Y       + + W+S L+SLE+L++  VDL +V  WL
Sbjct  168  TGRIPPQLGNLSSLRYLNLASNTYS------NGITWLSRLTSLEHLDLTFVDLSTVVHWL  221

Query  684  HSISKLSFLRT  716
              ++ L  L+ 
Sbjct  222  PVMNMLPSLKV  232



>gb|AEQ27753.1| receptor-like protein [Malus micromalus]
Length=982

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 85/190 (45%), Positives = 118/190 (62%), Gaps = 10/190 (5%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            C E+ER+ALL FK  +        S    +D DCC W GV CD+TT  H+  LHL     
Sbjct  37   CKESERQALLMFKQDLKDPANRLASWVAEEDSDCCSWTGVVCDHTT-GHIHELHLNN---  92

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynK  500
             TD    +   F G+I+PSLL L  LNFLDLS N F+  +IPSF GS+ +L +LNL+Y+ 
Sbjct  93   -TDSFLDFESSFGGKINPSLLSLKHLNFLDLSNNNFNGAQIPSFFGSMTSLKHLNLAYSV  151

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F G +P  LGN+S+L+YL++ ++FYG  LKV + ++WIS L  L++L++  V+L   SDW
Sbjct  152  FGGVIPHKLGNLSSLRYLNL-SSFYGSNLKV-ENIQWISGLPLLKHLDLSSVNLSKASDW  209

Query  681  LHSISKLSFL  710
            L   + L  L
Sbjct  210  LQVTNMLPSL  219



>ref|XP_002273469.1| PREDICTED: receptor-like protein 12 [Vitis vinifera]
Length=994

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 114/194 (59%), Gaps = 14/194 (7%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            +  + ER ALL FK  +        S  G+D  CCKW+GV C+N +  HV+ L+L  + L
Sbjct  39   ASIDTERVALLKFKQGLTDPSHRLSSWVGED--CCKWRGVVCNNRS-GHVIKLNL--RSL  93

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynK  500
              DG+   +    GEIS SLL L +LN LDLS N F+  RIP FIGSL  L YLNLS   
Sbjct  94   DDDGT---DGKLGGEISLSLLDLKYLNHLDLSMNNFEGTRIPKFIGSLERLRYLNLSCAS  150

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRL---KVVDTLEWISHLSSLEYLNMDCVDLHSV  671
            F G +PP LGN+S L YLD+   F   R       + L+WIS LSSL +LN++ V+L   
Sbjct  151  FSGPIPPQLGNLSRLIYLDLKEYFDFNRYPDESSQNNLQWISGLSSLRHLNLEGVNLSRA  210

Query  672  SD-WLHSISKLSFL  710
            S  WLH++SKL  L
Sbjct  211  SAYWLHAVSKLPSL  224



>ref|XP_009389804.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PEPR1 
[Musa acuminata subsp. malaccensis]
Length=998

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 85/203 (42%), Positives = 109/203 (54%), Gaps = 17/203 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHL-GRQGL  326
            C E ERKAL+ FK  +        S  G+D  CC W+G+ C N T  HV+ LHL  R   
Sbjct  4    CQETERKALMEFKQRVRDPSHRLSSWVGED--CCSWEGIRCSNVT-GHVIELHLRNRHRS  60

Query  327  CTDGSPCYNPGFQ-----------GEIspsllhlpflnfldlsFNKFD--RIPSFIGsln  467
                  C    F            G I+PSLL L  LN LDLS N F+  RIP F+GS  
Sbjct  61   DVSYMDCSETNFDDDDVGCRWALHGGITPSLLSLQHLNHLDLSGNNFEGNRIPEFLGSFR  120

Query  468  nlvylnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNM  647
             L YLNLS   F G VP  LGNISTL  LD+  NFY      ++ + WIS L+SL++L M
Sbjct  121  RLTYLNLSSAGFGGRVPDQLGNISTLHQLDLSYNFYSNYDLHIENIGWISRLTSLQHLYM  180

Query  648  DCVDLHSVSDWLHSISKLSFLRT  716
            + V   +VS+WL +++ LS ++ 
Sbjct  181  NWVSFRNVSNWLQALNTLSRIQV  203



>gb|KJB45928.1| hypothetical protein B456_007G338700 [Gossypium raimondii]
Length=1028

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 82/201 (41%), Positives = 112/201 (56%), Gaps = 16/201 (8%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            N +  C ++ER+ALL FK+ +        S     D CC+W GV C N+T  HV  LHL 
Sbjct  32   NSNLLCIQSEREALLKFKNHLFDPSNRLSSWVEGGD-CCEWTGVVCHNST-GHVNQLHLA  89

Query  315  RQGLCTDG-------SPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGsln  467
                  D           +N    G+I+PSLL L  L+ LDLS+N F    IP F G L 
Sbjct  90   APLSVPDAFATNAEWEAYHNSLLGGKINPSLLELKHLSSLDLSYNIFSSIHIPKFFGLLE  149

Query  468  nlvylnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNM  647
            +L YLNLS ++F G +P +LGN+S L+YLD+G N    +     TL+W+S LSSL+YL++
Sbjct  150  SLTYLNLSRSQFQGAIPHNLGNLSKLQYLDLGGNDLKSK-----TLQWVSGLSSLQYLDL  204

Query  648  DCVDLHSVSDWLHSISKLSFL  710
               DLH+ +DW+    KL  L
Sbjct  205  SYADLHTANDWVQVTLKLPSL  225



>ref|XP_006490685.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like [Citrus sinensis]
Length=959

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 109/185 (59%), Gaps = 16/185 (9%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNTTTAHVVALHLGRQG  323
            C + ER+ALL+FK S++ +     S     +  DCCKW GVGC N T  HV+ L +  Q 
Sbjct  33   CIDEEREALLTFKESLVDESGVLSSWGPEDEKRDCCKWTGVGCSNRT-GHVIKLEI--QP  89

Query  324  LCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsyn  497
            +  D  P      +G ISP+LL L  L +LDLS N F    IP FIGSL  L YL+LS+ 
Sbjct  90   IDFDSFP-----LRGTISPALLQLHRLTYLDLSLNNFSGSPIPEFIGSLTKLSYLDLSFA  144

Query  498  KFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSD  677
            +F G +P HLGN+S L++LD+  N     L  V  L+W+SHLSSL YL++   +L   +D
Sbjct  145  EFEGPIPSHLGNLSALQHLDLSLN----HLFSVGNLDWLSHLSSLTYLDLGSNNLSRSTD  200

Query  678  WLHSI  692
            WL  +
Sbjct  201  WLQVV  205



>gb|EAY74833.1| hypothetical protein OsI_02725 [Oryza sativa Indica Group]
Length=953

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 115/196 (59%), Gaps = 9/196 (5%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            N +  C  +ER AL+SFK  ++       S  GDD  C +W GV C+N T  H+V L+L 
Sbjct  31   NSTGGCIPSERSALISFKSGLLDPGNLLSSWEGDD--CFQWNGVWCNNET-GHIVELNL-  86

Query  315  RQGLCTDGSP--CYNPGFQGEIspsllhlpflnfldlsFNKFD-RIPSFIGslnnlvyln  485
              G C    P     PG  G I PSLL L  L  LDLS N F   +P F+GSL+NL  L+
Sbjct  87   PGGSCNILPPWVPLEPGLGGSIGPSLLGLKQLEHLDLSCNNFSGTLPEFLGSLHNLRSLD  146

Query  486  lsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLH  665
            LS++ FVG VPP LGN+S L+Y  +G+N     L   D + W+S LSSLE+L+M  V+L 
Sbjct  147  LSWSTFVGTVPPQLGNLSNLRYFSLGSN-DNSSLYSTD-VSWLSRLSSLEHLDMSLVNLS  204

Query  666  SVSDWLHSISKLSFLR  713
            +V DW+  ++KL  LR
Sbjct  205  AVVDWVSVVNKLPSLR  220



>ref|XP_010910868.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Elaeis guineensis]
Length=383

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 107/195 (55%), Gaps = 15/195 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C   ER ALL FK  +        S  GDD  CC WKGV CDN T  HVV L L R   C
Sbjct  31   CIPIERNALLGFKEGLKDPSNRLSSWVGDD--CCTWKGVACDNQT-GHVVKLDL-RNPSC  86

Query  330  TDGSPCYNPG-FQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynK  500
             +  P  N     GE+ PSLL L +LN+LDLS N F   RIP F+GS   L YLNLS   
Sbjct  87   FEYYPPNNTWCLGGELRPSLLGLKYLNYLDLSMNNFGGIRIPEFMGSFRQLKYLNLSRAY  146

Query  501  FVGNVPPHLGNISTLKYLDIGNNFY--GQRLKV------VDTLEWISHLSSLEYLNMDCV  656
              G +P  LGN+S+L+YLD+ +N+Y  G   KV      +D   WIS LSSL YLNM  V
Sbjct  147  MRGLIPYQLGNLSSLQYLDLSHNYYYYGDNFKVSYGFLIIDNAIWISRLSSLRYLNMMDV  206

Query  657  DLHSVSDWLHSISKL  701
                 + WL +++ L
Sbjct  207  QFREGAHWLQALNML  221



>ref|XP_009388094.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 [Musa acuminata subsp. malaccensis]
Length=209

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 103/189 (54%), Gaps = 18/189 (10%)
 Frame = +3

Query  162  ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLCTDGS  341
            ER+ALL FK         +  S     DCC W+GV C   TT HVV L L          
Sbjct  2    EREALLDFK--AGIHDTHNRLSSWVGQDCCAWEGVIC-GATTGHVVMLDLRNT-------  51

Query  342  PCYNPGFQGE--IspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynKFVG  509
              ++   +GE  ++ SLL L  L  LDLSFN F   RIP FIGS   L YLNLS   F+G
Sbjct  52   --FDRALRGERMMNSSLLALSHLEHLDLSFNNFSGIRIPEFIGSFKKLRYLNLSSTNFMG  109

Query  510  NVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWLHS  689
             +P  LGN+S+L  LD+    +   L  VD L+W+SHL+SL+YLN+  ++L  V DW  S
Sbjct  110  GIPARLGNLSSLYVLDLSVALHFTSL--VDNLDWLSHLTSLKYLNLSGLNLTDVPDWFSS  167

Query  690  ISKLSFLRT  716
            ++ L  L+ 
Sbjct  168  VNMLPSLQV  176



>ref|XP_011470503.1| PREDICTED: receptor-like protein 12 [Fragaria vesca subsp. vesca]
Length=264

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 115/192 (60%), Gaps = 8/192 (4%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslss-wgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            C E ER+ALL+ K  ++    S LSS      DCCKW+GV CD+ T  HV+ LHLG   L
Sbjct  34   CVEREREALLAIKQDLLVVNSSRLSSWGTAAKDCCKWEGVLCDHLT-GHVIQLHLGGWVL  92

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFN--KFDRIPSFIGslnnlvylnlsynK  500
             + G       F+G++S  L+ L  L ++DLS N  +   IP FIGSL NL YL+L  + 
Sbjct  93   SSQGEFEDYIPFEGKLSSKLIELQQLEYIDLSSNYLRPSPIPGFIGSLFNLRYLDLFSSG  152

Query  501  FVGNVP-PHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSD  677
            F G +P   LGN++ L+YLD+ ++ +      ++   W+ HLSSL+YL++  V+L +V D
Sbjct  153  FDGEIPYRELGNLTHLQYLDLSSSDFT---NAIEFFSWLPHLSSLKYLDLSFVNLSNVFD  209

Query  678  WLHSISKLSFLR  713
            W  ++++L  LR
Sbjct  210  WPDTLNRLPNLR  221



>emb|CBI22733.3| unnamed protein product [Vitis vinifera]
Length=558

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 113/191 (59%), Gaps = 12/191 (6%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E E+ ALL FK S+       L    + D CC+W+ V C+N T   VV LHLG     
Sbjct  55   CNEKEKHALLRFKKSLSDPGNRLLPWSVNQD-CCRWEAVRCNNVT-GRVVELHLGNPYDT  112

Query  330  TDGSPCYNPGFQ--GEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsyn  497
             D    +N  F+  GEISP+LL L FL++L+LS N F    IPSF+GS+ +L YL+LSY 
Sbjct  113  DDLE--FNSKFELGGEISPALLELEFLSYLNLSGNDFGGSPIPSFLGSMGSLRYLDLSYA  170

Query  498  KFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSD  677
             F G V   LGN+STL++LD+G    G     V+ L WISHL+ L+YL MD VDLH    
Sbjct  171  GFGGLVLHQLGNLSTLRHLDLG----GNSGLYVENLGWISHLAFLKYLGMDWVDLHREVH  226

Query  678  WLHSISKLSFL  710
            WL S+S L  L
Sbjct  227  WLESVSMLPSL  237



>ref|XP_009375609.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Pyrus x bretschneideri]
Length=961

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 105/193 (54%), Gaps = 15/193 (8%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            S  C   E+ ALL FK  +I       S     D CC+W+G+ C+N T  HVV L L   
Sbjct  27   SIGCLRTEKTALLQFKQGLIDKSNVLASWETGKD-CCEWRGITCNNKT-GHVVMLDL---  81

Query  321  GLCTDGSPCYNP--GFQGEIspsllhlpflnfldlsFNKFD-RIPSFIGslnnlvylnls  491
                + S  YN      G I+PSLL LP+L +LDLSFN F  +IP FIGSL+ L  L L 
Sbjct  82   --YYNSSDIYNAETPLSGVIAPSLLELPYLTYLDLSFNNFQGQIPKFIGSLSRLEQLKLP  139

Query  492  ynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSV  671
                 G +PP LGN+S+L  LD+  N+        + LEW+SHLSSL YLNM  ++    
Sbjct  140  GANLSGPIPPQLGNLSSLYTLDLAWNYV-----TFENLEWLSHLSSLRYLNMSRLNFSKF  194

Query  672  SDWLHSISKLSFL  710
             +W  SISKL  L
Sbjct  195  VNWPESISKLPSL  207



>ref|XP_007220752.1| hypothetical protein PRUPE_ppa025491mg [Prunus persica]
 gb|EMJ21951.1| hypothetical protein PRUPE_ppa025491mg [Prunus persica]
Length=859

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 110/191 (58%), Gaps = 13/191 (7%)
 Frame = +3

Query  150  CFENERKALLSFK-HsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            C E E++ALL+FK H        S     +D +CC W GV CDN T  HV+ LHLG    
Sbjct  5    CNEGEKQALLTFKQHLKDPANRLSSWVGEEDSNCCNWTGVVCDNLT-GHVLELHLGNSNS  63

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynK  500
              +     N    G++S SLL L  LN+LDLS N F   +IP F GSL +L YLNLS   
Sbjct  64   LLNS----NTSLGGKVSRSLLSLKHLNYLDLSNNDFQGIQIPKFFGSLISLRYLNLSKAG  119

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F G +P  LGN+++L+YL +G+     +LKV + L+W+S LS LE+L+M   DL   SDW
Sbjct  120  FEGIIPHQLGNLTSLRYLCLGD----YKLKV-ENLQWVSGLSHLEHLDMSSADLSKASDW  174

Query  681  LHSISKLSFLR  713
            L   + L  L+
Sbjct  175  LQVTNMLPSLK  185



>ref|XP_008670802.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PEPR1 
[Zea mays]
 tpg|DAA42145.1| TPA: hypothetical protein ZEAMMB73_745147 [Zea mays]
Length=969

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 88/202 (44%), Positives = 115/202 (57%), Gaps = 12/202 (6%)
 Frame = +3

Query  138  GSRSCFENERKALLSFKHsiisdplsslss--wgddddCCKWKGVGCDNTTTAHVVALHL  311
             S SC  +ER ALL+FKH I SDP+  L+S       DCC+W+GV C N T  HV+ L L
Sbjct  35   ASASCIPHERDALLAFKHGISSDPMGLLASWHQKGYGDCCRWRGVRCSNRT-GHVLKLRL  93

Query  312  GRQGLCTDGSPCY--NPGFQGEIspsllhlpflnfldlsFNKFD----RIPSFIGslnnl  473
                + +  S     +    G IS SLL L  L  LDLS N       +IP F+GSL NL
Sbjct  94   RNVHVTSSISYSLFRDTALIGHISHSLLALDQLVHLDLSMNNVTGSSGQIPDFLGSLVNL  153

Query  474  vylnlsynKFVGNVPPHLGNISTLKYLDIGN-NFYGQRLKVVDTLEWISHLSSLEYLNMD  650
             YLN+S   F G VPPHLGN+S L YLD+ +  F GQ       + W++ LS LEYL+M 
Sbjct  154  RYLNISGIPFSGTVPPHLGNLSKLMYLDLSSWVFQGQPYST--DISWLAGLSLLEYLDMS  211

Query  651  CVDLHSVSDWLHSISKLSFLRT  716
             V+L +V+DW H ++ +  L+ 
Sbjct  212  KVNLSTVADWAHVVNMIPSLKV  233



>ref|XP_010920367.1| PREDICTED: receptor-like protein 12 [Elaeis guineensis]
Length=1056

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 111/194 (57%), Gaps = 13/194 (7%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C + ERKALL FK         +  S     +CC+W+GV CDN T   V+ + L      
Sbjct  35   CLDAERKALLQFK--SGLSDPENRLSSWQGRNCCRWRGVSCDNQT-GSVICIDLHNPYPN  91

Query  330  TDGSPCYNP-GF---QGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnls  491
              GS   N  GF    G I PSLL L  L  LDLS+N F+  RIP FIG LNNL YLNLS
Sbjct  92   YFGSVSNNRNGFWNLSGRIDPSLLQLKSLRHLDLSYNTFEGIRIPEFIGCLNNLRYLNLS  151

Query  492  ynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSV  671
               FVG +P  LGN+S L YLD+ + F  Q L  V++ +W++ LSSL +L MD VDL  +
Sbjct  152  NAGFVGIIPSQLGNLSRLHYLDLSSGF--QPL-TVESFQWVTDLSSLVHLAMDGVDLSLI  208

Query  672  -SDWLHSISKLSFL  710
               W+H +++L FL
Sbjct  209  GPQWIHMLNRLPFL  222



>gb|KEH25178.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=946

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 107/185 (58%), Gaps = 21/185 (11%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E ER+ALL FK +++ +     S  G++  CCKW+G+ CDN T  HV +L L      
Sbjct  31   CVETERRALLKFKDALLLERNDLTSWKGEE--CCKWEGISCDNFT-HHVTSLDL------  81

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD-RIPSFIGslnnlvylnlsynKFV  506
                  +     G++  S+  L  L  L+L++NK + +IP  IGSL+ L+ LNL  NK V
Sbjct  82   ------FAFRLSGKLDSSICELKHLTSLNLAYNKLESKIPKCIGSLSKLIELNLIGNKLV  135

Query  507  GNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWLH  686
              +PP LGN+S L+ LD+G N         + LEWISHLS+L +L +  V+L  V DWL 
Sbjct  136  SVIPPSLGNLSNLQTLDLGFNDL-----TANDLEWISHLSNLRHLGLSKVNLSLVVDWLS  190

Query  687  SISKL  701
            SISK+
Sbjct  191  SISKI  195



>ref|XP_003634127.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 isoform X1 [Vitis vinifera]
Length=892

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 113/191 (59%), Gaps = 12/191 (6%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E E+ ALL FK S+       L    + D CC+W+ V C+N T   VV LHLG     
Sbjct  31   CNEKEKHALLRFKKSLSDPGNRLLPWSVNQD-CCRWEAVRCNNVT-GRVVELHLGNPYDT  88

Query  330  TDGSPCYNPGFQ--GEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsyn  497
             D    +N  F+  GEISP+LL L FL++L+LS N F    IPSF+GS+ +L YL+LSY 
Sbjct  89   DDLE--FNSKFELGGEISPALLELEFLSYLNLSGNDFGGSPIPSFLGSMGSLRYLDLSYA  146

Query  498  KFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSD  677
             F G V   LGN+STL++LD+G    G     V+ L WISHL+ L+YL MD VDLH    
Sbjct  147  GFGGLVLHQLGNLSTLRHLDLG----GNSGLYVENLGWISHLAFLKYLGMDWVDLHREVH  202

Query  678  WLHSISKLSFL  710
            WL S+S L  L
Sbjct  203  WLESVSMLPSL  213



>ref|XP_010660819.1| PREDICTED: receptor-like protein 12 [Vitis vinifera]
Length=1312

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 113/194 (58%), Gaps = 16/194 (8%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            + FE ER ALL FK  +        S  G+D  CCKW+GV C+N +  HV  L+L  + L
Sbjct  39   ASFETERVALLKFKQGLTDPSHRLSSWVGED--CCKWRGVVCNNRS-GHVNKLNL--RSL  93

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynK  500
              DG+   +    GEIS SLL L +LN LDLS N F+  RIP FIGSL  L YLNLS   
Sbjct  94   DDDGT---HGKLGGEISHSLLDLKYLNHLDLSMNNFEGTRIPKFIGSLEKLRYLNLSGAS  150

Query  501  FVGNVPPHLGNISTLKYLDIGNNF----YGQRLKVVDTLEWISHLSSLEYLNMDCVDLHS  668
            F G +PP LGN+S L YLD+   F    Y       D L+WIS LSSL +LN++ V+L  
Sbjct  151  FSGPIPPQLGNLSRLIYLDLKEYFDFNTYPDESSQND-LQWISGLSSLRHLNLEGVNLSR  209

Query  669  VSD-WLHSISKLSF  707
             S  WLH++SKL  
Sbjct  210  TSAYWLHAVSKLPL  223



>ref|XP_002276171.1| PREDICTED: receptor-like protein 12 [Vitis vinifera]
Length=1021

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 108/191 (57%), Gaps = 12/191 (6%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNTTTAHVVALHLGRQG  323
            C E ER+ALL FK  ++ D     S  +  D  DCCKW+GV C N T+ HV+ L L    
Sbjct  52   CVEKERQALLDFKQGLVDDFGILSSWGNEEDRRDCCKWRGVQCSNRTS-HVIMLDL--HA  108

Query  324  LCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsyn  497
            L TD    Y    +G IS SLL L  LN LDLS N F    +P FIG  + L YLNLS  
Sbjct  109  LPTDTVHKYQ-SLRGRISSSLLELQHLNHLDLSLNDFQGSYVPEFIGLFSKLRYLNLSEA  167

Query  498  KFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSD  677
            +  G +P HLGN+S L +LD+  N YG      +TLEW+S LSSL +L++  ++L     
Sbjct  168  RLAGMIPSHLGNLSNLHFLDLSRN-YGMS---SETLEWLSRLSSLRHLDLSGLNLDKAIY  223

Query  678  WLHSISKLSFL  710
            W H I++L  L
Sbjct  224  WEHVINRLPSL  234



>ref|XP_009405127.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Musa acuminata subsp. malaccensis]
Length=982

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 121/194 (62%), Gaps = 14/194 (7%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHL-GR  317
            ++ C E ER ALL+F+ + I DP   LSSW    DCC+W GV CD+TT   VV L+L   
Sbjct  26   AKGCTEVERDALLTFR-TRIVDPSHRLSSWRRLVDCCRWNGVVCDDTT-GRVVELNLQNS  83

Query  318  QGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnls  491
            + +  + +       +GEISPSLL L  L+ LDL+ N F    IP+F+GS   L YLNLS
Sbjct  84   EDMTVEANQA---ALRGEISPSLLSLTHLDRLDLNHNDFGGSPIPTFLGSFPKLTYLNLS  140

Query  492  ynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSV  671
            ++ F G++PP LGN+S+L+ LD+ +  YG      D L W+S LSSL YL+M  V+L   
Sbjct  141  WSNFSGSIPPQLGNLSSLRSLDLYS--YGLS---SDGLHWLSRLSSLRYLDMSGVNLSMA  195

Query  672  S-DWLHSISKLSFL  710
            S DWLHS++ LS L
Sbjct  196  SHDWLHSVNMLSSL  209



>ref|XP_009389802.1| PREDICTED: leucine-rich repeat receptor-like protein FASCIATED 
EAR2 [Musa acuminata subsp. malaccensis]
Length=853

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 115/208 (55%), Gaps = 23/208 (11%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E ERKAL+ FK  +        S  G+D  CC W+G+ C N T  HV+ +HL R    
Sbjct  32   CQETERKALMEFKQRVRDPSRRLSSWVGED--CCSWEGIRCSNVT-GHVIEIHL-RNRHR  87

Query  330  TDGS--PCYNPGFQ-----------GEIspsllhlpflnfldlsFNKFD--RIPSFIGsl  464
            +D S   C    F            G I+PSLL L  LN LDLS N F+  RIP F+GS 
Sbjct  88   SDVSYIDCSETDFDDDDVGCRWALHGGITPSLLSLQHLNHLDLSGNNFEGNRIPEFLGSF  147

Query  465  nnlvylnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQ----RLKVVDTLEWISHLSSL  632
              L YLNLS   F G VP  LGN+STL  LD+  NFY +    +   ++ + WIS L+SL
Sbjct  148  GRLTYLNLSGAGFGGKVPDQLGNLSTLHQLDLSYNFYSEDDFYKFLYIENIGWISRLTSL  207

Query  633  EYLNMDCVDLHSVSDWLHSISKLSFLRT  716
            ++LNM+ V   +VS+WL +++ LS ++ 
Sbjct  208  QHLNMNWVSFRNVSNWLQALNVLSSIQV  235



>ref|XP_006422087.1| hypothetical protein CICLE_v10007014mg [Citrus clementina]
 gb|ESR35327.1| hypothetical protein CICLE_v10007014mg [Citrus clementina]
Length=956

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 108/193 (56%), Gaps = 15/193 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNTTTAHVVALHLGRQG  323
            C + ER+ALL+FK  ++ +     S     +  DCC W+GV C N T  HV  L L    
Sbjct  36   CIDEEREALLAFKQGLVDESGILSSWGREDEKRDCCGWRGVNCSNRT-GHVYKLDL--HI  92

Query  324  LCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsyn  497
            L    SPC     +G IS SLL L  L +LDLS N F    IP FIGSL+ L YL LS  
Sbjct  93   LQVFPSPC----LKGTISSSLLILQHLTYLDLSGNNFSGSSIPEFIGSLSKLSYLGLSNT  148

Query  498  KFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSD  677
            +F G +P  LGN+S L+ LDIG N     L   + LEW+SHLSSL YL++   +L   S+
Sbjct  149  EFAGPIPLQLGNLSRLQVLDIGFN----SLISGENLEWLSHLSSLIYLDLSFSNLSKFSN  204

Query  678  WLHSISKLSFLRT  716
            W+  +SKL  L+ 
Sbjct  205  WMQVLSKLDSLKA  217



>gb|KHG30701.1| hypothetical protein F383_11023 [Gossypium arboreum]
Length=254

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 117/195 (60%), Gaps = 13/195 (7%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            N +  C  +ER+ALL FK+ +I    S  S     D CC+W GV C N+T  HV  LHL 
Sbjct  27   NSNVRCIHSEREALLKFKNDLIDPSNSLSSWMEGGD-CCEWSGVVCHNST-GHVHKLHLA  84

Query  315  RQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnl  488
                    SP      +G+I+PSLL L  L+FLDLS N F    IP F+G L NL+YLNL
Sbjct  85   -----APLSPYEQSALRGKINPSLLELEHLSFLDLSNNNFSSIHIPKFLGMLVNLMYLNL  139

Query  489  synKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHS  668
            S+ +F G +P +LGN++ L+YLD+ +N  G  +K   +L+WIS LSSL+YL++   DL  
Sbjct  140  SFARFQGEIPHNLGNLTKLQYLDLRSNERGD-IKAT-SLQWISGLSSLQYLDLSESDLSK  197

Query  669  VSDWLHSISK--LSF  707
             ++WL   S+  LSF
Sbjct  198  ATNWLQDKSQQALSF  212



>ref|XP_006490687.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like [Citrus sinensis]
 gb|KDO56859.1| hypothetical protein CISIN_1g046848mg [Citrus sinensis]
Length=956

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 108/193 (56%), Gaps = 15/193 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNTTTAHVVALHLGRQG  323
            C + ER+ALL+FK  ++ +     S     +  DCC W+GV C N T  HV  L L    
Sbjct  36   CIDEEREALLAFKQGLVDESGILSSWGREDEKRDCCGWRGVNCSNRT-GHVYKLDL--HI  92

Query  324  LCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsyn  497
            L    SPC     +G IS SLL L  L +LDLS N F    IP FIGSL+ L YL LS  
Sbjct  93   LQVFPSPC----LKGTISSSLLILQHLTYLDLSGNNFSGSSIPEFIGSLSKLSYLGLSNT  148

Query  498  KFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSD  677
            +F G +P  LGN+S L+ LDIG N     L   + LEW+SHLSSL YL++   +L   S+
Sbjct  149  EFAGPIPLQLGNLSRLQVLDIGFN----SLISGENLEWLSHLSSLIYLDLSFSNLSKFSN  204

Query  678  WLHSISKLSFLRT  716
            W+  +SKL  L+ 
Sbjct  205  WMQVLSKLDSLKA  217



>ref|XP_010910624.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Elaeis guineensis]
Length=699

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 104/192 (54%), Gaps = 11/192 (6%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            S  CF  ER ALL+FK     +      +     DCC W GVGCD+    HVV L+L   
Sbjct  28   SSRCFGLERMALLAFK--ASLNNTQIRLASWQGLDCCTWNGVGCDHA--GHVVKLNLRNP  83

Query  321  GLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsy  494
                + S        GEI+ SLL L  L  LDLS N F    IP FIGS   L YLNLS 
Sbjct  84   YNSINQSQW---ALGGEINSSLLALSHLKHLDLSMNDFGGILIPEFIGSFKRLKYLNLSG  140

Query  495  nKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVS  674
              F G +PPHLGN+S+++YLD+              L+W++HLSSL++L++  V+L + +
Sbjct  141  ADFSGLIPPHLGNLSSIRYLDLSAE--STYKTSAYNLQWLTHLSSLKHLDLSFVNLSTAA  198

Query  675  DWLHSISKLSFL  710
            DWL +++ L  L
Sbjct  199  DWLQAVNMLPSL  210



>ref|XP_008218592.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Prunus mume]
Length=926

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 120/199 (60%), Gaps = 21/199 (11%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            N S  C +NER+ALL FKH +        S  G+ D CC W GV C+N T  HV  LHL 
Sbjct  27   NLSAPCKQNERQALLKFKHDLEDPSNQLSSWAGEGD-CCNWAGVVCNNFT-GHVRDLHLA  84

Query  315  RQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnl  488
                        N  F G+I+PSLL+L  L++LDLS+N F+  +IPSF+GSL +L YLNL
Sbjct  85   ------------NMSFSGKINPSLLNLTHLSYLDLSYNDFEEMQIPSFLGSLKSLRYLNL  132

Query  489  synKFVGNVPPHLGNISTLKYLDIGNNFY----GQRLKV-VDTLEWISHLSSLEYLNMDC  653
            SY+ FVG +P  LGN+++L+ LD+ +  Y    G+   + V++L+WIS LS L++L+M  
Sbjct  133  SYSSFVGLIPHQLGNLTSLQVLDLDDLQYEDDHGEIHSLEVESLQWISGLSQLQHLDMSG  192

Query  654  VDLHSVSDWLHSISKLSFL  710
             +L   SDWL   + L  L
Sbjct  193  ANLSKASDWLRVTNTLPSL  211



>ref|NP_001174592.1| Os06g0140000 [Oryza sativa Japonica Group]
 dbj|BAD68675.1| putative HcrVf3 protein [Oryza sativa Japonica Group]
 gb|EAY99587.1| hypothetical protein OsI_21565 [Oryza sativa Indica Group]
 gb|EAZ35772.1| hypothetical protein OsJ_20063 [Oryza sativa Japonica Group]
 dbj|BAH93320.1| Os06g0140000 [Oryza sativa Japonica Group]
Length=961

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 78/199 (39%), Positives = 106/199 (53%), Gaps = 15/199 (8%)
 Frame = +3

Query  138  GSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGR  317
             + +C   ER AL   K          + S     +CC W GV C+N T  H++ L+L  
Sbjct  20   AAAACIGKERDALFDLK--ATLRDPGGMLSSWVGLNCCNWYGVTCNNRT-GHIIKLNLAN  76

Query  318  QGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnls  491
              +  + +        G+ISPSL+HL  L +L+L  N F   RIP+FIGSL NL +L+LS
Sbjct  77   YNISKEDA------LTGDISPSLVHLTHLMYLNLRSNDFGGARIPAFIGSLKNLRHLDLS  130

Query  492  ynKFVGNVPPHLGNISTLKYLDIG----NNFYGQRLKVVDTLEWISHLSSLEYLNMDCVD  659
            +  F G +PP LGN+S L YLDI     N         VD L W+S LSSL YL+M   +
Sbjct  131  FANFGGKIPPQLGNLSKLNYLDISFPYNNFSSFTSSSSVDNLLWVSQLSSLVYLDMSLWN  190

Query  660  LHSVSDWLHSISKLSFLRT  716
            L   SDWL S++ L+ L+ 
Sbjct  191  LSVASDWLQSLNMLASLKV  209



>ref|XP_007024895.1| Disease resistance family protein / LRR family protein, putative 
[Theobroma cacao]
 gb|EOY27517.1| Disease resistance family protein / LRR family protein, putative 
[Theobroma cacao]
Length=992

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 109/189 (58%), Gaps = 6/189 (3%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C + E+KALL FK S+        S  G+D  CC+W GV C  + T  V  L L R  L 
Sbjct  33   CSDIEKKALLVFKESLTDPFGRLSSWVGED--CCQWHGVSC-KSETGQVTKLDL-RNSLQ  88

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynKF  503
            T+ +       +G+I+ SLL+L  L +LDLS N F+   IP  IGSL  L YLNLSY + 
Sbjct  89   TNKAAQKKSALRGKINSSLLNLKNLRYLDLSMNNFEGSPIPQVIGSLRTLSYLNLSYAQL  148

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWL  683
             G++PPHLGN+S L+YLD+ +        +   L W+  L SLEYL+M  VDL +V+DWL
Sbjct  149  GGSIPPHLGNLSNLQYLDLHSYSDSSSKLIATDLLWLRGLPSLEYLDMGGVDLSAVTDWL  208

Query  684  HSISKLSFL  710
              ++ L  L
Sbjct  209  QQVNMLPSL  217



>gb|KGN50335.1| hypothetical protein Csa_5G168740 [Cucumis sativus]
Length=792

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 110/190 (58%), Gaps = 10/190 (5%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            + +C +NER+ALL FK+S   DP   L+SW D  DCC WKGV C N TT HV  + L R+
Sbjct  34   TAACIQNEREALLQFKNSFYDDPSHRLASWNDGTDCCNWKGVSC-NQTTGHVTIIDLRRE  92

Query  321  GLCTDGSPCYNPGFQ-GEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnls  491
                D  P  +P F    I  SL  L  L +LDLS N F   +IP F+GS+  L YLNLS
Sbjct  93   LRQVDFYP--SPLFSYNSIDSSLFELKCLTYLDLSGNNFIYTKIPKFLGSMVELTYLNLS  150

Query  492  ynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSV  671
               F G VPPHLGN++ L  LD+  N     L+    +EWISHLSSL++L +  +D    
Sbjct  151  NAYFSGKVPPHLGNLTKLDTLDLSFNL----LETNGDVEWISHLSSLKFLWLRGMDFSKA  206

Query  672  SDWLHSISKL  701
            S+ +  ++ L
Sbjct  207  SNLMQVLNYL  216



>gb|KEH16822.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=918

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 78/191 (41%), Positives = 110/191 (58%), Gaps = 20/191 (10%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            +  C E ER+ALL F+ +I  +     S  G++  CCKW+G+ CDN T  HV +LHL   
Sbjct  28   TNKCVEKERRALLKFRDAINLNRDGISSWKGEE--CCKWEGILCDNFT-HHVTSLHLILL  84

Query  321  GLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD-RIPSFIGslnnlvylnlsyn  497
            G            F G++  S+  L  L  L+L  N+F+ +IP  IGSL+ L+ LNL +N
Sbjct  85   G------------FGGKLDSSICELQHLTSLNLFGNQFEGKIPKCIGSLDKLIELNLGFN  132

Query  498  KFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSD  677
             FVG +PP LGN+S L+  D+G   Y       + LEW+SHLS+L  L++  V+L    D
Sbjct  133  YFVGVIPPSLGNLSNLQTFDLGLFNY----LTANDLEWLSHLSNLRCLDLSYVNLTLAVD  188

Query  678  WLHSISKLSFL  710
            WL SISK+ +L
Sbjct  189  WLSSISKIRYL  199



>gb|KJB26590.1| hypothetical protein B456_004G248900 [Gossypium raimondii]
Length=1007

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 109/200 (55%), Gaps = 19/200 (10%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E+ER+ALL+FK  II       S   + +DCCKW GV CDN T  HV  L L      
Sbjct  31   CIESERQALLNFKQDIIDRSNRLSSWSKNGEDCCKWLGVYCDNIT-GHVYKLDLKPPS--  87

Query  330  TDGSPCYNPG----------FQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnl  473
                P Y              +G+I+PSLL L  L  LDLS N F    IPSF+GS+ +L
Sbjct  88   --SPPVYASDAEFGVYWRSILRGKINPSLLSLNHLVHLDLSHNNFGGTLIPSFLGSMESL  145

Query  474  vylnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDC  653
             +L+LS   F G +P  LGN+S L++L++G N    +L     L+W+S  SSLE+L++  
Sbjct  146  TFLDLSDAHFGGVIPHQLGNLSELQHLNLGGN--SNKLFEAKNLQWLSGFSSLEFLDLSQ  203

Query  654  VDLHSVSDWLHSISKLSFLR  713
            VDL    DWL   SKL  L+
Sbjct  204  VDLSKAIDWLQVTSKLPSLK  223



>gb|EEC68383.1| hypothetical protein OsI_36529 [Oryza sativa Indica Group]
Length=565

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 116/198 (59%), Gaps = 12/198 (6%)
 Frame = +3

Query  138  GSRSCFENERKALLSFKHsiisdplsslss-wgddddCCKWKGVGCDNTTTAHVVALHLG  314
             + +C   ER ALL+FK  I SDPL  L+S   DD DCC+W+GV C N T  HV+ LHL 
Sbjct  28   ATTACVPRERDALLAFKRGITSDPLGLLTSWKEDDHDCCRWRGVTCSNLT-GHVLRLHLN  86

Query  315  RQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD----RIPSFIGslnnlvyl  482
              G   D       G  GEISP LLHL  +  LDLS N  +    +IP F+GS+N+L YL
Sbjct  87   -GGYDLDRFELV--GLVGEISPQLLHLNHIEHLDLSINSLEEPSGQIPKFLGSMNSLRYL  143

Query  483  nlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDL  662
            NLS   F G VPP LGN+S L+YLD+ +   G  L     + W+  L SL++LN+  +DL
Sbjct  144  NLSSIPFTGTVPPQLGNLSNLRYLDLSDMEGGVHLT---DISWLPRLGSLKFLNLTYIDL  200

Query  663  HSVSDWLHSISKLSFLRT  716
             + SDW + ++ +  LR 
Sbjct  201  SAASDWPYVMNMIPSLRV  218



>ref|XP_004143731.2| PREDICTED: receptor-like protein 12 [Cucumis sativus]
Length=969

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 110/190 (58%), Gaps = 10/190 (5%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            + +C +NER+ALL FK+S   DP   L+SW D  DCC WKGV C N TT HV  + L R+
Sbjct  34   TAACIQNEREALLQFKNSFYDDPSHRLASWNDGTDCCNWKGVSC-NQTTGHVTIIDLRRE  92

Query  321  GLCTDGSPCYNPGFQ-GEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnls  491
                D  P  +P F    I  SL  L  L +LDLS N F   +IP F+GS+  L YLNLS
Sbjct  93   LRQVDFYP--SPLFSYNSIDSSLFELKCLTYLDLSGNNFIYTKIPKFLGSMVELTYLNLS  150

Query  492  ynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSV  671
               F G VPPHLGN++ L  LD+  N     L+    +EWISHLSSL++L +  +D    
Sbjct  151  NAYFSGKVPPHLGNLTKLDTLDLSFNL----LETNGDVEWISHLSSLKFLWLRGMDFSKA  206

Query  672  SDWLHSISKL  701
            S+ +  ++ L
Sbjct  207  SNLMQVLNYL  216



>ref|XP_003633794.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Vitis vinifera]
Length=988

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 113/194 (58%), Gaps = 16/194 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E E+ ALL FK  +        S  G+D  CCKW+GV C+N +  HV+ L+L  + L 
Sbjct  39   CIETEKVALLKFKQGLTDPSHRLSSWVGED--CCKWRGVVCNNRS-GHVIKLNL--RSLD  93

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynKF  503
             DG+   +    GEIS SLL L +LN LDLS N F+  RIP FIGSL  L YLNLS   F
Sbjct  94   DDGT---SGKLGGEISLSLLDLKYLNHLDLSMNNFEGTRIPKFIGSLERLRYLNLSGASF  150

Query  504  VGNVPPHLGNISTLKYLDIGNNF----YGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSV  671
             G +PP LGN+S L YLD+   F    Y       D L+WIS LSSL +LN++ ++L   
Sbjct  151  SGPIPPQLGNLSRLIYLDLREYFDFNTYPDESSQND-LQWISGLSSLRHLNLEGINLSRA  209

Query  672  SD-WLHSISKLSFL  710
            S  WL ++SKL  L
Sbjct  210  SAYWLQAVSKLPSL  223



>ref|XP_009375610.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Pyrus x bretschneideri]
Length=899

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 104/190 (55%), Gaps = 15/190 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C   E+ ALL FK  +I       S    +D CCKW+G+ C+N T  HVV L L      
Sbjct  30   CLRTEKTALLQFKQGLIDKSNVLASWETGND-CCKWRGITCNNKT-GHVVMLDL-----Y  82

Query  330  TDGSPCYNP--GFQGEIspsllhlpflnfldlsFNKFD-RIPSFIGslnnlvylnlsynK  500
             + S  YN      G I PSLL LP+L +LDLSFN F  +IP FIGSL+ L  L L+   
Sbjct  83   YNSSDIYNAETPLSGVIVPSLLELPYLTYLDLSFNNFQGQIPKFIGSLSRLEQLKLAGAN  142

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
              G +PP L N+S+L  LD+  N+        + LEW+SHLSSL YLNM  ++     +W
Sbjct  143  LSGPIPPQLRNLSSLYTLDLAWNYV-----TFENLEWLSHLSSLRYLNMSRLNFSEFVNW  197

Query  681  LHSISKLSFL  710
              SISKL  L
Sbjct  198  PESISKLPSL  207



>ref|XP_011651766.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 isoform X2 [Cucumis sativus]
Length=991

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 114/199 (57%), Gaps = 26/199 (13%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTA-HVVALH---  308
            S  C + +R+AL++F++ +        S  G +  CC+W+GVGC+NTT A   + LH   
Sbjct  29   SIECSKPDREALIAFRNGLNDPENRLESWKGPN--CCQWRGVGCENTTGAVTAIDLHNPY  86

Query  309  -LGRQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFDRI--PSFIGslnnlvy  479
             LG QG              GEISPSL  L  L +LDLS+N F+ I  P F GSL  L Y
Sbjct  87   PLGEQGFWN---------LSGEISPSLTKLKSLRYLDLSYNTFNDIPVPDFFGSLKKLQY  137

Query  480  lnlsynKFVGNVPPHLGNISTLKYLDIGN-NFYGQRLKVVDTLEWISHLSSLEYLNMDCV  656
            LNLS   F   +PP  GN+S+L+YLD+ N N       +VD LEW+  L SL++L M+ V
Sbjct  138  LNLSNAGFSDMLPPSFGNMSSLQYLDMENLNL------IVDNLEWVGGLVSLKHLAMNSV  191

Query  657  DLHSV-SDWLHSISKLSFL  710
            DL SV S+W   +SKL ++
Sbjct  192  DLSSVKSNWFKILSKLRYV  210



>ref|XP_011001953.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 isoform X1 [Populus euphratica]
Length=971

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 113/194 (58%), Gaps = 18/194 (9%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNTTTAHVVALHLGRQG  323
            C E ER+ALL FK  +I D     S     +  DCCKW+GVGCDN T  HV  L L    
Sbjct  44   CIERERRALLQFKKDLIDDYGVLSSWGGEEEKRDCCKWRGVGCDNIT-GHVTLLDL----  98

Query  324  LCTDGSPCYNPGFQ---GEIspsllhlpflnfldlsFNKFDR-IPSFIGslnnlvylnls  491
                 SP Y   F    G++S SLL L +LN+LDLS N FD  +  FIGSL +L YLNLS
Sbjct  99   ---HSSPVYENLFTPLGGKVSDSLLELQYLNYLDLSLNNFDESMIDFIGSLTSLRYLNLS  155

Query  492  ynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSV  671
            YN F   +P  LGN+S L+ LD+  +F       V+ L+W+SHLSSLE L++   +L  V
Sbjct  156  YNFFTVIIPYQLGNLSRLQSLDLSYSFDAS----VENLDWLSHLSSLERLDLSGSNLSKV  211

Query  672  SDWLHSISKLSFLR  713
            +DWL  I+ L  L+
Sbjct  212  NDWLQVITNLPRLK  225



>gb|KGN58575.1| hypothetical protein Csa_3G687760 [Cucumis sativus]
Length=872

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 114/199 (57%), Gaps = 26/199 (13%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTA-HVVALH---  308
            S  C + +R+AL++F++ +        S  G +  CC+W+GVGC+NTT A   + LH   
Sbjct  29   SIECSKPDREALIAFRNGLNDPENRLESWKGPN--CCQWRGVGCENTTGAVTAIDLHNPY  86

Query  309  -LGRQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFDRI--PSFIGslnnlvy  479
             LG QG              GEISPSL  L  L +LDLS+N F+ I  P F GSL  L Y
Sbjct  87   PLGEQGFWN---------LSGEISPSLTKLKSLRYLDLSYNTFNDIPVPDFFGSLKKLQY  137

Query  480  lnlsynKFVGNVPPHLGNISTLKYLDIGN-NFYGQRLKVVDTLEWISHLSSLEYLNMDCV  656
            LNLS   F   +PP  GN+S+L+YLD+ N N       +VD LEW+  L SL++L M+ V
Sbjct  138  LNLSNAGFSDMLPPSFGNMSSLQYLDMENLNL------IVDNLEWVGGLVSLKHLAMNSV  191

Query  657  DLHSV-SDWLHSISKLSFL  710
            DL SV S+W   +SKL ++
Sbjct  192  DLSSVKSNWFKILSKLRYV  210



>ref|XP_006490688.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Citrus sinensis]
Length=467

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 113/194 (58%), Gaps = 18/194 (9%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNTTTAHVVALHLGRQG  323
            C + ER+ALL+FK S++ +     S     +  DCCKW GVGC +  T HV  L L  Q 
Sbjct  36   CIDEEREALLTFKASLVDESGILSSWRREDEKRDCCKWTGVGC-SKRTGHVNKLDL--QP  92

Query  324  LCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsyn  497
            +  D  P      +G+I+P+LL L  L +LDLS N F    IP F+GSL  L YL LS  
Sbjct  93   IGFDSFP-----LRGKITPALLKLQHLTYLDLSRNNFSGSSIPEFLGSLGKLSYLGLSSA  147

Query  498  KFVGNVPPHLGNISTLKYLDIG-NNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVS  674
            +F G +P  LGN+S L++LD+  NN +       + L+W+SHLSSL YL +D  DL + S
Sbjct  148  EFAGPIPHQLGNLSRLQFLDLSFNNLFSG-----ENLDWLSHLSSLIYLYLDLNDLSNFS  202

Query  675  DWLHSISKLSFLRT  716
            +W+  +SKL  L T
Sbjct  203  NWVQLLSKLHSLTT  216



>ref|XP_002458109.1| hypothetical protein SORBIDRAFT_03g027070 [Sorghum bicolor]
 gb|EES03229.1| hypothetical protein SORBIDRAFT_03g027070 [Sorghum bicolor]
Length=982

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 124/194 (64%), Gaps = 11/194 (6%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            N  + C  +ER ALL+F+ + +SDP + LSSWG+ D+CCKWKGV C NTT  HVV L L 
Sbjct  33   NTFKRCIAHERSALLAFR-AGLSDPANRLSSWGEGDNCCKWKGVQCSNTT-GHVVKLDL-  89

Query  315  RQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnl  488
             QG   D   C      G IS SL+ L  L +LDLS N+F   +IP F+GSL+ L YL+L
Sbjct  90   -QG--PDYYNCVKQVLGGNISSSLVALQHLQYLDLSCNRFSMVKIPEFLGSLHELRYLDL  146

Query  489  synKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHS  668
            S +  VG +PP LGN+S L+Y+++ ++ +G        + W+S LSSLE+L+M  V+L +
Sbjct  147  SMSSLVGRIPPQLGNLSNLRYMNL-DSIFGDTHST--DITWLSRLSSLEHLDMSWVNLST  203

Query  669  VSDWLHSISKLSFL  710
            +++W+  ++ L  L
Sbjct  204  ITNWVSVVNMLPSL  217



>emb|CDP12881.1| unnamed protein product [Coffea canephora]
Length=881

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 118/202 (58%), Gaps = 13/202 (6%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            N +  C + ER+AL+  K  +        S  G+D  CC+WKGV C+N T  +VV L L 
Sbjct  31   NVTAGCIKEEREALVRVKQGLEDPSGRLSSWIGED--CCRWKGVSCNNQT-GNVVKLDLR  87

Query  315  RQGLCTDG---SPC-YNPG-FQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnl  473
              G   +G    P   NP    G+IS SLL L  LN+LDLS N F  + +P F+GSL+ L
Sbjct  88   SYGCYLNGGQDDPSNLNPSCMSGKISSSLLDLKHLNYLDLSMNNFQNNPVPEFLGSLDEL  147

Query  474  vylnlsynKFVGNVPPHLGNISTLKYLD--IGNNFYGQRLKVVDTLEWISHLSSLEYLNM  647
             YL+LSY+ F G VPPHLGN+S L+YLD    +    Q    +  L WI+HL+SLEYLN+
Sbjct  148  SYLDLSYSNFAGLVPPHLGNLSNLRYLDLSSNSLNSSQPGIWIADLSWITHLTSLEYLNL  207

Query  648  DCVDLHSVSD-WLHSISKLSFL  710
              V+L  VSD WL + +KL  L
Sbjct  208  GFVNLSMVSDHWLKAFNKLPSL  229



>ref|XP_004149737.1| PREDICTED: leucine-rich repeat receptor protein kinase MSL1-like 
isoform X1 [Cucumis sativus]
Length=1021

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 114/199 (57%), Gaps = 26/199 (13%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTA-HVVALH---  308
            S  C + +R+AL++F++ +        S  G +  CC+W+GVGC+NTT A   + LH   
Sbjct  29   SIECSKPDREALIAFRNGLNDPENRLESWKGPN--CCQWRGVGCENTTGAVTAIDLHNPY  86

Query  309  -LGRQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFDRI--PSFIGslnnlvy  479
             LG QG              GEISPSL  L  L +LDLS+N F+ I  P F GSL  L Y
Sbjct  87   PLGEQGFWN---------LSGEISPSLTKLKSLRYLDLSYNTFNDIPVPDFFGSLKKLQY  137

Query  480  lnlsynKFVGNVPPHLGNISTLKYLDIGN-NFYGQRLKVVDTLEWISHLSSLEYLNMDCV  656
            LNLS   F   +PP  GN+S+L+YLD+ N N       +VD LEW+  L SL++L M+ V
Sbjct  138  LNLSNAGFSDMLPPSFGNMSSLQYLDMENLNL------IVDNLEWVGGLVSLKHLAMNSV  191

Query  657  DLHSV-SDWLHSISKLSFL  710
            DL SV S+W   +SKL ++
Sbjct  192  DLSSVKSNWFKILSKLRYV  210



>ref|XP_009405129.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Musa acuminata subsp. malaccensis]
Length=925

 Score = 85.5 bits (210),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 112/194 (58%), Gaps = 13/194 (7%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            ++ C E E+ +LL FK  I+ DP S LSSW    DCC+W GV CDN T  HVV L+L   
Sbjct  35   TKGCVEGEKDSLLDFKTGIVKDPSSRLSSWRGRVDCCRWSGVVCDNRT-GHVVELNLQNS  93

Query  321  GLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsy  494
                D          GEI PSLL L  L  LDLS N F   +IP F GSL  L YL+L+ 
Sbjct  94   DPDND-----EMSIGGEIRPSLLLLTHLERLDLSNNDFGGIQIPEFFGSLTKLTYLDLNG  148

Query  495  nKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVS  674
            + F G +PP LGN+S L+YLD+ N+ +      +D L W+S LSSL YL M  V+L   S
Sbjct  149  SYFGGAIPPQLGNLSRLRYLDL-NSLHDL---TIDGLHWLSRLSSLRYLYMGGVNLSVAS  204

Query  675  -DWLHSISKLSFLR  713
             DWL +++ LS L 
Sbjct  205  HDWLQAVNMLSSLE  218



>ref|XP_009352119.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Pyrus x bretschneideri]
Length=533

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 103/190 (54%), Gaps = 15/190 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C   E+ ALL FK  +I       S     D CC+W+G+ C+N T  HVV L L      
Sbjct  30   CLRTEKTALLQFKQGLIDKSNVLASWETGKD-CCEWRGITCNNKT-GHVVMLDL-----Y  82

Query  330  TDGSPCYNP--GFQGEIspsllhlpflnfldlsFNKFD-RIPSFIGslnnlvylnlsynK  500
             + S  YN      G I PSLL LP+L +LDLSFN F  +IP FIGSL+ L  L L+   
Sbjct  83   YNSSDIYNAETPLSGVIVPSLLELPYLTYLDLSFNNFQGQIPKFIGSLSRLEQLKLAGAN  142

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
              G +PP L N+S+L  LD+  N+        + LEW+SHLSSL YLNM  ++     +W
Sbjct  143  LSGPIPPQLRNLSSLYTLDLAWNYV-----TFENLEWLSHLSSLRYLNMSRLNFSEFVNW  197

Query  681  LHSISKLSFL  710
              SISKL  L
Sbjct  198  PESISKLPSL  207



>ref|XP_011001954.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 isoform X2 [Populus euphratica]
Length=944

 Score = 85.5 bits (210),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 113/194 (58%), Gaps = 18/194 (9%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNTTTAHVVALHLGRQG  323
            C E ER+ALL FK  +I D     S     +  DCCKW+GVGCDN T  HV  L L    
Sbjct  17   CIERERRALLQFKKDLIDDYGVLSSWGGEEEKRDCCKWRGVGCDNIT-GHVTLLDL----  71

Query  324  LCTDGSPCYNPGFQ---GEIspsllhlpflnfldlsFNKFDR-IPSFIGslnnlvylnls  491
                 SP Y   F    G++S SLL L +LN+LDLS N FD  +  FIGSL +L YLNLS
Sbjct  72   ---HSSPVYENLFTPLGGKVSDSLLELQYLNYLDLSLNNFDESMIDFIGSLTSLRYLNLS  128

Query  492  ynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSV  671
            YN F   +P  LGN+S L+ LD+  +F       V+ L+W+SHLSSLE L++   +L  V
Sbjct  129  YNFFTVIIPYQLGNLSRLQSLDLSYSFDAS----VENLDWLSHLSSLERLDLSGSNLSKV  184

Query  672  SDWLHSISKLSFLR  713
            +DWL  I+ L  L+
Sbjct  185  NDWLQVITNLPRLK  198



>ref|XP_008357614.1| PREDICTED: receptor-like protein kinase 2 [Malus domestica]
Length=928

 Score = 85.5 bits (210),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 110/182 (60%), Gaps = 12/182 (7%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C ENER+ LL FK  +        S  G+ D CC W GV C N+T  HV  LHL      
Sbjct  32   CKENERQTLLMFKKDLNDSLNMLSSWVGEGD-CCNWTGVACSNST-GHVHELHLAGNYNQ  89

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynKF  503
              G      G  G+++PSLL+L  L++LDLS+N F+  +IPSF+GSL  L YLNLS+  F
Sbjct  90   VTGE---KHGLGGKVNPSLLNLKQLSYLDLSYNNFEGLQIPSFLGSLKGLRYLNLSHAGF  146

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWL  683
             G +P  LGN+S+L+YLD+  N     L +V+ L+W+S LS L++L+M  V+L  VS WL
Sbjct  147  NGTIPHQLGNLSSLRYLDLSEN-----LLMVENLKWLSGLSMLKHLDMSYVNLSKVSHWL  201

Query  684  HS  689
             +
Sbjct  202  QA  203



>ref|XP_008218771.1| PREDICTED: receptor-like protein 12 [Prunus mume]
Length=929

 Score = 85.1 bits (209),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 115/195 (59%), Gaps = 22/195 (11%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            N S  C +NER+ALL FKH +        S  G+ D CC W GV CDN T  H+  LHL 
Sbjct  27   NLSAPCKQNERQALLKFKHDVEGPLNQLPSWAGEGD-CCNWTGVVCDNLT-GHIRELHLA  84

Query  315  RQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnl  488
                           + G+ISPSLL+L  L++LDLS N F   +IPSF+GSL +L YLNL
Sbjct  85   DT-------------YSGKISPSLLNLKHLSYLDLSNNDFQGMQIPSFLGSLKSLRYLNL  131

Query  489  synKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKV-VDTLEWISHLSSLEYLNMDCVDLH  665
            S + FVG +P  LGN+++L+ LD+    +G    + V++L+WIS LS L++L+M C +L 
Sbjct  132  SNSMFVGLIPHQLGNLTSLQVLDL----HGTTDSLSVESLQWISGLSKLQHLDMSCANLS  187

Query  666  SVSDWLHSISKLSFL  710
              SDWL   + L  L
Sbjct  188  KASDWLRVTNTLPSL  202



>ref|XP_007212880.1| hypothetical protein PRUPE_ppa021661mg, partial [Prunus persica]
 gb|EMJ14079.1| hypothetical protein PRUPE_ppa021661mg, partial [Prunus persica]
Length=932

 Score = 85.1 bits (209),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 116/200 (58%), Gaps = 17/200 (9%)
 Frame = +3

Query  144  RSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQG  323
            RSC E ER ALLSFK  +        S  G D  CC+W+G+ C+N T  HV   +L  Q 
Sbjct  7    RSCIEEERSALLSFKQDLKDPSGRLSSWAGRD--CCQWRGISCNNRT-GHVAKANLRNQY  63

Query  324  --LCTD---GSPCYNPG-FQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvy  479
              +  D       YN     G+I+PSLL L +LN+LDLS+N FD   IP F G L +L Y
Sbjct  64   PYVLYDEEWDELAYNQSCLGGKINPSLLSLKYLNYLDLSYNDFDGIHIPKFFGELKSLRY  123

Query  480  lnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDT-LEWISHLSSLEYLNMDCV  656
            LN+S   F G +P  LGN+S L YLD+G   +   + +  T L W+SHLSSL+YLN++ V
Sbjct  124  LNISSTSFSGEIPHSLGNLSELNYLDLG---FSYSISLYSTNLNWLSHLSSLKYLNLNGV  180

Query  657  DLHS--VSDWLHSISKLSFL  710
            +L S  V++W H ++ L  L
Sbjct  181  NLSSTGVTNWQHHLNMLPSL  200



>ref|XP_010650370.1| PREDICTED: polygalacturonase inhibitor-like [Vitis vinifera]
Length=312

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 91/212 (43%), Positives = 116/212 (55%), Gaps = 28/212 (13%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHL------  311
            C E E++ALLSFKH++        S    +D CC W GV C N T   V+ L L      
Sbjct  31   CNETEKRALLSFKHALFDPAHRLSSWSTHED-CCGWNGVYCHNVT-GRVIKLDLMNPDIY  88

Query  312  --GRQGLCTDG-------------SPCYNPGFQGEIspsllhlpflnfldlsFNKF--DR  440
                +G  T               +  YN    G++SP+LL L FLN+LDLS+N F    
Sbjct  89   NYSLEGKVTRAYRYNFSLEVKVSRAYRYNFSLGGKVSPALLQLEFLNYLDLSWNDFGGTP  148

Query  441  IPSFIGslnnlvylnlsynKFVGNVPPHLGNISTLKYLDIGN--NFYGQRLKVVDTLEWI  614
            IPSF+GS+ +L YLNL    F G +PP LGN+S L+YL +G+  +FY  +L  V+ L WI
Sbjct  149  IPSFLGSMRSLTYLNLHGASFGGLIPPQLGNLSNLQYLSLGSGYSFYEPQL-YVENLGWI  207

Query  615  SHLSSLEYLNMDCVDLHSVSDWLHSISKLSFL  710
            SHLSSLE+L M  VDL     WL S S LS L
Sbjct  208  SHLSSLEFLLMFEVDLQREVHWLESTSMLSSL  239



>gb|KHG16201.1| DNA-damage-repair/toleration protein [Gossypium arboreum]
Length=345

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 103/181 (57%), Gaps = 16/181 (9%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C ++ER+ALL FK+ +        S     D CCKW GV C N+T  HV  LHL      
Sbjct  36   CIQSEREALLKFKNDLTDPSNRLSSWVEGGD-CCKWIGVVCHNST-GHVNQLHLA-----  88

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynKF  503
                P       G+I+PSLL L  LN LDLS+N F    IP F G L +L YLNLS  +F
Sbjct  89   --APPLSPSALGGKINPSLLELKHLNSLDLSYNSFSSIHIPKFFGLLESLTYLNLSCAQF  146

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWL  683
             G +P +LGN+S L+YLD+G N + Q+     +L+W+S L SL++L++   DL   +DW+
Sbjct  147  QGAIPHNLGNLSKLQYLDLGGNDHEQK-----SLQWVSGLYSLQHLDLSGADLSKATDWV  201

Query  684  H  686
             
Sbjct  202  Q  202



>ref|XP_006481843.1| PREDICTED: receptor-like protein 12-like [Citrus sinensis]
Length=1115

 Score = 85.5 bits (210),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 114/198 (58%), Gaps = 14/198 (7%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            N + +C ++ER+ALL  K  +        S    D DCC W GV C+N T  HV+ L+LG
Sbjct  125  NSNVACIDSERQALLKLKQDLNDPSNRLASWNIGDGDCCAWDGVVCNNFT-GHVLQLNLG  183

Query  315  RQGLCTDGSPCYNPGFQ--GEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvyl  482
                  +  P +  G +  G+I+PSL+ +  L  LDLS N F    IP ++GSL NL YL
Sbjct  184  ------NPDPNHGTGSKLVGKINPSLVDIKHLIHLDLSGNDFQGIHIPKYLGSLQNLRYL  237

Query  483  nlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDL  662
            NLS  +F G +P  LGN+S L YLD+  NFY  +   V++  W+S LS LE+L++  VDL
Sbjct  238  NLSGAEFAGVIPHQLGNLSNLHYLDLSKNFYELQ---VESFLWLSGLSLLEHLDLSQVDL  294

Query  663  HSVSDWLHSISKLSFLRT  716
               SD+L +I+ L  LR 
Sbjct  295  SKSSDYLLTINSLPSLRV  312



>gb|EMT14344.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Aegilops 
tauschii]
Length=959

 Score = 85.1 bits (209),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 111/191 (58%), Gaps = 10/191 (5%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            SC   ER ALL+F+        ++L S    DDCC+WKGV C N T +HVV L L   G 
Sbjct  39   SCVAGERSALLAFR--AGLSDPANLLSSWKGDDCCRWKGVYCSNRT-SHVVKLDLQGSGY  95

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFDR--IPSFIGslnnlvylnlsynK  500
              D          G IS SLL L  L +LDLS N+FD+  IP FIGSL+ L YL+LS + 
Sbjct  96   TIDSDS--RKVLAGNISSSLLGLQHLRYLDLSSNEFDKMQIPEFIGSLHKLRYLDLSMSM  153

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F G VPP LGN+S L YL++  N  G  +   D + W+S L+S+E+L+M  V+L ++  W
Sbjct  154  FTGRVPPQLGNLSNLHYLNLAYNSDG--IYSTD-ITWLSRLTSVEHLDMTWVNLSTIVHW  210

Query  681  LHSISKLSFLR  713
            L  ++ L  L+
Sbjct  211  LPVVNMLPTLK  221



>ref|XP_006446689.1| hypothetical protein CICLE_v10017769mg [Citrus clementina]
 gb|ESR59929.1| hypothetical protein CICLE_v10017769mg [Citrus clementina]
Length=996

 Score = 85.1 bits (209),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 107/193 (55%), Gaps = 16/193 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNTTTAHVVALHLGRQG  323
            C E ER+ALL FK  ++ D     S  S     DCCKW GV C N T  HV+ L+L  + 
Sbjct  36   CIEKERQALLMFKQGLVDDCGYLSSWGSDEGRKDCCKWSGVQCSNRT-GHVIMLNLKYKV  94

Query  324  LCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsyn  497
                   C N   +G I+ SLL L  L++LDLS N F  + IP FIGS   L +L+LS  
Sbjct  95   ----DPVCPNRPLRGNINSSLLELQHLHYLDLSVNDFLGNPIPEFIGSFTKLRFLDLSLA  150

Query  498  KFVGNVPPHLGNISTLKYLDIG-NNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVS  674
             F G +P  LGN++ L+ L++G N+ Y      V    W+SHL+ L  L++D VDL   S
Sbjct  151  NFSGRIPYQLGNLTNLQSLNLGYNSLY------VSKFGWLSHLNKLTQLDLDFVDLSEAS  204

Query  675  DWLHSISKLSFLR  713
            DWL  I+ L+ LR
Sbjct  205  DWLQVITSLASLR  217



>gb|KCW64523.1| hypothetical protein EUGRSUZ_G02124, partial [Eucalyptus grandis]
Length=632

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 80/202 (40%), Positives = 105/202 (52%), Gaps = 25/202 (12%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHL-----  311
            SCF  ER+ALL F+  +I       S    D  CC+WK        T HV  L L     
Sbjct  20   SCFGTEREALLKFRQGLIDHSKRLSSWTSKD--CCEWKV-----KKTGHVFKLDLRNPFC  72

Query  312  -----GRQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnn  470
                 GR   C+D S        G+I  SL  L  L +LDLS N F   +IP F  +L  
Sbjct  73   ETFLPGRDVSCSDKS-----SLAGKIHASLAELKHLKYLDLSLNNFSKQKIPQFFSTLQR  127

Query  471  lvylnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMD  650
            L YLNLS   F GN+PPHLGN+S L+YLD+  +++G+     D L W+S  SSL+Y ++ 
Sbjct  128  LEYLNLSNAGFDGNIPPHLGNLSNLRYLDL-TSWFGKGDLTTDNLRWVSKSSSLKYFHLA  186

Query  651  CVDLHSVSDWLHSISKLSFLRT  716
             +DL    DW  SI+ LS L++
Sbjct  187  NIDLRKAKDWFSSINMLSSLQS  208



>ref|XP_009394666.1| PREDICTED: uncharacterized protein LOC103980107 [Musa acuminata 
subsp. malaccensis]
Length=1728

 Score = 85.5 bits (210),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 101/197 (51%), Gaps = 21/197 (11%)
 Frame = +3

Query  147   SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG----  314
             SC E+ER+ALL+ K            S     DCC W+GV C+N T  HV  LHL     
Sbjct  904   SCMESERRALLAIK--SDMYEPDDWFSTWTGKDCCGWRGVACNNIT-GHVTKLHLRYPYT  960

Query  315   -RQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvyln  485
               Q L T G    NP  Q         L  L +LDL  N F    +P  I SL +L YLN
Sbjct  961   YHQALETIGGSKVNPSLQ--------ELKHLEYLDLIMNNFSGAPVPKMISSLVHLEYLN  1012

Query  486   lsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLH  665
             LSY  F G +PP  GN+S L YLD+ + F G     VD L+W+S + SL++L+M  VDL 
Sbjct  1013  LSYAMFDGLIPPQFGNLSNLHYLDL-HGFLGDL--YVDDLDWLSRIPSLKHLDMSLVDLS  1069

Query  666   SVSDWLHSISKLSFLRT  716
               S+W H ++ +S L  
Sbjct  1070  RASNWFHIVNSISTLEV  1086


 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 102/206 (50%), Gaps = 31/206 (15%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ--  320
            SC E+ER+ALL+ K         +  S     DCC W+GV  DNTT  HV  L L     
Sbjct  50   SCMESERRALLAIK--SDMYDPDNWFSSWTGKDCCGWRGVAYDNTT-GHVTKLDLRYPYT  106

Query  321  ----------GLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFDR--IPSFIGsl  464
                       + T G+   NP  Q         L  L +LDLS N F    +P+ I SL
Sbjct  107  YTYDMWDVFYDVETIGASKVNPSLQ--------ELKHLKYLDLSMNNFSHAPVPTMIASL  158

Query  465  nnlvylnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLN  644
             +L YLNLS   F G +PP   N+S L YLD+ + +Y      VD L+W+S + SL+YL+
Sbjct  159  VHLEYLNLSNAMFDGPIPPQFENLSNLHYLDL-HGWYDDL--HVDDLDWLSRIPSLKYLD  215

Query  645  MDCVDLHSVSDW---LHSISKLSFLR  713
            M  VDL   ++W   ++SI  L  LR
Sbjct  216  MSYVDLSKATNWFYVINSIPALEVLR  241



>ref|XP_006424163.1| hypothetical protein CICLE_v10029837mg [Citrus clementina]
 gb|ESR37403.1| hypothetical protein CICLE_v10029837mg [Citrus clementina]
Length=975

 Score = 85.1 bits (209),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 116/198 (59%), Gaps = 14/198 (7%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            N +  C ++ER+ALL  K  +        S    D DCC W GV C+N T  HV+ L+LG
Sbjct  10   NPNVVCVDSERQALLKLKQDLSDPSNRLASWNIGDGDCCAWDGVVCNNFT-GHVLQLNLG  68

Query  315  RQGLCTDGSPCYNPGFQ--GEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvyl  482
                  + +P Y  G +  G+I+PSL  L  L  LDLS N F   +IPS++GSL NL YL
Sbjct  69   ------NPNPNYGTGSKLVGKINPSLFDLKHLIHLDLSDNDFQGIQIPSYLGSLKNLRYL  122

Query  483  nlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDL  662
            NLS  +F G +P  LGNIS L+YLD+  ++Y  +   V+++ W+S LS LE+L++  VDL
Sbjct  123  NLSGAEFAGVIPHQLGNISNLQYLDLSKSYYELQ---VESISWLSGLSFLEHLDLSLVDL  179

Query  663  HSVSDWLHSISKLSFLRT  716
               SD L +I+ L  L+ 
Sbjct  180  TKSSDGLVTINSLPSLKV  197



>emb|CDP04895.1| unnamed protein product [Coffea canephora]
Length=829

 Score = 84.7 bits (208),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 113/199 (57%), Gaps = 21/199 (11%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTA-------HVVAL  305
            +C E+ER+ALL  KH +  +     S  G+   CC W+GVGC  TT +       + V L
Sbjct  42   TCIESERRALLQLKHGLKDESNRLSSWIGEG--CCSWEGVGCHKTTGSVLKLDLCNTVPL  99

Query  306  HLGRQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvy  479
            +      CT+   C      G++SP L++L  L +LDLS N F   ++P+F+G L NL Y
Sbjct  100  YSDEDSHCTN---C----LGGQLSPFLVNLTNLRYLDLSVNNFSTFQVPTFLGLLENLRY  152

Query  480  lnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVD  659
            LNLS  KF G +P HLGN+S L+YLDIG +  G  +K    L+W+  LSSLE L +  V+
Sbjct  153  LNLSNAKFDGEIPHHLGNLSLLRYLDIGLSSSGSTIK---DLKWVVRLSSLEVLVLSLVN  209

Query  660  LHSVSDWLHSISKLSFLRT  716
            L +  D L +IS L  L T
Sbjct  210  LSAAQDGLRAISMLPSLTT  228



>ref|XP_004298186.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Fragaria vesca subsp. vesca]
Length=551

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 98/159 (62%), Gaps = 7/159 (4%)
 Frame = +3

Query  246  CCKWKGVGCDNTTTAHVVALHLGRQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsF  425
            CC W+GV CDN T  HV  LHLG + L + G       F+G + P L+ L  L ++DL+ 
Sbjct  67   CCAWEGVYCDNLT-GHVDQLHLGGEVLSSQGELLDYIPFKGTLGPKLIELQHLVYIDLTS  125

Query  426  NKFD--RIPSFIGslnnlvylnlsynKFVGNVPPH-LGNISTLKYLDIGNNFYGQRLKVV  596
            N+     IP FIGSL ++ YL+LS   FVG +P H LGN++ L+YLD+ ++ +      +
Sbjct  126  NRLQLSPIPGFIGSLPHIRYLDLSEAGFVGEIPYHELGNLTHLQYLDLSSSDFTNS---I  182

Query  597  DTLEWISHLSSLEYLNMDCVDLHSVSDWLHSISKLSFLR  713
            +   W+ HLSSL+YL++  V+L +V DW  +++KL  LR
Sbjct  183  EFFSWLPHLSSLKYLDLSFVNLSNVFDWPETVNKLHNLR  221



>ref|XP_004969084.1| PREDICTED: receptor-like protein kinase 5-like [Setaria italica]
Length=956

 Score = 84.7 bits (208),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 117/195 (60%), Gaps = 11/195 (6%)
 Frame = +3

Query  135  NGS-RSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHL  311
            NG+ + C  +ER ALL+F+        ++  S  + D CC+WKGV C N + +H+V L L
Sbjct  32   NGTIKKCIAHERSALLTFR--AGLSDPANRLSSWEGDSCCQWKGVQCSNRS-SHIVKLDL  88

Query  312  GRQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFDR--IPSFIGslnnlvyln  485
              QG   D S        G IS SL+ L  L +LDLS N+FD+  IP F+GS + L YL+
Sbjct  89   --QGPDCDNSDASMQVLGGNISSSLIVLQQLQYLDLSCNRFDKVQIPEFLGSFHELRYLD  146

Query  486  lsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLH  665
            LS +  VG +PP LGN+S L+YL++ ++ +G        + W+S LSSLE+L+M  V+L 
Sbjct  147  LSQSSLVGRIPPQLGNLSNLRYLNL-DSIFGDTHST--DITWLSRLSSLEHLDMSWVNLS  203

Query  666  SVSDWLHSISKLSFL  710
            ++++W+  ++ L  L
Sbjct  204  TITNWVSVMNMLPSL  218



>gb|AEQ27758.1| receptor-like protein [Malus domestica]
Length=1041

 Score = 84.7 bits (208),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 118/195 (61%), Gaps = 12/195 (6%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            C E+ER+ALL FK  +        S    +  DCC W  V C + T  H+  LHL   G 
Sbjct  37   CKESERQALLLFKQDLKDPANQLASWVAEEGSDCCSWTRVFCGHMT-GHIQELHL--NGF  93

Query  327  C----TDGSPC-YNPGFQGEIspsllhlpflnfldlsFNKFDR--IPSFIGslnnlvyln  485
            C    +D     ++  F G+I+PSLL+L  LNFLDLS N F+R  IPSF GS+ +L +LN
Sbjct  94   CFHSFSDSFDLDFDSCFSGKINPSLLNLKHLNFLDLSNNNFNRTQIPSFFGSMTSLTHLN  153

Query  486  lsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLH  665
            L+ ++F G +P  LGN+S+L+YL++ + F+G  LK V+ L+WIS LS L++L++  V+L 
Sbjct  154  LANSEFYGIIPHKLGNLSSLRYLNLSSGFFGPHLK-VENLQWISSLSLLKHLDLSSVNLS  212

Query  666  SVSDWLHSISKLSFL  710
              SDWL   + L  L
Sbjct  213  KASDWLQVTNMLPSL  227



>ref|XP_007214523.1| hypothetical protein PRUPE_ppa015660mg, partial [Prunus persica]
 gb|EMJ15722.1| hypothetical protein PRUPE_ppa015660mg, partial [Prunus persica]
Length=881

 Score = 84.7 bits (208),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 107/196 (55%), Gaps = 16/196 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E ERKAL SFK  +        S  G D  CC W+G+ C+N T  HV  + L      
Sbjct  5    CIEEERKALASFKQDLTDPSGRLSSWVGHD--CCNWEGISCNNRT-GHVSQMDLRNPHPY  61

Query  330  T-------DGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvyl  482
                    D          G+I+PSLL L  L++LDLS+N F+   IP+F G L  L YL
Sbjct  62   VWWNDEEWDELAYNKSCLGGKINPSLLSLKHLHYLDLSWNNFEGIHIPNFFGELKTLRYL  121

Query  483  nlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDL  662
            N+S  +F G +PP LGN+S L YLD G  +Y         L W+SHLSSL+YLN++ VDL
Sbjct  122  NISSAQFAGEIPPSLGNLSNLNYLDAG--WYSSL--SSKNLNWLSHLSSLKYLNLNGVDL  177

Query  663  HSVSDWLHSISKLSFL  710
            H  ++WLH ++ L  L
Sbjct  178  HGNTNWLHIVNMLPSL  193



>ref|XP_010910550.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180, partial [Elaeis guineensis]
Length=484

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 102/190 (54%), Gaps = 18/190 (9%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C + ER ALL  K S+        S  G +  CC W GVGC N +  HV+ L L    L 
Sbjct  28   CVKFERLALLKLKQSLKDPMDELASWKGIN--CCSWGGVGCHNRS-GHVIRLKLDSMSL-  83

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynKF  503
                        GEI+PSLL L  L  LDLS N F+   IP FIG L  L  LNLS   F
Sbjct  84   -----------GGEINPSLLELKHLRSLDLSMNDFNGTNIPEFIGLLTKLKNLNLSNASF  132

Query  504  VGNVPPHLGNISTLKYLDIG-NNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
             G +P  LGN+S L+YLD+G N+    R    D L W+S+LSSL+YL+M  V+L    +W
Sbjct  133  GGPIPHQLGNLSRLRYLDLGLNDIVPTRGLQDDDLRWVSNLSSLQYLDMSMVNLTKAGNW  192

Query  681  LHSISKLSFL  710
             ++I+K+  L
Sbjct  193  FYAINKIPSL  202



>ref|XP_004971980.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like [Setaria italica]
Length=337

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 110/201 (55%), Gaps = 14/201 (7%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C   ER ALLSF+ + I+    +  +     DCC+W+GV C N T  HV+ + L  +   
Sbjct  36   CTTKERDALLSFR-AGITSDPQNPLASWSGKDCCQWRGVECSNNT-CHVIKVDLCNKFFL  93

Query  330  TD-GSPCYNPGFQG---EIspsllhlpflnfldlsFNKFD----RIPSFIGslnnlvyln  485
             D  +P Y+P F+G   +IS  LL L  L +LDLS N        IPSF+GS   L+YLN
Sbjct  94   DDLFAPFYSPSFRGMNGKISHGLLTLRHLKYLDLSGNHLGGVGIPIPSFLGSFRRLIYLN  153

Query  486  lsynKFVGNVPPHLGNISTLKYLDIGNNFYG----QRLKVVDTLEWISHLSSLEYLNMDC  653
            LS   F G VPP LGN+S L+YLD+ N +Y       +   + L W+  L  L +L+M  
Sbjct  154  LSCMDFDGMVPPQLGNLSKLQYLDLDNTYYDYSGYDNVLQSEDLSWLPRLPFLRFLDMSG  213

Query  654  VDLHSVSDWLHSISKLSFLRT  716
            V+L ++  W+  +S LS LR 
Sbjct  214  VNLSTIGHWVQVVSMLSNLRA  234



>gb|KDO39365.1| hypothetical protein CISIN_1g047152mg, partial [Citrus sinensis]
Length=776

 Score = 84.7 bits (208),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 113/194 (58%), Gaps = 18/194 (9%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNTTTAHVVALHLGRQG  323
            C + ER+ALL+FK S++ +     S     +  DCCKW GVGC +  T HV  L L  Q 
Sbjct  36   CIDEEREALLTFKASLVDESGILSSWRREDEKRDCCKWTGVGC-SKRTGHVNKLDL--QP  92

Query  324  LCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsyn  497
            +  D  P      +G+I+P+LL L  L +LDLS N F    IP F+GSL  L YL LS  
Sbjct  93   IGFDSFP-----LRGKITPALLKLQHLTYLDLSRNNFSGSSIPEFLGSLGKLSYLGLSSA  147

Query  498  KFVGNVPPHLGNISTLKYLDIG-NNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVS  674
            +F G +P  LGN+S L++LD+  NN +       + L+W+SHLSSL YL +D  DL + S
Sbjct  148  EFAGPIPHQLGNLSRLQFLDLSFNNLFSG-----ENLDWLSHLSSLIYLYLDLNDLSNFS  202

Query  675  DWLHSISKLSFLRT  716
            +W+  +SKL  L T
Sbjct  203  NWVQLLSKLHSLTT  216



>gb|EMS60635.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Triticum 
urartu]
Length=1077

 Score = 84.7 bits (208),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 117/208 (56%), Gaps = 33/208 (16%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            SC   ER +LL+F+        ++L      DDCC+WKGV C N T  HVV L L     
Sbjct  39   SCIAGERSSLLAFR--AGLSDPTNLLPSWKGDDCCRWKGVYCSNRT-RHVVRLDLR----  91

Query  327  CTDGSPCYNPGFQ------GEIspsllhlpflnfldlsFNKFDR--IPSFIGslnnlvyl  482
                 P Y  G Q      G IS SLL L  L +LDLS N+FD+  IP FIGSL+ L YL
Sbjct  92   ----GPDYRNGNQSRQVLAGNISSSLLGLHHLRYLDLSQNRFDKKQIPEFIGSLHQLRYL  147

Query  483  nlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDT----------LEWISHLSSL  632
            +LS+++F G +PPHLGN+S L+YL++  N Y      VD+          + W+S L+SL
Sbjct  148  DLSWSQFTGRIPPHLGNLSNLQYLNLDTNSYVS----VDSSFHSGTYSTNITWLSRLTSL  203

Query  633  EYLNMDCVDLHSVSDWLHSISKLSFLRT  716
            E+L+M  V+L ++  WL  ++ LS L+ 
Sbjct  204  EHLDMTGVNLSTIVHWLPVVNMLSILKV  231



>ref|XP_009385818.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Musa acuminata subsp. malaccensis]
Length=917

 Score = 84.7 bits (208),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 106/195 (54%), Gaps = 16/195 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            CF  ER+ALL FK         +  S     DCC W GV C   TT HVV L L R    
Sbjct  29   CFSMEREALLDFK--AGIHDTQNRLSSWVGQDCCAWAGVIC-RATTGHVVKLDL-RNTNT  84

Query  330  TDGSPCYNPGFQGE-IspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynK  500
             DG+       +GE ++ SLL L  L  LDLSFN F   RIP FIGS   L YLNLS   
Sbjct  85   LDGA------LRGERMNSSLLALSHLRHLDLSFNDFSGIRIPEFIGSFKKLRYLNLSSTY  138

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLK---VVDTLEWISHLSSLEYLNMDCVDLHSV  671
            F+G +P  LGN+S+L  LD+ +  Y         VD L+W+SHL+SL++L++  ++L  V
Sbjct  139  FMGGIPARLGNLSSLYVLDLSDALYVDDYGNGYPVDNLDWLSHLTSLKHLDLSELNLTVV  198

Query  672  SDWLHSISKLSFLRT  716
             DW  S++ L  L+ 
Sbjct  199  PDWFSSVNMLPSLQV  213



>gb|KDO50225.1| hypothetical protein CISIN_1g0032002mg, partial [Citrus sinensis]
Length=713

 Score = 84.3 bits (207),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 109/189 (58%), Gaps = 14/189 (7%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E ER+ALL FK  +        S  GD D CC W GV C N T  H++ L+L      
Sbjct  31   CLETERRALLRFKQDLQDPSNRLASWTGDGD-CCTWAGVACGNVT-GHILELNLRNPSTS  88

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynKF  503
               S        G+++P+LL L  L++LDLS N F   +IP FIGS+ NL YLNLS  +F
Sbjct  89   NPRSMLV-----GKVNPALLDLKHLSYLDLSSNDFQGVQIPRFIGSMRNLRYLNLSDTQF  143

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWL  683
            VG +PP LGN+S L++LD+ +N+       VD + W+S LS LE+L++  V+L   SDWL
Sbjct  144  VGMIPPQLGNLSDLQFLDLSSNYL-----YVDNVWWLSGLSFLEHLDLRSVNLSKASDWL  198

Query  684  HSISKLSFL  710
             + + L  L
Sbjct  199  MATNTLPSL  207



>ref|XP_007214101.1| hypothetical protein PRUPE_ppa016834mg, partial [Prunus persica]
 gb|EMJ15300.1| hypothetical protein PRUPE_ppa016834mg, partial [Prunus persica]
Length=977

 Score = 84.7 bits (208),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 107/196 (55%), Gaps = 16/196 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E ERKAL SFK  +        S  G D  CC W+G+ C+N T  HV  + L      
Sbjct  41   CIEEERKALASFKQDLTDPSGRLSSWVGHD--CCNWEGISCNNRT-GHVSQMDLRNPHPY  97

Query  330  T-------DGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvyl  482
                    D          G+I+PSLL L  L++LDLS+N F+   IP+F G L  L YL
Sbjct  98   VWWNDEEWDELAYNKSCLGGKINPSLLSLKHLHYLDLSWNNFEGIHIPNFFGELKTLRYL  157

Query  483  nlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDL  662
            N+S  +F G +PP LGN+S L YLD G  +Y         L W+SHLSSL+YLN++ VDL
Sbjct  158  NISSAQFAGEIPPSLGNLSNLNYLDAG--WYSSL--SSKNLNWLSHLSSLKYLNLNGVDL  213

Query  663  HSVSDWLHSISKLSFL  710
            H  ++WLH ++ L  L
Sbjct  214  HGNTNWLHIVNMLPSL  229



>ref|XP_007214083.1| hypothetical protein PRUPE_ppa015322mg, partial [Prunus persica]
 gb|EMJ15282.1| hypothetical protein PRUPE_ppa015322mg, partial [Prunus persica]
Length=978

 Score = 84.7 bits (208),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 111/194 (57%), Gaps = 16/194 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E ER+AL+SFK  +        S  G D  CC+W+G+ C+N T  HV  + L R    
Sbjct  39   CIEEERQALVSFKQDLKDPSGRLSSWVGHD--CCQWEGISCNNRT-GHVAKMDL-RSSYP  94

Query  330  TDGSPCYNPG--FQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsyn  497
                P    G    G+I+PSLL L  L +LDLS N F    IP F G L +L YLN+S+ 
Sbjct  95   YPRQPDEEWGSSLGGKINPSLLSLKHLYYLDLSLNNFQGIPIPKFFGELKSLRYLNISFA  154

Query  498  KFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHS---  668
             F G +PP LGN+S L YLD+ +++Y     V   L W+SHLSSL+YLN++ V+L S   
Sbjct  155  WFGGEIPPSLGNLSNLNYLDLSSSYY-----VSKNLNWLSHLSSLKYLNLNRVNLSSTTG  209

Query  669  VSDWLHSISKLSFL  710
            V++W+H  + L  L
Sbjct  210  VTNWMHHFNMLPSL  223



>ref|XP_010655310.1| PREDICTED: leucine-rich repeat receptor-like protein CLAVATA2 
[Vitis vinifera]
Length=338

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 111/197 (56%), Gaps = 21/197 (11%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHV-VALHLGRQGL  326
            C E++R+AL+  K         +  S     +CC+WKG+ C+N+T + + V LH      
Sbjct  33   CLESDREALIDLK--SDLKYSKNRFSSWKGSNCCQWKGISCENSTRSVISVDLH------  84

Query  327  CTDGSPCY------NPGFQGEIspsllhlpflnfldlsFNKFDRIP--SFIGslnnlvyl  482
                SP Y      +    GEIS SLL L  L  LDLSFN F+ IP   F GSL NL YL
Sbjct  85   -NPYSPLYEFEKRSSMNLSGEISSSLLKLKSLKHLDLSFNTFESIPIPEFFGSLKNLQYL  143

Query  483  nlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDL  662
            N+S   F G +PP+LGN+S L+YLD+ +  YG  L   D  EW+  L SL++L M+ VDL
Sbjct  144  NISNAGFSGVIPPNLGNLSRLQYLDLSSQ-YGNGLS-ADNFEWMIGLISLKHLKMNQVDL  201

Query  663  HSV-SDWLHSISKLSFL  710
              V S+W+  ++KL FL
Sbjct  202  SFVRSNWVDVLNKLPFL  218



>ref|XP_002315907.2| scab resistance family protein [Populus trichocarpa]
 gb|EEF02078.2| scab resistance family protein [Populus trichocarpa]
Length=994

 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 113/190 (59%), Gaps = 13/190 (7%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            SC + ER ALL FK  +  D    LS  G+D  CC WKGV C N T  HVV L L  + +
Sbjct  30   SCIKRERDALLKFKQGLTDDSGQLLSWIGED--CCTWKGVSCSNRT-GHVVQLDLRNRQV  86

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynK  500
                S       +GEI+ SLL+L  L++LDLS N F    IP+F+GSL NL YLNLS+  
Sbjct  87   ----SFANKTTLRGEINHSLLNLTRLDYLDLSLNNFQGAEIPAFLGSLKNLKYLNLSHAS  142

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F G V  HLGN+S L+YLD+  N YG +   VDTL+W S L SL++L++  + L    DW
Sbjct  143  FNGQVSHHLGNLSNLQYLDLSWN-YGLK---VDTLQWASTLPSLKHLDLSGLKLTKAIDW  198

Query  681  LHSISKLSFL  710
            L S++ L  L
Sbjct  199  LESVNMLPSL  208



>ref|XP_006424167.1| hypothetical protein CICLE_v10030038mg, partial [Citrus clementina]
 gb|ESR37407.1| hypothetical protein CICLE_v10030038mg, partial [Citrus clementina]
Length=958

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 81/198 (41%), Positives = 111/198 (56%), Gaps = 15/198 (8%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            N + +C ++ER+ALL  K  +        S    D DCC W GV C+N T  HV+ L+LG
Sbjct  5    NSNVACIDSERQALLKLKQDLNDPSNRLASWNIGDGDCCAWDGVVCNNFT-GHVLQLNLG  63

Query  315  RQGLCTDGSPCYN--PGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvyl  482
                  +  P Y       G+I+PSL+ L  L  LDLS N F   +IP ++GSL NL YL
Sbjct  64   ------NPDPNYGTVSKLVGKINPSLVDLTHLIHLDLSGNDFHGIQIPKYLGSLKNLRYL  117

Query  483  nlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDL  662
            NLS  KF G +P  LGN+S L+YLD+  N+  Q    V++  W+S LS LE+L++   DL
Sbjct  118  NLSRAKFAGVIPYQLGNLSNLQYLDLSENYESQ----VESFSWLSGLSLLEHLDLSDADL  173

Query  663  HSVSDWLHSISKLSFLRT  716
               +DWL   + LS L+ 
Sbjct  174  SKATDWLLVTNSLSSLKV  191



>ref|XP_010662760.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Vitis vinifera]
Length=900

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 108/189 (57%), Gaps = 21/189 (11%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E E++ALLSFKH+++       S    +D CC W+GV C N T A V+ L L    L 
Sbjct  31   CNEKEKQALLSFKHALLHPANQLSSWSIKED-CCGWRGVHCSNVT-ARVLKLELADMNL-  87

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsynKF  503
                        GEISP+LL L FL+ LDLS N F     PSF+GS+ +L +L+LSY  F
Sbjct  88   -----------GGEISPALLKLEFLDHLDLSSNDFRGSPFPSFLGSMGSLKFLDLSYTYF  136

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWL  683
             G  PP LGN+S L +L++G++        V+ L WISHLSSL+YL MD +DLH    WL
Sbjct  137  GGLAPPQLGNLSKLLHLNLGHSGL-----YVENLNWISHLSSLKYLYMDGIDLHRGRHWL  191

Query  684  HSISKLSFL  710
              I  L  L
Sbjct  192  EPIGMLPSL  200



>gb|KJB45924.1| hypothetical protein B456_007G338300 [Gossypium raimondii]
Length=937

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 106/194 (55%), Gaps = 19/194 (10%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            N +  C  +ER+ALL FK+ +I    S  S     D CCKW GV C N +T HV  LHL 
Sbjct  26   NSNLLCIPSEREALLKFKNHLIDPSNSLSSWVEGGD-CCKWIGVVCHN-STGHVHQLHLA  83

Query  315  RQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFDR--IPSFIGslnnlvylnl  488
               L +      NP          L L  L+FLDLS N F    IP F+G L +L YLNL
Sbjct  84   --ALSSYDQSAINPSL--------LELKHLSFLDLSNNNFGSIPIPKFLGMLESLTYLNL  133

Query  489  synKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHS  668
            S  +F G +P +LGN+S L YLD+G N+   +     +L+W+S LSSLEYL++   DLH 
Sbjct  134  SNAQFQGAIPHNLGNLSKLHYLDLGGNYLKPK-----SLQWVSGLSSLEYLDLSSADLHK  188

Query  669  VSDWLHSISKLSFL  710
             +DW+    KL  L
Sbjct  189  ANDWVQVTLKLPSL  202



>ref|XP_006452209.1| hypothetical protein CICLE_v10007386mg [Citrus clementina]
 gb|ESR65449.1| hypothetical protein CICLE_v10007386mg [Citrus clementina]
Length=926

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 109/189 (58%), Gaps = 14/189 (7%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E ER+ALL FK  +        S  GD D CC W GV C N T  H++ L+L      
Sbjct  31   CLETERRALLRFKQDLQDPSNRLASWTGDGD-CCTWAGVACGNVT-GHILELNLRNPSTS  88

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynKF  503
               S        G+++P+LL L  L++LDLS N F   +IP FIGS+ NL YLNLS  +F
Sbjct  89   NPRSMLV-----GKVNPALLDLKHLSYLDLSSNDFQGVQIPRFIGSMRNLRYLNLSDTQF  143

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWL  683
            VG +PP LGN+S L++LD+ +N+       VD + W+S LS LE+L++  V+L   SDWL
Sbjct  144  VGMIPPQLGNLSDLQFLDLSSNYL-----YVDNVWWLSGLSFLEHLDLRSVNLSKASDWL  198

Query  684  HSISKLSFL  710
             + + L  L
Sbjct  199  MATNTLPSL  207



>ref|XP_008349566.1| PREDICTED: LOW QUALITY PROTEIN: LRR receptor-like serine/threonine-protein 
kinase GSO1 [Malus domestica]
Length=1025

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 113/194 (58%), Gaps = 16/194 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHV-VALHLGRQGL  326
            C E+E +AL+ FK  +        S  G +  CC+W+G+ C NTT A + V LH      
Sbjct  27   CLESEXEALIDFKKGLEDPENRLSSWKGSN--CCEWRGIHCHNTTGAVLTVDLH-NPHPQ  83

Query  327  CTDGSPCYNPGF---QGEIspsllhlpflnfldlsFNKFDRIP--SFIGslnnlvylnls  491
               GSP    GF    GEISPSL  L  L  LDLSFN F+ IP   F GSL NL YLNLS
Sbjct  84   DPFGSPSRY-GFWNLSGEISPSLKMLESLKHLDLSFNTFNGIPIXEFFGSLKNLQYLNLS  142

Query  492  ynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSV  671
            +  F G + P+LGN+S+L++LD+ +N        VD LEW++ + S+EYLNM+  DL  V
Sbjct  143  HAGFSGRILPNLGNLSSLQFLDVSSNXIS-----VDNLEWVTGIVSMEYLNMNGADLSXV  197

Query  672  -SDWLHSISKLSFL  710
              DW+  ++KL FL
Sbjct  198  GPDWIPKLNKLLFL  211



>ref|XP_006452275.1| hypothetical protein CICLE_v10007379mg [Citrus clementina]
 gb|ESR65515.1| hypothetical protein CICLE_v10007379mg [Citrus clementina]
Length=942

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 115/200 (58%), Gaps = 18/200 (9%)
 Frame = +3

Query  135  NGSR--SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALH  308
            NGS   +C  +E++ALL FK  +I       S  GD++DCC W GV CDN T  HV  L 
Sbjct  32   NGSSYVACMGSEKEALLRFKQDLIDPSNRLASWIGDEEDCCTWAGVVCDNFT-GHVRMLQ  90

Query  309  LGRQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvyl  482
            L         +P       G+ISPSLL+L  L +LDLSFN F   +IP F+GS+ NL YL
Sbjct  91   L-------RNNPSQISMLGGKISPSLLNLKHLVYLDLSFNDFGGIQIPPFLGSMVNLSYL  143

Query  483  nlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDL  662
            +LS   F+G +P  L N+S L+YLD+   + G      + L W+S LSSLE+L++  VDL
Sbjct  144  DLSSAGFLGMIPHQLANLSNLQYLDLSQKYLGL---YAENLRWLSGLSSLEHLDLSNVDL  200

Query  663  HSVSDWL---HSISKLSFLR  713
               SDWL   +++  L  LR
Sbjct  201  SRASDWLLVMNTLPSLVLLR  220



>gb|EEC71023.1| hypothetical protein OsI_02720 [Oryza sativa Indica Group]
Length=1200

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 109/186 (59%), Gaps = 9/186 (5%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            N +  C  +ER AL+SFK         +L S  + DDCC W GV C+N T  H+V L+L 
Sbjct  31   NSTGGCIPSERSALISFK--SGLLDPGNLLSSWEGDDCCPWNGVWCNNET-GHIVELNL-  86

Query  315  RQGLCTDGSP--CYNPGFQGEIspsllhlpflnfldlsFNKFD-RIPSFIGslnnlvyln  485
              G C    P     PG  G I PSLL L  L  LDLS N F   +P F+GSL+NL  L+
Sbjct  87   PGGSCNILPPWVPLEPGLGGSIGPSLLGLKQLEHLDLSCNNFSGTLPEFLGSLHNLRSLD  146

Query  486  lsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLH  665
            LS++ FVG VPP LGN+S L+Y  +G+N     L   D + W+S LSSLE+L+M  V+L 
Sbjct  147  LSWSTFVGTVPPQLGNLSNLRYFSLGSN-DNSSLYSTD-VSWLSRLSSLEHLDMSLVNLS  204

Query  666  SVSDWL  683
            +V DW+
Sbjct  205  AVVDWV  210



>gb|EMS60645.1| Leucine-rich repeat receptor protein kinase EXS [Triticum urartu]
Length=935

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 113/203 (56%), Gaps = 25/203 (12%)
 Frame = +3

Query  138  GSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGR  317
            G+ +C   ER ALLSFK        +   S    +DCC+W+GV C ++ T HV+ L+L  
Sbjct  37   GTGTCITRERDALLSFK--ADLLDPTGRLSSWHGEDCCQWEGVQC-SSRTGHVMKLNLRN  93

Query  318  QGLCTDGSPCYNPGFQ--------GEIspsllhlpflnfldlsFNKFD--RIPSFIGsln  467
                      Y  G++         E+S SL  L  L +LDLS+N F+   IP+ +GSL 
Sbjct  94   ---------TYENGYKYNSLKLERDEMSSSLAALQQLRYLDLSWNDFNGASIPASMGSLE  144

Query  468  nlvylnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNM  647
            NL YLNLS + F G +P  LGN+S LKYLD+G +     L+ VD L W+S LS L YL++
Sbjct  145  NLRYLNLSMSDFSGTIPSQLGNLSNLKYLDVGGD--NNSLQAVD-LAWLSRLSLLTYLDL  201

Query  648  DCVDLHSVSDWLHSISKLSFLRT  716
               DL  V DW+H ++ LS L+ 
Sbjct  202  SYADLSDVRDWVHVVNPLSSLKV  224



>ref|XP_006452261.1| hypothetical protein CICLE_v10010776mg, partial [Citrus clementina]
 gb|ESR65501.1| hypothetical protein CICLE_v10010776mg, partial [Citrus clementina]
Length=974

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 115/200 (58%), Gaps = 18/200 (9%)
 Frame = +3

Query  135  NGSR--SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALH  308
            NGS   +C  +E++ALL FK  +I       S  GD++DCC W GV CDN T  HV  L 
Sbjct  64   NGSSYVACMGSEKEALLRFKQDLIDPSNRLASWIGDEEDCCTWAGVVCDNFT-GHVRMLQ  122

Query  309  LGRQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvyl  482
            L         +P       G+ISPSLL+L  L +LDLSFN F   +IP F+GS+ NL YL
Sbjct  123  L-------RNNPSQISMLGGKISPSLLNLKHLVYLDLSFNDFGGIQIPPFLGSMVNLSYL  175

Query  483  nlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDL  662
            +LS   F+G +P  L N+S L+YLD+   + G      + L W+S LSSLE+L++  VDL
Sbjct  176  DLSSAGFLGMIPHQLANLSNLQYLDLSQKYLGL---YAENLRWLSGLSSLEHLDLSNVDL  232

Query  663  HSVSDWL---HSISKLSFLR  713
               SDWL   +++  L  LR
Sbjct  233  SRASDWLLVMNTLPSLVLLR  252



>ref|XP_009378842.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Pyrus x bretschneideri]
Length=983

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 114/190 (60%), Gaps = 10/190 (5%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            C E+ER+ALL FK  +        S    +D DCC W GV CD+ T  H+  LHL     
Sbjct  37   CKESERQALLMFKQDLKDPANRLASWVAEEDSDCCSWTGVVCDHMT-GHIHELHLNNSDS  95

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsynK  500
              D + C    F G+I+PSLL L  LN+LDLS N F   +IPSF GS+ +L +LNL+Y++
Sbjct  96   DWDCNSC----FGGKINPSLLSLKHLNYLDLSNNDFRTTQIPSFFGSMTSLTHLNLAYSQ  151

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F G +P  LGN+S+L+YL++ + +Y      V+ L+WIS LS L++L++  V+L   SDW
Sbjct  152  FDGVIPHKLGNLSSLRYLNVSSLYYSSL--TVENLQWISGLSLLKHLDLSSVNLSKASDW  209

Query  681  LHSISKLSFL  710
            L   + L  L
Sbjct  210  LQVTNMLPSL  219



>gb|KDO58288.1| hypothetical protein CISIN_1g002600mg [Citrus sinensis]
Length=902

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 115/198 (58%), Gaps = 14/198 (7%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            N +  C ++ER+ALL  K  +        S    D DCC W GV C+N T  HV+ L+LG
Sbjct  31   NPNVGCVDSERQALLKLKQDLSDPSNRLASWNIGDGDCCAWDGVVCNNFT-GHVLQLNLG  89

Query  315  RQGLCTDGSPCYNPGFQ--GEIspsllhlpflnfldlsFNKFDRI--PSFIGslnnlvyl  482
                  + +P Y  G +  G+I+PSL  L  L  LDLS N F  I  PS++GSL NL YL
Sbjct  90   ------NPNPNYGTGSKLVGKINPSLFDLKHLIHLDLSDNDFQGIQTPSYLGSLKNLRYL  143

Query  483  nlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDL  662
            NLS  +F G +P  LGNIS L+YLD+  ++Y  +   V+++ W+S LS LE+L++  VDL
Sbjct  144  NLSGAEFAGVIPHQLGNISNLQYLDLSKSYYELQ---VESISWLSGLSFLEHLDLSLVDL  200

Query  663  HSVSDWLHSISKLSFLRT  716
               SD L +I+ L  L+ 
Sbjct  201  TKSSDGLVTINSLPSLKV  218



>ref|XP_009385819.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Musa acuminata subsp. malaccensis]
Length=902

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 106/195 (54%), Gaps = 15/195 (8%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQ  320
            +  CF  ER+ALL FK         +  S     DCC W+GV C   TT HVV L L   
Sbjct  26   TSGCFSMEREALLDFK--AGIHDTYNRLSSWVGQDCCAWEGVIC-GATTGHVVMLDLRNT  82

Query  321  GLCTDGSPCYNPGFQGE-IspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnls  491
             +       Y+   +GE ++ SLL L  L  LDLSFN F   RIP FIGS   L YLNLS
Sbjct  83   NI-------YDWKLRGERMNSSLLALSHLERLDLSFNDFSGIRIPEFIGSFKKLRYLNLS  135

Query  492  ynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSV  671
               F+G +P  LGN+S+L  LD+ +  +      VD L W+SHL+SL++L++  ++L  V
Sbjct  136  STNFMGGIPARLGNLSSLHVLDLSDALHFT--SHVDNLHWLSHLTSLKHLDLSGLNLTDV  193

Query  672  SDWLHSISKLSFLRT  716
             DW  S++ L  L+ 
Sbjct  194  PDWFSSVNMLPSLQV  208



>ref|XP_009394655.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Musa acuminata subsp. malaccensis]
Length=1219

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 108/196 (55%), Gaps = 9/196 (5%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHV--VALHLG  314
            S SC E+ER+ALL+ K         +  S     DCC W+GV CD+TT  HV  + LH  
Sbjct  48   SSSCMESERRALLAIK--SDMYDPDNWFSTWTGKDCCGWRGVACDHTT-GHVTKLDLHYS  104

Query  315  RQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFDR--IPSFIGslnnlvylnl  488
                  D S         +++PSL  L  L +LDLS N F    +P  I SL +L YLNL
Sbjct  105  YTYYVWDISDIRETMGGSKVNPSLQELKHLKYLDLSMNNFSYAPVPKMIASLVHLEYLNL  164

Query  489  synKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHS  668
            SY  F G +PP LGN+S L YLD+   +YG  L V D L+W+S + SL+YL+M  VDL  
Sbjct  165  SYAMFDGLIPPQLGNLSNLHYLDL-QGWYGYHLHV-DNLDWLSRIPSLKYLDMSLVDLSR  222

Query  669  VSDWLHSISKLSFLRT  716
             ++W H ++ +S L  
Sbjct  223  ATNWFHIVNSISTLEV  238



>ref|XP_008343845.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Malus domestica]
Length=916

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 88/187 (47%), Gaps = 40/187 (21%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C + E+ ALL FK  +I +     S     D CC+W+G+ C+N T  HVV L L +  L 
Sbjct  30   CLQAEKTALLQFKQGLIDEXNLLSSWETGXD-CCEWRGIXCNNET-GHVVTLDLYQXXLI  87

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFDRIPSFIGslnnlvylnlsynKFVG  509
              G                                  IP FIGSL+ L  L L+     G
Sbjct  88   VMG---------------------------------EIPKFIGSLSRLEQLKLAGAXLSG  114

Query  510  NVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWLHS  689
             +PP LGN+S+L  LD+  N +       + LEW+SHLSSL YLNM  +++  V +W  S
Sbjct  115  PIPPQLGNLSSLYTLDLAKNNF-----TFENLEWLSHLSSLRYLNMSGLNVSEVVNWPES  169

Query  690  ISKLSFL  710
            ISKL  L
Sbjct  170  ISKLPSL  176



>emb|CBI25207.3| unnamed protein product [Vitis vinifera]
Length=1038

 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 112/194 (58%), Gaps = 17/194 (9%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHV-VALHLGR  317
            S +C +++R+AL+ FK            S     DCC+W+G+GC+  T A + + LH   
Sbjct  67   SGNCLQSDREALIDFK--SGLKFSKKRFSSWRGSDCCQWQGIGCEKGTGAVIMIDLH---  121

Query  318  QGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFDRIP--SFIGslnnlvylnls  491
                 +     N    G+I PSL  L  L +LDLSFN F  IP   F GS  NL YLNLS
Sbjct  122  -----NPEGHKNRNLSGDIRPSLKKLMSLRYLDLSFNSFKDIPIPKFFGSFKNLKYLNLS  176

Query  492  ynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSV  671
            Y  F G +PP+LGN+S L+YLD+ + +  ++L  VD  EW+++L SL++L M  VDL  V
Sbjct  177  YAGFSGVIPPNLGNLSNLQYLDLSSEY--EQLS-VDNFEWVANLVSLKHLQMSEVDLSMV  233

Query  672  -SDWLHSISKLSFL  710
             S W+ +++KL FL
Sbjct  234  GSQWVEALNKLPFL  247



>ref|XP_009367839.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Pyrus x bretschneideri]
Length=1084

 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 72/196 (37%), Positives = 105/196 (54%), Gaps = 16/196 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNTTTAHVVALHLGR--  317
            C E+ER+ALL+FK  ++ D     S        DCCKW GV C N T  HV  LHLGR  
Sbjct  52   CIESEREALLAFKQGLVDDYDLLSSWGREEHKQDCCKWLGVHCSNRTN-HVTQLHLGRSY  110

Query  318  ----QGLCTDGSPCYNPGF-QGEIspsllhlpflnfldlsFN-KFD--RIPSFIGslnnl  473
                  L   G P +   + QG++    L              KF+  ++P FIGSL+NL
Sbjct  111  LDQAHALQQKGRPQFIYYYLQGKMMSPKLTKLKHLKYLDLSRIKFNGSQVPDFIGSLSNL  170

Query  474  vylnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDC  653
             +L+L+Y  F G +P  +GN++ L+YLD+  N +     V D   W+ HLS+L YL++  
Sbjct  171  RHLDLTYASFGGRIPTQIGNLTHLQYLDLRYNNFA---NVEDLNSWMPHLSALTYLDLSG  227

Query  654  VDLHSVSDWLHSISKL  701
             +L +V DW+ +++KL
Sbjct  228  NNLSNVPDWMEAVNKL  243



>ref|XP_010918701.1| PREDICTED: receptor-like protein 12 [Elaeis guineensis]
Length=1085

 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 103/203 (51%), Gaps = 30/203 (15%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHL----G  314
            SC E ER+ALL+ +            S     DCC+W+GVGCDN TT  VV L L    G
Sbjct  67   SCIELERRALLAIR--ADIYDPGEWLSSWTGQDCCQWRGVGCDN-TTGQVVTLDLKYPSG  123

Query  315  RQGLCTDG---SPC-YNPGFQGEIspsllhlpflnfldlsFNKFDRIPSFIGslnnlvyl  482
               +   G    P   NP   G I    L L   NF       F  IP FIGSL +L YL
Sbjct  124  YDLILGTGKILEPSKVNPSISGLIHLRYLDLSMNNF------SFAPIPEFIGSLMHLEYL  177

Query  483  nlsynKFVGNVPPHLGNISTLKYLDIGN------------NFYGQRLKVVDTLEWISHLS  626
            NLS   F G+VP  +GN+S+L YLD+G              +Y   L+V D L+W+S ++
Sbjct  178  NLSKAWFSGSVPRQIGNLSSLHYLDLGGGYLFLDKWYGFAEYYPIALRVND-LQWLSRIT  236

Query  627  SLEYLNMDCVDLHSVSDWLHSIS  695
            SL+YL++   DL   S+WLH I+
Sbjct  237  SLQYLDLSFADLSMASNWLHEIN  259



>ref|XP_010646018.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 [Vitis vinifera]
Length=467

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 104/186 (56%), Gaps = 17/186 (9%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C   ER+AL   K  ++       S   +   CC WKG+GCDN T  HVV ++L  +   
Sbjct  37   CSARERRALQRIKQGLVDQGNYLSSWTREA--CCSWKGIGCDNIT-RHVVKINLSCE---  90

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynKF  503
                P       G+IS SLL L  L +LDLS+N F+  +IP F+GSL  L YLNLS    
Sbjct  91   ----PMEGASLGGDISTSLLDLNHLQYLDLSWNSFEGLQIPEFLGSLTGLRYLNLSNAGL  146

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWL  683
             G+VP  LG  S+L+YLDIG    G  L   + L+WIS LS LE L+M  VDL+  S+WL
Sbjct  147  TGDVPRQLGKQSSLQYLDIG----GISLDTKN-LDWISSLSVLEVLDMSWVDLNKASNWL  201

Query  684  HSISKL  701
             +++ L
Sbjct  202  QAMNTL  207



>ref|XP_002315858.2| scab resistance family protein [Populus trichocarpa]
 gb|EEF02029.2| scab resistance family protein [Populus trichocarpa]
Length=995

 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 114/190 (60%), Gaps = 13/190 (7%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            SC + ER+ALL FK  +  D    LS  G+D  CC WKGV C + T  HVV L L  + +
Sbjct  30   SCIKREREALLKFKQGLTDDSGQLLSWVGED--CCTWKGVSCSHRT-GHVVQLELRNRQV  86

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynK  500
                S       +GEI+ SLL+L  L++LDLS N F    IP+F+GSL NL YLNLS+  
Sbjct  87   ----SFANKTTLRGEINHSLLNLTRLDYLDLSLNNFQGAEIPAFLGSLKNLKYLNLSHAS  142

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F G V  HLGN+S L+YLD+  N YG +   VDTL+W S L SL++L++  + L    DW
Sbjct  143  FNGQVSHHLGNLSNLQYLDLSWN-YGLK---VDTLQWASTLPSLKHLDLSGLKLTKAIDW  198

Query  681  LHSISKLSFL  710
            L S++ L  L
Sbjct  199  LESVNMLPSL  208



>emb|CAN71011.1| hypothetical protein VITISV_002381 [Vitis vinifera]
Length=974

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 112/194 (58%), Gaps = 17/194 (9%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHV-VALHLGR  317
            S +C +++R+AL+ FK            S     DCC+W+G+GC+  T A + + LH   
Sbjct  29   SGNCLQSDREALIDFK--SGLKFSKKRFSSWRGSDCCQWQGIGCEKGTGAVIMIDLH---  83

Query  318  QGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFDRIP--SFIGslnnlvylnls  491
                 +     N    G+I PSL  L  L +LDLSFN F  IP   F GS  NL YLNLS
Sbjct  84   -----NPEGHKNRNLSGDIRPSLKKLMSLRYLDLSFNSFKDIPIPKFFGSFKNLKYLNLS  138

Query  492  ynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSV  671
            Y  F G +PP+LGN+S L+YLD+ + +  ++L  VD  EW+++L SL++L M  VDL  V
Sbjct  139  YAGFSGVIPPNLGNLSNLQYLDLSSEY--EQLS-VDNFEWVANLVSLKHLQMSEVDLSMV  195

Query  672  -SDWLHSISKLSFL  710
             S W+ +++KL FL
Sbjct  196  GSQWVEALNKLPFL  209



>gb|KJB45923.1| hypothetical protein B456_007G338100 [Gossypium raimondii]
Length=954

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 111/195 (57%), Gaps = 18/195 (9%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            N +  C ++ER+ALL FK+ +I       S     D CC+W GV C N+T  HV  LHL 
Sbjct  32   NSNLLCIQSEREALLKFKNHLIDPSNRLSSWVEGGD-CCEWTGVVCHNST-GHVNQLHLA  89

Query  315  RQGLCTDGSPCYNP-GFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvyln  485
                    SP ++P    G+I+PSLL L  L+ LDLS N F    IP F+G L +L +LN
Sbjct  90   --------SPPFSPSALGGKINPSLLELKHLSSLDLSNNDFSSIHIPIFLGMLGSLTHLN  141

Query  486  lsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLH  665
            LS   F G +P +LGN+S L+YLD+  N    +     +L+W+S LSSL+YL++   DLH
Sbjct  142  LSRAGFQGAIPHNLGNLSKLQYLDLRGNDLKSK-----SLQWVSGLSSLQYLDLSYADLH  196

Query  666  SVSDWLHSISKLSFL  710
              +DW+    KL  L
Sbjct  197  KATDWVQVTFKLPSL  211



>ref|XP_010655112.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Vitis vinifera]
Length=1035

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 114/194 (59%), Gaps = 17/194 (9%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHV-VALHLGR  317
            S +C +++R+AL+ FK  +        S  G D  CC+W+G+GC+  T A + + LH   
Sbjct  29   SGNCLQSDREALIDFKSGLKFSKKRFSSWRGSD--CCQWQGIGCEKGTGAVIMIDLH---  83

Query  318  QGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFDRIP--SFIGslnnlvylnls  491
                 +     N    G+I PSL  L  L +LDLSFN F  IP   F GS  NL YLNLS
Sbjct  84   -----NPEGHKNRNLSGDIRPSLKKLMSLRYLDLSFNSFKDIPIPKFFGSFKNLKYLNLS  138

Query  492  ynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSV  671
            Y  F G +PP+LGN+S L+YLD+ + +  ++L  VD  EW+++L SL++L M  VDL  V
Sbjct  139  YAGFSGVIPPNLGNLSNLQYLDLSSEY--EQLS-VDNFEWVANLVSLKHLQMSEVDLSMV  195

Query  672  -SDWLHSISKLSFL  710
             S W+ +++KL FL
Sbjct  196  GSQWVEALNKLPFL  209



>ref|XP_011654866.1| PREDICTED: receptor-like protein 12 [Cucumis sativus]
Length=970

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 102/174 (59%), Gaps = 11/174 (6%)
 Frame = +3

Query  138  GSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGR  317
             +  C + ER+ALL FK+S   DP   L+SW    DCC WKGVGC N  T HV  + L R
Sbjct  33   AAAPCIQKERQALLRFKNSFYDDPSLRLASWNASTDCCNWKGVGC-NQITGHVTIIDLRR  91

Query  318  QGLCTDG--SPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvyln  485
                 D   SP Y+      I  SL  L +L++LDLS N FD  +IPSF+GS+  L YLN
Sbjct  92   DPWQVDCYLSPLYS---NKSIDSSLFELKYLSYLDLSGNYFDSIQIPSFLGSMVELTYLN  148

Query  486  lsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNM  647
            LS       V PHLGN++ L  LD+ NN++     VV   EWISHLSSL++L++
Sbjct  149  LSGTSISSKVLPHLGNLTNLDTLDLSNNYWVDTEGVV---EWISHLSSLQFLDL  199



>ref|XP_002274689.1| PREDICTED: receptor-like protein 12 [Vitis vinifera]
Length=985

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 117/198 (59%), Gaps = 19/198 (10%)
 Frame = +3

Query  138  GSRS-CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            GS++ C E ER+ALLSFK  I        S   ++  CC W+GV C NTT  HV+ L+L 
Sbjct  30   GSKALCREEEREALLSFKRGIHDPSNRLSSWANEE--CCNWEGVCCHNTT-GHVLKLNL-  85

Query  315  RQGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnl  488
            R  L  D     +    GEIS SLL L  L +LDLS N F    IP F+GSL+NL YLNL
Sbjct  86   RWDLYQD-----HGSLGGEISSSLLDLKHLQYLDLSCNDFGSLHIPKFLGSLSNLRYLNL  140

Query  489  synKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHS  668
            S   F G +P  LGN+S L YLDIGN+     L V D LEWIS L+ L++L+M  V+L  
Sbjct  141  SSAGFGGVIPHQLGNLSKLHYLDIGNS---DSLNVED-LEWISGLTFLKFLDMANVNLSK  196

Query  669  VSDWLHSISK---LSFLR  713
             S+WL  ++K   LS LR
Sbjct  197  ASNWLQVMNKFHSLSVLR  214



>ref|XP_010040211.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Eucalyptus grandis]
Length=958

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 106/196 (54%), Gaps = 13/196 (7%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            SC   ER+ALL FKH +        S  G++  CCKW+GV C N  T HV+ L L    +
Sbjct  37   SCIGVEREALLKFKHGLTDPSRRLSSWIGEE--CCKWEGVEC-NKKTGHVLKLDLRNPCI  93

Query  327  CTDGSPCYNPG----FQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnl  488
                   + P       G I PSL  L +L +LDLS N F   RIP F  SL  L YLNL
Sbjct  94   EEIDIDIFIPSDKCMLGGNIVPSLTKLKYLKYLDLSVNNFSTQRIPMFFASLQKLEYLNL  153

Query  489  synKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHS  668
            S+  F G++P  L N+S L+YLD+  N Y       + L W+S LSSL+YL+M  VDL  
Sbjct  154  SHASFNGDIPRQLSNLSKLQYLDLSTNSY----TTSNNLAWVSKLSSLKYLHMSGVDLSK  209

Query  669  VSDWLHSISKLSFLRT  716
            V DW+  I+ L  L++
Sbjct  210  VKDWIGCINMLPSLQS  225



>gb|KCW45386.1| hypothetical protein EUGRSUZ_L00930, partial [Eucalyptus grandis]
Length=884

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 106/196 (54%), Gaps = 13/196 (7%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            SC   ER+ALL FKH +        S  G++  CCKW+GV C N  T HV+ L L    +
Sbjct  17   SCIGVEREALLKFKHGLTDPSRRLSSWIGEE--CCKWEGVEC-NKKTGHVLKLDLRNPCI  73

Query  327  CTDGSPCYNPG----FQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnl  488
                   + P       G I PSL  L +L +LDLS N F   RIP F  SL  L YLNL
Sbjct  74   EEIDIDIFIPSDKCMLGGNIVPSLTKLKYLKYLDLSVNNFSTQRIPMFFASLQKLEYLNL  133

Query  489  synKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHS  668
            S+  F G++P  L N+S L+YLD+  N Y       + L W+S LSSL+YL+M  VDL  
Sbjct  134  SHASFNGDIPRQLSNLSKLQYLDLSTNSY----TTSNNLAWVSKLSSLKYLHMSGVDLSK  189

Query  669  VSDWLHSISKLSFLRT  716
            V DW+  I+ L  L++
Sbjct  190  VKDWIGCINMLPSLQS  205



>ref|XP_009378848.1| PREDICTED: uncharacterized protein LOC103967297 [Pyrus x bretschneideri]
Length=1903

 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 114/190 (60%), Gaps = 10/190 (5%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            C E+ER+ALL FK  +        S    +D DCC W GV CD+ T  H+  LHL     
Sbjct  37   CKESERQALLMFKQDLKDPANRLASWVAEEDSDCCSWTGVVCDHMT-GHIHELHLNNSDS  95

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsynK  500
              D + C    F G+I+PSLL L  LN+LDLS N F   +IPSF GS+ +L +LNL+Y++
Sbjct  96   DWDCNSC----FGGKINPSLLSLKHLNYLDLSNNDFRTTQIPSFFGSMTSLTHLNLAYSQ  151

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F G +P  LGN+S+L+YL++ + +Y      V+ L+WIS LS L++L++  V+L   SDW
Sbjct  152  FDGVIPHKLGNLSSLRYLNVSSLYYSSL--TVENLQWISGLSLLKHLDLSSVNLSKASDW  209

Query  681  LHSISKLSFL  710
            L   + L  L
Sbjct  210  LQVTNMLPSL  219



>ref|XP_002273824.2| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Vitis vinifera]
Length=990

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 116/198 (59%), Gaps = 15/198 (8%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLG  314
            N +  C E E++ALL FK  +        S  G+D  CCKW+GV C+N T   V+ L LG
Sbjct  31   NQNMDCLEVEKEALLKFKQGLTDPSGRLSSWVGED--CCKWRGVSCNNRT-GRVIKLKLG  87

Query  315  R---QGLCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvy  479
                  L  DG+        GEI+PSLL L +LN+LDLS N F    IP FIGSL  L Y
Sbjct  88   NPFPNSLEGDGTASE---LGGEINPSLLSLKYLNYLDLSMNNFGGMEIPKFIGSLGKLRY  144

Query  480  lnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVD  659
            LNLS   F G +PP++ N+S L+YLD+ N +  +  K  + LEW+S LSSL+YLN+  +D
Sbjct  145  LNLSGASFGGMIPPNIANLSNLRYLDL-NTYSIEPNK--NGLEWLSGLSSLKYLNLGGID  201

Query  660  L-HSVSDWLHSISKLSFL  710
            L  + + WL +I+ L  L
Sbjct  202  LSEAAAYWLQTINTLPSL  219



>ref|XP_010908126.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Elaeis guineensis]
Length=897

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 105/197 (53%), Gaps = 16/197 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHL-GRQGL  326
            C   ER ALL+FK  +        S  GDD  CC W+GV CDN T  HV+ L L     L
Sbjct  31   CIPIERNALLAFKEGLKDPSNRLSSWVGDD--CCTWEGVACDNRT-RHVIKLDLRNTHPL  87

Query  327  CTDGSPCYNP-GFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsyn  497
                 P YN     GE+ PSLL L +LN+LDLS N F   RIP F+G    L YLNLS  
Sbjct  88   SYADDPPYNTWSLGGELRPSLLGLKYLNYLDLSMNNFGGIRIPEFMGLFRQLKYLNLSCA  147

Query  498  KFVGNVPPHLGNISTLKYLDIGNN----FYGQRLKV-----VDTLEWISHLSSLEYLNMD  650
               G VP  LGN+S+L+YLD+  N    FYG  +++     +D   WIS LSSL YLNM 
Sbjct  148  NLGGLVPHQLGNLSSLQYLDLSYNYYYHFYGDIVEIDGFLIIDNAIWISRLSSLRYLNMT  207

Query  651  CVDLHSVSDWLHSISKL  701
             V       WL +++ L
Sbjct  208  VVKFKEGVHWLQALNML  224



>ref|XP_011467021.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Fragaria vesca subsp. vesca]
Length=772

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 105/188 (56%), Gaps = 11/188 (6%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C  +E+ ALL FK  ++ +     S     D CC+W+G+ C+N T  HV+ L L      
Sbjct  35   CIASEKTALLQFKQGLLDESNVLASWESKKD-CCEWRGIACNNQT-GHVIMLDLYYNS--  90

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD-RIPSFIGslnnlvylnlsynKFV  506
            +D     +P  +G I+PSLL L  L++LDLS N F+  IP FIGSL+ L  L L+   F 
Sbjct  91   SDSYNVESP-LRGVIAPSLLGLQHLSYLDLSNNYFEGLIPKFIGSLSRLKVLKLAGASFT  149

Query  507  GNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWLH  686
            G +PP LGN+S L  LD+  NF        + L+W++ +SSL YLNM  ++     +W  
Sbjct  150  GPIPPQLGNLSNLHTLDLARNFV-----TFENLDWLTQISSLRYLNMSGLNFSEAVNWPQ  204

Query  687  SISKLSFL  710
            +ISKL  L
Sbjct  205  AISKLPSL  212



>ref|XP_010087192.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB28473.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=562

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 104/189 (55%), Gaps = 11/189 (6%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E E+ ALL FK  +  +     S     D CC+W+G+   N  T  V+ L L      
Sbjct  35   CIEKEKNALLKFKQGLGDESNVLSSWETKTD-CCQWRGI-TGNNETGRVIMLDLSHN--I  90

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynKF  503
            +D      P   G I PSL+ L +L++LDLSFN FD   IP+FIGS+  L +L L+   F
Sbjct  91   SDVFSEEQP-LSGGIIPSLVELQYLSYLDLSFNSFDGLEIPNFIGSVALLKHLKLASVGF  149

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWL  683
            VG +P  LGN++ L  LD+  N     L V D L+W+S L SL YLN+  ++L  V DW 
Sbjct  150  VGTIPHQLGNLTDLHTLDLSMNI---ELNVTD-LDWLSRLPSLRYLNLSRLNLSEVVDWS  205

Query  684  HSISKLSFL  710
             SI+KL +L
Sbjct  206  QSINKLPYL  214



>gb|EMT13563.1| LRR receptor-like serine/threonine-protein kinase FLS2 [Aegilops 
tauschii]
Length=931

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 115/188 (61%), Gaps = 13/188 (7%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            SC   ER ALLS K S+    ++  S  G++  CC WKGV C +  T HVV L+L  +G 
Sbjct  97   SCVAYERGALLSIKESLWEPSVNLSSWQGEE--CCNWKGVRC-SYKTGHVVKLNL--RGS  151

Query  327  CTDGSPCYN-PGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsyn  497
              +   C+  P ++G IS SL+ L  L +LDLS N F+   IP  IGS  +L YLNLSY+
Sbjct  152  AHN---CFRYPAYRGAISHSLVTLQQLRYLDLSCNNFNWTEIPELIGSFPSLRYLNLSYS  208

Query  498  KFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSD  677
             F G VPP +GN+S L YLD+  + Y   L  +  L+W+SH+ SL++L++  ++L +V D
Sbjct  209  LFYGRVPPQIGNLSKLVYLDLKTSRY--NLLYLRDLQWLSHMPSLKHLDLSYMNLTNVVD  266

Query  678  WLHSISKL  701
            W+H I+ L
Sbjct  267  WVHRINML  274



>ref|XP_007021417.1| Disease resistance family protein / LRR family protein [Theobroma 
cacao]
 gb|EOY12942.1| Disease resistance family protein / LRR family protein [Theobroma 
cacao]
Length=906

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 105/191 (55%), Gaps = 15/191 (8%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgd--dddCCKWKGVGCDNTTTAHVVALHLGRQG  323
            C E+ER+ALL FK S+     +           DCC W GV C N+ T +V  L L    
Sbjct  2    CKESERQALLDFKQSLQVVDRAGFEGLSSWDGKDCCAWMGVLC-NSLTGYVEMLQLSG--  58

Query  324  LCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsyn  497
                    Y     G ISPSLL L  L+ LDLS N F+   IP FIGSL NL +L+LS  
Sbjct  59   --------YFWLVAGTISPSLLKLQHLSVLDLSQNDFNGTLIPDFIGSLKNLTHLDLSLA  110

Query  498  KFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSD  677
             F G +P  LGN+S L+ L +G +F   +L  V  LEW+SHL+SL+YL++   +L   SD
Sbjct  111  NFRGPIPSQLGNLSKLEILSLGGDFVNPKLVSVGNLEWLSHLTSLKYLDLSFTNLSKASD  170

Query  678  WLHSISKLSFL  710
            W   +++L FL
Sbjct  171  WSQVVNQLPFL  181



>ref|XP_003633783.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Vitis vinifera]
Length=981

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 86/192 (45%), Positives = 113/192 (59%), Gaps = 14/192 (7%)
 Frame = +3

Query  144  RSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQG  323
            R C + E+ ALL FK  +        S  G+D  CCKW+GV C+N +  HV+ L L  + 
Sbjct  37   RGCIDTEKVALLKFKQGLTDPSGRLSSWVGED--CCKWRGVVCNNRS-GHVIKLTL--RY  91

Query  324  LCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsyn  497
            L +DG+        G+ISP+LL L +LN+LDLS N F    IP FIGSL  L YLNLS  
Sbjct  92   LDSDGTEGE---LGGKISPALLDLKYLNYLDLSMNNFGGIPIPEFIGSLEKLRYLNLSGA  148

Query  498  KFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDL-HSVS  674
             F G +PP LGN+S+L YLD+   F        D L WIS L+SL +LN+  VDL  + +
Sbjct  149  SFGGPIPPQLGNLSSLHYLDLKEYFDESS---QDDLHWISGLTSLRHLNLGGVDLSQAAA  205

Query  675  DWLHSISKLSFL  710
             WL ++SK+S L
Sbjct  206  YWLQAVSKISSL  217



>gb|EAY74858.1| hypothetical protein OsI_02750 [Oryza sativa Indica Group]
Length=972

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 107/195 (55%), Gaps = 8/195 (4%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C   ER ALLSFK + I+       S    ++CC+W GV C N T  HV+ L+L    L 
Sbjct  48   CIAAERDALLSFK-AGITSDPKKRLSSWLGENCCQWSGVRCSNRT-GHVIILNLSNTILQ  105

Query  330  TDGSPCY---NPGFQ--GEIspsllhlpflnfldlsFNKF-DRIPSFIGslnnlvylnls  491
             D    Y   N  FQ  G IS SL+ L  L  LDLS N   + +P F+GSL +L +LNL+
Sbjct  106  YDDPHYYKFPNVDFQLYGIISSSLVSLRQLKRLDLSGNILGESMPEFLGSLQSLTHLNLA  165

Query  492  ynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSV  671
            Y  F G VP  LGN+S L++LDI   FY         + W++ L SL+YL+M  V+L SV
Sbjct  166  YMGFYGRVPHQLGNLSNLQFLDITPRFYEYPPMHAADISWLARLPSLKYLDMSYVNLSSV  225

Query  672  SDWLHSISKLSFLRT  716
             DW+  ++ LS L  
Sbjct  226  VDWVRPVNMLSRLEV  240



>ref|XP_009607039.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Nicotiana tomentosiformis]
Length=1051

 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 113/199 (57%), Gaps = 15/199 (8%)
 Frame = +3

Query  135  NGSRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHV-VALHL  311
            N   SC  N+ +ALL FK+ +        S  G D  CCKW+G+GC NTT + + + LH 
Sbjct  27   NVGTSCSANDHEALLDFKNGLNDPENRLSSWQGRD--CCKWRGIGCSNTTGSVIKIDLH-  83

Query  312  GRQGLCTDGSPCYNPGF---QGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlv  476
                   + +     GF    GEI PSLL +  L +LDLS N F    IP F+GSL NL 
Sbjct  84   --NPFPVNSADVTRYGFWNLSGEIRPSLLKIQSLQYLDLSLNTFGGIPIPRFVGSLKNLE  141

Query  477  ylnlsynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCV  656
            YLNLS   F G +PP LGN+S L+YLD+ + F       V++ +W+++L SL++L M+ V
Sbjct  142  YLNLSKAGFFGTIPPTLGNLSHLQYLDVSSEFSA---VTVESFQWVTYLVSLKHLGMNQV  198

Query  657  DLHSV-SDWLHSISKLSFL  710
            DL  V S WL  +++L  L
Sbjct  199  DLSMVGSSWLKMLNQLPHL  217



>gb|KCW64534.1| hypothetical protein EUGRSUZ_G02136 [Eucalyptus grandis]
Length=689

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 99/192 (52%), Gaps = 26/192 (14%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            SCF  +R+ALL F+  +I       S    D  CC+WKGV C   T    +A        
Sbjct  33   SCFGTQREALLKFRQGLIDHSKCLSSWTSKD--CCEWKGVECSKKTGHSSLA--------  82

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnlsynK  500
                         G+I  SL  L  L +LDLS N F   +IP F G+L  L YLNLS   
Sbjct  83   -------------GKIHASLAELKHLKYLDLSLNNFSKQKIPQFFGTLQRLEYLNLSSAG  129

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F GN+P HLGN+S L+YLD+   F    L   D L+W+S LSSL+Y ++  +DL    DW
Sbjct  130  FDGNIPHHLGNLSNLQYLDLACKFSEGYL-TSDNLQWVSKLSSLKYFHLAVIDLRKAKDW  188

Query  681  LHSISKLSFLRT  716
              SI+ LS L++
Sbjct  189  FSSINMLSSLQS  200



>ref|XP_009388219.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA, partial [Musa acuminata subsp. malaccensis]
Length=377

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 105/192 (55%), Gaps = 17/192 (9%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            CF  ER+ALL FK         +  S     DCC W+GV C   TT HVV L        
Sbjct  29   CFSMEREALLDFK--AGIHDTYNRLSSWVGQDCCAWEGVIC-RATTGHVVKL--------  77

Query  330  TDGSPCYNPGFQGE-IspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynK  500
             D    ++   +GE ++ SLL L  L  LDLSFN F+  R+P FIGS   L YLNLS   
Sbjct  78   -DLRNTFDRALRGERMNSSLLALSHLKHLDLSFNDFNGIRMPEFIGSFKKLRYLNLSSTN  136

Query  501  FVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDW  680
            F+G +P  LGN+S+L  LD+ +  +      VD L+W+SHL+SL++L++  + L  + DW
Sbjct  137  FMGGIPARLGNLSSLYVLDLSDALHFT--SHVDNLDWLSHLTSLKHLDLSWLKLTDLPDW  194

Query  681  LHSISKLSFLRT  716
              S++ L  L+ 
Sbjct  195  FSSVNMLHSLQV  206



>ref|XP_009348759.1| PREDICTED: receptor-like protein 12 [Pyrus x bretschneideri]
Length=944

 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 107/181 (59%), Gaps = 11/181 (6%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C ENER+ LL FK  +        S  G+ D CC W GV C N T  HV  LHL      
Sbjct  30   CKENERQTLLMFKKDLNDSSNMLSSWDGEGD-CCNWTGVACSNLT-GHVRELHLAGYYDE  87

Query  330  TDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynKF  503
              G         G+++PSLL+L  L+ LDLS N F+  +IPSF+GSL  L YL+LSY +F
Sbjct  88   VTGEEHM---LGGKVNPSLLNLKHLSHLDLSINNFEGLQIPSFLGSLKRLRYLDLSYARF  144

Query  504  VGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSDWL  683
             G +P  LGN+S+L+YL++  NF    + +V+ LEW+S LS L++L+M  VDL + S WL
Sbjct  145  HGTIPHQLGNLSSLRYLNLSGNF----VLMVENLEWLSRLSMLKHLDMSDVDLTNTSHWL  200

Query  684  H  686
             
Sbjct  201  Q  201



>emb|CAN75074.1| hypothetical protein VITISV_026259 [Vitis vinifera]
Length=540

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 110/194 (57%), Gaps = 16/194 (8%)
 Frame = +3

Query  147  SCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGL  326
            + FE ER  LL FK  +        S  G+D  CCKW+GV C N  + HV+ L+L  + L
Sbjct  39   ASFETERVVLLKFKQGLTDSSHRLSSWVGED--CCKWRGVVC-NXRSGHVIKLNL--RSL  93

Query  327  CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsynK  500
              DG+   +    GEIS SLL L +LN LDLS N F+  RIP  IGSL  L YLNLS   
Sbjct  94   DDDGT---HGKLGGEISHSLLDLKYLNXLDLSMNNFEGTRIPKXIGSLEKLRYLNLSGAS  150

Query  501  FVGNVPPHLGNISTLKYLDIGNNF----YGQRLKVVDTLEWISHLSSLEYLNMDCVDLHS  668
            F G +PP LGN+S L YLD+   F    Y       D L+WIS LSSL +LN+  V+L  
Sbjct  151  FSGPIPPQLGNLSRLIYLDLKEYFDFNTYPDESSQND-LQWISGLSSLRHLNLGGVNLSR  209

Query  669  VSD-WLHSISKLSF  707
             S  WLH++SKL  
Sbjct  210  ASAYWLHAVSKLPL  223



>ref|XP_007030467.1| Disease resistance family protein / LRR family protein, putative 
[Theobroma cacao]
 gb|EOY10969.1| Disease resistance family protein / LRR family protein, putative 
[Theobroma cacao]
Length=1016

 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 106/194 (55%), Gaps = 9/194 (5%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C E+ER+ALL FK  II       +     D CC W GV CDN T  HV  L L    + 
Sbjct  34   CIESERQALLKFKQDIIDRSNRLSAWADGGD-CCNWVGVSCDNLT-GHVYKLDLRPSSIS  91

Query  330  TDGSPC-----YNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnl  488
               S       +    +G I+PSLL L  L+ LDLS N F   +IP F+GS+ +L YL+L
Sbjct  92   DYASDAEIGVYWRSLLRGRINPSLLLLKHLSHLDLSLNNFGGLQIPQFLGSMESLTYLDL  151

Query  489  synKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHS  668
            S   F G +P  LGN+S L++L++G   +   L     L+W+S LSSL+YL++  VDL  
Sbjct  152  SKAGFGGALPHQLGNLSKLQHLNLGVTNFRYPLVEARNLQWLSGLSSLQYLDLSGVDLSK  211

Query  669  VSDWLHSISKLSFL  710
             +DWL   +KL  L
Sbjct  212  ATDWLQVTNKLPSL  225



>ref|XP_006490686.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Citrus sinensis]
Length=907

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 107/183 (58%), Gaps = 16/183 (9%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNTTTAHVVALHLGRQG  323
            C + ER+ALL+FK S++ +     S     +  D CKW GVGC N T  HV+ L +  Q 
Sbjct  33   CIDEEREALLTFKESLVDESGVLSSWGPEDEKRDRCKWAGVGCSNRT-GHVIKLEI--QP  89

Query  324  LCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD--RIPSFIGslnnlvylnlsyn  497
            +  D  P      +G ISP+LL L  L +LDLS N F    IP FIGSL  L YL+LS+ 
Sbjct  90   IDFDSFP-----LRGTISPALLQLHRLTYLDLSLNNFSGSPIPEFIGSLTTLSYLDLSFA  144

Query  498  KFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSVSD  677
            +F G +P HLGN+S L++LD+  N     L  V  L+W+SHLSSL YL++   +L   +D
Sbjct  145  EFEGPIPSHLGNLSALQHLDLSLN----HLFSVGNLDWLSHLSSLTYLDLGSNNLSRSTD  200

Query  678  WLH  686
            WL 
Sbjct  201  WLQ  203



>ref|XP_009624409.1| PREDICTED: receptor-like protein 12 [Nicotiana tomentosiformis]
Length=1025

 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 74/195 (38%), Positives = 106/195 (54%), Gaps = 23/195 (12%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNTTTAHVVALHLGRQG  323
            C   ER+ALL FK  +I +     S  +  D+++CC W+GV C NTT  H++ L+L    
Sbjct  41   CINKEREALLEFKRGLIDEYDLLSSWRNEEDNEECCSWRGVKCSNTT-GHILVLNLRGNT  99

Query  324  LCTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKFD-RIPSFIG----slnnlvylnl  488
                          G IS SL+ L +L +LDLS N F+ +IP FIG         +    
Sbjct  100  FTY---------LTGNISSSLVKLQYLKYLDLSSNNFEGQIPKFIGYFKRLEYLNLSSET  150

Query  489  synKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHS  668
            S N+F G +PP L N++ L+ LD+G NF      +V +LEW+SHL  LEYL++   ++  
Sbjct  151  SSNRFAGPIPPQLRNLTYLRALDLGGNFL-----IVKSLEWLSHLVYLEYLDLSESNVQQ  205

Query  669  VSDWLHSISKLSFLR  713
              +WLH I+KL  LR
Sbjct  206  -KNWLHEITKLPNLR  219



>gb|KCW64345.1| hypothetical protein EUGRSUZ_G019722, partial [Eucalyptus grandis]
Length=588

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 107/195 (55%), Gaps = 10/195 (5%)
 Frame = +3

Query  150  CFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHLGRQGLC  329
            C   ER+ALL FKH +        S  G++  CCKW+GV C N  T HV+ L L    + 
Sbjct  38   CIGAEREALLKFKHGLTDPSRRLSSWTGEE--CCKWEGVEC-NKKTGHVLKLDLHNPCIE  94

Query  330  TDGSPCYNPG----FQGEIspsllhlpflnfldlsFNKF--DRIPSFIGslnnlvylnls  491
                  + P       G I PSL  L +L +LDLS N F   +IP+F  SL  L YLNLS
Sbjct  95   EIDIKVFVPSNKCMLGGNIVPSLTELKYLKYLDLSVNNFSTQKIPTFFASLQKLEYLNLS  154

Query  492  ynKFVGNVPPHLGNISTLKYLDIGNNFYGQRLKVVDTLEWISHLSSLEYLNMDCVDLHSV  671
            +  F GN+P  L N+S L+YLD+  NF    L   D  +W+S LSSL+YL+M  V+L  V
Sbjct  155  HASFNGNIPRQLSNLSKLQYLDLSINFDMGYLTSND-FDWVSKLSSLKYLHMSGVNLSKV  213

Query  672  SDWLHSISKLSFLRT  716
             DW+  I+ L  L++
Sbjct  214  KDWIGCINMLPSLQS  228



>ref|XP_009389814.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Musa acuminata subsp. malaccensis]
Length=903

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 109/209 (52%), Gaps = 25/209 (12%)
 Frame = +3

Query  141  SRSCFENERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNTTTAHVVALHL---  311
            S  C E ERKAL+ FK  +        S  G+D  CC W+GVGC N +  HV+ L L   
Sbjct  24   SHGCRETERKALIDFKRGLHDPSNRLSSWVGED--CCAWEGVGCSNIS-GHVIKLDLRNR  80

Query  312  ---------GRQGL--CTDGSPCYNPGFQGEIspsllhlpflnfldlsFNKF--DRIPSF  452
                      RQ +    D  P  N   +G+I+PSL  L  LN LDLS N F    IP F
Sbjct  81   RRMDLYEDCSRQEVYYLLDDDPGCNWAVRGDITPSLRSLQQLNRLDLSGNYFMHKPIPKF  140

Query  453  IGslnnlvylnlsynKFVGNVPPHLGNISTLKYLDIGNNFY------GQRLKVVDTLEWI  614
            +G+   L YLNLS   FVG VP  LGN+STL++LD+  NFY      G     ++   WI
Sbjct  141  LGAFRRLTYLNLSGAGFVGRVPDQLGNLSTLQHLDLSYNFYLDDEGGGFFCLYLENTRWI  200

Query  615  SHLSSLEYLNMDCVDLHSVSDWLHSISKL  701
            S L+SL +LNM  V   + ++WL  ++ L
Sbjct  201  SMLTSLRHLNMTRVRFTNAANWLQDLNAL  229



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1949878542686