BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3606

Length=879
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009592136.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    302   9e-93   
ref|XP_010043743.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    302   1e-92   Eucalyptus grandis [rose gum]
emb|CDP07116.1|  unnamed protein product                                300   3e-92   Coffea canephora [robusta coffee]
dbj|BAF98296.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synt...    299   1e-91   Hevea brasiliensis [jebe]
gb|AEZ55668.1|  4-hydroxy-3-methylbut-2-enyl diphosphate synthase       298   2e-91   Salvia miltiorrhiza [Chinese salvia]
gb|AJA39985.1|  (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synt...    298   2e-91   Salvia miltiorrhiza f. alba
ref|XP_010253662.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    297   5e-91   Nelumbo nucifera [Indian lotus]
ref|XP_007016723.1|  4-hydroxy-3-methylbut-2-enyl diphosphate syn...    297   5e-91   
gb|KDO73247.1|  hypothetical protein CISIN_1g0046342mg                  288   2e-90   Citrus sinensis [apfelsine]
ref|NP_001234648.1|  GcpE                                               295   4e-90   Solanum lycopersicum
ref|XP_006340201.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    295   4e-90   Solanum tuberosum [potatoes]
gb|AFQ98370.1|  hydroxymethylbutenyl diphosphate synthase               295   4e-90   Camellia sinensis [black tea]
ref|XP_008225831.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    291   7e-90   Prunus mume [ume]
ref|XP_006378965.1|  hypothetical protein POPTR_0009s01900g             291   3e-89   
ref|XP_011089897.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    292   4e-89   Sesamum indicum [beniseed]
gb|KHG03611.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    292   5e-89   Gossypium arboreum [tree cotton]
ref|XP_006378969.1|  hypothetical protein POPTR_0009s01900g             291   7e-89   
ref|XP_006378968.1|  hypothetical protein POPTR_0009s01900g             290   1e-88   
ref|XP_008225843.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    291   1e-88   Prunus mume [ume]
ref|XP_011044361.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    291   1e-88   Populus euphratica
gb|KJB26175.1|  hypothetical protein B456_004G228600                    291   1e-88   Gossypium raimondii
gb|KJB26176.1|  hypothetical protein B456_004G228600                    291   1e-88   Gossypium raimondii
ref|XP_006378966.1|  hypothetical protein POPTR_0009s01900g             291   1e-88   
ref|XP_008359197.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    290   3e-88   
ref|XP_012064829.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    290   3e-88   Jatropha curcas
gb|AGQ04156.1|  4-hydroxy-3-methylbut-2-enyl diphosphate synthase       290   3e-88   Lavandula angustifolia [lavender]
ref|XP_004295028.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    289   7e-88   Fragaria vesca subsp. vesca
ref|XP_008349746.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    289   8e-88   
ref|XP_009335082.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    289   8e-88   Pyrus x bretschneideri [bai li]
ref|XP_006424584.1|  hypothetical protein CICLE_v10027881mg             287   8e-88   
gb|AAO24774.1|  GCPE protein                                            289   9e-88   Catharanthus roseus [chatas]
ref|XP_009367086.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    287   4e-87   Pyrus x bretschneideri [bai li]
ref|XP_006384896.1|  hypothetical protein POPTR_0004s22010g             287   5e-87   
ref|XP_006424585.1|  hypothetical protein CICLE_v10027881mg             287   5e-87   Citrus clementina [clementine]
ref|XP_006488105.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    286   9e-87   
ref|NP_001289212.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    285   2e-86   Pyrus x bretschneideri [bai li]
ref|XP_010098198.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    289   2e-86   
ref|XP_004487120.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    285   3e-86   
gb|ADX06907.1|  1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate sy...    285   3e-86   Rauvolfia verticillata
gb|EYU36192.1|  hypothetical protein MIMGU_mgv1a001893mg                284   5e-86   Erythranthe guttata [common monkey flower]
gb|EYU36193.1|  hypothetical protein MIMGU_mgv1a001893mg                284   5e-86   Erythranthe guttata [common monkey flower]
ref|XP_007150210.1|  hypothetical protein PHAVU_005G135800g             284   7e-86   Phaseolus vulgaris [French bean]
ref|XP_002530286.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    283   8e-86   
ref|XP_004487119.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    284   9e-86   
ref|XP_002285130.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    283   2e-85   Vitis vinifera
gb|ABG75916.2|  (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synt...    281   7e-85   Stevia rebaudiana
gb|AES67479.2|  4-hydroxy-3-methylbut-2-enyl diphosphate synthase       280   2e-84   Medicago truncatula
gb|KHN11204.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    280   3e-84   Glycine soja [wild soybean]
emb|CAN72185.1|  hypothetical protein VITISV_005654                     279   3e-84   Vitis vinifera
gb|EPS69702.1|  hypothetical protein M569_05062                         273   3e-84   Genlisea aurea
ref|XP_003540178.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    279   3e-84   Glycine max [soybeans]
ref|XP_003597228.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    280   4e-84   
gb|AHA11129.1|  chloroplast 4-hydroxy-3-methylbut-2-enyl diphosph...    277   3e-83   Picrorhiza kurrooa
gb|KHN21521.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    275   2e-82   Glycine soja [wild soybean]
gb|AID51432.1|  (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synt...    275   2e-82   Astragalus membranaceus
ref|XP_003543457.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    275   2e-82   Glycine max [soybeans]
gb|AEM42998.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    273   7e-82   Siraitia grosvenorii [arhat fruit]
ref|XP_008807336.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    271   5e-81   Phoenix dactylifera
ref|XP_006400831.1|  hypothetical protein EUTSA_v10012774mg             268   5e-80   Eutrema salsugineum [saltwater cress]
ref|XP_006280064.1|  hypothetical protein CARUB_v10025946mg             268   6e-80   Capsella rubella
ref|XP_010906493.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    267   1e-79   Elaeis guineensis
ref|XP_008463938.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    266   4e-79   Cucumis melo [Oriental melon]
ref|XP_002864694.1|  hypothetical protein ARALYDRAFT_919295             265   6e-79   Arabidopsis lyrata subsp. lyrata
ref|NP_001119467.1|  4-hydroxy-3-methylbut-2-enyl diphosphate syn...    264   2e-78   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200868.2|  4-hydroxy-3-methylbut-2-enyl diphosphate synthase     264   2e-78   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851233.1|  4-hydroxy-3-methylbut-2-enyl diphosphate synthase     264   3e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009392271.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    264   3e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004148774.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    263   4e-78   Cucumis sativus [cucumbers]
ref|XP_010443862.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    263   7e-78   Camelina sativa [gold-of-pleasure]
gb|AAM19840.1|  AT5g60600/mup24_10                                      262   1e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010483710.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    262   1e-77   Camelina sativa [gold-of-pleasure]
gb|AAL91150.1|  GcpE protein                                            261   4e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010535603.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    259   9e-77   Tarenaya hassleriana [spider flower]
gb|AHN91473.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    259   2e-76   Dendrobium officinale
gb|AJA32314.1|  chloroplast 1-hydroxy-2-methyl-2-(E)-butenyl-4-di...    258   3e-76   Narcissus tazetta
ref|XP_010456601.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    258   3e-76   Camelina sativa [gold-of-pleasure]
ref|XP_006854508.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    258   4e-76   Amborella trichopoda
ref|XP_010689558.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    258   4e-76   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO73255.1|  hypothetical protein CISIN_1g0046342mg                  249   2e-75   Citrus sinensis [apfelsine]
gb|AJA32313.1|  chloroplast 1-hydroxy-2-methyl-2-(E)-butenyl-4-di...    256   2e-75   Narcissus tazetta
emb|CDY53637.1|  BnaC09g54000D                                          255   3e-75   Brassica napus [oilseed rape]
ref|XP_009120594.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    255   4e-75   Brassica rapa
ref|XP_007207209.1|  hypothetical protein PRUPE_ppa002111mg             254   5e-75   
emb|CDY31531.1|  BnaA10g13400D                                          253   4e-74   Brassica napus [oilseed rape]
ref|XP_003575307.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    246   1e-71   Brachypodium distachyon [annual false brome]
ref|XP_002454137.1|  hypothetical protein SORBIDRAFT_04g025290          245   2e-71   Sorghum bicolor [broomcorn]
ref|XP_006647487.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    244   8e-71   Oryza brachyantha
gb|ABB78087.1|  (E)-4-hydroxy-3-methyl-but-2-enyl diphosphate syn...    243   1e-70   Ginkgo biloba [ginkgo]
ref|XP_004953020.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    243   2e-70   Setaria italica
ref|NP_001047365.1|  Os02g0603800                                       242   2e-70   
gb|EMT15013.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    242   3e-70   
dbj|BAB09833.1|  GcpE protein                                           241   6e-70   Arabidopsis thaliana [mouse-ear cress]
gb|ACL53652.1|  unknown                                                 238   1e-68   Zea mays [maize]
ref|NP_001105676.1|  LOC542690                                          237   2e-68   Zea mays [maize]
ref|XP_003597229.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    231   2e-66   
gb|ACG47448.1|  hydroxymethylbutenyl 4-diphosphate synthase             225   7e-64   Zea mays [maize]
gb|ACD70401.1|  putative chloroplast 4-hydroxy-3-methylbut-2-en-1...    215   2e-60   Populus trichocarpa [western balsam poplar]
ref|XP_002973473.1|  hypothetical protein SELMODRAFT_149035             213   1e-59   
ref|XP_002986683.1|  hypothetical protein SELMODRAFT_158184             213   1e-59   
ref|XP_001755871.1|  predicted protein                                  209   3e-58   
gb|EMS56222.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    196   6e-54   Triticum urartu
ref|XP_001766565.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    194   8e-53   
ref|XP_005650225.1|  putative chloroplast 1-hydroxy-2-methyl-2-(E...    154   1e-38   Coccomyxa subellipsoidea C-169
gb|KDD73287.1|  GcpE                                                    139   2e-35   Helicosporidium sp. ATCC 50920
ref|XP_011400578.1|  26S proteasome non-ATPase regulatory subunit 1     147   2e-35   Auxenochlorella protothecoides
ref|XP_007510861.1|  predicted protein                                  143   1e-34   Bathycoccus prasinos
ref|WP_042282293.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    142   1e-34   Candidatus Protochlamydia sp. R18
ref|WP_039357656.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    142   1e-34   Candidatus Protochlamydia amoebophila
ref|WP_011175290.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    142   1e-34   Candidatus Protochlamydia amoebophila
gb|KIC72391.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    142   2e-34   Candidatus Protochlamydia amoebophila
ref|XP_005841109.1|  hypothetical protein GUITHDRAFT_63981              142   2e-34   Guillardia theta CCMP2712
ref|XP_001690937.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    141   3e-34   Chlamydomonas reinhardtii
gb|AAX54905.1|  putative chloroplast 1-hydroxy-2-methyl-2-(E)-but...    141   3e-34   Chlamydomonas reinhardtii
ref|XP_002953482.1|  hypothetical protein VOLCADRAFT_63610              141   4e-34   Volvox carteri f. nagariensis
ref|XP_005848392.1|  hypothetical protein CHLNCDRAFT_144676             140   1e-33   Chlorella variabilis
ref|XP_001419500.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    139   3e-33   Ostreococcus lucimarinus CCE9901
gb|KIA77148.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    137   1e-32   Parachlamydia acanthamoebae
ref|WP_036746476.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    136   2e-32   Parachlamydia acanthamoebae
ref|WP_013925438.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    136   2e-32   Parachlamydia acanthamoebae
ref|XP_002506236.1|  predicted protein                                  134   1e-31   Micromonas commoda
ref|XP_003081089.1|  putative chloroplast 1-hydroxy-2-methyl-2-(ISS)    134   1e-31   Ostreococcus tauri
ref|XP_002179061.1|  1-hydroxy-2-methyl-2-(E)-butenyl-4-diphospha...    134   2e-31   Phaeodactylum tricornutum CCAP 1055/1
ref|WP_035395035.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    133   2e-31   
ref|WP_042103571.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    128   1e-29   Parachlamydiaceae bacterium HS-T3
ref|XP_005764175.1|  hypothetical protein EMIHUDRAFT_447290             123   1e-29   Emiliania huxleyi CCMP1516
emb|CDZ80220.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synt...    127   3e-29   Candidatus Rubidus massiliensis
gb|EJK67655.1|  hypothetical protein THAOC_11283                        127   6e-29   Thalassiosira oceanica
emb|CDR33454.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synt...    125   1e-28   Criblamydia sequanensis CRIB-18
ref|WP_041016942.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    125   1e-28   
ref|XP_002292108.1|  gcpe-like protein                                  125   2e-28   Thalassiosira pseudonana CCMP1335
ref|XP_009035331.1|  hypothetical protein AURANDRAFT_71112              126   3e-28   Aureococcus anophagefferens
emb|CBJ30926.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate s...    124   6e-28   Ectocarpus siliculosus
ref|WP_013943315.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    122   1e-27   Simkania negevensis
ref|XP_005783224.1|  hypothetical protein EMIHUDRAFT_442353             123   1e-27   Emiliania huxleyi CCMP1516
ref|XP_003056663.1|  predicted protein                                  120   2e-26   Micromonas pusilla CCMP1545
gb|AHI16949.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate sy...    117   3e-26   Voromonas pontica
ref|XP_002768617.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    117   1e-25   Perkinsus marinus ATCC 50983
dbj|BAG14389.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synt...    117   1e-25   Perkinsus marinus ATCC 50439
ref|WP_010230169.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    115   2e-25   Chlamydia muridarum [agent of mouse pneumonitis]
ref|WP_020966877.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    115   4e-25   Chlamydia trachomatis
ref|WP_033418316.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    115   4e-25   Cytophaga aurantiaca
ref|WP_044882180.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    115   4e-25   Neochlamydia sp. EPS4
ref|WP_042240386.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    113   2e-24   Neochlamydia sp. S13
ref|WP_039385010.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    113   2e-24   Neochlamydia sp. TUME1
ref|WP_035405552.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    112   3e-24   Chlamydia suis
emb|CDO64659.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synt...    113   3e-24   Plasmodium reichenowi
ref|WP_009871405.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    112   6e-24   Chlamydia trachomatis
ref|WP_010725012.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    111   6e-24   Chlamydia trachomatis
ref|WP_015505647.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    111   6e-24   Chlamydia trachomatis
ref|WP_012263592.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    111   6e-24   Chlamydia trachomatis
gb|AEP34867.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate sy...    111   6e-24   Chlamydia trachomatis A2497
ref|WP_011324544.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    111   6e-24   Chlamydia trachomatis
ref|WP_009872353.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    111   6e-24   Chlamydia trachomatis
ref|WP_015506433.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    111   6e-24   Chlamydia trachomatis
gb|AGT66840.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    111   6e-24   Chlamydia trachomatis F/11-96
gb|AGT67768.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    111   7e-24   Chlamydia trachomatis
ref|WP_015505856.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    111   7e-24   Chlamydia trachomatis
gb|AGT69620.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    111   7e-24   Chlamydia trachomatis
gb|ADI50733.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate sy...    111   7e-24   Chlamydia trachomatis D-EC
ref|WP_009873027.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    111   7e-24   Chlamydia trachomatis
ref|WP_009873526.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    111   7e-24   Chlamydia trachomatis
gb|ETW56653.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    112   8e-24   Plasmodium falciparum Palo Alto/Uganda
ref|XP_009690697.1|  1-hydroxy-2-methyl-2-(e)-butenyl 4-diphospha...    112   1e-23   Theileria orientalis strain Shintoku
gb|ETW28594.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    112   1e-23   Plasmodium falciparum FCH/4
gb|ETW18403.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    112   1e-23   Plasmodium falciparum Vietnam Oak-Knoll (FVO)
ref|XP_001347505.1|  GcpE protein                                       112   1e-23   Plasmodium falciparum 3D7
gb|EUR71974.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    112   1e-23   Plasmodium falciparum 7G8
gb|ETW42409.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    112   1e-23   Plasmodium falciparum NF135/5.C10
gb|EWC76322.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    112   1e-23   Plasmodium falciparum UGT5.1
ref|WP_040496810.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    110   2e-23   Fulvivirga imtechensis
emb|CCF74567.1|  unnamed protein product                                110   2e-23   
gb|KJP85959.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    110   2e-23   Plasmodium fragile
ref|WP_021756575.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    109   3e-23   Chlamydia pecorum
ref|WP_021757239.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    109   4e-23   Chlamydia pecorum
gb|ABG59455.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    109   5e-23   Cytophaga hutchinsonii ATCC 33406
ref|WP_041932708.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    109   5e-23   Cytophaga hutchinsonii
emb|CDR94010.1|  gcpE protein, putative                                 109   6e-23   Babesia bigemina
ref|WP_020526939.1|  hypothetical protein                               108   6e-23   Flexithrix dorotheae
ref|WP_044200698.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    108   7e-23   Flammeovirga sp. OC4
gb|EFB40485.1|  hypothetical protein pah_c200o034                       107   2e-22   Parachlamydia acanthamoebae str. Hall's coccus
ref|WP_017729932.1|  hypothetical protein                               107   2e-22   Nafulsella turpanensis
ref|WP_013712790.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    107   2e-22   Chlamydia pecorum
gb|KIY95488.1|  hypothetical protein MNEG_12472                         100   2e-22   Monoraphidium neglectum
ref|WP_015030917.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    107   2e-22   Emticicia oligotrophica
ref|WP_035391966.1|  MULTISPECIES: 4-hydroxy-3-methylbut-2-en-1-y...    107   3e-22   Chlamydia ibidis
ref|XP_008625669.1|  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate...    107   3e-22   Plasmodium vinckei vinckei
ref|XP_002261743.1|  GcpE protein                                       107   4e-22   Plasmodium knowlesi strain H
ref|WP_045640961.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    106   6e-22   
ref|WP_030001802.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    106   6e-22   
ref|WP_010526318.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    105   1e-21   Thermophagus xiamenensis
gb|ETB58995.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    105   1e-21   Plasmodium yoelii 17X
ref|XP_729456.1|  (E)-4-hydroxy-3-methylbut-2-enyl diphosphate sy...    105   1e-21   Plasmodium yoelii
ref|XP_952048.1|  1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate ...    105   1e-21   Theileria annulata
ref|WP_044117870.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    104   1e-21   Alkaliflexus imshenetskii
ref|WP_013665481.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    104   2e-21   
ref|WP_009036471.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    104   2e-21   Indibacter alkaliphilus
gb|ACT64770.1|  (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synt...    103   3e-21   Artemisia annua [sweet Annie]
ref|XP_008817266.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    104   3e-21   Plasmodium inui San Antonio 1
emb|CDS45871.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synt...    103   5e-21   
ref|XP_743307.1|  GcpE protein                                          103   5e-21   
ref|WP_013407896.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    103   5e-21   Leadbetterella byssophila
ref|WP_025278548.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    102   6e-21   Barnesiella viscericola
ref|WP_039866655.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    103   6e-21   Pedobacter sp. BAL39
ref|WP_009185621.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    103   7e-21   Cecembia lonarensis
ref|WP_012925967.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    103   7e-21   
gb|EHQ25285.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    103   7e-21   Mucilaginibacter paludis DSM 18603
ref|WP_040627083.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    102   8e-21   
ref|XP_680310.1|  GcpE protein                                          103   8e-21   Plasmodium berghei ANKA
gb|EUD69889.1|  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synt...    103   8e-21   Plasmodium vinckei petteri
ref|WP_010422549.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    102   8e-21   Anaerophaga thermohalophila
ref|WP_014020335.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    102   8e-21   Cyclobacterium marinum
ref|WP_045753255.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    102   9e-21   Sphingobacterium sp. PM2-P1-29
ref|WP_026464184.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    102   1e-20   Adhaeribacter aquaticus
ref|WP_009132918.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    102   1e-20   Alistipes indistinctus
ref|WP_044222153.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    102   1e-20   Flammeovirga pacifica
ref|WP_020888417.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    102   1e-20   Cyclobacterium qasimii
ref|WP_008863068.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    102   1e-20   Barnesiella intestinihominis
gb|EQB83053.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate sy...    102   1e-20   
ref|XP_001610211.1|  gcpE protein                                       102   1e-20   Babesia bovis T2Bo
ref|WP_021891692.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    102   1e-20   Bacteroides sp. AF14-46
ref|WP_037525485.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    102   1e-20   Sphingobacterium sp. IITKGP-BTPF85
ref|WP_041873454.1|  hypothetical protein                             97.8    1e-20   
ref|WP_008627688.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    102   1e-20   Mariniradius saccharolyticus
ref|XP_001608540.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    102   1e-20   Plasmodium vivax
ref|XP_765233.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate syn...    102   2e-20   Theileria parva strain Muguga
ref|WP_007658562.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    101   2e-20   Pontibacter sp. BAB1700
ref|WP_038700675.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    101   2e-20   Sphingobacterium sp. ML3W
gb|AEA43526.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    101   2e-20   Fluviicola taffensis DSM 16823
ref|WP_014559193.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    101   2e-20   Ignavibacterium album
ref|WP_010883016.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    101   2e-20   Chlamydia pneumoniae
ref|WP_043024168.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    101   2e-20   
ref|WP_018122659.1|  hypothetical protein                             99.4    2e-20   Wohlfahrtiimonas chitiniclastica
ref|WP_026995433.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    101   2e-20   Flectobacillus major
ref|WP_009217671.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  99.0    2e-20   Bacteroidetes oral taxon 274
ref|WP_013926162.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    101   3e-20   
dbj|GAO29200.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate s...    101   3e-20   Geofilum rubicundum JCM 15548
ref|WP_028070631.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    100   3e-20   Sphingobacterium thalpophilum
ref|WP_014772391.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    100   3e-20   Belliella baltica
ref|WP_044211885.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    100   3e-20   Saccharicrinis fermentans
ref|XP_004829307.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    100   4e-20   Theileria equi strain WA
ref|WP_011458136.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    100   4e-20   Chlamydia felis
ref|WP_019245958.1|  hypothetical protein                             99.4    7e-20   Alistipes ihumii
ref|WP_015265930.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    100   7e-20   Echinicola vietnamensis
ref|WP_025761675.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    100   7e-20   Dyadobacter tibetensis
ref|WP_003011709.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    100   7e-20   Sphingobacterium spiritivorum
ref|WP_002992820.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    100   7e-20   Sphingobacterium spiritivorum
ref|WP_039749913.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  99.8    8e-20   
ref|WP_014944975.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  99.8    8e-20   Chlamydia psittaci
ref|WP_010662104.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  99.8    8e-20   Marinilabilia salmonicolor
ref|WP_041523399.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  97.4    1e-19   Gilvimarinus agarilyticus
ref|WP_026632945.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  99.4    1e-19   Dyadobacter alkalitolerans
ref|WP_014945938.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  99.4    1e-19   Chlamydia psittaci
ref|WP_016967917.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  99.4    1e-19   Chlamydia psittaci
ref|WP_013452189.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  99.4    1e-19   Marivirga tractuosa
ref|WP_021069034.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  99.4    1e-19   Sphingobacterium paucimobilis
ref|WP_014943808.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  99.0    1e-19   Chlamydia psittaci
ref|WP_014518475.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  99.0    1e-19   Chlamydia psittaci
ref|WP_006343099.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  99.0    1e-19   Chlamydia psittaci
ref|WP_014944250.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  99.0    1e-19   
ref|WP_014946610.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  99.0    1e-19   Chlamydia psittaci
ref|WP_041952338.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  99.0    1e-19   Spirosoma spitsbergense
ref|WP_018472954.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  99.0    1e-19   Echinicola pacifica
ref|WP_031527052.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  99.0    2e-19   Dyadobacter crusticola
ref|WP_019599168.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  99.0    2e-19   Rhodonellum
ref|WP_033564087.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  99.0    2e-19   Sphingobacteriaceae bacterium DW12
emb|CCH52120.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate s...  99.0    2e-19   Fibrisoma limi BUZ 3
ref|WP_019986408.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  99.0    2e-19   Rudanella lutea
ref|WP_033425950.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  95.9    2e-19   
ref|WP_040005539.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  98.6    2e-19   Fibrisoma limi
ref|WP_008199314.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  98.6    2e-19   Algoriphagus machipongonensis
ref|WP_028523087.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  98.6    2e-19   Runella limosa
gb|AHM63652.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase  98.6    2e-19   Flammeovirgaceae bacterium 311
ref|WP_011006385.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  98.2    3e-19   Chlamydia caviae
ref|WP_028665433.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  98.2    3e-19   Runella zeae
ref|WP_019111293.1|  hypothetical protein                             97.8    3e-19   Verrucomicrobia bacterium SCGC AAA164-L15
ref|WP_028297123.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  98.2    3e-19   Olivibacter sitiensis
ref|WP_038131498.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  97.8    3e-19   Verrucomicrobia bacterium SCGC AAA168-F10
ref|WP_020149813.1|  hypothetical protein                             97.8    3e-19   
ref|WP_007235988.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  95.9    3e-19   marine gamma proteobacterium HTCC2080
gb|EHQ06249.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase  97.8    3e-19   
ref|WP_013044727.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  97.8    4e-19   
ref|WP_026946987.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  97.8    4e-19   
ref|WP_009053773.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  97.8    4e-19   
ref|WP_039053483.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  97.8    4e-19   
ref|WP_016544642.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...  97.4    4e-19   
ref|WP_035071223.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  97.4    4e-19   
ref|WP_035562438.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  97.8    4e-19   
emb|CCH01413.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate s...  97.4    5e-19   
ref|WP_013633270.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  97.4    5e-19   
ref|WP_008315311.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  95.5    5e-19   
ref|WP_012487111.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  95.1    6e-19   
ref|WP_044017536.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  97.4    6e-19   
ref|WP_037495597.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  97.1    6e-19   
ref|WP_040762255.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  97.1    6e-19   
gb|ETX02314.1|  hypothetical protein ETSY1_04030                      97.4    6e-19   
ref|WP_035610064.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  96.7    8e-19   
ref|WP_027000276.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  96.7    8e-19   
gb|EEZ80401.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase  94.4    8e-19   
ref|WP_022824903.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  96.7    9e-19   
dbj|GAE23022.1|  ribonucleotide reductase of class Ia                 94.0    9e-19   
ref|WP_044004668.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  96.7    9e-19   
ref|WP_022602951.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  96.3    9e-19   
ref|WP_036885410.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  93.6    9e-19   
ref|WP_022390297.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  96.3    1e-18   
dbj|GAE15356.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate s...  94.0    1e-18   
ref|WP_009318162.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  96.3    1e-18   
ref|WP_020856660.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  94.4    1e-18   
ref|WP_033159354.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  94.7    1e-18   
ref|WP_021930870.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  96.3    1e-18   
ref|WP_035491099.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  94.0    1e-18   
ref|WP_043128160.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  93.6    1e-18   
ref|WP_023493763.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  94.4    1e-18   
ref|WP_025605263.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  95.9    1e-18   
ref|WP_026952032.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  95.9    1e-18   
ref|WP_040585707.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  95.9    1e-18   
ref|WP_010856632.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  95.9    1e-18   
ref|WP_019943804.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  95.9    2e-18   
ref|WP_025829678.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  95.9    2e-18   
ref|WP_024283448.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  95.9    2e-18   
ref|WP_043587390.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  93.2    2e-18   
ref|WP_028304682.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  93.6    2e-18   
ref|WP_044227122.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  95.9    2e-18   
ref|WP_026955484.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  95.9    2e-18   
ref|WP_020481968.1|  MULTISPECIES: 4-hydroxy-3-methylbut-2-en-1-y...  94.0    2e-18   
ref|WP_023057845.1|  MULTISPECIES: 4-hydroxy-3-methylbut-2-en-1-y...  95.5    2e-18   
ref|WP_011097048.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  95.5    2e-18   
ref|WP_006344058.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  95.5    2e-18   
ref|WP_004347837.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  95.5    2e-18   
ref|WP_036873128.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  95.5    2e-18   
ref|WP_045071837.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  95.1    2e-18   
ref|WP_012780078.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  95.5    2e-18   
ref|WP_022436495.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  95.1    2e-18   
ref|WP_044513706.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  95.1    3e-18   
ref|WP_018109390.1|  hypothetical protein                             95.1    3e-18   
ref|WP_005928699.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  95.1    3e-18   
dbj|GAE85460.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate s...  93.6    3e-18   
ref|WP_007479874.1|  MULTISPECIES: 4-hydroxy-3-methylbut-2-en-1-y...  95.1    3e-18   
ref|WP_004344592.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  94.7    3e-18   
ref|XP_001764904.1|  predicted protein                                89.7    4e-18   
ref|WP_014681066.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  94.7    4e-18   
ref|WP_026764890.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  94.7    4e-18   
ref|WP_010151556.1|  1-hydroxy-2-methyl-2-(e)-butenyl 4-diphospha...  94.4    4e-18   
ref|WP_002702180.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  94.7    4e-18   
ref|WP_001011582.1|  hypothetical protein                             90.5    4e-18   
ref|WP_021854484.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  94.4    5e-18   
ref|WP_007412442.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  94.4    5e-18   
ref|WP_039914153.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  92.0    6e-18   
ref|WP_006743867.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  94.0    6e-18   
ref|XP_002365345.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  94.7    6e-18   
ref|WP_026627165.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  94.0    6e-18   
gb|ESS31948.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase  94.7    7e-18   
ref|WP_023936268.1|  MULTISPECIES: 1-hydroxy-2-methyl-2-(E)-buten...  93.6    7e-18   
gb|EPR62596.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase  94.7    7e-18   
ref|WP_036277799.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  92.4    7e-18   
ref|WP_044045663.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  94.0    7e-18   
ref|WP_040391824.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  92.0    7e-18   
ref|WP_044110438.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  92.8    7e-18   
ref|WP_021828266.1|  MULTISPECIES: 4-hydroxy-3-methylbut-2-en-1-y...  93.6    7e-18   
ref|WP_036884355.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  93.6    7e-18   
gb|EFC71936.2|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase  94.0    7e-18   
gb|ERI85835.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase  93.6    7e-18   
ref|WP_045090610.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  93.6    8e-18   
ref|WP_039972477.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  93.6    8e-18   
ref|WP_027325203.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  93.6    8e-18   
ref|WP_032517630.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  89.4    8e-18   
ref|WP_025888062.1|  MULTISPECIES: hypothetical protein               89.0    8e-18   
ref|WP_016549865.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...  93.6    9e-18   
ref|WP_043333809.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  91.7    9e-18   
ref|WP_022083614.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  93.2    9e-18   
ref|WP_020986937.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...  93.6    9e-18   
ref|WP_028900336.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  93.2    1e-17   
ref|XP_005771768.1|  hypothetical protein EMIHUDRAFT_118009           93.2    1e-17   
gb|EMG09265.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl diphosph...  90.5    1e-17   
ref|WP_010417793.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  93.2    1e-17   
ref|WP_027318083.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  93.2    1e-17   
ref|WP_026309265.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  91.3    1e-17   
ref|WP_004342058.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  93.2    1e-17   
dbj|GAK37212.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate s...  93.2    1e-17   
ref|WP_004381368.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  92.8    1e-17   
ref|WP_018477847.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  93.2    1e-17   
ref|WP_027454725.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  92.0    1e-17   
ref|WP_041259095.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  92.8    1e-17   
ref|WP_038029147.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  92.8    1e-17   
ref|WP_010675049.1|  MULTISPECIES: 4-hydroxy-3-methylbut-2-en-1-y...  90.9    1e-17   
ref|WP_042076598.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.9    2e-17   
ref|XP_001764903.1|  predicted protein                                92.8    2e-17   
gb|KFG52681.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase  93.6    2e-17   
ref|WP_042033547.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.9    2e-17   
ref|WP_042043762.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.9    2e-17   
ref|WP_024941377.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.9    2e-17   
ref|WP_042050892.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.9    2e-17   
ref|WP_025943319.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  91.3    2e-17   
ref|WP_013819254.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  91.3    2e-17   
ref|WP_033114509.1|  MULTISPECIES: 4-hydroxy-3-methylbut-2-en-1-y...  90.9    2e-17   
ref|WP_046010939.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.9    2e-17   
ref|WP_010634291.1|  MULTISPECIES: 4-hydroxy-3-methylbut-2-en-1-y...  90.9    2e-17   
ref|WP_016350405.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.9    2e-17   
ref|WP_008592103.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  92.8    2e-17   
ref|WP_042064338.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.9    2e-17   
ref|WP_011705645.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.9    2e-17   
ref|WP_026750307.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  92.8    2e-17   
ref|WP_045469021.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  92.8    2e-17   
emb|CCK75666.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synt...  90.9    2e-17   
ref|WP_028980942.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  92.4    2e-17   
ref|WP_033129115.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.5    2e-17   
ref|WP_002981464.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...  92.4    2e-17   
ref|WP_043759924.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.5    2e-17   
ref|WP_042063435.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.5    2e-17   
emb|CDP21797.1|  unnamed protein product                              84.3    2e-17   
ref|WP_042658451.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.5    2e-17   
ref|WP_006841499.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  92.4    2e-17   
ref|WP_042640718.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.5    2e-17   
ref|WP_007233265.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.5    2e-17   
ref|WP_024990128.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  92.4    2e-17   
ref|WP_033136070.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.5    2e-17   
ref|WP_007016456.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.5    2e-17   
ref|WP_002752446.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  92.4    2e-17   
ref|WP_004377953.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  92.4    2e-17   
ref|WP_040098380.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.5    2e-17   
ref|WP_005907848.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.5    2e-17   
ref|WP_001011573.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.9    2e-17   
ref|WP_005333801.1|  MULTISPECIES: 4-hydroxy-3-methylbut-2-en-1-y...  90.5    2e-17   
ref|WP_002558195.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  92.0    3e-17   
ref|WP_026878990.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.9    3e-17   
ref|WP_007487521.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  92.0    3e-17   
ref|WP_042865876.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.1    3e-17   
ref|WP_025071104.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  92.0    3e-17   
ref|WP_020770260.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...  92.0    3e-17   
ref|WP_026768257.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  92.0    3e-17   
ref|WP_043136741.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.1    3e-17   
ref|WP_043555292.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.1    3e-17   
ref|WP_042034644.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.1    3e-17   
ref|WP_010455890.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.1    3e-17   
ref|WP_038162080.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  92.0    3e-17   
ref|WP_001011587.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  92.0    3e-17   
ref|WP_011671608.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  92.0    3e-17   
ref|WP_002725099.1|  MULTISPECIES: 4-hydroxy-3-methylbut-2-en-1-y...  92.0    3e-17   
ref|WP_040919883.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  92.0    3e-17   
ref|WP_011670735.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  92.0    3e-17   
ref|WP_009965977.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  91.7    3e-17   
ref|WP_026772720.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  92.0    3e-17   
ref|WP_024915474.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.1    3e-17   
ref|WP_021140481.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.1    3e-17   
gb|ABO90624.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase  90.1    3e-17   
ref|WP_005310427.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.1    3e-17   
ref|WP_017259779.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  92.0    3e-17   
ref|WP_012388276.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  92.0    3e-17   
sp|Q0I9J4.1|ISPG_SYNS3  RecName: Full=4-hydroxy-3-methylbut-2-en-...  90.1    4e-17   
ref|WP_035756919.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.1    4e-17   
gb|EKD27770.1|  hypothetical protein ACD_79C00585G0008                91.7    4e-17   
ref|WP_013262243.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  89.7    4e-17   
ref|WP_008564334.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  91.7    4e-17   
ref|WP_043154776.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  89.7    4e-17   
ref|WP_036928792.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  91.7    4e-17   
ref|WP_037291592.1|  hypothetical protein                             91.3    4e-17   
ref|WP_024952383.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  89.7    4e-17   
ref|WP_028900850.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  91.3    4e-17   
ref|WP_008125240.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  91.3    4e-17   
ref|WP_039929258.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  91.7    4e-17   
ref|WP_042025965.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  89.7    4e-17   
ref|WP_002997489.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...  91.7    4e-17   
ref|WP_005356017.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  89.7    4e-17   
ref|XP_008882873.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  92.0    4e-17   
ref|WP_031432786.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.1    4e-17   
ref|WP_007134951.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  91.3    4e-17   
gb|EMO27346.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl diphosph...  91.3    5e-17   
ref|WP_004450043.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...  91.3    5e-17   
ref|WP_008763605.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  91.3    5e-17   
ref|WP_016560160.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...  91.3    5e-17   
ref|WP_026967844.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...  91.3    5e-17   
ref|WP_016269902.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  91.3    5e-17   
ref|WP_009669390.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  89.4    5e-17   
ref|WP_005344862.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  89.4    5e-17   
ref|WP_011108331.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  91.3    5e-17   
ref|WP_022470789.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  91.3    5e-17   
ref|WP_030002905.1|  MULTISPECIES: 4-hydroxy-3-methylbut-2-en-1-y...  89.7    5e-17   
ref|WP_008765163.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  91.3    5e-17   
ref|WP_005791302.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  91.3    5e-17   
ref|WP_029904849.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  91.3    5e-17   
ref|WP_016776386.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  91.3    5e-17   
ref|WP_004426903.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...  91.3    5e-17   
ref|WP_012457945.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.9    5e-17   
ref|WP_036825506.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  89.7    5e-17   
ref|WP_017765908.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  89.4    5e-17   
ref|WP_016411902.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.9    5e-17   
ref|WP_031578522.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  89.4    6e-17   
ref|WP_032529518.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.9    6e-17   
ref|WP_042019023.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  89.4    6e-17   
ref|WP_021825879.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.9    6e-17   
ref|WP_042652392.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  89.4    6e-17   
ref|WP_041426582.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  89.7    6e-17   
ref|WP_003887857.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  89.4    6e-17   
ref|WP_004373060.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.9    6e-17   
ref|WP_018600805.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  89.4    6e-17   
ref|WP_039586975.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  89.4    6e-17   
ref|WP_019969690.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  89.4    6e-17   
ref|WP_035455688.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.9    6e-17   
ref|WP_018920634.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.9    6e-17   
ref|WP_041311861.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  89.4    6e-17   
ref|WP_019968182.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...  90.9    6e-17   



>ref|XP_009592136.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Nicotiana tomentosiformis]
 ref|XP_009592137.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Nicotiana tomentosiformis]
Length=740

 Score =   302 bits (773),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 159/175 (91%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSS----SVEVQ  533
            MA GAVP SF GLK RENG+GF K++DFVRVSD+QRVK RR+KV VIRN++    ++E+Q
Sbjct  1    MAAGAVPTSFTGLKSRENGVGFAKSLDFVRVSDLQRVKFRRTKVSVIRNANPGPETIELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE IHKTVRRKT TVMVGNVA+GSEHPIRIQTMTTTDTKDVA TV
Sbjct  61   PASEGSPLLVPRQKYCESIHKTVRRKTCTVMVGNVAIGSEHPIRIQTMTTTDTKDVAATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVMKIAD GADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAP +AL
Sbjct  121  EQVMKIADAGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPPIAL  175



>ref|XP_010043743.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Eucalyptus grandis]
 gb|KCW85733.1| hypothetical protein EUGRSUZ_B02495 [Eucalyptus grandis]
Length=740

 Score =   302 bits (773),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 161/174 (93%), Gaps = 3/174 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRN---SSSVEVQP  536
            MA+GAVP SF+GLK R++GLGF K+MDFVR+SD QRV+S R K+ VIRN   +S +E++P
Sbjct  3    MASGAVPASFSGLKSRDSGLGFVKSMDFVRISDQQRVRSHRKKITVIRNCKPASEIELKP  62

Query  537  ASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVE  716
            ASEGSPLLVPRQKYCE +HKTVRRKTRTVMVGNVALGSEHPIRIQTMTT+DTKDVAGTVE
Sbjct  63   ASEGSPLLVPRQKYCESLHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTSDTKDVAGTVE  122

Query  717  QVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            QVMKIAD GAD+VRITVQGK+EADACFEIKNSLVQKNYNIPLVADIHFAPSVAL
Sbjct  123  QVMKIADKGADLVRITVQGKREADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  176



>emb|CDP07116.1| unnamed protein product [Coffea canephora]
Length=731

 Score =   300 bits (769),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 160/175 (91%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATGAVP SF GLK RENGLGF K+M+FVRVS+ QRVK RR+KV VI+NS+     VE+Q
Sbjct  1    MATGAVPASFTGLKSRENGLGFAKSMEFVRVSNTQRVKFRRTKVSVIKNSNPGQEIVELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE +HKT+RRKTRTVMVGNVALGSEHPIR+QTMTTTDTKDVAGTV
Sbjct  61   PASEGSPLLVPRQKYCESVHKTIRRKTRTVMVGNVALGSEHPIRVQTMTTTDTKDVAGTV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM IAD GAD+VRITVQGK+EADAC++IKN+LVQKNYNIPLVADIHFAPSVAL
Sbjct  121  EQVMGIADKGADLVRITVQGKREADACYDIKNTLVQKNYNIPLVADIHFAPSVAL  175



>dbj|BAF98296.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Hevea brasiliensis]
Length=740

 Score =   299 bits (765),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 160/175 (91%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATGAVP SF GLK R++ LGFGK+MDFVRV D++R+KS R K+ +IRNS+     VE+Q
Sbjct  1    MATGAVPASFTGLKTRDSSLGFGKSMDFVRVCDLKRIKSGRKKISMIRNSNPGPEMVELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE +HKTVRRKTRTVMVGNVALGSEHPIR+QTMTT+DTKDVAGTV
Sbjct  61   PASEGSPLLVPRQKYCESVHKTVRRKTRTVMVGNVALGSEHPIRVQTMTTSDTKDVAGTV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM+IAD GAD+VRITVQGK+EADACFEIKNSLVQKNYNIPLVADIHFAPSVAL
Sbjct  121  EQVMRIADQGADLVRITVQGKREADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  175



>gb|AEZ55668.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Salvia miltiorrhiza]
Length=742

 Score =   298 bits (764),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 161/177 (91%), Gaps = 6/177 (3%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGREN-GLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSS-----SVE  527
            MATGAVP SF GLK R++ GLGFGK+ DFVRVSD+QRVK  RSKV VIRNS+     +VE
Sbjct  1    MATGAVPASFTGLKSRDHRGLGFGKSSDFVRVSDLQRVKFGRSKVAVIRNSNNPGSETVE  60

Query  528  VQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAG  707
            ++PASEGSPLLVPRQKYCE IHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKD+AG
Sbjct  61   LKPASEGSPLLVPRQKYCESIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDIAG  120

Query  708  TVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            TVEQVM+IAD GAD+VRITVQG+KEADACFEIKNSLVQKNYNIPLVADIHFAP VA+
Sbjct  121  TVEQVMRIADQGADLVRITVQGRKEADACFEIKNSLVQKNYNIPLVADIHFAPPVAM  177



>gb|AJA39985.1| (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Salvia 
miltiorrhiza f. alba]
Length=742

 Score =   298 bits (764),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 161/177 (91%), Gaps = 6/177 (3%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGREN-GLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSS-----SVE  527
            MATGAVP SF GLK R++ GLGFGK+ DFVRVSD+QRVK  RSKV VIRNS+     +VE
Sbjct  1    MATGAVPASFTGLKSRDHRGLGFGKSSDFVRVSDLQRVKFGRSKVAVIRNSNNPGSETVE  60

Query  528  VQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAG  707
            ++PASEGSPLLVPRQKYCE IHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKD+AG
Sbjct  61   LKPASEGSPLLVPRQKYCESIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDIAG  120

Query  708  TVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            TVEQVM+IAD GAD+VRITVQG+KEADACFEIKNSLVQKNYNIPLVADIHFAP VA+
Sbjct  121  TVEQVMRIADQGADLVRITVQGRKEADACFEIKNSLVQKNYNIPLVADIHFAPPVAM  177



>ref|XP_010253662.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Nelumbo nucifera]
 ref|XP_010253663.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Nelumbo nucifera]
Length=740

 Score =   297 bits (761),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 159/175 (91%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATG+VP SF+G K R+ GL F K++DFV+VSD+QRVKSRRSKV  IRNS+S    VE+Q
Sbjct  1    MATGSVPASFSGPKIRDYGLSFTKSVDFVKVSDLQRVKSRRSKVSTIRNSNSGSETVELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            P SEGSPLLVPRQKYCE +HKTVRRKTRTVMVGNVA+GSEHPIRIQTMTTTDTKDVA TV
Sbjct  61   PTSEGSPLLVPRQKYCESLHKTVRRKTRTVMVGNVAIGSEHPIRIQTMTTTDTKDVAATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM+IAD GADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL
Sbjct  121  EQVMRIADKGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  175



>ref|XP_007016723.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase isoform 1 [Theobroma 
cacao]
 ref|XP_007016724.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase isoform 1 [Theobroma 
cacao]
 gb|EOY34342.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase isoform 1 [Theobroma 
cacao]
 gb|EOY34343.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase isoform 1 [Theobroma 
cacao]
Length=740

 Score =   297 bits (761),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 159/175 (91%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATGAVP SF+GLK R++ LGF K+MDFVRV D++R+KS R+++ VIRN +      E+Q
Sbjct  1    MATGAVPASFSGLKHRDSSLGFAKSMDFVRVCDLKRIKSGRTRISVIRNQNPGPDIAELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE IHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV
Sbjct  61   PASEGSPLLVPRQKYCESIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM+IAD GADIVRITVQGK+EADACFEIKN+LVQKNYNIPLVADIHFAPSVAL
Sbjct  121  EQVMRIADKGADIVRITVQGKREADACFEIKNTLVQKNYNIPLVADIHFAPSVAL  175



>gb|KDO73247.1| hypothetical protein CISIN_1g0046342mg, partial [Citrus sinensis]
 gb|KDO73248.1| hypothetical protein CISIN_1g0046342mg, partial [Citrus sinensis]
 gb|KDO73249.1| hypothetical protein CISIN_1g0046342mg, partial [Citrus sinensis]
 gb|KDO73250.1| hypothetical protein CISIN_1g0046342mg, partial [Citrus sinensis]
 gb|KDO73251.1| hypothetical protein CISIN_1g0046342mg, partial [Citrus sinensis]
 gb|KDO73252.1| hypothetical protein CISIN_1g0046342mg, partial [Citrus sinensis]
 gb|KDO73253.1| hypothetical protein CISIN_1g0046342mg, partial [Citrus sinensis]
 gb|KDO73254.1| hypothetical protein CISIN_1g0046342mg, partial [Citrus sinensis]
Length=466

 Score =   288 bits (738),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 155/176 (88%), Gaps = 5/176 (3%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS-----VEV  530
            MATG +P SF GLK R++GLGF K++DFVRV D ++ KS R +  VIRNSS+      E+
Sbjct  1    MATGTLPASFPGLKSRDSGLGFAKSVDFVRVCDFRKFKSGRRRFTVIRNSSNSSSDIAEL  60

Query  531  QPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGT  710
            QPASEGSPLLVPRQKYCE IHKTVRRKTRTVMVGNVA+GSEHPIR+QTMTT DTKDVAGT
Sbjct  61   QPASEGSPLLVPRQKYCESIHKTVRRKTRTVMVGNVAIGSEHPIRVQTMTTNDTKDVAGT  120

Query  711  VEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VE+VM+IAD GAD+VRITVQGK+EADACFEIKNSLVQKNYNIPLVADIHFAPSVAL
Sbjct  121  VEEVMRIADQGADLVRITVQGKREADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  176



>ref|NP_001234648.1| GcpE [Solanum lycopersicum]
 ref|XP_010313199.1| PREDICTED: gcpE isoform X1 [Solanum lycopersicum]
 gb|AAO15447.1|AF435086_1 GcpE [Solanum lycopersicum]
Length=740

 Score =   295 bits (755),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 157/175 (90%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSS----SVEVQ  533
            MA G VP SF GLK  ENGLGF K+M+F+RVSD+QRVK RR+K  VIRN++    ++E+Q
Sbjct  1    MAAGTVPASFTGLKSNENGLGFAKSMNFIRVSDLQRVKFRRTKFSVIRNANPGQETIELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE I+KTVRR+T TVMVGNVALGSEHPIRIQTMTTTDTKDVA TV
Sbjct  61   PASEGSPLLVPRQKYCESIYKTVRRQTCTVMVGNVALGSEHPIRIQTMTTTDTKDVAATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVMKIAD GADIVRITVQG+KEADACFEIKN+LVQKNYNIPLVADIHFAPSVAL
Sbjct  121  EQVMKIADAGADIVRITVQGRKEADACFEIKNTLVQKNYNIPLVADIHFAPSVAL  175



>ref|XP_006340201.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Solanum tuberosum]
Length=740

 Score =   295 bits (755),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 157/175 (90%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNS----SSVEVQ  533
            MA GAVP SF GLK  EN LGF K+M+FVRVSD+QRVK RR+KV VIRN+     ++E+Q
Sbjct  1    MAAGAVPASFTGLKSNENVLGFTKSMNFVRVSDLQRVKFRRTKVSVIRNAIPDQETIELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE I+KTVRR+T TVMVGNVALGSEHPIRIQTMTTTDTKDVA TV
Sbjct  61   PASEGSPLLVPRQKYCESIYKTVRRQTCTVMVGNVALGSEHPIRIQTMTTTDTKDVAATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVMKIAD GADIVRITVQGKKEADACFEIKN+LVQKNYNIPLVADIHFAPSVAL
Sbjct  121  EQVMKIADAGADIVRITVQGKKEADACFEIKNTLVQKNYNIPLVADIHFAPSVAL  175



>gb|AFQ98370.1| hydroxymethylbutenyl diphosphate synthase [Camellia sinensis]
Length=741

 Score =   295 bits (755),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 158/175 (90%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATGAVP SF GLK R++GLGF K+MDFV+V D+QRVK RR+KV VIRNS+      E+Q
Sbjct  1    MATGAVPASFTGLKSRDHGLGFVKSMDFVKVCDLQRVKFRRTKVSVIRNSNPGSEIAELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPL+VPRQKYCE IHKTVRRKTRTVMVGNVA+GSEHPIR+QTMTTTDTKDV  TV
Sbjct  61   PASEGSPLVVPRQKYCESIHKTVRRKTRTVMVGNVAIGSEHPIRVQTMTTTDTKDVDATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM+IADTGADIVRITVQGK+EADAC+EIKNSLVQKNY IPLVADIHFAPSVAL
Sbjct  121  EQVMRIADTGADIVRITVQGKREADACYEIKNSLVQKNYTIPLVADIHFAPSVAL  175



>ref|XP_008225831.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Prunus mume]
Length=616

 Score =   291 bits (745),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 157/175 (90%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATG VP SF GLKGR++ +GF K+MDFVRV D++R KS R+++ VIRNS+      E++
Sbjct  1    MATGTVPASFMGLKGRDSSIGFAKSMDFVRVCDLKRFKSGRTRISVIRNSNPGSDIAELK  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE IHKTVRRKTRTVMVGNVA+GSEHPIRIQTMTTTDTKDVA TV
Sbjct  61   PASEGSPLLVPRQKYCESIHKTVRRKTRTVMVGNVAIGSEHPIRIQTMTTTDTKDVAATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM+IAD GAD+VRITVQGKKEADACF+IKN+LVQKNYNIPLVADIHFAPSVAL
Sbjct  121  EQVMRIADKGADLVRITVQGKKEADACFDIKNTLVQKNYNIPLVADIHFAPSVAL  175



>ref|XP_006378965.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|ERP56762.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
Length=678

 Score =   291 bits (745),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 159/175 (91%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATGAVP SF+GL+ +E+GLGFGK+MDFVR+ D++R+KS R K+ +IRNS++    VE+Q
Sbjct  1    MATGAVPASFSGLQMKESGLGFGKSMDFVRICDIKRIKSGRKKISMIRNSNTGRDIVELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGS LLVPRQKYCE I+KTVRRKTRTVMVGNV LGSEHPIRIQTMTTTDTKDVA TV
Sbjct  61   PASEGSSLLVPRQKYCESINKTVRRKTRTVMVGNVPLGSEHPIRIQTMTTTDTKDVAATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM IAD GADIVR+TVQGK+EADACFEIKNSLVQKNYNIPLVADIHFAPSVAL
Sbjct  121  EQVMIIADKGADIVRLTVQGKREADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  175



>ref|XP_011089897.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Sesamum indicum]
 ref|XP_011089899.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Sesamum indicum]
 ref|XP_011089900.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Sesamum indicum]
Length=742

 Score =   292 bits (748),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 159/177 (90%), Gaps = 6/177 (3%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGREN-GLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSS-----SVE  527
            MATGAVP SF GLK R++ G+ F K+ DFVRVSD+QRVK RR+K+ VIRNS+     +VE
Sbjct  1    MATGAVPASFTGLKSRDHQGISFAKSSDFVRVSDLQRVKFRRTKIAVIRNSTNPGSDTVE  60

Query  528  VQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAG  707
            ++PAS+GSPLLVPRQKYCE IHKT+RRKT TVMVGNVALGSEHPIRIQTMTTTDTKDVA 
Sbjct  61   LEPASDGSPLLVPRQKYCESIHKTIRRKTSTVMVGNVALGSEHPIRIQTMTTTDTKDVAA  120

Query  708  TVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            TVEQVM+IAD GADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAP+VAL
Sbjct  121  TVEQVMRIADQGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPAVAL  177



>gb|KHG03611.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Gossypium 
arboreum]
Length=740

 Score =   292 bits (747),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 157/175 (90%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSS----SVEVQ  533
            MA+GAVP SF GLK ++ GLGF K+ DFVR+ D++R K+ R+++ VIRN +    + ++Q
Sbjct  1    MASGAVPASFPGLKSKDPGLGFAKSTDFVRICDLRRTKTGRTRISVIRNQNPSQDTAQLQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE IHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV
Sbjct  61   PASEGSPLLVPRQKYCESIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM+IAD GADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL
Sbjct  121  EQVMRIADKGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  175



>ref|XP_006378969.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|ERP56766.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
Length=708

 Score =   291 bits (744),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 159/175 (91%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATGAVP SF+GL+ +E+GLGFGK+MDFVR+ D++R+KS R K+ +IRNS++    VE+Q
Sbjct  1    MATGAVPASFSGLQMKESGLGFGKSMDFVRICDIKRIKSGRKKISMIRNSNTGRDIVELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGS LLVPRQKYCE I+KTVRRKTRTVMVGNV LGSEHPIRIQTMTTTDTKDVA TV
Sbjct  61   PASEGSSLLVPRQKYCESINKTVRRKTRTVMVGNVPLGSEHPIRIQTMTTTDTKDVAATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM IAD GADIVR+TVQGK+EADACFEIKNSLVQKNYNIPLVADIHFAPSVAL
Sbjct  121  EQVMIIADKGADIVRLTVQGKREADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  175



>ref|XP_006378968.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|ERP56765.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
Length=705

 Score =   290 bits (743),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 159/175 (91%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATGAVP SF+GL+ +E+GLGFGK+MDFVR+ D++R+KS R K+ +IRNS++    VE+Q
Sbjct  1    MATGAVPASFSGLQMKESGLGFGKSMDFVRICDIKRIKSGRKKISMIRNSNTGRDIVELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGS LLVPRQKYCE I+KTVRRKTRTVMVGNV LGSEHPIRIQTMTTTDTKDVA TV
Sbjct  61   PASEGSSLLVPRQKYCESINKTVRRKTRTVMVGNVPLGSEHPIRIQTMTTTDTKDVAATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM IAD GADIVR+TVQGK+EADACFEIKNSLVQKNYNIPLVADIHFAPSVAL
Sbjct  121  EQVMIIADKGADIVRLTVQGKREADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  175



>ref|XP_008225843.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Prunus mume]
Length=749

 Score =   291 bits (745),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 157/175 (90%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATG VP SF GLKGR++ +GF K+MDFVRV D++R KS R+++ VIRNS+      E++
Sbjct  1    MATGTVPASFMGLKGRDSSIGFAKSMDFVRVCDLKRFKSGRTRISVIRNSNPGSDIAELK  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE IHKTVRRKTRTVMVGNVA+GSEHPIRIQTMTTTDTKDVA TV
Sbjct  61   PASEGSPLLVPRQKYCESIHKTVRRKTRTVMVGNVAIGSEHPIRIQTMTTTDTKDVAATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM+IAD GAD+VRITVQGKKEADACF+IKN+LVQKNYNIPLVADIHFAPSVAL
Sbjct  121  EQVMRIADKGADLVRITVQGKKEADACFDIKNTLVQKNYNIPLVADIHFAPSVAL  175



>ref|XP_011044361.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Populus euphratica]
 ref|XP_011044362.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Populus euphratica]
Length=740

 Score =   291 bits (745),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 159/175 (91%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATGAVP SF+GL+ +E+GLGFGK+MDFVR+ D++R+KS R K+ +IRNS++    VE+Q
Sbjct  1    MATGAVPASFSGLQMKESGLGFGKSMDFVRICDIKRIKSDRKKISMIRNSNTGPDIVELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGS LLVPRQKYCE I+KTVRRKTRTVMVGNV LGSEHPIRIQTMTTTDTKDVA TV
Sbjct  61   PASEGSSLLVPRQKYCESINKTVRRKTRTVMVGNVPLGSEHPIRIQTMTTTDTKDVAATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM IAD GADIVR+TVQGK+EADACFEIKNSLVQKNYNIPLVADIHFAPSVAL
Sbjct  121  EQVMIIADKGADIVRLTVQGKREADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  175



>gb|KJB26175.1| hypothetical protein B456_004G228600 [Gossypium raimondii]
Length=740

 Score =   291 bits (745),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 157/175 (90%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSS----SVEVQ  533
            MA+GAVP SF GLK ++ GLGF K+ DFVR+ D++R K+ R+++ VIRN +    + ++Q
Sbjct  1    MASGAVPASFPGLKSKDPGLGFAKSTDFVRICDLRRTKTGRTRISVIRNQNPSQDTAQLQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE +HKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV
Sbjct  61   PASEGSPLLVPRQKYCESMHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM+IAD GADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL
Sbjct  121  EQVMRIADKGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  175



>gb|KJB26176.1| hypothetical protein B456_004G228600 [Gossypium raimondii]
Length=739

 Score =   291 bits (744),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 157/175 (90%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSS----SVEVQ  533
            MA+GAVP SF GLK ++ GLGF K+ DFVR+ D++R K+ R+++ VIRN +    + ++Q
Sbjct  1    MASGAVPASFPGLKSKDPGLGFAKSTDFVRICDLRRTKTGRTRISVIRNQNPSQDTAQLQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE +HKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV
Sbjct  61   PASEGSPLLVPRQKYCESMHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM+IAD GADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL
Sbjct  121  EQVMRIADKGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  175



>ref|XP_006378966.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 ref|XP_006378967.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 ref|XP_002314268.2| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 ref|XP_006378970.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|ERP56763.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|ERP56764.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|EEE88223.2| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|ERP56767.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
Length=741

 Score =   291 bits (744),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 159/175 (91%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATGAVP SF+GL+ +E+GLGFGK+MDFVR+ D++R+KS R K+ +IRNS++    VE+Q
Sbjct  1    MATGAVPASFSGLQMKESGLGFGKSMDFVRICDIKRIKSGRKKISMIRNSNTGRDIVELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGS LLVPRQKYCE I+KTVRRKTRTVMVGNV LGSEHPIRIQTMTTTDTKDVA TV
Sbjct  61   PASEGSSLLVPRQKYCESINKTVRRKTRTVMVGNVPLGSEHPIRIQTMTTTDTKDVAATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM IAD GADIVR+TVQGK+EADACFEIKNSLVQKNYNIPLVADIHFAPSVAL
Sbjct  121  EQVMIIADKGADIVRLTVQGKREADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  175



>ref|XP_008359197.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Malus domestica]
Length=740

 Score =   290 bits (742),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 156/175 (89%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATGAVP SF GLK R++  GF K+MDF RVSD++R KS R+++ VIRNS+      E++
Sbjct  1    MATGAVPASFTGLKSRDSSFGFAKSMDFARVSDLKRFKSGRTRISVIRNSNPGSDIAELK  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE IHKTVRRKTRTVMVGNVA+GSEHPIRIQTMTTTDTKDVA TV
Sbjct  61   PASEGSPLLVPRQKYCESIHKTVRRKTRTVMVGNVAIGSEHPIRIQTMTTTDTKDVAATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM+IAD GADIVRITVQG+KEADACFEIKNSLVQKNY+IPLVADIHFAP+VAL
Sbjct  121  EQVMRIADKGADIVRITVQGRKEADACFEIKNSLVQKNYDIPLVADIHFAPTVAL  175



>ref|XP_012064829.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(ferredoxin), chloroplastic [Jatropha curcas]
 ref|XP_012064830.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(ferredoxin), chloroplastic [Jatropha curcas]
 gb|KDP44060.1| hypothetical protein JCGZ_05527 [Jatropha curcas]
Length=740

 Score =   290 bits (742),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 158/175 (90%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATG VP SF GLK RE+ LGFGK+MDFVRV D++R+KS R K+ +IRNS+     VE+Q
Sbjct  1    MATGTVPASFTGLKARESSLGFGKSMDFVRVCDLKRIKSGRKKISMIRNSNPGPEMVELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE +HKTVRRKTRTVMVGNVALGS+HPIR+QTMTT+DTKDVAGTV
Sbjct  61   PASEGSPLLVPRQKYCESVHKTVRRKTRTVMVGNVALGSDHPIRVQTMTTSDTKDVAGTV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM+IAD GA++VRITVQGK+EADA FEIKN+LVQKNYNIPLVADIHFAP+VAL
Sbjct  121  EQVMRIADQGANLVRITVQGKREADAAFEIKNTLVQKNYNIPLVADIHFAPTVAL  175



>gb|AGQ04156.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Lavandula 
angustifolia]
Length=742

 Score =   290 bits (742),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 159/177 (90%), Gaps = 6/177 (3%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENG-LGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSS-----SVE  527
            MATGAVP SF GLK R++  LGF K+ DFVRVS++QRVK  R+KV VIRNS+     +VE
Sbjct  1    MATGAVPASFTGLKSRDHPCLGFAKSSDFVRVSNLQRVKFGRTKVAVIRNSNNPSRETVE  60

Query  528  VQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAG  707
            ++PASEGSPLLVPRQKYCE IHKTVRRKTRTVMVGNVALGSEHPIR+QTMTTTDTKDVAG
Sbjct  61   LEPASEGSPLLVPRQKYCESIHKTVRRKTRTVMVGNVALGSEHPIRVQTMTTTDTKDVAG  120

Query  708  TVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            TVEQVM+IAD GADIVRITVQG+KEADACFEIKN+LVQKNYNIPLVADIHFAP VA+
Sbjct  121  TVEQVMRIADQGADIVRITVQGRKEADACFEIKNTLVQKNYNIPLVADIHFAPPVAM  177



>ref|XP_004295028.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Fragaria vesca subsp. vesca]
 ref|XP_011461710.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Fragaria vesca subsp. vesca]
Length=740

 Score =   289 bits (739),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 157/175 (90%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATGAVP SF GL GRE  LGF K++DFVRVSD++R KS R+++ VIRNS+      E++
Sbjct  1    MATGAVPASFTGLTGRETTLGFTKSVDFVRVSDLKRFKSGRTRISVIRNSNPGSDIAELK  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE IHKTVRRKTRTVMVGNVA+GSEHPIRIQTMTT+DTK+V+ TV
Sbjct  61   PASEGSPLLVPRQKYCESIHKTVRRKTRTVMVGNVAIGSEHPIRIQTMTTSDTKEVSATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            E+VM+IAD GADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL
Sbjct  121  EEVMRIADKGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  175



>ref|XP_008349746.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Malus domestica]
 ref|XP_008349747.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Malus domestica]
Length=740

 Score =   289 bits (739),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 156/175 (89%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATGAVP SF GLKG ++  GF K+MDFVRVSD++R KS R+++ V RNS+      E++
Sbjct  1    MATGAVPASFTGLKGXDSSFGFAKSMDFVRVSDLKRFKSGRTRISVXRNSNPGSDIAELK  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE +HKTVRRKTRTVMVGNVA+GSEHPIRIQTMTTTDTKDVA TV
Sbjct  61   PASEGSPLLVPRQKYCESVHKTVRRKTRTVMVGNVAIGSEHPIRIQTMTTTDTKDVAATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM+IAD GADIVRITVQG+KEADACFEIKNSLVQKNY+IPLVADIHFAP+VAL
Sbjct  121  EQVMRIADKGADIVRITVQGRKEADACFEIKNSLVQKNYDIPLVADIHFAPTVAL  175



>ref|XP_009335082.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Pyrus x bretschneideri]
 ref|XP_009335083.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Pyrus x bretschneideri]
Length=740

 Score =   289 bits (739),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 156/175 (89%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATGAVP SF G KGR++  GF K+MDFVRVSD++R KS R+++ VIRNS+      E++
Sbjct  1    MATGAVPASFTGPKGRDSSFGFAKSMDFVRVSDLKRFKSGRTRISVIRNSNPGSDIAELK  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE +HKTVRRKTRTVMVGNV +GSEHPIRIQTMTTTDTKDVA TV
Sbjct  61   PASEGSPLLVPRQKYCESVHKTVRRKTRTVMVGNVGIGSEHPIRIQTMTTTDTKDVAATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM+IAD GADIVRITVQG+KEADACFEIKNSLVQKNY+IPLVADIHFAP+VAL
Sbjct  121  EQVMRIADKGADIVRITVQGRKEADACFEIKNSLVQKNYDIPLVADIHFAPTVAL  175



>ref|XP_006424584.1| hypothetical protein CICLE_v10027881mg [Citrus clementina]
 gb|ESR37824.1| hypothetical protein CICLE_v10027881mg [Citrus clementina]
Length=676

 Score =   287 bits (735),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 155/176 (88%), Gaps = 5/176 (3%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS-----VEV  530
            MATG +P SF GLK R++GLGF K++DFVRV D ++ KS R +  VIRNSS+      E+
Sbjct  1    MATGTLPASFPGLKSRDSGLGFAKSVDFVRVCDFRKFKSGRRRFTVIRNSSNSSSDIAEL  60

Query  531  QPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGT  710
            QPASEGSPLLVPRQKYCE IHKTVRRKTRTVMVGNVA+GSEHPIR+QTMTT DTKDVAGT
Sbjct  61   QPASEGSPLLVPRQKYCESIHKTVRRKTRTVMVGNVAIGSEHPIRVQTMTTNDTKDVAGT  120

Query  711  VEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VE+VM+IAD GAD+VRITVQGK+EADACFEIKN+LVQKNYNIPLVADIHFAPSVAL
Sbjct  121  VEEVMRIADQGADLVRITVQGKREADACFEIKNTLVQKNYNIPLVADIHFAPSVAL  176



>gb|AAO24774.1| GCPE protein [Catharanthus roseus]
Length=740

 Score =   289 bits (739),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 158/175 (90%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSS----SVEVQ  533
            MATG VP SF GLK RENGLGF K+MDFV+VSD++RVK RR+KV VI+NS+    +VE+Q
Sbjct  1    MATGTVPASFTGLKSRENGLGFAKSMDFVQVSDLRRVKFRRAKVSVIKNSNPGPETVELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PAS+GS LLVP QKYCE IHKTVRRKTRTVMVGNVALGS+HPIRIQTMTTTDTKDVA TV
Sbjct  61   PASQGSQLLVPVQKYCESIHKTVRRKTRTVMVGNVALGSDHPIRIQTMTTTDTKDVAATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM IAD GADIVRITVQGKKEADAC++IKN+LVQK+YNIPLVADIHFAP+VAL
Sbjct  121  EQVMGIADKGADIVRITVQGKKEADACYDIKNTLVQKSYNIPLVADIHFAPAVAL  175



>ref|XP_009367086.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Pyrus x bretschneideri]
 ref|XP_009367087.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Pyrus x bretschneideri]
 ref|XP_009367088.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Pyrus x bretschneideri]
Length=740

 Score =   287 bits (734),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 156/175 (89%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATGAVP SF GLK R++  GF K+MDFVRVSD++R KS R+++ VIRNS+      E++
Sbjct  1    MATGAVPASFTGLKSRDSSFGFAKSMDFVRVSDLKRFKSGRTRISVIRNSNRGSDIAELK  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE IHKTVRRKT TVMVGNVA+GSEHPIR+QTMTTTDTKDVA TV
Sbjct  61   PASEGSPLLVPRQKYCESIHKTVRRKTCTVMVGNVAIGSEHPIRVQTMTTTDTKDVAATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM+IAD GADIVRITVQG+KEADACFEIKNSLVQKNY+IPLVADIHFAP+VAL
Sbjct  121  EQVMRIADKGADIVRITVQGRKEADACFEIKNSLVQKNYDIPLVADIHFAPTVAL  175



>ref|XP_006384896.1| hypothetical protein POPTR_0004s22010g [Populus trichocarpa]
 gb|ERP62693.1| hypothetical protein POPTR_0004s22010g [Populus trichocarpa]
Length=760

 Score =   287 bits (735),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 160/175 (91%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATGAVP SF+GLK RE+ LGFGK++DFVR+ D++R+KS R ++ +I+NS++    VE+Q
Sbjct  1    MATGAVPASFSGLKMRESSLGFGKSVDFVRICDIKRIKSGRKRISMIQNSNTGPGIVELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPR+KYCE I+KTVRRKTRTV+VGNV LGSEHP+R+QTMTTTDTKDVA TV
Sbjct  61   PASEGSPLLVPRKKYCESINKTVRRKTRTVLVGNVPLGSEHPVRVQTMTTTDTKDVAATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM+IAD GADIVRITVQGK+EADACFEIKNSLVQKNYNIPLVADIHFAPSVAL
Sbjct  121  EQVMRIADKGADIVRITVQGKREADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  175



>ref|XP_006424585.1| hypothetical protein CICLE_v10027881mg [Citrus clementina]
 ref|XP_006424586.1| hypothetical protein CICLE_v10027881mg [Citrus clementina]
 ref|XP_006488107.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X3 [Citrus sinensis]
 gb|ESR37825.1| hypothetical protein CICLE_v10027881mg [Citrus clementina]
 gb|ESR37826.1| hypothetical protein CICLE_v10027881mg [Citrus clementina]
Length=741

 Score =   287 bits (734),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 155/176 (88%), Gaps = 5/176 (3%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS-----VEV  530
            MATG +P SF GLK R++GLGF K++DFVRV D ++ KS R +  VIRNSS+      E+
Sbjct  1    MATGTLPASFPGLKSRDSGLGFAKSVDFVRVCDFRKFKSGRRRFTVIRNSSNSSSDIAEL  60

Query  531  QPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGT  710
            QPASEGSPLLVPRQKYCE IHKTVRRKTRTVMVGNVA+GSEHPIR+QTMTT DTKDVAGT
Sbjct  61   QPASEGSPLLVPRQKYCESIHKTVRRKTRTVMVGNVAIGSEHPIRVQTMTTNDTKDVAGT  120

Query  711  VEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VE+VM+IAD GAD+VRITVQGK+EADACFEIKN+LVQKNYNIPLVADIHFAPSVAL
Sbjct  121  VEEVMRIADQGADLVRITVQGKREADACFEIKNTLVQKNYNIPLVADIHFAPSVAL  176



>ref|XP_006488105.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X1 [Citrus sinensis]
 ref|XP_006488106.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X2 [Citrus sinensis]
Length=751

 Score =   286 bits (732),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 155/176 (88%), Gaps = 5/176 (3%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS-----VEV  530
            MATG +P SF GLK R++GLGF K++DFVRV D ++ KS R +  VIRNSS+      E+
Sbjct  1    MATGTLPASFPGLKSRDSGLGFAKSVDFVRVCDFRKFKSGRRRFTVIRNSSNSSSDIAEL  60

Query  531  QPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGT  710
            QPASEGSPLLVPRQKYCE IHKTVRRKTRTVMVGNVA+GSEHPIR+QTMTT DTKDVAGT
Sbjct  61   QPASEGSPLLVPRQKYCESIHKTVRRKTRTVMVGNVAIGSEHPIRVQTMTTNDTKDVAGT  120

Query  711  VEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VE+VM+IAD GAD+VRITVQGK+EADACFEIKN+LVQKNYNIPLVADIHFAPSVAL
Sbjct  121  VEEVMRIADQGADLVRITVQGKREADACFEIKNTLVQKNYNIPLVADIHFAPSVAL  176



>ref|NP_001289212.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, chloroplastic 
[Pyrus x bretschneideri]
 gb|AHM26645.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase protein 
[Pyrus x bretschneideri]
Length=740

 Score =   285 bits (730),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 155/175 (89%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATGAVP SF GLK R++  GF K+MDFVRVSD++R KS R+++ VIRNS+      E++
Sbjct  1    MATGAVPASFTGLKSRDSSFGFAKSMDFVRVSDLKRFKSGRTRISVIRNSNPGSDIAELK  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE IHKTVRRKT TV VGNVA+GSEHPIRIQTMTTTDTKDVA TV
Sbjct  61   PASEGSPLLVPRQKYCESIHKTVRRKTCTVAVGNVAIGSEHPIRIQTMTTTDTKDVAATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM+IAD GADIVRITVQG+KEADACFEIKNSLVQKNY+IPLVADIHFAP+VAL
Sbjct  121  EQVMRIADKGADIVRITVQGRKEADACFEIKNSLVQKNYDIPLVADIHFAPTVAL  175



>ref|XP_010098198.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Morus notabilis]
 gb|EXB74654.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Morus notabilis]
Length=978

 Score =   289 bits (740),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 157/175 (90%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MA G VP +F+GLK R++GLGF K++DFV+VSD++RVK  R++V VIRNS+      E+Q
Sbjct  239  MAAGTVPAAFSGLKSRDSGLGFAKSLDFVKVSDLKRVKFARTRVSVIRNSNPGSDIAELQ  298

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
              SEGSPLLVPRQKYCE +HKTVRRKTRTVMVGNVALGSEHPIRIQTMTT+DTKDVAGTV
Sbjct  299  STSEGSPLLVPRQKYCESLHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTSDTKDVAGTV  358

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM+IAD GADIVRITVQGKKEADACFEIKN+LVQKNYNIPLVADIHFAPSVAL
Sbjct  359  EQVMRIADKGADIVRITVQGKKEADACFEIKNTLVQKNYNIPLVADIHFAPSVAL  413



>ref|XP_004487120.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X2 [Cicer arietinum]
Length=740

 Score =   285 bits (729),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 156/175 (89%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MA G VP SF+  + R++GLGFGK++DFVRVSD++R+ S R+KV +IRNS+S     E+Q
Sbjct  1    MAAGTVPASFSSFRKRDSGLGFGKSIDFVRVSDLKRMNSARTKVSIIRNSNSGQDIAELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PAS+GS LLVPRQKYCE +HKTVRRKTRTV VG+V +GSEHPIRIQTMTTTDTKDVAGTV
Sbjct  61   PASKGSQLLVPRQKYCESLHKTVRRKTRTVTVGDVTIGSEHPIRIQTMTTTDTKDVAGTV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVMKIAD GADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAP+VAL
Sbjct  121  EQVMKIADKGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPTVAL  175



>gb|ADX06907.1| 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate synthase [Rauvolfia 
verticillata]
Length=740

 Score =   285 bits (728),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 156/175 (89%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSS----SVEVQ  533
            MATG VP SF GLK  ENGLGF K++DFVRVSD++RVK  R+KV VI+NS+    ++E+Q
Sbjct  1    MATGTVPASFTGLKSGENGLGFAKSIDFVRVSDLRRVKFLRAKVSVIKNSNPGPETLELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGS LLVP QKYCE +HKTVRRKTRTVMVG VALGS+HPIRIQTMTTTDTKDVA TV
Sbjct  61   PASEGSQLLVPVQKYCESVHKTVRRKTRTVMVGKVALGSDHPIRIQTMTTTDTKDVAATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM+IAD GADIVRITVQGKKEADAC++IKN+LVQKNYNIPLVADIHFAPSVAL
Sbjct  121  EQVMRIADKGADIVRITVQGKKEADACYDIKNTLVQKNYNIPLVADIHFAPSVAL  175



>gb|EYU36192.1| hypothetical protein MIMGU_mgv1a001893mg [Erythranthe guttata]
Length=743

 Score =   284 bits (727),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 155/177 (88%), Gaps = 6/177 (3%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRE-NGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNS-----SSVE  527
            MATGAVP SF  LK R+  G+ F K+ DFVRVSD+QR+K RR+K+ V+RNS      +VE
Sbjct  1    MATGAVPASFTALKSRDLKGISFAKSSDFVRVSDLQRIKFRRTKIAVVRNSGNPGSETVE  60

Query  528  VQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAG  707
            ++PAS+GS LLVPRQKYCE IHKT+RRKT TVMVGNVALGSEHPIRIQTMTTTDTKDVAG
Sbjct  61   LEPASDGSTLLVPRQKYCESIHKTIRRKTCTVMVGNVALGSEHPIRIQTMTTTDTKDVAG  120

Query  708  TVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            TVEQVM+IAD GADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAP +AL
Sbjct  121  TVEQVMRIADKGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPPIAL  177



>gb|EYU36193.1| hypothetical protein MIMGU_mgv1a001893mg [Erythranthe guttata]
Length=742

 Score =   284 bits (727),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 155/177 (88%), Gaps = 6/177 (3%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRE-NGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNS-----SSVE  527
            MATGAVP SF  LK R+  G+ F K+ DFVRVSD+QR+K RR+K+ V+RNS      +VE
Sbjct  1    MATGAVPASFTALKSRDLKGISFAKSSDFVRVSDLQRIKFRRTKIAVVRNSGNPGSETVE  60

Query  528  VQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAG  707
            ++PAS+GS LLVPRQKYCE IHKT+RRKT TVMVGNVALGSEHPIRIQTMTTTDTKDVAG
Sbjct  61   LEPASDGSTLLVPRQKYCESIHKTIRRKTCTVMVGNVALGSEHPIRIQTMTTTDTKDVAG  120

Query  708  TVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            TVEQVM+IAD GADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAP +AL
Sbjct  121  TVEQVMRIADKGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPPIAL  177



>ref|XP_007150210.1| hypothetical protein PHAVU_005G135800g [Phaseolus vulgaris]
 gb|ESW22204.1| hypothetical protein PHAVU_005G135800g [Phaseolus vulgaris]
Length=740

 Score =   284 bits (726),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 155/175 (89%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MA+G VP SF+ LK  ++ LGF K++DFVRVSD++ +KS R KV +IRNS+     VE+Q
Sbjct  1    MASGTVPTSFSSLKTWDSNLGFAKSIDFVRVSDLKSMKSSRKKVSIIRNSNPGQDIVELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PAS GSPLLVPRQKYCE +HKTVRRKT TVMVGNVALGSEHPIR+QTMTTTDTKD+AGTV
Sbjct  61   PASPGSPLLVPRQKYCESLHKTVRRKTSTVMVGNVALGSEHPIRVQTMTTTDTKDIAGTV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM+IAD GADIVRITVQGKKEADACFEIKN+LVQKNYNIPLVADIHFAP+VAL
Sbjct  121  EQVMRIADKGADIVRITVQGKKEADACFEIKNTLVQKNYNIPLVADIHFAPTVAL  175



>ref|XP_002530286.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Ricinus communis]
 gb|EEF32093.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Ricinus communis]
Length=716

 Score =   283 bits (724),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 158/177 (89%), Gaps = 6/177 (3%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSR-RSKVCVIRNSSS-----VE  527
            MATGAVP SF GLK RE+ LGFGK+MDFVR+ D++R+KS  R ++ +IRNSS+     VE
Sbjct  1    MATGAVPTSFTGLKTRESNLGFGKSMDFVRICDLKRIKSGGRKRISMIRNSSNPGPEMVE  60

Query  528  VQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAG  707
            +QPAS GSPLLVPRQKYCE  HKTVRRKTRTVMVGNVALGS+HPIR+QTMTT+DTK+VA 
Sbjct  61   LQPASPGSPLLVPRQKYCESTHKTVRRKTRTVMVGNVALGSDHPIRVQTMTTSDTKNVAA  120

Query  708  TVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            TVE+VM+IAD GAD+VRITVQGK+EADACF+IKNSLVQKNYNIPLVADIHFAPSVAL
Sbjct  121  TVEEVMRIADKGADLVRITVQGKREADACFDIKNSLVQKNYNIPLVADIHFAPSVAL  177



>ref|XP_004487119.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X1 [Cicer arietinum]
Length=774

 Score =   284 bits (727),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 156/175 (89%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MA G VP SF+  + R++GLGFGK++DFVRVSD++R+ S R+KV +IRNS+S     E+Q
Sbjct  1    MAAGTVPASFSSFRKRDSGLGFGKSIDFVRVSDLKRMNSARTKVSIIRNSNSGQDIAELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PAS+GS LLVPRQKYCE +HKTVRRKTRTV VG+V +GSEHPIRIQTMTTTDTKDVAGTV
Sbjct  61   PASKGSQLLVPRQKYCESLHKTVRRKTRTVTVGDVTIGSEHPIRIQTMTTTDTKDVAGTV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVMKIAD GADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAP+VAL
Sbjct  121  EQVMKIADKGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPTVAL  175



>ref|XP_002285130.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Vitis vinifera]
 emb|CBI16309.3| unnamed protein product [Vitis vinifera]
Length=740

 Score =   283 bits (723),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 153/175 (87%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATG+VP SF+GL+  +  LG  K++DFVRVSDMQR+   R KV VIRNS+      E+Q
Sbjct  1    MATGSVPTSFSGLRRMDCNLGSSKSVDFVRVSDMQRITYGRRKVSVIRNSNPSSDIAELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
             +SEGSPLLVPRQKYCE IHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVA TV
Sbjct  61   ASSEGSPLLVPRQKYCESIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVMKIAD GADIVRITVQGK+EADACFEIKNSLVQKNYNIPLVADIHFAPSVAL
Sbjct  121  EQVMKIADKGADIVRITVQGKREADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  175



>gb|ABG75916.2| (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Stevia 
rebaudiana]
Length=740

 Score =   281 bits (719),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 152/175 (87%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATGA P SF  LKGRENGLGF K  DFV+VSD++RVK  R+K+ V +NS S     E +
Sbjct  1    MATGAAPTSFMSLKGRENGLGFAKTSDFVKVSDLKRVKFHRTKIFVPKNSKSGSDIAEFK  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVP QKYCE  HKT+RRKTRTVMVG+VALGS+HPIRIQTMTT+DTKDVA TV
Sbjct  61   PASEGSPLLVPVQKYCESTHKTLRRKTRTVMVGDVALGSDHPIRIQTMTTSDTKDVAATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM+IAD GAD+VRITVQGK+EADACFEIKN+LVQKNYNIPLVADIHFAPSVAL
Sbjct  121  EQVMQIADRGADLVRITVQGKREADACFEIKNTLVQKNYNIPLVADIHFAPSVAL  175



>gb|AES67479.2| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Medicago truncatula]
Length=740

 Score =   280 bits (716),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 154/175 (88%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            M  G VP SF+ L+  ++GLGFGK++DFVRVSD+QR+KS R KV +IRNS+      E+Q
Sbjct  1    MVAGTVPASFSSLRTCDSGLGFGKSIDFVRVSDLQRMKSSRRKVSIIRNSNPSQDIAELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PAS+GS LLVPRQKYCE +HKTVRRKTRTV VG+V +GS+HPIRIQTMTTTDTKDVAGTV
Sbjct  61   PASKGSQLLVPRQKYCESLHKTVRRKTRTVNVGDVTIGSDHPIRIQTMTTTDTKDVAGTV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVMKIAD GADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAP+VAL
Sbjct  121  EQVMKIADKGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPTVAL  175



>gb|KHN11204.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Glycine 
soja]
Length=741

 Score =   280 bits (715),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 155/176 (88%), Gaps = 5/176 (3%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSR-RSKVCVIRNSSS----VEV  530
            MA+GAVP +F+ LK  ++ LGF K+MDFVRVSD++ +KS  R +V +IRNS+      E+
Sbjct  1    MASGAVPTTFSTLKTWDSSLGFAKSMDFVRVSDLKSMKSSARKRVSIIRNSNPGQDIAEL  60

Query  531  QPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGT  710
            QPAS GSPLLVPRQKYCE +HKTVRRKT TVMVGNVA+GSEHPIRIQTMTTTDTKDVAGT
Sbjct  61   QPASPGSPLLVPRQKYCESLHKTVRRKTNTVMVGNVAIGSEHPIRIQTMTTTDTKDVAGT  120

Query  711  VEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VEQVM+IAD GADIVRITVQGKKEADACFEIKN+LVQKNYNIPLVADIHFAPSVAL
Sbjct  121  VEQVMRIADKGADIVRITVQGKKEADACFEIKNTLVQKNYNIPLVADIHFAPSVAL  176



>emb|CAN72185.1| hypothetical protein VITISV_005654 [Vitis vinifera]
Length=740

 Score =   279 bits (714),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 152/175 (87%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATG+VP SF+GL+  +  LG  K++DFVRVSDMQR+   R KV VIRNS+      E+Q
Sbjct  1    MATGSVPTSFSGLRRMDCNLGSSKSVDFVRVSDMQRITYGRRKVSVIRNSNPSSDIAELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
             +SEGSPLLVPRQKYCE IHKTVRRKT TVMVGNVALGSEHPIRIQTMTTTDTKDVA TV
Sbjct  61   ASSEGSPLLVPRQKYCESIHKTVRRKTCTVMVGNVALGSEHPIRIQTMTTTDTKDVAATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVMKIAD GADIVRITVQGK+EADACFEIKNSLVQKNYNIPLVADIHFAPSVAL
Sbjct  121  EQVMKIADKGADIVRITVQGKREADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  175



>gb|EPS69702.1| hypothetical protein M569_05062, partial [Genlisea aurea]
Length=474

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 154/177 (87%), Gaps = 6/177 (3%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENG-LGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS-----VE  527
            MATG+VP SF G++ R++   G  K+ DFVRVSD++RVK  R++V VIR+SSS     VE
Sbjct  1    MATGSVPTSFTGVQIRDHERFGVAKSSDFVRVSDLRRVKFGRNRVGVIRSSSSPGSETVE  60

Query  528  VQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAG  707
            ++PAS GSPLLVPRQKYCE IHKTVRRKTRTVMVGNV LGSEHPIRIQTMTTTDTKDVA 
Sbjct  61   LEPASAGSPLLVPRQKYCESIHKTVRRKTRTVMVGNVPLGSEHPIRIQTMTTTDTKDVAA  120

Query  708  TVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            TVEQVM+IAD GADIVRITVQG+KEADACFEIKNSLVQKNYNIPLVADIHFAP +A+
Sbjct  121  TVEQVMRIADRGADIVRITVQGRKEADACFEIKNSLVQKNYNIPLVADIHFAPPIAI  177



>ref|XP_003540178.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X1 [Glycine max]
 ref|XP_006592698.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X2 [Glycine max]
 ref|XP_006592699.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X3 [Glycine max]
Length=741

 Score =   279 bits (714),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 155/176 (88%), Gaps = 5/176 (3%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSR-RSKVCVIRNSSS----VEV  530
            MA+GAVP +F+ LK  ++ LGF K+MDFVRVSD++ +KS  R +V +IRNS+      E+
Sbjct  1    MASGAVPTTFSTLKTWDSSLGFAKSMDFVRVSDLKSMKSSARKRVSIIRNSNPGQDIAEL  60

Query  531  QPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGT  710
            QPAS GSPLLVPRQKYCE +HKTVRRKT TVMVGNVA+GSEHPIRIQTMTTTDTKDVAGT
Sbjct  61   QPASPGSPLLVPRQKYCESLHKTVRRKTNTVMVGNVAIGSEHPIRIQTMTTTDTKDVAGT  120

Query  711  VEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VEQVM+IAD GADIVRITVQGKKEADACFEIKN+LVQKNYNIPLVADIHFAPSVAL
Sbjct  121  VEQVMRIADKGADIVRITVQGKKEADACFEIKNTLVQKNYNIPLVADIHFAPSVAL  176



>ref|XP_003597228.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Medicago 
truncatula]
Length=767

 Score =   280 bits (715),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 154/175 (88%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            M  G VP SF+ L+  ++GLGFGK++DFVRVSD+QR+KS R KV +IRNS+      E+Q
Sbjct  1    MVAGTVPASFSSLRTCDSGLGFGKSIDFVRVSDLQRMKSSRRKVSIIRNSNPSQDIAELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PAS+GS LLVPRQKYCE +HKTVRRKTRTV VG+V +GS+HPIRIQTMTTTDTKDVAGTV
Sbjct  61   PASKGSQLLVPRQKYCESLHKTVRRKTRTVNVGDVTIGSDHPIRIQTMTTTDTKDVAGTV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVMKIAD GADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAP+VAL
Sbjct  121  EQVMKIADKGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPTVAL  175



>gb|AHA11129.1| chloroplast 4-hydroxy-3-methylbut-2-enyl diphosphate synthase 
[Picrorhiza kurrooa]
Length=748

 Score =   277 bits (708),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 155/177 (88%), Gaps = 6/177 (3%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENG-LGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSS-----SVE  527
            MATG VP SF GLK R++  LGF K  DFVRVSD+QRVK RR+KV VIR+S+     ++E
Sbjct  1    MATGTVPSSFTGLKSRDHQRLGFAKTSDFVRVSDLQRVKFRRTKVSVIRSSTNPGSETLE  60

Query  528  VQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAG  707
            ++PAS+GS LLVPRQKYCE IHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVA 
Sbjct  61   LEPASDGSTLLVPRQKYCESIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAA  120

Query  708  TVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            TVEQVM+IAD GAD+VRITVQG+KEAD+CF+IKN+L+QKNY IPLVADIHFAP VA+
Sbjct  121  TVEQVMRIADQGADLVRITVQGRKEADSCFDIKNTLIQKNYTIPLVADIHFAPPVAM  177



>gb|KHN21521.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Glycine 
soja]
Length=742

 Score =   275 bits (702),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 154/177 (87%), Gaps = 6/177 (3%)
 Frame = +3

Query  366  MATGA-VPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSR-RSKVCVIRNSSS----VE  527
            MATGA VP +F+ LK  ++ LGF KN+DFVRVSDM+ +KS  R +V +IRNS+      E
Sbjct  1    MATGAAVPTTFSTLKTWDSSLGFAKNIDFVRVSDMKSMKSSARKRVSIIRNSNPGQDIAE  60

Query  528  VQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAG  707
            +QPAS GSPLLVPRQKYCE +HK +RRKT TVMVGNVA+GSEHPIRIQTMTTTDTKDVAG
Sbjct  61   LQPASPGSPLLVPRQKYCESLHKPIRRKTSTVMVGNVAIGSEHPIRIQTMTTTDTKDVAG  120

Query  708  TVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            TVEQVM+IAD GADIVRITVQGKKEADACFEIKN+LVQKNYNIPLVADIHFAPSVAL
Sbjct  121  TVEQVMRIADKGADIVRITVQGKKEADACFEIKNTLVQKNYNIPLVADIHFAPSVAL  177



>gb|AID51432.1| (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Astragalus 
membranaceus]
Length=742

 Score =   275 bits (702),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 153/177 (86%), Gaps = 6/177 (3%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSR--RSKVCVIRNSSS----VE  527
            MA G VP SF   +  ++GLGFGK++DFVRVSD++R+KS   RSKV +IRNS+      E
Sbjct  1    MAAGTVPASFTNFRKCDSGLGFGKSIDFVRVSDLKRIKSATARSKVSIIRNSNPSQDVTE  60

Query  528  VQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAG  707
            +QPASE S LLVPRQKY E +HKTVRRKT TVMVGNVA+GSEHPIRIQTMTTTDTKDVAG
Sbjct  61   LQPASERSQLLVPRQKYSESLHKTVRRKTNTVMVGNVAIGSEHPIRIQTMTTTDTKDVAG  120

Query  708  TVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            TVEQVM+IAD GADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAP+VAL
Sbjct  121  TVEQVMRIADKGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPTVAL  177



>ref|XP_003543457.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Glycine max]
Length=742

 Score =   275 bits (702),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 154/177 (87%), Gaps = 6/177 (3%)
 Frame = +3

Query  366  MATGA-VPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSR-RSKVCVIRNSSS----VE  527
            MATGA VP +F+ LK  ++ LGF KN+DFVRVSDM+ +KS  R +V +IRNS+      E
Sbjct  1    MATGAAVPTTFSTLKTWDSSLGFAKNIDFVRVSDMKSMKSSARKRVSIIRNSNPGQDIAE  60

Query  528  VQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAG  707
            +QPAS GSPLLVPRQKYCE +HK +RRKT TVMVGNVA+GSEHPIRIQTMTTTDTKDVAG
Sbjct  61   LQPASPGSPLLVPRQKYCESLHKPIRRKTSTVMVGNVAIGSEHPIRIQTMTTTDTKDVAG  120

Query  708  TVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            TVEQVM+IAD GADIVRITVQGKKEADACFEIKN+LVQKNYNIPLVADIHFAPSVAL
Sbjct  121  TVEQVMRIADKGADIVRITVQGKKEADACFEIKNTLVQKNYNIPLVADIHFAPSVAL  177



>gb|AEM42998.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Siraitia 
grosvenorii]
Length=740

 Score =   273 bits (698),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 150/175 (86%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATG +P   +GLKG    LGF K ++ V+VSD++ V+SR  KV V+RNS+      E+Q
Sbjct  1    MATGTLPSHLSGLKGGNVNLGFAKRLELVKVSDLKSVRSRGRKVLVVRNSNPGSDIAELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGS LLVPRQKYCE  +KTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV
Sbjct  61   PASEGSSLLVPRQKYCESTNKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVM++AD GADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL
Sbjct  121  EQVMRVADKGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  175



>ref|XP_008807336.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Phoenix dactylifera]
 ref|XP_008807344.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Phoenix dactylifera]
Length=743

 Score =   271 bits (692),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 155/178 (87%), Gaps = 8/178 (4%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDM---QRVKSRRSKVCVIRN----SSSV  524
            MA G VP +F GLK R+ GL F K++DF RVS +   QR+K RR+KV V+RN    S +V
Sbjct  1    MAAGTVP-AFPGLKTRDCGLSFAKSIDFARVSCVPGPQRLKFRRAKVPVMRNAISGSDTV  59

Query  525  EVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVA  704
            ++QPASEGSPLLVPRQKYCE +HKTVRRKTRTVMVGNVALGSEHPIR+QTMTT+DTKDVA
Sbjct  60   QMQPASEGSPLLVPRQKYCESVHKTVRRKTRTVMVGNVALGSEHPIRVQTMTTSDTKDVA  119

Query  705  GTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
             TVE+VM+IAD GAD+VRITVQG+KEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL
Sbjct  120  KTVEEVMRIADKGADLVRITVQGRKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  177



>ref|XP_006400831.1| hypothetical protein EUTSA_v10012774mg [Eutrema salsugineum]
 dbj|BAJ34115.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42284.1| hypothetical protein EUTSA_v10012774mg [Eutrema salsugineum]
Length=742

 Score =   268 bits (685),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 152/176 (86%), Gaps = 5/176 (3%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCV-IRNSSS----VEV  530
            MATG +P  F+G+K   + LGFGKN++FVR+ D++  +S R +V V IRNS+      E+
Sbjct  1    MATGVLPAPFSGVKSSGSKLGFGKNINFVRICDLRSQRSARRRVSVVIRNSNQGSDLAEL  60

Query  531  QPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGT  710
            QPAS+GSPLLVPRQKYCE +HKTVRRKTRTVMVGNVALGSEHPIRIQTMTT+DTKDVAGT
Sbjct  61   QPASDGSPLLVPRQKYCESLHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTSDTKDVAGT  120

Query  711  VEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VE+VM+IAD GADIVRITVQGKKEADACFEIK+ LVQ NYNIPLVADIHFAP+VAL
Sbjct  121  VEEVMRIADRGADIVRITVQGKKEADACFEIKDKLVQLNYNIPLVADIHFAPTVAL  176



>ref|XP_006280064.1| hypothetical protein CARUB_v10025946mg [Capsella rubella]
 gb|EOA12962.1| hypothetical protein CARUB_v10025946mg [Capsella rubella]
Length=741

 Score =   268 bits (685),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 151/175 (86%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATG +P   +G+K  ++ LGFGK+M  VR+ DM+ ++S R +V VIRNS+      E+Q
Sbjct  1    MATGVLPAPVSGVKIPDSKLGFGKSMSIVRICDMRSLRSARRRVSVIRNSNQGSDLAELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE +HKTVRRKTRTVMVGNVALGSEHPIRIQTMTT+DTKD+AGTV
Sbjct  61   PASEGSPLLVPRQKYCESLHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTSDTKDIAGTV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            ++VM+IAD GADIVRITVQGKKEADACFEIK+ LVQ NYNIPLVADIHFAP+VAL
Sbjct  121  DEVMRIADKGADIVRITVQGKKEADACFEIKDKLVQLNYNIPLVADIHFAPAVAL  175



>ref|XP_010906493.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Elaeis guineensis]
 ref|XP_010906494.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Elaeis guineensis]
 ref|XP_010906496.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Elaeis guineensis]
Length=743

 Score =   267 bits (683),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 153/178 (86%), Gaps = 8/178 (4%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVS---DMQRVKSRRSKVCVIRN----SSSV  524
            MA G VP +F GLK  + GL F K++DF RVS     QR+K RR+KV V+RN    S +V
Sbjct  1    MAAGTVP-AFPGLKTGDCGLSFAKSIDFARVSCAPGPQRLKFRRAKVPVMRNAISGSDTV  59

Query  525  EVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVA  704
            ++QPASEGSPLLVPRQKYCE +HKTVRRKTRTVMVGNVALGSEHPIRIQTMTT+DTKDVA
Sbjct  60   QMQPASEGSPLLVPRQKYCESVHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTSDTKDVA  119

Query  705  GTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
             TVE+VM+IAD GAD+VRITVQG+KEADACFEIKNSL+QKNYNIPLVADIHFAPSVAL
Sbjct  120  KTVEEVMRIADKGADLVRITVQGRKEADACFEIKNSLLQKNYNIPLVADIHFAPSVAL  177



>ref|XP_008463938.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Cucumis melo]
 ref|XP_008463947.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Cucumis melo]
Length=741

 Score =   266 bits (679),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 147/174 (84%), Gaps = 4/174 (2%)
 Frame = +3

Query  369  ATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQP  536
            + G +P   +GLKG    LGF K ++ V+V D++  KSR  KV +IRNS+      E+QP
Sbjct  3    SAGTLPTHLSGLKGGNVNLGFSKRLESVKVFDLKSAKSRGRKVLIIRNSNPGSDIAELQP  62

Query  537  ASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVE  716
            ASEGS LLVPRQKYCE I+KTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKD+AGTVE
Sbjct  63   ASEGSSLLVPRQKYCESINKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDIAGTVE  122

Query  717  QVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            QVM+IAD GADIVRITVQGKKEADACFEIKN+LVQKNYNIPLVADIHFAPSVAL
Sbjct  123  QVMRIADKGADIVRITVQGKKEADACFEIKNTLVQKNYNIPLVADIHFAPSVAL  176



>ref|XP_002864694.1| hypothetical protein ARALYDRAFT_919295 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40953.1| hypothetical protein ARALYDRAFT_919295 [Arabidopsis lyrata subsp. 
lyrata]
Length=741

 Score =   265 bits (678),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 151/175 (86%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATG +P   +G+K  ++ LGFGK+M+  R+ D++ ++S R +V VIRNS+      E+Q
Sbjct  1    MATGVLPAPVSGVKVPDSKLGFGKSMNLARICDVRSLRSARRRVSVIRNSNQGSDVAELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE +HKTVRRKTRTVMVGNVALGSEHPIRIQTMTT+DTKD+AGTV
Sbjct  61   PASEGSPLLVPRQKYCESLHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTSDTKDIAGTV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            ++VM+IAD GADIVRITVQGKKEADACFEIK+ LVQ NYNIPLVADIHFAP+VAL
Sbjct  121  DEVMRIADRGADIVRITVQGKKEADACFEIKDKLVQLNYNIPLVADIHFAPAVAL  175



>ref|NP_001119467.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Arabidopsis 
thaliana]
 gb|AED97355.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Arabidopsis 
thaliana]
Length=717

 Score =   264 bits (674),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 151/175 (86%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATG +P   +G+K  ++ +GFGK+M+ VR+ D++ ++S R +V VIRNS+      E+Q
Sbjct  1    MATGVLPAPVSGIKIPDSKVGFGKSMNLVRICDVRSLRSARRRVSVIRNSNQGSDLAELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE +HKTVRRKTRTVMVGNVALGSEHPIRIQTMTT+DTKD+ GTV
Sbjct  61   PASEGSPLLVPRQKYCESLHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTSDTKDITGTV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            ++VM+IAD GADIVRITVQGKKEADACFEIK+ LVQ NYNIPLVADIHFAP+VAL
Sbjct  121  DEVMRIADKGADIVRITVQGKKEADACFEIKDKLVQLNYNIPLVADIHFAPTVAL  175



>ref|NP_200868.2| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Arabidopsis 
thaliana]
 gb|AAO15446.1|AF434673_1 GcpE [Arabidopsis thaliana]
 gb|AED97354.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Arabidopsis 
thaliana]
Length=740

 Score =   264 bits (674),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 151/175 (86%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATG +P   +G+K  ++ +GFGK+M+ VR+ D++ ++S R +V VIRNS+      E+Q
Sbjct  1    MATGVLPAPVSGIKIPDSKVGFGKSMNLVRICDVRSLRSARRRVSVIRNSNQGSDLAELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE +HKTVRRKTRTVMVGNVALGSEHPIRIQTMTT+DTKD+ GTV
Sbjct  61   PASEGSPLLVPRQKYCESLHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTSDTKDITGTV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            ++VM+IAD GADIVRITVQGKKEADACFEIK+ LVQ NYNIPLVADIHFAP+VAL
Sbjct  121  DEVMRIADKGADIVRITVQGKKEADACFEIKDKLVQLNYNIPLVADIHFAPTVAL  175



>ref|NP_851233.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Arabidopsis 
thaliana]
 sp|F4K0E8.1|ISPG_ARATH RecName: Full=4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(ferredoxin), chloroplastic; AltName: Full=1-hydroxy-2-methyl-2-(E)-butenyl 
4-diphosphate synthase; AltName: Full=Protein 
CHLOROPLAST BIOGENESIS 4; AltName: Full=Protein CONSTITUTIVE 
SUBTILISIN 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AED97353.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Arabidopsis 
thaliana]
Length=741

 Score =   264 bits (674),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 151/175 (86%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATG +P   +G+K  ++ +GFGK+M+ VR+ D++ ++S R +V VIRNS+      E+Q
Sbjct  1    MATGVLPAPVSGIKIPDSKVGFGKSMNLVRICDVRSLRSARRRVSVIRNSNQGSDLAELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE +HKTVRRKTRTVMVGNVALGSEHPIRIQTMTT+DTKD+ GTV
Sbjct  61   PASEGSPLLVPRQKYCESLHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTSDTKDITGTV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            ++VM+IAD GADIVRITVQGKKEADACFEIK+ LVQ NYNIPLVADIHFAP+VAL
Sbjct  121  DEVMRIADKGADIVRITVQGKKEADACFEIKDKLVQLNYNIPLVADIHFAPTVAL  175



>ref|XP_009392271.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Musa acuminata subsp. malaccensis]
Length=745

 Score =   264 bits (674),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 150/179 (84%), Gaps = 8/179 (4%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVS---DMQRVKSRRSKVCVIRNSSS-----  521
            MA GAVP S  GL+ R+ GL F K++DF RVS   +  R+K RR    VIR+SS+     
Sbjct  1    MAAGAVPSSIPGLRTRDYGLSFAKSVDFARVSCAPEQPRMKLRRRHAAVIRSSSNSGSEI  60

Query  522  VEVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDV  701
            VE++ ASEGSPLLVPRQKYCE +HKTVRRKTRTVMVGNVALGSEHPIRIQTMTT+DTKDV
Sbjct  61   VELESASEGSPLLVPRQKYCESVHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTSDTKDV  120

Query  702  AGTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            A TVE+V++IAD GAD+VRITVQGKKEADACFEIKN LVQKNYNIPLVADIHFAP+VAL
Sbjct  121  AKTVEEVIRIADKGADLVRITVQGKKEADACFEIKNKLVQKNYNIPLVADIHFAPAVAL  179



>ref|XP_004148774.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(ferredoxin), chloroplastic [Cucumis sativus]
 ref|XP_011653452.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(ferredoxin), chloroplastic [Cucumis sativus]
 gb|KGN64731.1| hypothetical protein Csa_1G084300 [Cucumis sativus]
Length=741

 Score =   263 bits (672),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 146/174 (84%), Gaps = 4/174 (2%)
 Frame = +3

Query  369  ATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQP  536
            + G +P   +G KG    LGF K ++ V+V D++  KSR  KV +IRNS+      E+QP
Sbjct  3    SAGTLPSHLSGWKGGNVNLGFSKRLESVKVFDLKSPKSRGRKVLIIRNSNPGSDIAELQP  62

Query  537  ASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVE  716
            ASEGS LLVPRQKYCE I+KTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVE
Sbjct  63   ASEGSSLLVPRQKYCESINKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVE  122

Query  717  QVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            QVM+IAD GADIVRITVQGKKEADACFEIKN+LVQKNYNIPLVADIHFAPSVAL
Sbjct  123  QVMRIADKGADIVRITVQGKKEADACFEIKNTLVQKNYNIPLVADIHFAPSVAL  176



>ref|XP_010443862.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Camelina sativa]
Length=741

 Score =   263 bits (671),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 150/175 (86%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATG +P   +G+K  ++ LGF K+M+ VR+ D++ ++S   +V VIRNS+      E+Q
Sbjct  1    MATGVLPAPVSGVKILDSKLGFSKSMNLVRICDLRTLRSAGRRVSVIRNSNQGSDLAELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE +HKTVRRKTRTVMVGNVALGSEHPIRIQTMTT+DTKDVAGTV
Sbjct  61   PASEGSPLLVPRQKYCESLHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTSDTKDVAGTV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            ++VM+IAD GADIVRITVQGKKEADACFEIK+ LVQ NYNIPLVADIHFAP+VAL
Sbjct  121  DEVMRIADKGADIVRITVQGKKEADACFEIKDKLVQLNYNIPLVADIHFAPAVAL  175



>gb|AAM19840.1| AT5g60600/mup24_10 [Arabidopsis thaliana]
Length=741

 Score =   262 bits (669),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 151/175 (86%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATG +P   +G+K  ++ +GFGK+M+ VR+ D++ ++S R +V VIRNS+      E+Q
Sbjct  1    MATGVLPAPVSGIKIPDSKVGFGKSMNLVRICDVRSLRSARRRVSVIRNSNQGSDLAELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE +HKTVRRKTRTVMVG+VALGSEHPIRIQTMTT+DTKD+ GTV
Sbjct  61   PASEGSPLLVPRQKYCESLHKTVRRKTRTVMVGDVALGSEHPIRIQTMTTSDTKDITGTV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            ++VM+IAD GADIVRITVQGKKEADACFEIK+ LVQ NYNIPLVADIHFAP+VAL
Sbjct  121  DEVMRIADKGADIVRITVQGKKEADACFEIKDKLVQLNYNIPLVADIHFAPTVAL  175



>ref|XP_010483710.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Camelina sativa]
Length=742

 Score =   262 bits (669),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 150/176 (85%), Gaps = 5/176 (3%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS-----VEV  530
            MATG +P   +G+K  ++ LGF K+M+ VR+ D++ ++S   +V VIRNSS+      E+
Sbjct  1    MATGVLPAPVSGVKIPDSKLGFSKSMNLVRICDLRSLRSAGRRVSVIRNSSNQGSDLAEL  60

Query  531  QPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGT  710
            QPASEGSPLLVPRQKYCE +HKTVRR TRTVMVGNVALGSEHPIRIQTMTT+DTKDVAGT
Sbjct  61   QPASEGSPLLVPRQKYCESLHKTVRRTTRTVMVGNVALGSEHPIRIQTMTTSDTKDVAGT  120

Query  711  VEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            V++VM+IAD GADIVRITVQGKKEADACFEIK+ LVQ NYNIPLVADIHFAP+VAL
Sbjct  121  VDEVMRIADKGADIVRITVQGKKEADACFEIKDKLVQLNYNIPLVADIHFAPAVAL  176



>gb|AAL91150.1| GcpE protein [Arabidopsis thaliana]
 gb|AAQ65096.1| At5g60600 [Arabidopsis thaliana]
Length=741

 Score =   261 bits (666),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 150/175 (86%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATG +P   +G+K  ++ +GFGK+M+ VR+ D++ ++S R +V VIRNS+      E+Q
Sbjct  1    MATGVLPAPVSGIKIPDSKVGFGKSMNLVRICDVRSLRSARRRVSVIRNSNQGSDLAELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE +HKTVRRKTRTVMVGNVALGSEHPI IQTMTT+DTKD+ GTV
Sbjct  61   PASEGSPLLVPRQKYCESLHKTVRRKTRTVMVGNVALGSEHPIGIQTMTTSDTKDITGTV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            ++VM+IAD GADIVRITVQGKKEADACFEIK+ LVQ NYNIPLVADIHFAP+VAL
Sbjct  121  DEVMRIADKGADIVRITVQGKKEADACFEIKDKLVQLNYNIPLVADIHFAPTVAL  175



>ref|XP_010535603.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Tarenaya hassleriana]
Length=743

 Score =   259 bits (663),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 151/176 (86%), Gaps = 5/176 (3%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSK-VCVIRNSSS----VEV  530
            MATG +P SF+G+K  ++ LGF K++DFV+V D++R +    + V V+R SS      E+
Sbjct  1    MATGVLPASFSGVKIPDSKLGFAKSLDFVKVCDLRRTRYGGRRRVSVVRCSSQGSDIAEL  60

Query  531  QPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGT  710
            QPASEGSPLLVPRQKYCE +HKTVRRKTRTVMVGNVALGS+HPIR+QTMTT+DTKDV+GT
Sbjct  61   QPASEGSPLLVPRQKYCESLHKTVRRKTRTVMVGNVALGSDHPIRLQTMTTSDTKDVSGT  120

Query  711  VEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VE+VM+IAD GADIVRITVQGKKEADACFEIKN LVQ NYNIPLVADIHFAPSVAL
Sbjct  121  VEEVMRIADKGADIVRITVQGKKEADACFEIKNKLVQLNYNIPLVADIHFAPSVAL  176



>gb|AHN91473.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Dendrobium 
catenatum]
Length=745

 Score =   259 bits (662),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 147/178 (83%), Gaps = 7/178 (4%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRV-SDMQRVKSR--RSKVCVIRNSSS----V  524
            M  G +   F  LKG E GL F K +DF ++ SD    KS   +SKV +IRNSSS    V
Sbjct  2    MVAGTISTCFPTLKGTEYGLSFAKTVDFAKIASDPNSKKSWHCKSKVFMIRNSSSGSETV  61

Query  525  EVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVA  704
            E+QPASEGSPLLVPR+KYCE +HKTVRRKTRTVMVGNVALGS+HPIRIQTMTT+DTKDVA
Sbjct  62   ELQPASEGSPLLVPRRKYCESVHKTVRRKTRTVMVGNVALGSQHPIRIQTMTTSDTKDVA  121

Query  705  GTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
             TVE+VM+IAD GADIVRITVQGK+EADACFEIKNSLVQ NYNIPLVADIHFAPSVAL
Sbjct  122  KTVEEVMRIADKGADIVRITVQGKREADACFEIKNSLVQNNYNIPLVADIHFAPSVAL  179



>gb|AJA32314.1| chloroplast 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate synthase 
[Narcissus tazetta]
Length=745

 Score =   258 bits (660),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 151/179 (84%), Gaps = 8/179 (4%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRV---SDMQRVKSRRSKV-CVIRNSSS----  521
            MA+G++P SF  L+ R+ GL F KN+DF +V   S+ QR K  + KV  VI NS+S    
Sbjct  1    MASGSIPASFPSLRSRDLGLSFAKNVDFTKVAYVSNSQRRKFPKVKVFSVIMNSTSGSDT  60

Query  522  VEVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDV  701
            VE+QPASEGSPLLVP+QKYCE ++KTVRRKTRTVMVGNVALGS HPI+IQTMTT+DTKDV
Sbjct  61   VELQPASEGSPLLVPKQKYCESVYKTVRRKTRTVMVGNVALGSGHPIKIQTMTTSDTKDV  120

Query  702  AGTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            A TVE+VM+IAD GAD+VRITVQGKKEADACFEIKN+LVQKNYNIPLVADIHFAP VAL
Sbjct  121  AKTVEEVMRIADKGADLVRITVQGKKEADACFEIKNTLVQKNYNIPLVADIHFAPPVAL  179



>ref|XP_010456601.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Camelina sativa]
Length=743

 Score =   258 bits (659),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 152/177 (86%), Gaps = 6/177 (3%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS------VE  527
            MATG +P   +G+K  ++ LGF K+M+ VR+ D++ ++S R +V VIRNSS+       E
Sbjct  1    MATGVLPAHVSGVKIPDSKLGFSKSMNLVRICDLRSLRSARRRVSVIRNSSNQGGSDLAE  60

Query  528  VQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAG  707
            +QPASEGSPLLVPRQKYCE +HKTVRRKTRTVMVGNVALGSEHPIRIQTMTT+DTKDVAG
Sbjct  61   LQPASEGSPLLVPRQKYCESLHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTSDTKDVAG  120

Query  708  TVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            TV++VM+IAD GADIVRITVQGKKEADACFEIK+ LVQ NYNIPLVADIHFAP+VAL
Sbjct  121  TVDEVMRIADKGADIVRITVQGKKEADACFEIKDKLVQLNYNIPLVADIHFAPAVAL  177



>ref|XP_006854508.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Amborella trichopoda]
 gb|ERN15975.1| hypothetical protein AMTR_s00175p00057810 [Amborella trichopoda]
Length=741

 Score =   258 bits (659),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 148/176 (84%), Gaps = 5/176 (3%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVS---DMQRVKSRRSKVCVIRNSSS--VEV  530
            MATG V  SF+ LK  + GL F   +   ++    ++QR++SR+++V V+RNS S  VE+
Sbjct  1    MATGTVSASFSCLKRSDCGLSFYNGVGSAKIGVTRNLQRIRSRKNRVLVVRNSGSETVEL  60

Query  531  QPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGT  710
            QPAS+GSPLLVPRQKYCE IHKTVRRKTRTVM GNVALGS+HPIRIQTMTTTDTKDV  T
Sbjct  61   QPASDGSPLLVPRQKYCESIHKTVRRKTRTVMAGNVALGSQHPIRIQTMTTTDTKDVTAT  120

Query  711  VEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VEQVM+IAD GADIVRITVQGKKEADACFEIKN+LVQKNYNIPLVADIHF+P VA+
Sbjct  121  VEQVMRIADKGADIVRITVQGKKEADACFEIKNTLVQKNYNIPLVADIHFSPPVAM  176



>ref|XP_010689558.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Beta vulgaris subsp. vulgaris]
 ref|XP_010689559.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=740

 Score =   258 bits (658),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 151/175 (86%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATG +      +K ++  LGF KN+DFV++S+++RVK +R+K  VI++S+      E+Q
Sbjct  1    MATGIIQAPICHVKNKDFELGFSKNVDFVKISNIRRVKFQRTKSSVIKSSNPGSDIAELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGS LLVPRQKYCE  +KTVRRKT TVMVG+VA+GS+HPIRIQTMTTTDTKDVAGTV
Sbjct  61   PASEGSSLLVPRQKYCELPYKTVRRKTCTVMVGDVAIGSDHPIRIQTMTTTDTKDVAGTV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EQVMKIAD+GADIVRITVQGKKEADACFEIKN+LVQKNYNIPLVADIHFAPSVA+
Sbjct  121  EQVMKIADSGADIVRITVQGKKEADACFEIKNTLVQKNYNIPLVADIHFAPSVAM  175



>gb|KDO73255.1| hypothetical protein CISIN_1g0046342mg, partial [Citrus sinensis]
Length=449

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 139/176 (79%), Gaps = 22/176 (13%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS-----VEV  530
            MATG +P SF GLK R++GLGF K++DFVRV D ++ KS R +  VIRNSS+      E+
Sbjct  1    MATGTLPASFPGLKSRDSGLGFAKSVDFVRVCDFRKFKSGRRRFTVIRNSSNSSSDIAEL  60

Query  531  QPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGT  710
            QPASEGSPLLVPRQKYCE IHKTVRRKTRTVMVGNVA+GSEHPIR+QTMTT DTKDVAGT
Sbjct  61   QPASEGSPLLVPRQKYCESIHKTVRRKTRTVMVGNVAIGSEHPIRVQTMTTNDTKDVAGT  120

Query  711  VEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VE+VM+I                 ADACFEIKNSLVQKNYNIPLVADIHFAPSVAL
Sbjct  121  VEEVMRI-----------------ADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  159



>gb|AJA32313.1| chloroplast 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate synthase 
[Narcissus tazetta]
Length=745

 Score =   256 bits (654),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 149/179 (83%), Gaps = 8/179 (4%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVS---DMQRVKSRRSKV-CVIRNSSS----  521
            MA+G +P SF  LK R+ GL F KN+DF +V+   + QR K    KV  V  NS+S    
Sbjct  1    MASGLIPASFPSLKCRDLGLSFAKNVDFTKVAYVPNSQRRKFPNVKVFSVTMNSTSGSDT  60

Query  522  VEVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDV  701
            VE+QPASEGSPLLVP+QKYCE ++KTVRRKTRTVMVGNVALGSEHPI+IQTMTT+DTKDV
Sbjct  61   VELQPASEGSPLLVPKQKYCESVYKTVRRKTRTVMVGNVALGSEHPIKIQTMTTSDTKDV  120

Query  702  AGTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            A TVE+VM+IAD GAD+VRITVQGKKEADACFEIKN+LVQKNYNIPLVADIHFAP VAL
Sbjct  121  AKTVEEVMRIADKGADLVRITVQGKKEADACFEIKNTLVQKNYNIPLVADIHFAPPVAL  179



>emb|CDY53637.1| BnaC09g54000D [Brassica napus]
Length=736

 Score =   255 bits (652),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 147/175 (84%), Gaps = 9/175 (5%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATG +P  F+G+   ++ LGFGK+M+ VR      ++S R +V VIR+S+      E+Q
Sbjct  1    MATGVLPAPFSGVNISDSKLGFGKSMNIVR-----SLRSARRRVSVIRSSNQGSDLAELQ  55

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE +HKTVRRKTRTVMVG+VALGSEHPIRIQTMTT+DTKD+A TV
Sbjct  56   PASEGSPLLVPRQKYCESLHKTVRRKTRTVMVGDVALGSEHPIRIQTMTTSDTKDIAATV  115

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            E+VM+IAD GADIVRITVQGKKEADACFEIK+ LVQ NYNIPLVADIHFAPSVAL
Sbjct  116  EEVMRIADKGADIVRITVQGKKEADACFEIKDKLVQLNYNIPLVADIHFAPSVAL  170



>ref|XP_009120594.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Brassica rapa]
Length=741

 Score =   255 bits (651),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 152/175 (87%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATG +P  F+G+K  ++ LGFGK+++ VR+ D++ ++S R +V VIR+S+      E+Q
Sbjct  1    MATGVLPAPFSGVKISDSKLGFGKSLNIVRICDLRSLRSARRRVSVIRSSNQGSDLAELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE +HKTVRRKTRTVMVG+VALGSEHPIRIQTMTT+DTKD+A TV
Sbjct  61   PASEGSPLLVPRQKYCESLHKTVRRKTRTVMVGDVALGSEHPIRIQTMTTSDTKDIAATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            ++VM+IAD GADIVRITVQGKKEADACFEIK+ LVQ NYNIPLVADIHFAP+VAL
Sbjct  121  DEVMRIADKGADIVRITVQGKKEADACFEIKDKLVQLNYNIPLVADIHFAPAVAL  175



>ref|XP_007207209.1| hypothetical protein PRUPE_ppa002111mg [Prunus persica]
 gb|EMJ08408.1| hypothetical protein PRUPE_ppa002111mg [Prunus persica]
Length=715

 Score =   254 bits (650),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 137/150 (91%), Gaps = 4/150 (3%)
 Frame = +3

Query  441  MDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQPASEGSPLLVPRQKYCEHIHKTVRR  608
            MDFVRV D++R KS R+++ VIRNS+      E++PASEGSPLLVPRQKYCE IHKTVRR
Sbjct  1    MDFVRVCDLKRFKSGRTRISVIRNSNPGSDIAELKPASEGSPLLVPRQKYCESIHKTVRR  60

Query  609  KTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITVQGKKEAD  788
            KTRTV+VGNVA+GSEHPIRIQTMTTTDTKDVA TVEQVM+IAD GAD+VRITVQGKKEAD
Sbjct  61   KTRTVLVGNVAIGSEHPIRIQTMTTTDTKDVAATVEQVMRIADKGADLVRITVQGKKEAD  120

Query  789  ACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            ACF+IKN+LVQKNYNIPLVADIHFAPSVAL
Sbjct  121  ACFDIKNTLVQKNYNIPLVADIHFAPSVAL  150



>emb|CDY31531.1| BnaA10g13400D [Brassica napus]
Length=741

 Score =   253 bits (645),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 151/175 (86%), Gaps = 4/175 (2%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQ  533
            MATG +P  F+G+K  ++ LGFGK+++ VR+ D++ ++S R +V VIRNS+      E+Q
Sbjct  1    MATGVLPAPFSGVKISDSKLGFGKSLNIVRICDLRSLRSARRRVSVIRNSNQGSDLAELQ  60

Query  534  PASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTV  713
            PASEGSPLLVPRQKYCE ++KTVRRKTRTVMVG+VALGSEHPIRIQTMTT+DTKD+  TV
Sbjct  61   PASEGSPLLVPRQKYCESLNKTVRRKTRTVMVGDVALGSEHPIRIQTMTTSDTKDITATV  120

Query  714  EQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            ++VM+IAD GADIVRITVQGKKEADACFEIK+ LVQ NYNIPLVADIHFAP+VAL
Sbjct  121  DEVMRIADKGADIVRITVQGKKEADACFEIKDKLVQLNYNIPLVADIHFAPAVAL  175



>ref|XP_003575307.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Brachypodium distachyon]
Length=744

 Score =   246 bits (627),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 145/178 (81%), Gaps = 7/178 (4%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQ---RVKSRRSKVCVIRNSSS----V  524
            MATG  P     ++ R+ G+GF +++DF +V  +    R  S R +  V+R+SS+    +
Sbjct  1    MATGVAPAPLPHVRVRDGGIGFTRSVDFAKVLSVPAVLRTGSSRGRGLVVRSSSTESDTI  60

Query  525  EVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVA  704
            E++PASEGSPLLVPRQKYCE IH+T RRKTRTVMVGNVA+GS+HPIRIQTMTT+DTKDV 
Sbjct  61   ELEPASEGSPLLVPRQKYCESIHQTRRRKTRTVMVGNVAMGSDHPIRIQTMTTSDTKDVT  120

Query  705  GTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
             TVE+VM+IAD GAD VRITVQGKKEADACFEIKN+LVQKNYNIPLVADIHFAP+VAL
Sbjct  121  KTVEEVMRIADKGADFVRITVQGKKEADACFEIKNTLVQKNYNIPLVADIHFAPAVAL  178



>ref|XP_002454137.1| hypothetical protein SORBIDRAFT_04g025290 [Sorghum bicolor]
 gb|EES07113.1| hypothetical protein SORBIDRAFT_04g025290 [Sorghum bicolor]
Length=746

 Score =   245 bits (626),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 146/180 (81%), Gaps = 9/180 (5%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRV-----SDMQRVKSRRSKVCVIRNSSS---  521
            MATG  P S   ++ R+ G+GF +++DF +V     +   R  S R +  V ++SS+   
Sbjct  1    MATGVAPASLPHVRVRDGGVGFTRSVDFAKVLSTPSAGTMRTSSSRGRALVAKSSSTGSE  60

Query  522  -VEVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKD  698
             VE++P+SEGSPLLVPRQKYCE IH+T RRKTRTVMVGNV LGS+HPIRIQTMTT+DTKD
Sbjct  61   TVELEPSSEGSPLLVPRQKYCESIHQTRRRKTRTVMVGNVPLGSDHPIRIQTMTTSDTKD  120

Query  699  VAGTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VA TVE+VM+IAD GADIVRITVQG+KEADACFEIK++LVQKNYNIPLVADIHFAP+VAL
Sbjct  121  VAKTVEEVMRIADKGADIVRITVQGRKEADACFEIKDTLVQKNYNIPLVADIHFAPTVAL  180



>ref|XP_006647487.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Oryza brachyantha]
Length=744

 Score =   244 bits (622),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 146/178 (82%), Gaps = 7/178 (4%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQ---RVKSRRSKVCVIRNSSS----V  524
            MATG  P     ++ R+ G+GF +++DF ++  +    RV S R +V V R+SS+    +
Sbjct  1    MATGVAPAPLPHVRVRDGGIGFTRSVDFAKILSVPAPIRVGSSRGRVLVARSSSTGSDTM  60

Query  525  EVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVA  704
            E++P+SEGSPLLVPRQKYCE I++T RRKTRTVMVGNV LGS+HPIRIQTMTT+DTKDVA
Sbjct  61   ELEPSSEGSPLLVPRQKYCESIYETRRRKTRTVMVGNVPLGSDHPIRIQTMTTSDTKDVA  120

Query  705  GTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
             TVE+VM+IAD GAD VRITVQG+KEADACFEIKN+LVQKNYNIPLVADIHFAP+VAL
Sbjct  121  KTVEEVMRIADKGADFVRITVQGRKEADACFEIKNTLVQKNYNIPLVADIHFAPTVAL  178



>gb|ABB78087.1| (E)-4-hydroxy-3-methyl-but-2-enyl diphosphate synthase [Ginkgo 
biloba]
Length=741

 Score =   243 bits (620),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 147/176 (84%), Gaps = 5/176 (3%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDF---VRVSDMQRVKSRRSKVCVIRNSSS--VEV  530
            MA G +P SF+GLK  ++  G  + ++     R+S+ Q  +S R ++ V+RNSSS   E+
Sbjct  1    MAAGTIPASFSGLKQTDSLPGCLEKINSTKNFRISNCQTSRSCRKRLNVVRNSSSDIAEM  60

Query  531  QPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGT  710
            Q ASEGSPLLVPRQKYCE I+KTVRR+TRT+M GNVALGSEHPIRIQTMTTTDTKDV+ T
Sbjct  61   QRASEGSPLLVPRQKYCESIYKTVRRRTRTMMAGNVALGSEHPIRIQTMTTTDTKDVSAT  120

Query  711  VEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VEQVM+IAD GAD+VRITVQGKKEADAC++IKN+LVQK+YNIPLVADIHFAPSVA+
Sbjct  121  VEQVMRIADRGADLVRITVQGKKEADACYDIKNTLVQKDYNIPLVADIHFAPSVAM  176



>ref|XP_004953020.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Setaria italica]
Length=746

 Score =   243 bits (619),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 144/180 (80%), Gaps = 9/180 (5%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDM-----QRVKSRRSKVCVIRNSSS---  521
            MATG  P     ++ R+ G+GF +++DF +V  +      R  S R +  V + SS+   
Sbjct  1    MATGVAPAPLPHVRVRDGGIGFTRSVDFAKVLSVPGVGTTRTGSSRGRALVAKCSSTGSD  60

Query  522  -VEVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKD  698
             +E++P+SEGSPLLVPRQKYCE IH+T RRKTRTVMVGNV LGS+HPIRIQTMTT+DTKD
Sbjct  61   TMELEPSSEGSPLLVPRQKYCESIHQTRRRKTRTVMVGNVPLGSDHPIRIQTMTTSDTKD  120

Query  699  VAGTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VA TVE+VM+IAD GADIVRITVQGKKEADACFEIKN+LVQKNYNIPLVADIHFAP+VAL
Sbjct  121  VAKTVEEVMRIADKGADIVRITVQGKKEADACFEIKNTLVQKNYNIPLVADIHFAPTVAL  180



>ref|NP_001047365.1| Os02g0603800 [Oryza sativa Japonica Group]
 sp|Q6K8J4.1|ISPG_ORYSJ RecName: Full=4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(ferredoxin), chloroplastic; AltName: Full=1-hydroxy-2-methyl-2-(E)-butenyl 
4-diphosphate synthase; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAD19354.1| putative GCPE protein [Oryza sativa Japonica Group]
 dbj|BAF09279.1| Os02g0603800 [Oryza sativa Japonica Group]
 dbj|BAH00163.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73552.1| hypothetical protein OsI_07973 [Oryza sativa Indica Group]
 gb|EEE57327.1| hypothetical protein OsJ_07430 [Oryza sativa Japonica Group]
Length=744

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 146/178 (82%), Gaps = 7/178 (4%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQ---RVKSRRSKVCVIRNSSS----V  524
            MATG  P     ++ R+ G+GF +++DF ++  +    RV S R +V V ++SS+    +
Sbjct  1    MATGVAPAPLPHVRVRDGGIGFTRSVDFAKILSVPATLRVGSSRGRVLVAKSSSTGSDTM  60

Query  525  EVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVA  704
            E++P+SEGSPLLVPRQKYCE I++T RRKTRTVMVGNV LGS+HPIRIQTMTT+DTKDVA
Sbjct  61   ELEPSSEGSPLLVPRQKYCESIYETRRRKTRTVMVGNVPLGSDHPIRIQTMTTSDTKDVA  120

Query  705  GTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
             TVE+VM+IAD GAD VRITVQG+KEADACFEIKN+LVQKNYNIPLVADIHFAP+VAL
Sbjct  121  KTVEEVMRIADKGADFVRITVQGRKEADACFEIKNTLVQKNYNIPLVADIHFAPTVAL  178



>gb|EMT15013.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Aegilops 
tauschii]
Length=723

 Score =   242 bits (617),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 144/179 (80%), Gaps = 8/179 (4%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKN-MDFVRVSDMQ---RVKSRRSKVCVIRNSSS----  521
            MATG  P     +K R  G+GF K+ +DF +V  +    R  S R +  V+ +SS+    
Sbjct  1    MATGVAPAPLPHVKVRGGGIGFTKSSVDFAKVLSVPGALRTASSRGRALVVWSSSTESDT  60

Query  522  VEVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDV  701
            +E++PASEGSPLLVPRQKYCE IH+T RRKTRTVMVGNVALGS+HP+RIQTMTT+DTKDV
Sbjct  61   MELEPASEGSPLLVPRQKYCESIHQTRRRKTRTVMVGNVALGSDHPMRIQTMTTSDTKDV  120

Query  702  AGTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            A TVE+VM+IAD GAD VRITVQGKKEADACFEIKN+LVQKNYNIPLVADIHFAP+VAL
Sbjct  121  AKTVEEVMRIADKGADFVRITVQGKKEADACFEIKNTLVQKNYNIPLVADIHFAPTVAL  179



>dbj|BAB09833.1| GcpE protein [Arabidopsis thaliana]
Length=716

 Score =   241 bits (615),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 133/150 (89%), Gaps = 4/150 (3%)
 Frame = +3

Query  441  MDFVRVSDMQRVKSRRSKVCVIRNSSS----VEVQPASEGSPLLVPRQKYCEHIHKTVRR  608
            M+ VR+ D++ ++S R +V VIRNS+      E+QPASEGSPLLVPRQKYCE +HKTVRR
Sbjct  1    MNLVRICDVRSLRSARRRVSVIRNSNQGSDLAELQPASEGSPLLVPRQKYCESLHKTVRR  60

Query  609  KTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITVQGKKEAD  788
            KTRTVMVGNVALGSEHPIRIQTMTT+DTKD+ GTV++VM+IAD GADIVRITVQGKKEAD
Sbjct  61   KTRTVMVGNVALGSEHPIRIQTMTTSDTKDITGTVDEVMRIADKGADIVRITVQGKKEAD  120

Query  789  ACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            ACFEIK+ LVQ NYNIPLVADIHFAP+VAL
Sbjct  121  ACFEIKDKLVQLNYNIPLVADIHFAPTVAL  150



>gb|ACL53652.1| unknown [Zea mays]
 gb|AFW72213.1| hydroxymethylbutenyl 4-diphosphate synthase [Zea mays]
Length=746

 Score =   238 bits (606),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 142/180 (79%), Gaps = 9/180 (5%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRV-----SDMQRVKSRRSKVCVIRNSSS---  521
            MATG  P     ++    G+GF +++DF +V     +   R  S R +  V ++SS+   
Sbjct  1    MATGVAPAPLPHVRVHHGGVGFTRSVDFAKVLSAPGAGTMRASSSRGRALVAKSSSTGSE  60

Query  522  -VEVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKD  698
             +E++P+SEGSPLLVPRQKYCE  H+T RRKTRTVMVGNV LGS+HPIRIQTMTT+DTKD
Sbjct  61   TMELEPSSEGSPLLVPRQKYCESTHQTRRRKTRTVMVGNVPLGSDHPIRIQTMTTSDTKD  120

Query  699  VAGTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VA TVE+VM+IAD GAD+VRITVQG+KEADACFEIKN+LVQKNYNIPLVADIHFAP+VAL
Sbjct  121  VAKTVEEVMRIADKGADLVRITVQGRKEADACFEIKNTLVQKNYNIPLVADIHFAPTVAL  180



>ref|NP_001105676.1| LOC542690 [Zea mays]
 gb|AAT70081.1| hydroxymethylbutenyl 4-diphosphate synthase [Zea mays]
 gb|AAT70082.1| hydroxymethylbutenyl 4-diphosphate synthase [Zea mays]
Length=746

 Score =   237 bits (605),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 142/180 (79%), Gaps = 9/180 (5%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRV-----SDMQRVKSRRSKVCVIRNSSS---  521
            MATG  P     ++    G+GF +++DF +V     +   R  S R +  V ++SS+   
Sbjct  1    MATGVAPAPLPHVRVHHGGVGFTRSVDFAKVLSAPGAGTMRAGSSRGRALVAKSSSTGSE  60

Query  522  -VEVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKD  698
             +E++P+SEGSPLLVPRQKYCE  H+T RRKTRTVMVGNV LGS+HPIRIQTMTT+DTKD
Sbjct  61   TMELEPSSEGSPLLVPRQKYCESTHQTRRRKTRTVMVGNVPLGSDHPIRIQTMTTSDTKD  120

Query  699  VAGTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VA TVE+VM+IAD GAD+VRITVQG+KEADACFEIKN+LVQKNYNIPLVADIHFAP+VAL
Sbjct  121  VAKTVEEVMRIADKGADLVRITVQGRKEADACFEIKNTLVQKNYNIPLVADIHFAPTVAL  180



>ref|XP_003597229.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Medicago 
truncatula]
Length=731

 Score =   231 bits (590),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 125/139 (90%), Gaps = 4/139 (3%)
 Frame = +3

Query  474  VKSRRSKVCVIRNSSS----VEVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVA  641
            +KS R KV +IRNS+      E+QPAS+GS LLVPRQKYCE +HKTVRRKTRTV VG+V 
Sbjct  1    MKSSRRKVSIIRNSNPSQDIAELQPASKGSQLLVPRQKYCESLHKTVRRKTRTVNVGDVT  60

Query  642  LGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQ  821
            +GS+HPIRIQTMTTTDTKDVAGTVEQVMKIAD GADIVRITVQGKKEADACFEIKNSLVQ
Sbjct  61   IGSDHPIRIQTMTTTDTKDVAGTVEQVMKIADKGADIVRITVQGKKEADACFEIKNSLVQ  120

Query  822  KNYNIPLVADIHFAPSVAL  878
            KNYNIPLVADIHFAP+VAL
Sbjct  121  KNYNIPLVADIHFAPTVAL  139



>gb|ACG47448.1| hydroxymethylbutenyl 4-diphosphate synthase [Zea mays]
Length=745

 Score =   225 bits (573),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 135/173 (78%), Gaps = 9/173 (5%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRV-----SDMQRVKSRRSKVCVIRNSSS---  521
            MATG  P     ++    G+GF +++DF +V     +   R  S R +  V ++SS+   
Sbjct  1    MATGVAPAPLPHVRVHHGGVGFTRSVDFAKVLSAPGAGTMRASSSRGRALVAKSSSTGSE  60

Query  522  -VEVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKD  698
             +E++P+SEGSPLLVPRQKYCE  H+T RRKTRTVMVGNV LGS+HPIRIQTMTT+DTKD
Sbjct  61   TMELEPSSEGSPLLVPRQKYCESTHQTRRRKTRTVMVGNVPLGSDHPIRIQTMTTSDTKD  120

Query  699  VAGTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIH  857
            VA TVE+VM+IAD GAD+VRITVQG+KEADACFEIKN+LVQKNYNIPLVADIH
Sbjct  121  VAKTVEEVMRIADKGADLVRITVQGRKEADACFEIKNTLVQKNYNIPLVADIH  173



>gb|ACD70401.1| putative chloroplast 4-hydroxy-3-methylbut-2-en-1-yl diphosphate 
synthase [Populus trichocarpa]
Length=680

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +3

Query  537  ASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVE  716
            ASEGS LLVPRQKYCE I+KTVRRKTRTVMVGNV LGSEHPIRIQTMTTTDTKDVA TVE
Sbjct  1    ASEGSSLLVPRQKYCESINKTVRRKTRTVMVGNVPLGSEHPIRIQTMTTTDTKDVAATVE  60

Query  717  QVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            QVM IAD GADIVR+TVQGK+EADACFEIKNSLVQKNYNIPLVADIHFAPSVAL
Sbjct  61   QVMIIADKGADIVRLTVQGKREADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  114



>ref|XP_002973473.1| hypothetical protein SELMODRAFT_149035 [Selaginella moellendorffii]
 gb|EFJ25847.1| hypothetical protein SELMODRAFT_149035 [Selaginella moellendorffii]
Length=690

 Score =   213 bits (541),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +3

Query  522  VEVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDV  701
            VE++PAS+ SPLLVPRQKYCE +HKT+RR+T TVMVGNVA+GSEHPIR+QTMTTTDTKDV
Sbjct  6    VEMEPASQNSPLLVPRQKYCESVHKTIRRQTSTVMVGNVAVGSEHPIRVQTMTTTDTKDV  65

Query  702  AGTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
             GTV+QVMKIAD GADIVRITVQGKKEAD C+EIKN+LV+K Y+IPLVADIHFAPSVAL
Sbjct  66   LGTVDQVMKIADRGADIVRITVQGKKEADCCYEIKNTLVKKGYSIPLVADIHFAPSVAL  124



>ref|XP_002986683.1| hypothetical protein SELMODRAFT_158184 [Selaginella moellendorffii]
 gb|EFJ12246.1| hypothetical protein SELMODRAFT_158184 [Selaginella moellendorffii]
Length=690

 Score =   213 bits (541),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +3

Query  522  VEVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDV  701
            VE++PAS+ SPLLVPRQKYCE +HKT+RR+T TVMVGNVA+GSEHPIR+QTMTTTDTKDV
Sbjct  6    VEMEPASQNSPLLVPRQKYCESVHKTIRRQTSTVMVGNVAVGSEHPIRVQTMTTTDTKDV  65

Query  702  AGTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
             GTV+QVMKIAD GADIVRITVQGKKEAD C+EIKN+LV+K Y+IPLVADIHFAPSVAL
Sbjct  66   LGTVDQVMKIADRGADIVRITVQGKKEADCCYEIKNTLVKKGYSIPLVADIHFAPSVAL  124



>ref|XP_001755871.1| predicted protein [Physcomitrella patens]
 gb|EDQ79156.1| predicted protein [Physcomitrella patens]
Length=687

 Score =   209 bits (531),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  522  VEVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDV  701
            VE++PAS+GS LLVPRQKYCE IHK VRRKTRTV +G V +GSEHPIR+QTMTTTDTKDV
Sbjct  6    VEMEPASQGSQLLVPRQKYCESIHKPVRRKTRTVSIGGVTVGSEHPIRVQTMTTTDTKDV  65

Query  702  AGTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
             GTVEQVM+IAD G DIVRITVQGKKEADAC+EIKN+LVQK YNIPLVADIHFAPS+A+
Sbjct  66   KGTVEQVMRIADRGCDIVRITVQGKKEADACYEIKNTLVQKGYNIPLVADIHFAPSIAM  124



>gb|EMS56222.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Triticum 
urartu]
Length=665

 Score =   196 bits (499),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 114/171 (67%), Gaps = 39/171 (23%)
 Frame = +3

Query  366  MATGAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSSVEVQPASE  545
            MATG  P   + +K R  G+GF K+ DF                                
Sbjct  1    MATGMAPAPLSHVKVRGGGIGFTKSGDFA-------------------------------  29

Query  546  GSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVM  725
                    QKYCE IH+T RRKTRTVMVGNVALGS+HPIRIQTMTT+DTKDVA TVE+VM
Sbjct  30   --------QKYCESIHQTRRRKTRTVMVGNVALGSDHPIRIQTMTTSDTKDVAKTVEEVM  81

Query  726  KIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            +IAD GAD VRITVQGKKEADACFEIKN+LVQKNYNIPLVADIHFAP VAL
Sbjct  82   RIADKGADFVRITVQGKKEADACFEIKNTLVQKNYNIPLVADIHFAPPVAL  132



>ref|XP_001766565.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Physcomitrella 
patens]
 gb|EDQ68630.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Physcomitrella 
patens]
Length=691

 Score =   194 bits (492),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 106/120 (88%), Gaps = 1/120 (1%)
 Frame = +3

Query  522  VEVQPASEGSPLL-VPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKD  698
            VE++PASEGS LL VPR+KYCE I+K +RRKTRTV VG V +GSEHPIR+QTMTTTDTKD
Sbjct  6    VEMKPASEGSQLLAVPRKKYCESIYKPIRRKTRTVNVGGVTVGSEHPIRVQTMTTTDTKD  65

Query  699  VAGTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            V  TVEQVM+IAD G DIVRITVQGKKEADAC+ IKN+LVQK YNIPLVADIHFAP +A+
Sbjct  66   VQRTVEQVMRIADKGCDIVRITVQGKKEADACYSIKNTLVQKGYNIPLVADIHFAPPIAM  125



>ref|XP_005650225.1| putative chloroplast 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate 
synthase precursor [Coccomyxa subellipsoidea C-169]
 gb|EIE25681.1| putative chloroplast 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate 
synthase precursor [Coccomyxa subellipsoidea C-169]
Length=748

 Score =   154 bits (389),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 105/147 (71%), Gaps = 11/147 (7%)
 Frame = +3

Query  468  QRVKSRRSKVCVIRNSSS----VEVQPASEGSPLLVPRQK------YCEHIHKTVRRKTR  617
            +R+ ++R+  C+   S      + +Q      P+++P++K      YCE I++T+RR TR
Sbjct  18   ERITNKRA-ACISHTSRGRRRHIPIQGVVAEGPIILPQEKKLALPKYCESIYQTIRRPTR  76

Query  618  TVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITVQGKKEADACF  797
            T+ +G V  GSEHP+R+QTMTTTDT+DVAGTVEQV +  D+GA+IVRITVQGKKEA AC 
Sbjct  77   TIHIGKVETGSEHPVRLQTMTTTDTRDVAGTVEQVKRCVDSGAEIVRITVQGKKEAAACM  136

Query  798  EIKNSLVQKNYNIPLVADIHFAPSVAL  878
            +I+ +L +  Y++PLVADIHF P VA+
Sbjct  137  DIREALFKDGYDVPLVADIHFQPQVAM  163



>gb|KDD73287.1| GcpE, partial [Helicosporidium sp. ATCC 50920]
Length=264

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = +3

Query  573  KYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADI  752
            KYCE + +T RR TRT+ VG V +G  HP+R+QTMTT+DT+DV  TV QV + AD GA++
Sbjct  34   KYCESVFQTRRRPTRTMQVGKVLIGGSHPVRLQTMTTSDTRDVEATVAQVKRCADAGAEL  93

Query  753  VRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VRITVQGKKEA AC +I+  L Q NY+ PLVADIHF P VA+
Sbjct  94   VRITVQGKKEAAACMKIRERLFQDNYDTPLVADIHFQPGVAM  135



>ref|XP_011400578.1| 26S proteasome non-ATPase regulatory subunit 1 [Auxenochlorella 
protothecoides]
 gb|KFM27595.1| 26S proteasome non-ATPase regulatory subunit 1 [Auxenochlorella 
protothecoides]
Length=1584

 Score =   147 bits (370),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 69/108 (64%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +3

Query  555  LLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIA  734
            L +P   YCE I++T RR TRT+ VG V +GSEHP+  QTMTTTDT+DV  TVEQV K A
Sbjct  887  LWLPTPHYCESIYQTRRRPTRTIYVGKVPVGSEHPLARQTMTTTDTRDVEATVEQVKKCA  946

Query  735  DTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            D GADIVRITVQGK+EA AC +I++ L Q  Y+ PLVADIHF P+VA+
Sbjct  947  DAGADIVRITVQGKREATACLKIRDRLFQDRYDTPLVADIHFQPTVAM  994



>ref|XP_007510861.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18394.1| predicted protein [Bathycoccus prasinos]
Length=745

 Score =   143 bits (361),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 95/133 (71%), Gaps = 1/133 (1%)
 Frame = +3

Query  480  SRRSKVCVIRNSSSVEVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHP  659
            +RR+KV     + +V+    +EG  +L+P   YC    +T RRKTRT+ +GNV +GS+HP
Sbjct  45   NRRTKVQRAIRAQAVQQHEMTEGG-VLLPTGLYCPDTTQTFRRKTRTIQIGNVKVGSDHP  103

Query  660  IRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIP  839
            I  QTMTT+DT+DV  TV ++M+ AD GA++VRITVQG +EA AC EIKN L+Q  Y  P
Sbjct  104  IVKQTMTTSDTRDVDATVNEIMRCADAGAEMVRITVQGMQEAKACQEIKNKLLQSGYTTP  163

Query  840  LVADIHFAPSVAL  878
            ++ADIHFAP VA+
Sbjct  164  IIADIHFAPKVAM  176



>ref|WP_042282293.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Candidatus 
Protochlamydia sp. R18]
Length=654

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +3

Query  567  RQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGA  746
            ++KYCE IH+T RR TR V VGNV +G  HPIRIQ+MTT+ T+DV  T+EQV+++AD G 
Sbjct  3    QKKYCEAIHQTERRPTRVVNVGNVGIGGNHPIRIQSMTTSSTRDVEATIEQVIRLADQGC  62

Query  747  DIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            +IVR+TVQG KEADAC  IK  L+++ Y IPLVADIHF P  A+
Sbjct  63   EIVRVTVQGIKEADACEHIKKGLIKRGYQIPLVADIHFYPPAAM  106



>ref|WP_039357656.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Candidatus 
Protochlamydia amoebophila]
Length=654

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +3

Query  567  RQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGA  746
            ++KYCE IH+T RR TR V VGNV +G  HPIRIQ+MTT+ T+DV  T+EQV+++AD G 
Sbjct  3    QKKYCEAIHQTERRPTRVVNVGNVGIGGNHPIRIQSMTTSSTRDVEATIEQVIRLADQGC  62

Query  747  DIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            +IVR+TVQG KEADAC  IK  L+++ Y IPLVADIHF P  A+
Sbjct  63   EIVRVTVQGIKEADACEHIKKGLIKRGYQIPLVADIHFYPPAAM  106



>ref|WP_011175290.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Candidatus Protochlamydia amoebophila]
 sp|Q6MD85.1|ISPG_PARUW RecName: Full=4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(flavodoxin); AltName: Full=1-hydroxy-2-methyl-2-(E)-butenyl 
4-diphosphate synthase [Candidatus Protochlamydia amoebophila 
UWE25]
 emb|CAF23464.1| probable gcpE protein [Candidatus Protochlamydia amoebophila 
UWE25]
Length=654

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +3

Query  567  RQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGA  746
            ++KYCE IH+T RR TR V VGNV +G  HPIRIQ+MTT+ T+DV  T+EQV+++AD G 
Sbjct  3    QKKYCEAIHQTERRPTRIVNVGNVGIGGNHPIRIQSMTTSSTRDVEATIEQVIRLADQGC  62

Query  747  DIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            +IVR+TVQG KEADAC  IK  L+++ Y IPLVADIHF P  A+
Sbjct  63   EIVRVTVQGIKEADACEHIKKGLIKRGYQIPLVADIHFYPPAAM  106



>gb|KIC72391.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Candidatus 
Protochlamydia amoebophila]
Length=657

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +3

Query  567  RQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGA  746
            ++KYCE IH+T RR TR V VGNV +G  HPIRIQ+MTT+ T+DV  T+EQV+++AD G 
Sbjct  6    QKKYCEAIHQTERRPTRVVNVGNVGIGGNHPIRIQSMTTSSTRDVEATIEQVIRLADQGC  65

Query  747  DIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            +IVR+TVQG KEADAC  IK  L+++ Y IPLVADIHF P  A+
Sbjct  66   EIVRVTVQGIKEADACEHIKKGLIKRGYQIPLVADIHFYPPAAM  109



>ref|XP_005841109.1| hypothetical protein GUITHDRAFT_63981 [Guillardia theta CCMP2712]
 gb|EKX54129.1| hypothetical protein GUITHDRAFT_63981 [Guillardia theta CCMP2712]
Length=679

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +3

Query  576  YCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIV  755
            YC+ ++KT RRKTRTV  G+V +GSEHPI +QTMTT  T D+ G+++QVM+ AD GA +V
Sbjct  10   YCDSVYKTTRRKTRTVQCGDVPIGSEHPIALQTMTTAMTTDIQGSIDQVMRCADAGAQLV  69

Query  756  RITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            R+TVQG++EADAC +IK  L++K Y  PLVADIHFAP +AL
Sbjct  70   RLTVQGQREADACSKIKEGLLKKGYTTPLVADIHFAPKIAL  110



>ref|XP_001690937.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chlamydomonas 
reinhardtii]
 gb|EDP05383.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chlamydomonas 
reinhardtii]
Length=681

 Score =   141 bits (356),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = +3

Query  576  YCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIV  755
            YCE I+KT+RR TRTVM+G V +GS+H I +QTMTTTDT++V  TV+QV K AD GADIV
Sbjct  9    YCESINKTIRRPTRTVMIGKVPVGSQHRIALQTMTTTDTRNVQLTVDQVKKCADAGADIV  68

Query  756  RITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            RITVQGKKEA+AC +I+  L +  Y++PLVADIHF P+VA+
Sbjct  69   RITVQGKKEAEACMKIREQLFKDKYDVPLVADIHFQPTVAM  109



>gb|AAX54905.1| putative chloroplast 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate 
synthase precursor [Chlamydomonas reinhardtii]
Length=681

 Score =   141 bits (355),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = +3

Query  576  YCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIV  755
            YCE I+KT+RR TRTVM+G V +GS+H I +QTMTTTDT++V  TV+QV K AD GADIV
Sbjct  9    YCESINKTIRRPTRTVMIGKVPVGSQHRIALQTMTTTDTRNVQLTVDQVKKCADAGADIV  68

Query  756  RITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            RITVQGKKEA+AC +I+  L +  Y++PLVADIHF P+VA+
Sbjct  69   RITVQGKKEAEACMKIREQLFKDKYDVPLVADIHFQPTVAM  109



>ref|XP_002953482.1| hypothetical protein VOLCADRAFT_63610 [Volvox carteri f. nagariensis]
 gb|EFJ45455.1| hypothetical protein VOLCADRAFT_63610 [Volvox carteri f. nagariensis]
Length=679

 Score =   141 bits (355),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = +3

Query  573  KYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADI  752
            KYCE +++T RR TRTVM+G V +GSEH I +QTMTTTDT++V  TV+QV K AD GADI
Sbjct  5    KYCESVYQTQRRPTRTVMIGKVPVGSEHRIALQTMTTTDTRNVQLTVDQVKKCADAGADI  64

Query  753  VRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VRITVQGKKEA+AC  I+  L +  Y++PLVADIHF P+VA+
Sbjct  65   VRITVQGKKEAEACMRIREQLFKDRYDVPLVADIHFQPTVAM  106



>ref|XP_005848392.1| hypothetical protein CHLNCDRAFT_144676 [Chlorella variabilis]
 gb|EFN56290.1| hypothetical protein CHLNCDRAFT_144676 [Chlorella variabilis]
Length=698

 Score =   140 bits (352),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 82/108 (76%), Gaps = 2/108 (2%)
 Frame = +3

Query  555  LLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIA  734
            LL P  KYCE I +T RR TRTV +G V +GSEHPI +QTMTTTDT+D+  TVEQV + A
Sbjct  56   LLTP--KYCESISQTRRRPTRTVDIGPVKVGSEHPIALQTMTTTDTRDIEATVEQVKRCA  113

Query  735  DTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            D GADIVRITVQ K+EA+AC +I+  L +  Y  PLVADIHF P+VA+
Sbjct  114  DAGADIVRITVQSKREAEACMKIRERLFKDRYTTPLVADIHFQPAVAM  161



>ref|XP_001419500.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
chloroplast precursor (1-hydroxy-2-methyl-2-(E)-butenyl  4-diphosphate 
synthase) (ISPG) [Ostreococcus lucimarinus CCE9901]
 gb|ABO97793.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
chloroplast precursor (1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate 
synthase) (ISPG) [Ostreococcus lucimarinus CCE9901]
Length=680

 Score =   139 bits (349),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +3

Query  555  LLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIA  734
            +L+P  KYC +  +TVRRKTRTV VGNV +GSEHPI  QTMTT+DT+DV  TV +V++ A
Sbjct  6    VLMPTGKYCVNHAETVRRKTRTVHVGNVKIGSEHPIVKQTMTTSDTRDVEKTVAEVIRCA  65

Query  735  DTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            D GA++VRITVQG +EA AC  IK +LV K Y+ PL+ADIHFAP VA+
Sbjct  66   DAGAEMVRITVQGMQEAKACKIIKETLVAKGYDTPLIADIHFAPKVAM  113



>gb|KIA77148.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Parachlamydia 
acanthamoebae]
Length=673

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +3

Query  567  RQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGA  746
            + KYC   ++T+RRKTR V++GN+ +G  HPIRIQ+MTT+ T++V  TV+Q++++AD G 
Sbjct  17   KMKYCTSHYQTIRRKTREVLIGNIGVGGNHPIRIQSMTTSSTRNVEATVDQIIRLADAGC  76

Query  747  DIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            +IVR+TVQG KEA+AC  IKN LV+K Y IPLVADIHF P  A+
Sbjct  77   EIVRMTVQGMKEAEACEHIKNDLVKKGYLIPLVADIHFYPPAAM  120



>ref|WP_036746476.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Parachlamydia 
acanthamoebae]
Length=656

 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +3

Query  573  KYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADI  752
            KYC   ++T+RRKTR V++GN+ +G  HPIRIQ+MTT+ T++V  TV+Q++++AD G +I
Sbjct  2    KYCTSHYQTIRRKTREVLIGNIGVGGNHPIRIQSMTTSSTRNVEATVDQIIRLADAGCEI  61

Query  753  VRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VR+TVQG KEA+AC  IKN LV+K Y IPLVADIHF P  A+
Sbjct  62   VRMTVQGMKEAEACEHIKNDLVKKGYLIPLVADIHFYPPAAM  103



>ref|WP_013925438.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Parachlamydia 
acanthamoebae]
 emb|CCB87188.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Parachlamydia 
acanthamoebae UV-7]
Length=656

 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +3

Query  573  KYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADI  752
            KYC   ++T+RRKTR V++GN+ +G  HPIRIQ+MTT+ T++V  TV+Q++++AD G +I
Sbjct  2    KYCTSHYQTIRRKTREVLIGNIGVGGNHPIRIQSMTTSSTRNVEATVDQIIRLADAGCEI  61

Query  753  VRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VR+TVQG KEA+AC  IKN LV+K Y IPLVADIHF P  A+
Sbjct  62   VRMTVQGMKEAEACEHIKNDLVKKGYLIPLVADIHFYPPAAM  103



>ref|XP_002506236.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67494.1| predicted protein [Micromonas sp. RCC299]
Length=697

 Score =   134 bits (338),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 90/129 (70%), Gaps = 3/129 (2%)
 Frame = +3

Query  501  VIRNSSS---VEVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQ  671
            V+R +S+   +E   A+  S   +P   YC    +T+RRKTRTV +G V +GS+HPI  Q
Sbjct  3    VVRAASTEPKIESVAAAVPSDAFLPDGLYCVDNTQTIRRKTRTVTIGKVKMGSDHPIVRQ  62

Query  672  TMTTTDTKDVAGTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVAD  851
            TMTT+DT+DV  TV +V K AD GA++VRITVQG +EA AC EIK  LV+  Y+ PL+AD
Sbjct  63   TMTTSDTRDVEATVAEVKKCADAGAEMVRITVQGMQEAKACAEIKKRLVEDGYDTPLIAD  122

Query  852  IHFAPSVAL  878
            IHFAP VA+
Sbjct  123  IHFAPKVAM  131



>ref|XP_003081089.1| putative chloroplast 1-hydroxy-2-methyl-2-(ISS) [Ostreococcus 
tauri]
 emb|CAL55258.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, bacterial-type 
[Ostreococcus tauri]
Length=726

 Score =   134 bits (338),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = +3

Query  543  EGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQV  722
            + + ++VP  +YC +  +TVRRKTRTV VGNV +GSEH I  QTMTT+DT+DV  TV +V
Sbjct  49   DATGVMVPTGEYCVNHAETVRRKTRTVHVGNVKIGSEHAIVKQTMTTSDTRDVEKTVAEV  108

Query  723  MKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            ++ AD GAD+VRITVQG +EA AC  IK +L+ + Y  PL+ADIHFAP VA+
Sbjct  109  IRCADAGADMVRITVQGMQEAKACKAIKETLLARGYTTPLIADIHFAPKVAM  160



>ref|XP_002179061.1| 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate synthase [Phaeodactylum 
tricornutum CCAP 1055/1]
 gb|ACI45957.1| putative chloroplast 4-hydroxy-3-methylbut-2-en-1-yl diphosphate 
synthase precursor [Phaeodactylum tricornutum]
 gb|EEC49759.1| 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate synthase [Phaeodactylum 
tricornutum CCAP 1055/1]
Length=757

 Score =   134 bits (337),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +3

Query  564  PRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTG  743
            P QKYCE +++  RRKTRTV  G +  GS+HPI  QTM TT+T DV  T++QVM+ AD G
Sbjct  67   PIQKYCEDLYEVTRRKTRTVNCGPIKFGSDHPIVRQTMATTNTADVEATMDQVMRCADKG  126

Query  744  ADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
             D+VR+TVQGK+EA+AC +I+  L +K Y+IPL AD+HF P VAL
Sbjct  127  FDLVRVTVQGKREANACAKIREGLFKKGYDIPLCADMHFQPVVAL  171



>ref|WP_035395035.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, partial 
[Chlamydia sp. 'Diamant']
Length=638

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +3

Query  588  IHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITV  767
            +++T RR TRTVMVG++ +G  +P+RIQ+MTT++T+DV  T++QV+++AD+G +IVR+TV
Sbjct  1    MYQTQRRPTRTVMVGHIGVGGNNPVRIQSMTTSNTRDVEATIDQVIRLADSGCEIVRMTV  60

Query  768  QGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            QG KEADAC  IKN LVQ+ YNIPLVADIHF P  A+
Sbjct  61   QGIKEADACEYIKNGLVQRGYNIPLVADIHFYPPAAM  97



>ref|WP_042103571.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Parachlamydiaceae 
bacterium HS-T3]
Length=649

 Score =   128 bits (322),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = +3

Query  573  KYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADI  752
            KYC+ + KT R +TR + VGNV +G +HPIRIQ+MTT++T+DV  T+EQV+++ D G +I
Sbjct  3    KYCDSVFKTKRWQTREIFVGNVGVGGDHPIRIQSMTTSNTRDVEATIEQVLRLQDAGCEI  62

Query  753  VRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VRITVQG KEA++   IKN L+Q+   +PLVADIHF P  A+
Sbjct  63   VRITVQGMKEAESFELIKNGLLQRGCTVPLVADIHFFPPAAM  104



>ref|XP_005764175.1| hypothetical protein EMIHUDRAFT_447290, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD11746.1| hypothetical protein EMIHUDRAFT_447290, partial [Emiliania huxleyi 
CCMP1516]
Length=228

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 86/137 (63%), Gaps = 10/137 (7%)
 Frame = +3

Query  489  SKVCVIRNSSSVEVQPASEGSPLLVPRQK-------YCEHIHKTVRRKTRTVMVGNVALG  647
            SK+ V+    +V+  P++ G P   PR         Y   +++  RR+TRTV  G +  G
Sbjct  69   SKLSVL---DAVQWSPSARGEPGKTPRDLAYGPLDLYATDLYEVKRRETRTVECGPIKFG  125

Query  648  SEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKN  827
            SEHP+  QTM TT T DV GT+EQV+K AD G D+VR+TV G K+A AC  I+  L ++ 
Sbjct  126  SEHPLVRQTMATTLTSDVEGTIEQVIKCADEGFDLVRVTVVGMKDAKACMAIRKGLDERG  185

Query  828  YNIPLVADIHFAPSVAL  878
            Y+IPL AD+HFAP VAL
Sbjct  186  YDIPLCADMHFAPKVAL  202



>emb|CDZ80220.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
sp. 'Rubis']
Length=653

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +3

Query  573  KYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADI  752
            KYCE ++KT R KTR VMVGNV +G ++P+RIQ+MTT+ T+D+  TV+Q+M++ADTG +I
Sbjct  3    KYCESVYKTKRWKTRQVMVGNVGVGGDNPVRIQSMTTSSTRDIEATVQQIMQLADTGCEI  62

Query  753  VRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
             R+TVQG KEADAC  IKNSL+QK Y IP+VADIHF P  A+
Sbjct  63   ARVTVQGMKEADACEGIKNSLIQKGYTIPIVADIHFFPPAAM  104



>gb|EJK67655.1| hypothetical protein THAOC_11283, partial [Thalassiosira oceanica]
Length=756

 Score =   127 bits (318),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 74/106 (70%), Gaps = 0/106 (0%)
 Frame = +3

Query  558  LVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIAD  737
            L P  +YCE ++   RR TRTV  G V  GSEHPI  QTM TTDT +V  ++EQ+M+ AD
Sbjct  74   LGPLGRYCEDLYSVRRRPTRTVTCGPVKFGSEHPIVRQTMATTDTANVDASIEQIMRCAD  133

Query  738  TGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
             G D+VRITVQGK+EA+A  +I+  L +K Y IPL AD+HF P VA
Sbjct  134  EGFDLVRITVQGKREANAAMQIREGLFKKGYTIPLCADMHFQPKVA  179



>emb|CDR33454.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Criblamydia 
sequanensis CRIB-18]
Length=619

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +3

Query  576  YCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIV  755
            YCE I++T R  TR V VG++ +G  +PIR+Q+MTT++T+DV  TV+Q++K+ D G +IV
Sbjct  3    YCESIYQTKRFPTREVKVGSLGVGGNNPIRLQSMTTSNTRDVEATVDQILKLRDYGCEIV  62

Query  756  RITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            R+TVQGKKEA+A   IKN L+Q N +IPLVADIHF P  AL
Sbjct  63   RLTVQGKKEAEAAGLIKNRLLQLNCDIPLVADIHFYPPAAL  103



>ref|WP_041016942.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Criblamydia 
sequanensis]
Length=622

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +3

Query  576  YCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIV  755
            YCE I++T R  TR V VG++ +G  +PIR+Q+MTT++T+DV  TV+Q++K+ D G +IV
Sbjct  6    YCESIYQTKRFPTREVKVGSLGVGGNNPIRLQSMTTSNTRDVEATVDQILKLRDYGCEIV  65

Query  756  RITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            R+TVQGKKEA+A   IKN L+Q N +IPLVADIHF P  AL
Sbjct  66   RLTVQGKKEAEAAGLIKNRLLQLNCDIPLVADIHFYPPAAL  106



>ref|XP_002292108.1| gcpe-like protein [Thalassiosira pseudonana CCMP1335]
 gb|EED90959.1| gcpe-like protein [Thalassiosira pseudonana CCMP1335]
Length=686

 Score =   125 bits (314),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = +3

Query  573  KYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADI  752
            KYCE ++   RRKTRTV  G +  GS+HPI  QTM TTDT +V  ++EQ+M+ AD G D+
Sbjct  3    KYCEDLYSVTRRKTRTVTCGPIQFGSDHPIVRQTMATTDTANVDASIEQIMRCADKGFDL  62

Query  753  VRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            +RITVQGK+EA+A  +I+  L +K Y+IPL AD+HF P VA
Sbjct  63   IRITVQGKREANAAAKIREGLFKKGYDIPLCADMHFQPVVA  103



>ref|XP_009035331.1| hypothetical protein AURANDRAFT_71112 [Aureococcus anophagefferens]
 gb|EGB10547.1| hypothetical protein AURANDRAFT_71112 [Aureococcus anophagefferens]
Length=2166

 Score =   126 bits (316),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 63/124 (51%), Positives = 84/124 (68%), Gaps = 2/124 (2%)
 Frame = +3

Query  513  SSSVEVQPASEGSPLLVPRQ--KYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTT  686
            +S +  Q   +  PLL  +   KYCE + + VRRKTRTV  G V+ GS+H I  QTM TT
Sbjct  48   ASHISGQRDIDYGPLLGEKHNGKYCESLREVVRRKTRTVTAGPVSFGSDHKIVRQTMGTT  107

Query  687  DTKDVAGTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAP  866
             T+DVAGT++QVM+ +D G D+ R+TV G KEA AC +I+  L +K Y+IPL AD+HF P
Sbjct  108  STRDVAGTIDQVMRCSDAGFDLFRLTVVGMKEATACHDIREGLFKKGYDIPLCADMHFQP  167

Query  867  SVAL  878
             VA+
Sbjct  168  KVAM  171



>emb|CBJ30926.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase, chloroplast 
precursor [Ectocarpus siliculosus]
Length=695

 Score =   124 bits (310),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  573  KYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADI  752
            KYCE    T RR +RTV  G V +GSEH I  QTMTTT+T DV  TV QV+K AD GAD+
Sbjct  19   KYCEDTSATKRRTSRTVWAGKVPIGSEHRIARQTMTTTNTNDVDATVAQVIKCADAGADL  78

Query  753  VRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VRITVQGK+EA +C  I+  L +  Y++PLVADIHF P VA+
Sbjct  79   VRITVQGKREAKSCKLIREKLNELGYDVPLVADIHFQPKVAM  120



>ref|WP_013943315.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Simkania 
negevensis]
 emb|CCB88848.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Simkania 
negevensis Z]
Length=604

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +3

Query  573  KYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADI  752
            +Y E I++T R KTR V VG V +G  +PIRIQ+MTT+DT+DV  T  Q+M++ADTG +I
Sbjct  2    RYSEAIYQTKRWKTREVKVGKVGVGGNNPIRIQSMTTSDTRDVEATANQIMRLADTGCEI  61

Query  753  VRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
             R+TVQGKKEA+AC  IKN+LVQK Y+IP+VADIHF P  A+
Sbjct  62   ARVTVQGKKEAEACEGIKNTLVQKGYDIPVVADIHFYPPAAM  103



>ref|XP_005783224.1| hypothetical protein EMIHUDRAFT_442353 [Emiliania huxleyi CCMP1516]
 gb|EOD30795.1| hypothetical protein EMIHUDRAFT_442353 [Emiliania huxleyi CCMP1516]
Length=780

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 86/137 (63%), Gaps = 10/137 (7%)
 Frame = +3

Query  489  SKVCVIRNSSSVEVQPASEGSPLLVPRQK-------YCEHIHKTVRRKTRTVMVGNVALG  647
            SK+ V+    +V+  P++ G P   PR         Y   +++  RR+TRTV  G +  G
Sbjct  69   SKLSVL---DAVQWSPSARGEPGKTPRDLAYGPLDLYATDLYEVKRRETRTVECGPIKFG  125

Query  648  SEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKN  827
            SEHP+  QTM TT T DV GT+EQV+K AD G D+VR+TV G K+A AC  I+  L ++ 
Sbjct  126  SEHPLVRQTMATTLTSDVEGTIEQVIKCADEGFDLVRVTVVGMKDAKACMAIRKGLDERG  185

Query  828  YNIPLVADIHFAPSVAL  878
            Y+IPL AD+HFAP VAL
Sbjct  186  YDIPLCADMHFAPKVAL  202



>ref|XP_003056663.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58308.1| predicted protein [Micromonas pusilla CCMP1545]
Length=732

 Score =   120 bits (300),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 98/144 (68%), Gaps = 9/144 (6%)
 Frame = +3

Query  471  RVKSRRSKVCVIRNSSS--------VEVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVM  626
            R  +++++V  +  ++S        VEV  A + + LL P   YC   ++T RRKTRTV 
Sbjct  23   RKHAKKAQVSTVTRAASAEKAGPKIVEVAAAVDHNDLL-PEGLYCNAHYQTTRRKTRTVT  81

Query  627  VGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITVQGKKEADACFEIK  806
            +GNV LGS+HPI  QTMTT+DT+DV  TV +V+K AD GA++VRITVQG +EA AC  IK
Sbjct  82   IGNVKLGSDHPIVRQTMTTSDTRDVEATVAEVIKCADAGAEMVRITVQGMQEAKACKVIK  141

Query  807  NSLVQKNYNIPLVADIHFAPSVAL  878
             +L+ K Y  PL+ADIHFAP VA+
Sbjct  142  ETLMAKGYTTPLIADIHFAPKVAM  165



>gb|AHI16949.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase, partial 
[Voromonas pontica]
Length=475

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +3

Query  570  QKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGAD  749
            +KYCE+ ++T+R  + TV VG   +GS HPIR QTMTTTDTKDV  +++QV +IAD GAD
Sbjct  62   EKYCENPYRTLRFPSDTVTVGTTTIGSAHPIRCQTMTTTDTKDVRASIDQVKRIADAGAD  121

Query  750  IVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            +VR+TVQG++EA A  EI++ L  + Y+IPLVADIHF P  A+
Sbjct  122  LVRLTVQGQREAAAAKEIRDGLTAEGYDIPLVADIHFNPRAAV  164



>ref|XP_002768617.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Perkinsus marinus ATCC 50983]
 gb|EER01335.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Perkinsus marinus ATCC 50983]
Length=798

 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  576  YCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIV  755
            YC+ +   +RRKTRTVMVGNV +GSEH + +QTM+ + T DV  TV+Q+ + AD G DIV
Sbjct  137  YCKGVDHPIRRKTRTVMVGNVPVGSEHRLALQTMSNSSTDDVDATVKQIERCADAGIDIV  196

Query  756  RITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            R+TVQG KEA A   IK  L++  Y  P+VADIHF P VA+
Sbjct  197  RVTVQGIKEAHATKLIKERLLKDGYTTPIVADIHFKPKVAM  237



>dbj|BAG14389.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Perkinsus 
marinus]
Length=798

 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  546  GSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVM  725
            G  + V    YC+ +   +RRKTRTVMVGNV +GSEH + +QTM+ + T DV  TV+Q+ 
Sbjct  127  GPIMAVADLPYCKGVDHPIRRKTRTVMVGNVPVGSEHRLALQTMSNSSTDDVDATVKQIE  186

Query  726  KIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            + AD G DIVR+TVQG KEA A   IK  L++  Y  P+VADIHF P VA+
Sbjct  187  RCADAGIDIVRVTVQGIKEAHATKLIKERLLKDGYTTPIVADIHFKPKVAM  237



>ref|WP_010230169.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Chlamydia muridarum]
 sp|Q9PKY3.1|ISPG_CHLMU RecName: Full=4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(flavodoxin); AltName: Full=1-hydroxy-2-methyl-2-(E)-butenyl 
4-diphosphate synthase [Chlamydia muridarum str. Nigg]
 gb|AAF39191.1| gcpE protein [Chlamydia muridarum str. Nigg]
 gb|AHH22717.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
muridarum str. Nigg3 CMUT3-5]
 gb|AHH23642.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
muridarum str. Nigg CM972]
 gb|KDU80760.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
muridarum]
 gb|KDU81334.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
muridarum]
 gb|KDU82620.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
muridarum]
 gb|KDU83286.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
muridarum]
 gb|KDU84608.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
muridarum]
 gb|AID37860.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
muridarum str. Nigg 2 MCR]
 gb|AIT90528.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
muridarum]
 gb|AIT91414.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
muridarum]
 gb|AIW23292.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
muridarum]
 gb|AJR10413.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
muridarum]
Length=601

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 71/98 (72%), Gaps = 0/98 (0%)
 Frame = +3

Query  585  HIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRIT  764
            ++    RRKT +V VGN+ +GSEH I+IQ+MTTT T DV GTV Q+  + + G +IVR+T
Sbjct  5    YLQNGFRRKTLSVKVGNLFVGSEHSIKIQSMTTTATTDVEGTVRQIYALQECGCEIVRVT  64

Query  765  VQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VQG KE  AC +IK+ LVQ+N  IPLVADIHF P  A+
Sbjct  65   VQGLKEVGACEQIKDRLVQQNVTIPLVADIHFFPQAAI  102



>ref|WP_020966877.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis]
 gb|AGT71465.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis]
Length=602

 Score =   115 bits (287),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +3

Query  588  IHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITV  767
            I    RRKT  V +G++ +GSEHPI+IQ+MTTT T DV GTV Q+  + + G DIVR+TV
Sbjct  6    IQNAFRRKTLPVRIGDLFVGSEHPIKIQSMTTTATTDVDGTVRQICALQEWGCDIVRVTV  65

Query  768  QGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            QG +E  AC  IK+ L+Q+N +IPLVADIHF P  A+
Sbjct  66   QGLREVHACEHIKDRLIQQNISIPLVADIHFFPQAAI  102



>ref|WP_033418316.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Cytophaga 
aurantiaca]
Length=657

 Score =   115 bits (288),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = +3

Query  573  KYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADI  752
            KYC  + + VRRKT  V +GNV +G ++PIR+Q+MTT DT D  G+VEQ++++ D G + 
Sbjct  4    KYCSSLTQYVRRKTTVVTIGNVPMGGDNPIRLQSMTTVDTMDTLGSVEQIIRMVDAGCEY  63

Query  753  VRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            VR+T    KEA    EIK  L+++ YN+PLVADIHF P+ A
Sbjct  64   VRVTAPSVKEAQNLAEIKKELLKRGYNVPLVADIHFTPNAA  104



>ref|WP_044882180.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Neochlamydia 
sp. EPS4]
 gb|KIC74118.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Neochlamydia 
sp. EPS4]
Length=638

 Score =   115 bits (288),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = +3

Query  573  KYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADI  752
            KYCE I +  RR TR VMVG V +G  +PIRIQ+MTT++T+DV  T +Q+M++AD G +I
Sbjct  2    KYCESIAQLKRRPTREVMVGPVGVGGNNPIRIQSMTTSNTRDVEATTQQIMRLADAGCEI  61

Query  753  VRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
             R+TVQG KEAD+C  IKN L+QK Y+IPLVADIHF P  A+
Sbjct  62   ARVTVQGMKEADSCEAIKNGLLQKGYSIPLVADIHFFPPAAM  103



>ref|WP_042240386.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Neochlamydia 
sp. S13]
Length=638

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +3

Query  573  KYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADI  752
            KYCE I +  RR TR VMVG V +G  +PIRIQ+MTT++T+D   T +Q+M++AD G +I
Sbjct  2    KYCESIAQLKRRPTREVMVGPVGVGGNNPIRIQSMTTSNTRDAEATTQQIMRLADAGCEI  61

Query  753  VRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
             R+TVQG KEAD+C  IKN L+QK Y+IPLVADIHF P  A+
Sbjct  62   ARVTVQGMKEADSCEAIKNGLLQKGYSIPLVADIHFFPPAAM  103



>ref|WP_039385010.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Neochlamydia 
sp. TUME1]
 gb|KIC75889.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Neochlamydia 
sp. TUME1]
Length=638

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +3

Query  573  KYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADI  752
            KYCE I +  RR TR VMVG V +G  +PIRIQ+MTT++T+D   T +Q+M++AD G +I
Sbjct  2    KYCESIAQLKRRPTREVMVGPVGVGGNNPIRIQSMTTSNTRDAEATTQQIMRLADAGCEI  61

Query  753  VRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
             R+TVQG KEAD+C  IKN L+QK Y+IPLVADIHF P  A+
Sbjct  62   ARVTVQGMKEADSCEAIKNGLLQKGYSIPLVADIHFFPPAAM  103



>ref|WP_035405552.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
suis]
 gb|ESN89748.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
suis MD56]
Length=604

 Score =   112 bits (281),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  588  IHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITV  767
            + K  RRKT +V +G++ +GSEH I+IQ+MTTT T DV GTV+Q+  + + G +I R+TV
Sbjct  6    LQKPFRRKTLSVKIGDLFVGSEHSIKIQSMTTTATTDVEGTVKQICALQECGCEIARVTV  65

Query  768  QGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            QG KE  AC +IK+ L+Q+N +IPLVADIHF P  A+
Sbjct  66   QGLKEVSACEKIKDRLIQQNVSIPLVADIHFFPQAAM  102



>emb|CDO64659.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Plasmodium 
reichenowi]
Length=821

 Score =   113 bits (283),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 71/103 (69%), Gaps = 0/103 (0%)
 Frame = +3

Query  570  QKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGAD  749
            +KYCE   K  R  TR V++GNV +G  + I IQTMT+ DT++V   V Q+ K  D GAD
Sbjct  107  KKYCECTKKYKRLPTREVVIGNVKIGGNNKIAIQTMTSCDTRNVEECVYQIRKCKDLGAD  166

Query  750  IVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            IVR+TVQG +EA A + IK  L+ +N NIPLVADIHF P +AL
Sbjct  167  IVRLTVQGVQEAQASYHIKEKLLSENVNIPLVADIHFNPKIAL  209



>ref|WP_009871405.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis]
 gb|ADH17748.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis G/9768]
 gb|ADH18668.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis G/11222]
 gb|ADH19595.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis G/11074]
 gb|ADH96691.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis G/9301]
 emb|CCP50223.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis K/SotonK1]
 emb|CCP54023.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis D/SotonD6]
 emb|CCP58514.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis Ia/SotonIa1]
 emb|CCP59408.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis Ia/SotonIa3]
 gb|AGS01853.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis J/6276tet1]
 gb|AGT70539.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis]
Length=602

 Score =   112 bits (279),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  588  IHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITV  767
            I    RRKT  V +G++ +GSEH I+IQ+MTTT T DV GTV Q+  + + G DIVR+TV
Sbjct  6    IQNAFRRKTLPVRIGDLFVGSEHSIKIQSMTTTATTDVDGTVRQICALQEWGCDIVRVTV  65

Query  768  QGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            QG +E  AC  IK+ L+Q+N +IPLVADIHF P  A+
Sbjct  66   QGLREVHACEHIKDRLIQQNISIPLVADIHFFPQAAI  102



>ref|WP_010725012.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Chlamydia trachomatis]
 ref|NP_219560.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis D/UW-3/CX]
 sp|O84060.1|ISPG_CHLTR RecName: Full=4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(flavodoxin); AltName: Full=1-hydroxy-2-methyl-2-(E)-butenyl 
4-diphosphate synthase [Chlamydia trachomatis D/UW-3/CX]
 gb|AAC67648.1| hypothetical protein CT_057 [Chlamydia trachomatis D/UW-3/CX]
 emb|CCP53132.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis D/SotonD5]
 emb|CCP57622.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis G/SotonG1]
Length=602

 Score =   111 bits (278),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  588  IHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITV  767
            I    RRKT  V +G++ +GSEH I+IQ+MTTT T DV GTV Q+  + + G DIVR+TV
Sbjct  6    IQNAFRRKTLPVRIGDLFVGSEHSIKIQSMTTTATTDVDGTVRQICALQEWGCDIVRVTV  65

Query  768  QGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            QG +E  AC  IK+ L+Q+N +IPLVADIHF P  A+
Sbjct  66   QGLREVHACEHIKDRLIQQNISIPLVADIHFFPQAAI  102



>ref|WP_015505647.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Chlamydia trachomatis]
 emb|CCP62984.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis L1/1322/p2]
 emb|CCP63874.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis L1/115]
 emb|CCP64763.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis L1/224]
 emb|CCP66543.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis L3/404/LN]
Length=602

 Score =   111 bits (278),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  588  IHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITV  767
            I    RRKT  V +G++ +GSEH I+IQ+MTTT T DV GTV Q+  + + G DIVR+TV
Sbjct  6    IQNAFRRKTLPVRIGDLFVGSEHSIKIQSMTTTATTDVDGTVRQICALQEWGCDIVRVTV  65

Query  768  QGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            QG +E  AC  IK+ L+Q+N +IPLVADIHF P  A+
Sbjct  66   QGLREVHACEHIKDRLIQQNISIPLVADIHFFPQAAI  102



>ref|WP_012263592.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Chlamydia trachomatis]
 sp|B0BB44.1|ISPG_CHLTB RecName: Full=4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(flavodoxin); AltName: Full=1-hydroxy-2-methyl-2-(E)-butenyl 
4-diphosphate synthase [Chlamydia trachomatis L2b/UCH-1/proctitis]
 emb|CAP06706.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chlamydia 
trachomatis L2b/UCH-1/proctitis]
 emb|CCP51348.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis L2b/8200/07]
 emb|CCP61201.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis L2b/795]
 emb|CCP67431.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis L2b/UCH-2]
 emb|CCP68321.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis L2b/Canada2]
 emb|CCP69213.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis L2b/LST]
 emb|CCP70103.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis L2b/Ams1]
 emb|CCP70993.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis L2b/CV204]
 emb|CCP90158.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis L2b/Ams2]
 emb|CCP91048.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis L2b/Ams3]
 emb|CCP91938.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis L2b/Canada1]
 emb|CCP92833.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis L2b/Ams4]
 emb|CCP93723.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis L2b/Ams5]
Length=602

 Score =   111 bits (278),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  588  IHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITV  767
            I    RRKT  V +G++ +GSEH I+IQ+MTTT T DV GTV Q+  + + G DIVR+TV
Sbjct  6    IQNAFRRKTLPVRIGDLFVGSEHSIKIQSMTTTATTDVDGTVRQICALQEWGCDIVRVTV  65

Query  768  QGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            QG +E  AC  IK+ L+Q+N +IPLVADIHF P  A+
Sbjct  66   QGLREVHACEHIKDRLIQQNISIPLVADIHFFPQAAI  102



>gb|AEP34867.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chlamydia 
trachomatis A2497]
Length=609

 Score =   111 bits (278),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  588  IHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITV  767
            I    RRKT  V +G++ +GSEH I+IQ+MTTT T DV GTV Q+  + + G DIVR+TV
Sbjct  13   IQNAFRRKTLPVRIGDLFVGSEHSIKIQSMTTTATTDVDGTVRQICALQEWGCDIVRVTV  72

Query  768  QGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            QG +E  AC  IK+ L+Q+N +IPLVADIHF P  A+
Sbjct  73   QGLREVHACEHIKDRLIQQNISIPLVADIHFFPQAAI  109



>ref|WP_011324544.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Chlamydia trachomatis]
 sp|Q3KMW4.1|ISPG_CHLTA RecName: Full=4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(flavodoxin); AltName: Full=1-hydroxy-2-methyl-2-(E)-butenyl 
4-diphosphate synthase [Chlamydia trachomatis A/HAR-13]
 gb|AAX50308.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chlamydia 
trachomatis A/HAR-13]
 emb|CAX09610.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chlamydia 
trachomatis B/TZ1A828/OT]
 emb|CAX10504.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chlamydia 
trachomatis B/Jali20/OT]
 emb|CAX08716.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chlamydia 
trachomatis A2497]
 emb|CCP49232.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis A/7249]
 emb|CCP48333.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis A/5291]
 emb|CCP47433.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis A/363]
 gb|AHC16903.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis C/TW-3]
Length=602

 Score =   111 bits (278),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  588  IHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITV  767
            I    RRKT  V +G++ +GSEH I+IQ+MTTT T DV GTV Q+  + + G DIVR+TV
Sbjct  6    IQNAFRRKTLPVRIGDLFVGSEHSIKIQSMTTTATTDVDGTVRQICALQEWGCDIVRVTV  65

Query  768  QGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            QG +E  AC  IK+ L+Q+N +IPLVADIHF P  A+
Sbjct  66   QGLREVHACEHIKDRLIQQNISIPLVADIHFFPQAAI  102



>ref|WP_009872353.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Chlamydia trachomatis]
 ref|YP_008634569.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chlamydia 
trachomatis E/C599]
 emb|CBJ14573.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chlamydia 
trachomatis Sweden2]
 gb|ADH16822.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis E/150]
 gb|ADH20514.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis E/11023]
 emb|CCE13222.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chlamydia 
trachomatis F/SW4]
 emb|CCE12333.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chlamydia 
trachomatis E/SW3]
 emb|CCP54915.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis E/SotonE4]
 emb|CCP55808.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis E/SotonE8]
 emb|CCP60303.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis E/Bour]
 emb|CCP27844.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chlamydia 
trachomatis IU824]
 emb|CCP28748.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chlamydia 
trachomatis IU888]
 gb|AGR95321.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis RC-F(s)/852]
 gb|AGR99039.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis RC-F(s)/342]
 gb|AGT65910.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis]
 emb|CDG42950.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chlamydia 
trachomatis E/C599]
Length=602

 Score =   111 bits (278),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  588  IHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITV  767
            I    RRKT  V +G++ +GSEH I+IQ+MTTT T DV GTV Q+  + + G DIVR+TV
Sbjct  6    IQNAFRRKTLPVRIGDLFVGSEHSIKIQSMTTTATTDVDGTVRQICALQEWGCDIVRVTV  65

Query  768  QGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            QG +E  AC  IK+ L+Q+N +IPLVADIHF P  A+
Sbjct  66   QGLREVHACEHIKDRLIQQNISIPLVADIHFFPQAAI  102



>ref|WP_015506433.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis]
 emb|CCP52239.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis D/SotonD1]
Length=602

 Score =   111 bits (278),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  588  IHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITV  767
            I    RRKT  V +G++ +GSEH I+IQ+MTTT T DV GTV Q+  + + G DIVR+TV
Sbjct  6    IQNAFRRKTLPVRIGDLFVGSEHSIKIQSMTTTATTDVDGTVRQICALQEWGCDIVRVTV  65

Query  768  QGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            QG +E  AC  IK+ L+Q+N +IPLVADIHF P  A+
Sbjct  66   QGLREVHACEHIKDRLIQQNISIPLVADIHFFPQAAI  102



>gb|AGT66840.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis F/11-96]
Length=609

 Score =   111 bits (278),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  588  IHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITV  767
            I    RRKT  V +G++ +GSEH I+IQ+MTTT T DV GTV Q+  + + G DIVR+TV
Sbjct  13   IQNAFRRKTLPVRIGDLFVGSEHSIKIQSMTTTATTDVDGTVRQICALQEWGCDIVRVTV  72

Query  768  QGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            QG +E  AC  IK+ L+Q+N +IPLVADIHF P  A+
Sbjct  73   QGLREVHACEHIKDRLIQQNISIPLVADIHFFPQAAI  109



>gb|AGT67768.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis]
Length=609

 Score =   111 bits (278),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  588  IHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITV  767
            I    RRKT  V +G++ +GSEH I+IQ+MTTT T DV GTV Q+  + + G DIVR+TV
Sbjct  13   IQNAFRRKTLPVRIGDLFVGSEHSIKIQSMTTTATTDVDGTVRQICALQEWGCDIVRVTV  72

Query  768  QGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            QG +E  AC  IK+ L+Q+N +IPLVADIHF P  A+
Sbjct  73   QGLREVHACEHIKDRLIQQNISIPLVADIHFFPQAAI  109



>ref|WP_015505856.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis]
 emb|CCP62092.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis L1/440/LN]
Length=602

 Score =   111 bits (278),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  588  IHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITV  767
            I    RRKT  V +G++ +GSEH I+IQ+MTTT T DV GTV Q+  + + G DIVR+TV
Sbjct  6    IQNAFRRKTLPVRIGDLFVGSEHSIKIQSMTTTATTDVDGTVRQICALQELGCDIVRVTV  65

Query  768  QGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            QG +E  AC  IK+ L+Q+N +IPLVADIHF P  A+
Sbjct  66   QGLREVHACEHIKDRLIQQNISIPLVADIHFFPQAAI  102



>gb|AGT69620.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis]
 gb|AGT72381.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis]
Length=609

 Score =   111 bits (278),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  588  IHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITV  767
            I    RRKT  V +G++ +GSEH I+IQ+MTTT T DV GTV Q+  + + G DIVR+TV
Sbjct  13   IQNAFRRKTLPVRIGDLFVGSEHSIKIQSMTTTATTDVDGTVRQICALQEWGCDIVRVTV  72

Query  768  QGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            QG +E  AC  IK+ L+Q+N +IPLVADIHF P  A+
Sbjct  73   QGLREVHACEHIKDRLIQQNISIPLVADIHFFPQAAI  109



>gb|ADI50733.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chlamydia 
trachomatis D-EC]
 gb|ADI51745.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chlamydia 
trachomatis D-LC]
Length=609

 Score =   111 bits (278),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  588  IHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITV  767
            I    RRKT  V +G++ +GSEH I+IQ+MTTT T DV GTV Q+  + + G DIVR+TV
Sbjct  13   IQNAFRRKTLPVRIGDLFVGSEHSIKIQSMTTTATTDVDGTVRQICALQEWGCDIVRVTV  72

Query  768  QGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            QG +E  AC  IK+ L+Q+N +IPLVADIHF P  A+
Sbjct  73   QGLREVHACEHIKDRLIQQNISIPLVADIHFFPQAAI  109



>ref|WP_009873027.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis]
 ref|YP_008655221.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chlamydia 
trachomatis F/SWFPminus]
 emb|CCE14111.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chlamydia 
trachomatis F/SW5]
 emb|CCP56731.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis F/SotonF3]
 gb|AGT64061.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis]
 gb|AGT64984.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis]
 gb|AGT68691.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis]
 emb|CDG42061.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chlamydia 
trachomatis F/SWFPminus]
Length=602

 Score =   111 bits (278),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  588  IHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITV  767
            I    RRKT  V +G++ +GSEH I+IQ+MTTT T DV GTV Q+  + + G DIVR+TV
Sbjct  6    IQNAFRRKTLPVRIGDLFVGSEHSIKIQSMTTTATTDVDGTVRQICALQEWGCDIVRVTV  65

Query  768  QGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            QG +E  AC  IK+ L+Q+N +IPLVADIHF P  A+
Sbjct  66   QGLREVHACEHIKDRLIQQNISIPLVADIHFFPQAAI  102



>ref|WP_009873526.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Chlamydia trachomatis]
 ref|YP_001654396.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis 434/Bu]
 sp|B0B9G5.1|ISPG_CHLT2 RecName: Full=4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(flavodoxin); AltName: Full=1-hydroxy-2-methyl-2-(E)-butenyl 
4-diphosphate synthase [Chlamydia trachomatis 434/Bu]
 emb|CAP03752.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chlamydia 
trachomatis 434/Bu]
 emb|CCP65653.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis L2/25667R]
 gb|AGJ65351.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis L2/434/Bu(f)]
 gb|AGJ64411.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis L2/434/Bu(i)]
 gb|AGR93472.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis RC-F/69]
 gb|AGR94396.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis RC-L2(s)/46]
 gb|AGR96274.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis RC-J/943]
 gb|AGR97201.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis RC-J/953]
 gb|AGR98121.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis RC-L2(s)/3]
 gb|AGR99990.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis RC-J(s)/122]
 gb|AGS00928.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis RC-J/966]
 gb|AGS02810.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis RC-J/971]
 gb|AGS03735.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
trachomatis RC-L2/55]
Length=602

 Score =   111 bits (278),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  588  IHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITV  767
            I    RRKT  V +G++ +GSEH I+IQ+MTTT T DV GTV Q+  + + G DIVR+TV
Sbjct  6    IQNAFRRKTLPVRIGDLFVGSEHSIKIQSMTTTATTDVDGTVRQICALQELGCDIVRVTV  65

Query  768  QGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            QG +E  AC  IK+ L+Q+N +IPLVADIHF P  A+
Sbjct  66   QGLREVHACEHIKDRLIQQNISIPLVADIHFFPQAAI  102



>gb|ETW56653.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Plasmodium 
falciparum Palo Alto/Uganda]
 gb|ETW61219.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Plasmodium 
falciparum CAMP/Malaysia]
Length=824

 Score =   112 bits (279),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = +3

Query  570  QKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGAD  749
            +KYCE   K  R  TR V++GNV +G  + I IQTM + DT++V   V Q+ K  D GAD
Sbjct  107  KKYCECTKKYKRLPTREVIIGNVKIGGNNKIAIQTMASCDTRNVEECVYQIRKCKDLGAD  166

Query  750  IVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            IVR+TVQG +EA A + IK  L+ +N NIPLVADIHF P +AL
Sbjct  167  IVRLTVQGVQEAQASYHIKEKLLSENVNIPLVADIHFNPKIAL  209



>ref|XP_009690697.1| 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Theileria 
orientalis strain Shintoku]
 dbj|BAM40396.1| 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Theileria 
orientalis strain Shintoku]
Length=834

 Score =   112 bits (279),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = +3

Query  573  KYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADI  752
            KYCE+++K VR  TR V +G V +G  +PI +QTMT+ DT DV  TV+Q++K+ + GAD+
Sbjct  91   KYCENVYKRVRFPTRCVKIGKVTIGGNNPIALQTMTSCDTNDVKETVDQILKVQEYGADM  150

Query  753  VRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VR+TVQ  +E  +   IK  L   N +IPL+ADIHF P VAL
Sbjct  151  VRLTVQSPREVKSSVLIKEKLTSLNCDIPLIADIHFNPKVAL  192



>gb|ETW28594.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Plasmodium 
falciparum FCH/4]
 gb|ETW49043.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Plasmodium 
falciparum MaliPS096_E11]
Length=821

 Score =   112 bits (279),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = +3

Query  570  QKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGAD  749
            +KYCE   K  R  TR V++GNV +G  + I IQTM + DT++V   V Q+ K  D GAD
Sbjct  107  KKYCECTKKYKRLPTREVVIGNVKIGGNNKIAIQTMASCDTRNVEECVYQIRKCKDLGAD  166

Query  750  IVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            IVR+TVQG +EA A + IK  L+ +N NIPLVADIHF P +AL
Sbjct  167  IVRLTVQGVQEAQASYHIKEKLLSENVNIPLVADIHFNPKIAL  209



>gb|ETW18403.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Plasmodium 
falciparum Vietnam Oak-Knoll (FVO)]
Length=823

 Score =   112 bits (279),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = +3

Query  570  QKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGAD  749
            +KYCE   K  R  TR V++GNV +G  + I IQTM + DT++V   V Q+ K  D GAD
Sbjct  107  KKYCECTKKYKRLPTREVVIGNVKIGGNNKIAIQTMASCDTRNVEECVYQIRKCKDLGAD  166

Query  750  IVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            IVR+TVQG +EA A + IK  L+ +N NIPLVADIHF P +AL
Sbjct  167  IVRLTVQGVQEAQASYHIKEKLLSENVNIPLVADIHFNPKIAL  209



>ref|XP_001347505.1| GcpE protein [Plasmodium falciparum 3D7]
 gb|AAK12103.1|AF323928_1 GcpE [Plasmodium falciparum]
 gb|AAN35418.1|AE014832_40 GcpE protein [Plasmodium falciparum 3D7]
 gb|ETW36319.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Plasmodium 
falciparum Tanzania (2000708)]
 gb|EUT85548.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Plasmodium 
falciparum Santa Lucia]
 gb|EWC85755.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Plasmodium 
falciparum NF54]
Length=824

 Score =   112 bits (279),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = +3

Query  570  QKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGAD  749
            +KYCE   K  R  TR V++GNV +G  + I IQTM + DT++V   V Q+ K  D GAD
Sbjct  107  KKYCECTKKYKRLPTREVVIGNVKIGGNNKIAIQTMASCDTRNVEECVYQIRKCKDLGAD  166

Query  750  IVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            IVR+TVQG +EA A + IK  L+ +N NIPLVADIHF P +AL
Sbjct  167  IVRLTVQGVQEAQASYHIKEKLLSENVNIPLVADIHFNPKIAL  209



>gb|EUR71974.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Plasmodium 
falciparum 7G8]
Length=825

 Score =   112 bits (279),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = +3

Query  570  QKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGAD  749
            +KYCE   K  R  TR V++GNV +G  + I IQTM + DT++V   V Q+ K  D GAD
Sbjct  107  KKYCECTKKYKRLPTREVVIGNVKIGGNNKIAIQTMASCDTRNVEECVYQIRKCKDLGAD  166

Query  750  IVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            IVR+TVQG +EA A + IK  L+ +N NIPLVADIHF P +AL
Sbjct  167  IVRLTVQGVQEAQASYHIKEKLLSENVNIPLVADIHFNPKIAL  209



>gb|ETW42409.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Plasmodium 
falciparum NF135/5.C10]
Length=825

 Score =   112 bits (279),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = +3

Query  570  QKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGAD  749
            +KYCE   K  R  TR V++GNV +G  + I IQTM + DT++V   V Q+ K  D GAD
Sbjct  107  KKYCECTKKYKRLPTREVVIGNVKIGGNNKIAIQTMASCDTRNVEECVYQIRKCKDLGAD  166

Query  750  IVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            IVR+TVQG +EA A + IK  L+ +N NIPLVADIHF P +AL
Sbjct  167  IVRLTVQGVQEAQASYHIKEKLLSENVNIPLVADIHFNPKIAL  209



>gb|EWC76322.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Plasmodium 
falciparum UGT5.1]
Length=823

 Score =   112 bits (279),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = +3

Query  570  QKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGAD  749
            +KYCE   K  R  TR V++GNV +G  + I IQTM + DT++V   V Q+ K  D GAD
Sbjct  107  KKYCECTKKYKRLPTREVVIGNVKIGGNNKIAIQTMASCDTRNVEECVYQIRKCKDLGAD  166

Query  750  IVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            IVR+TVQG +EA A + IK  L+ +N NIPLVADIHF P +AL
Sbjct  167  IVRLTVQGVQEAQASYHIKEKLLSENVNIPLVADIHFNPKIAL  209



>ref|WP_040496810.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Fulvivirga 
imtechensis]
Length=662

 Score =   110 bits (276),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 68/102 (67%), Gaps = 0/102 (0%)
 Frame = +3

Query  570  QKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGAD  749
            ++YC  +    RRKTR V +G+V LG EHP+R+Q+MTT DT D  G+VEQV+++ D G +
Sbjct  9    RQYCNSLTSYSRRKTRVVNIGDVPLGGEHPVRVQSMTTVDTMDTLGSVEQVIRMVDAGCE  68

Query  750  IVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
             VRIT    KEA     IK  L ++ Y +PL+ADIHF P+ A
Sbjct  69   YVRITAPSIKEAQNLENIKKELRKRGYQVPLIADIHFTPNAA  110



>emb|CCF74567.1| unnamed protein product [Babesia microti strain RI]
Length=709

 Score =   110 bits (276),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = +3

Query  573  KYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADI  752
            KYC+      R  TR V +GNV +G  +PI IQTMT++DT +V  TV+Q+++ AD GA I
Sbjct  35   KYCQSTVVYKRHPTRPVKIGNVTIGGNNPIAIQTMTSSDTANVPDTVDQILRCADAGASI  94

Query  753  VRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VR+TVQ  +EA A  EIK+ L+  N +IPLVADIHF P +AL
Sbjct  95   VRLTVQSPREAKASHEIKDRLLAMNCHIPLVADIHFNPKIAL  136



>gb|KJP85959.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Plasmodium 
fragile]
Length=812

 Score =   110 bits (276),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 71/103 (69%), Gaps = 0/103 (0%)
 Frame = +3

Query  570  QKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGAD  749
            +KYCE   +  R  TR V +GN+ +G  + I IQTMTT DTK+V   V+Q+ K  D GAD
Sbjct  99   KKYCECTKRYRRLPTREVTIGNIKIGGNNKIAIQTMTTCDTKNVDACVDQIKKCKDLGAD  158

Query  750  IVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            ++R+TVQG +EA+A + IK  L+ +N  IPLVADIHF P ++L
Sbjct  159  LIRLTVQGVQEAEASYHIKEKLLAQNITIPLVADIHFNPKISL  201



>ref|WP_021756575.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
pecorum]
 gb|AGW37904.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
pecorum PV3056/3]
Length=600

 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +3

Query  594  KTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITVQG  773
            + VRR T +V +G++ +GSEH I+IQ+MTTT T DVA T+EQ+  +A+ G +I R+TVQG
Sbjct  2    RPVRRPTCSVKIGHLYVGSEHSIKIQSMTTTPTADVAATLEQIYSLAECGCEIARVTVQG  61

Query  774  KKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
             KEA AC +IK+ L+ +   IPLVADIHF P  A+
Sbjct  62   IKEAQACEKIKDQLLSRGLRIPLVADIHFFPQAAM  96



>ref|WP_021757239.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
pecorum]
 gb|AGW38825.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
pecorum W73]
 gb|AGW39750.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
pecorum P787]
 gb|ETF37477.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
pecorum VR629]
 gb|ETF37985.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
pecorum DBDeUG]
 gb|ETF38253.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
pecorum MC/MarsBar]
 gb|ETF40219.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
pecorum IPTaLE]
Length=600

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = +3

Query  600  VRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITVQGKK  779
            VRR T +V +G++ +GSEH I+IQ+MTTT T DVA T+EQ+  +A+ G +I R+TVQG K
Sbjct  4    VRRPTCSVKIGHLYVGSEHSIKIQSMTTTPTADVAATLEQIYSLAECGCEIARVTVQGIK  63

Query  780  EADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EA AC +IK+ L+ +   IPLVADIHF P  A+
Sbjct  64   EAQACEKIKDQLLSRGLRIPLVADIHFFPQAAM  96



>gb|ABG59455.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Cytophaga 
hutchinsonii ATCC 33406]
Length=665

 Score =   109 bits (272),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 70/101 (69%), Gaps = 0/101 (0%)
 Frame = +3

Query  573  KYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADI  752
            KYC  + + VRRK+  V +G V +G ++PIR+Q+MTT DT D  G+VEQ++++ + G + 
Sbjct  12   KYCSSLTQYVRRKSSVVTIGKVPMGGDYPIRLQSMTTVDTMDTMGSVEQIIRMVEAGCEY  71

Query  753  VRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            VR+T    KEA     IKN L+++ Y++PLVADIHF P+ A
Sbjct  72   VRVTAPSVKEAQNLENIKNELLKRGYDVPLVADIHFTPNAA  112



>ref|WP_041932708.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Cytophaga 
hutchinsonii]
Length=657

 Score =   109 bits (272),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 70/101 (69%), Gaps = 0/101 (0%)
 Frame = +3

Query  573  KYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADI  752
            KYC  + + VRRK+  V +G V +G ++PIR+Q+MTT DT D  G+VEQ++++ + G + 
Sbjct  4    KYCSSLTQYVRRKSSVVTIGKVPMGGDYPIRLQSMTTVDTMDTMGSVEQIIRMVEAGCEY  63

Query  753  VRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            VR+T    KEA     IKN L+++ Y++PLVADIHF P+ A
Sbjct  64   VRVTAPSVKEAQNLENIKNELLKRGYDVPLVADIHFTPNAA  104



>emb|CDR94010.1| gcpE protein, putative [Babesia bigemina]
Length=780

 Score =   109 bits (272),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 96/168 (57%), Gaps = 12/168 (7%)
 Frame = +3

Query  375  GAVPVSFAGLKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSSVEVQPASEGSP  554
            G   ++F  L   +  +  G+++    ++     +SR S    +R ++S +  P S+   
Sbjct  24   GESALTFVSLTPSQKHVDGGRSLSSADIAGAADGRSRNS----LRAAASTKSAPFSDNV-  78

Query  555  LLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIA  734
                   YCE + + VR  TR V VGNV +G  +PI +QTMT++DT DV  TV+Q+++  
Sbjct  79   -------YCESVTERVRFPTRAVKVGNVTIGGGNPIALQTMTSSDTNDVEATVDQIIRCQ  131

Query  735  DTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
              GA +VR+TVQ  +EA A   IK  L+ K  +IPLVADIHF+P VAL
Sbjct  132  QYGAALVRLTVQSPREARASVIIKEKLLAKGCHIPLVADIHFSPKVAL  179



>ref|WP_020526939.1| hypothetical protein [Flexithrix dorotheae]
Length=665

 Score =   108 bits (271),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 69/101 (68%), Gaps = 0/101 (0%)
 Frame = +3

Query  573  KYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADI  752
            +YC  + +  RRKT  V +G++ +G+ HPIR+Q+MTT DT D  G+VEQ +++ D+G + 
Sbjct  11   QYCNSLTEYQRRKTIEVKIGDIPMGAHHPIRVQSMTTIDTMDTIGSVEQTIRMVDSGCEY  70

Query  753  VRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            VRIT    KEA     IKN L ++ YN+PLVADIHF P+ A
Sbjct  71   VRITAPSIKEAQNLENIKNELRKRGYNVPLVADIHFTPNAA  111



>ref|WP_044200698.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Flammeovirga 
sp. OC4]
Length=654

 Score =   108 bits (271),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = +3

Query  576  YCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIV  755
            YC++I+   RR+T  V +G V +G ++PIRIQ+MTT DT D  G++E+++++ ++G + V
Sbjct  11   YCDNINAYQRRQTVIVNIGGVPMGGDNPIRIQSMTTVDTMDTEGSIEEIIRMVESGCEYV  70

Query  756  RITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            RIT   KKEA+   EIK+ L  + YN+PLVADIHF P+ A
Sbjct  71   RITAPSKKEAENLQEIKDGLRARGYNVPLVADIHFTPNAA  110



>gb|EFB40485.1| hypothetical protein pah_c200o034 [Parachlamydia acanthamoebae 
str. Hall's coccus]
Length=632

 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  642  LGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQ  821
            +G  HPIRIQ+MTT+ T++V  TV+Q++++AD G +IVR+TVQG KEA+AC  IKN LV+
Sbjct  1    MGGNHPIRIQSMTTSSTRNVEATVDQIIRLADAGCEIVRMTVQGMKEAEACEHIKNDLVK  60

Query  822  KNYNIPLVADIHFAPSVAL  878
            K Y IPLVADIHF P  A+
Sbjct  61   KGYLIPLVADIHFYPPAAM  79



>ref|WP_017729932.1| hypothetical protein [Nafulsella turpanensis]
Length=665

 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 68/101 (67%), Gaps = 0/101 (0%)
 Frame = +3

Query  573  KYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADI  752
            +YC  +    RR+TR V +G+VALG  +PIR+Q+MTT DT D  G+VEQ +++A+ G + 
Sbjct  13   QYCNSLTAYSRRQTREVKIGDVALGGNNPIRVQSMTTVDTMDTKGSVEQTIRMAEAGCEY  72

Query  753  VRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            VRIT    KEA    EIK  L ++ Y +PL+ADIHF P+ A
Sbjct  73   VRITAPSLKEAQNLQEIKKELRKRGYTVPLIADIHFTPNAA  113



>ref|WP_013712790.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
pecorum]
 gb|AEB41712.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydophila 
pecorum E58]
Length=600

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = +3

Query  600  VRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITVQGKK  779
            VRR T +V +G++ +GS+H I+IQ+MTTT T DVA T+EQ+  +A+ G +I R+TVQG K
Sbjct  4    VRRPTCSVKIGHLYVGSKHSIKIQSMTTTPTADVAATLEQIYSLAECGCEIARVTVQGIK  63

Query  780  EADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            EA AC +IK+ L+ +   IPLVADIHF P  A+
Sbjct  64   EAQACEKIKDQLLSRGLRIPLVADIHFFPQAAM  96



>gb|KIY95488.1| hypothetical protein MNEG_12472 [Monoraphidium neglectum]
Length=116

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +3

Query  675  MTTTDTKDVAGTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADI  854
            MTTTDT+DVA TVEQV + AD GADIVRITVQG++EA+AC +I+  L +  Y+ PLVADI
Sbjct  1    MTTTDTRDVAKTVEQVKRCADAGADIVRITVQGRREAEACMKIREQLFKDGYDTPLVADI  60

Query  855  HFAPSVAL  878
            HF P+VA+
Sbjct  61   HFQPAVAM  68



>ref|WP_015030917.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Emticicia 
oligotrophica]
 gb|AFK05229.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Emticicia 
oligotrophica DSM 17448]
Length=666

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = +3

Query  555  LLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIA  734
            LL  ++KYC+ +    RR+T  V +G++ LGS++PIR+Q+MTT DT D  G+VEQ +++ 
Sbjct  2    LLEIQKKYCKSLTAYSRRQTNQVRIGDLYLGSDYPIRVQSMTTVDTMDTIGSVEQSIRMI  61

Query  735  DTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            ++G ++VRIT    KEA     IKN L ++ Y  PLVADIHF P+ A
Sbjct  62   ESGCELVRITAPSVKEAQNLENIKNELRKRGYQTPLVADIHFTPNAA  108



>ref|WP_035391966.1| MULTISPECIES: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Chlamydia]
Length=606

 Score =   107 bits (266),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  588  IHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITV  767
            +++ +RR T +V +GN+ +GSEH I+IQ+MTTT T DV  T +Q+  +A+ G DIVR+TV
Sbjct  7    VNQLLRRNTHSVRIGNLYVGSEHTIKIQSMTTTPTADVEATTQQICSLAECGCDIVRVTV  66

Query  768  QGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            QG KEA AC  IK  L+    +IP++ADIHF P  A+
Sbjct  67   QGIKEAQACEHIKERLLSIGVDIPIIADIHFFPQAAM  103



>ref|XP_008625669.1| (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase [Plasmodium 
vinckei vinckei]
 gb|KEG01214.1| (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase [Plasmodium 
vinckei vinckei]
Length=826

 Score =   107 bits (267),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 77/118 (65%), Gaps = 0/118 (0%)
 Frame = +3

Query  525  EVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVA  704
            +++   +   L+   +KYCE   +  R  T  V +GNV +G  + I IQTMT+ DT++V 
Sbjct  100  QIKTDEDKYNLIKDIKKYCECTKRYKRLPTHEVQIGNVKIGGNNRIAIQTMTSCDTRNVE  159

Query  705  GTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
              V+Q+ K  D GAD+VR+TVQG +E +A + IK++L+ +N  IPLVADIHF P +AL
Sbjct  160  ECVDQIKKCKDLGADLVRLTVQGVQEVEASYRIKDTLLSQNITIPLVADIHFNPKIAL  217



>ref|XP_002261743.1| GcpE protein [Plasmodium knowlesi strain H]
 emb|CAQ38906.1| GcpE protein, putative [Plasmodium knowlesi strain H]
Length=813

 Score =   107 bits (267),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = +3

Query  570  QKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGAD  749
            +KYCE   K  R  TR V +GN+ +G  + I IQTMTT DTK+V   V Q+ K  + GAD
Sbjct  96   KKYCECTKKYRRLPTREVTIGNIKIGGNNKIAIQTMTTCDTKNVDECVNQIKKCKELGAD  155

Query  750  IVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            ++R+TVQG +EA+A + IK  L+ +N  IPLVADIHF P +++
Sbjct  156  LIRLTVQGVQEAEASYYIKEKLLAQNITIPLVADIHFNPKISM  198



>ref|WP_045640961.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Flavobacteriales 
bacterium BRH_c54]
 gb|KJS04276.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Flavobacteriales 
bacterium BRH_c54]
Length=642

 Score =   106 bits (264),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 67/100 (67%), Gaps = 0/100 (0%)
 Frame = +3

Query  576  YCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIV  755
            YC ++    R KT+ VMVGN+ +G  +PIRIQ+MTTTDT +   TV Q +++ + G +IV
Sbjct  5    YCTNLTSYKRFKTKEVMVGNIGIGGNNPIRIQSMTTTDTMNTEATVAQAIRMINAGCEIV  64

Query  756  RITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            RIT   KKEA+    IK  L ++ YN PLVADIHF P+ A
Sbjct  65   RITAPSKKEAENLANIKAELKKRGYNTPLVADIHFTPNAA  104



>ref|WP_030001802.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Marinimicrobia 
bacterium SCGC AAA003-E22]
Length=649

 Score =   106 bits (264),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 67/102 (66%), Gaps = 0/102 (0%)
 Frame = +3

Query  573  KYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADI  752
            KYCE + K  R KTR V +G+V LG + PIR+Q+MTTTD+ D   TVEQ +++ + G + 
Sbjct  6    KYCESLIKYQRLKTRVVHIGDVPLGGDFPIRVQSMTTTDSMDTKATVEQSIRMIEAGCEY  65

Query  753  VRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VRIT    KEA    EIK  L ++ Y  PL+ADIHF P+ AL
Sbjct  66   VRITAPSIKEAQNLAEIKKELRKQGYTTPLIADIHFTPNAAL  107



>ref|WP_010526318.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Thermophagus 
xiamenensis]
Length=626

 Score =   105 bits (262),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 69/104 (66%), Gaps = 2/104 (2%)
 Frame = +3

Query  570  QKY--CEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTG  743
            QKY  C+   +  R KT  V VGNV +G + PIR+Q+MTTT+T D A TVEQ +KIA  G
Sbjct  4    QKYHFCQSYFQYCRNKTAPVKVGNVTIGGDSPIRVQSMTTTNTLDTAATVEQSLKIARAG  63

Query  744  ADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
             ++VRIT QG++EA     IK SL +    +PLVAD+HF PS A
Sbjct  64   GELVRITTQGRREALNLKSIKESLTRLGCEVPLVADVHFNPSAA  107



>gb|ETB58995.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Plasmodium 
yoelii 17X]
Length=826

 Score =   105 bits (263),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = +3

Query  570  QKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGAD  749
            +KYCE   +  R  TR V +GN+ +G  + I IQTMT+ DT++V   V Q+ +  D GAD
Sbjct  115  KKYCECTKRYKRLPTREVKIGNIKIGGNNRISIQTMTSCDTRNVEECVNQIKRCKDLGAD  174

Query  750  IVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            +VR+TVQG +E +A + IK+ L+ +N  IPLVADIHF P +AL
Sbjct  175  LVRLTVQGVQEVEASYRIKDMLLSQNITIPLVADIHFNPKIAL  217



>ref|XP_729456.1| (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Plasmodium 
yoelii yoelii 17XNL]
 gb|EAA21021.1| GcpE [Plasmodium yoelii yoelii]
 emb|CDU16669.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Plasmodium yoelii]
 emb|CDZ11200.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Plasmodium yoelii]
Length=826

 Score =   105 bits (263),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = +3

Query  570  QKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGAD  749
            +KYCE   +  R  TR V +GN+ +G  + I IQTMT+ DT++V   V Q+ +  D GAD
Sbjct  115  KKYCECTKRYKRLPTREVKIGNIKIGGNNRISIQTMTSCDTRNVEECVNQIKRCKDLGAD  174

Query  750  IVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            +VR+TVQG +E +A + IK+ L+ +N  IPLVADIHF P +AL
Sbjct  175  LVRLTVQGVQEVEASYRIKDMLLSQNITIPLVADIHFNPKIAL  217



>ref|XP_952048.1| 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Theileria 
annulata strain Ankara]
 emb|CAI74316.1| 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase, putative 
[Theileria annulata]
Length=808

 Score =   105 bits (262),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 91/159 (57%), Gaps = 19/159 (12%)
 Frame = +3

Query  402  LKGRENGLGFGKNMDFVRVSDMQRVKSRRSKVCVIRNSSSVEVQPASEGSPLLVPRQKYC  581
            LK R NG  FG+N+ F+   D ++           RNS   + +   +G       + YC
Sbjct  26   LKDRLNG-QFGRNVTFIANFDSKK-----------RNSKLFD-KTGEDGD------KTYC  66

Query  582  EHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRI  761
            E+++K  R  TR V +G V +G  +PI IQTMT+ DT DV  TV+Q++K+ + G+D+VRI
Sbjct  67   ENVYKRERFPTRCVKIGKVTIGGNNPIAIQTMTSCDTNDVQQTVDQILKVQEYGSDMVRI  126

Query  762  TVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            TVQ  +EA +   IK  L   N +IPL+AD HF   VA+
Sbjct  127  TVQSPREAKSSELIKEKLSSLNCDIPLIADTHFNAKVAM  165



>ref|WP_044117870.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Alkaliflexus 
imshenetskii]
Length=625

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 67/100 (67%), Gaps = 0/100 (0%)
 Frame = +3

Query  576  YCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIV  755
            YC+ + +  R  T+ V VG+V LGS HP+R+Q+MTTT+T D   T  Q + I + G +IV
Sbjct  9    YCKSLFRYRRNATQEVRVGSVLLGSGHPVRLQSMTTTNTLDAEATAAQCISIFEAGGEIV  68

Query  756  RITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            RIT QG++EA    EIK  L QK Y+ P+VADIHF P+ A
Sbjct  69   RITTQGRREAHNLEEIKRILQQKGYHFPIVADIHFNPNAA  108



>ref|WP_013665481.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Sphingobacterium 
sp. 21]
 gb|ADZ78759.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Sphingobacterium 
sp. 21]
Length=670

 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 65/101 (64%), Gaps = 0/101 (0%)
 Frame = +3

Query  573  KYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADI  752
            KYCE +    R  TR V +G+V +G  HPIRIQ+MTT DT D  G+VEQ +++ + G + 
Sbjct  12   KYCESLTHYKRWLTREVQIGDVPMGGTHPIRIQSMTTVDTMDTKGSVEQTLRMVEAGCEY  71

Query  753  VRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            VRIT    KEA    EIK  L+++   +PLVADIHF P+ A
Sbjct  72   VRITAPSIKEAQNLAEIKKELLKRGCKVPLVADIHFTPNAA  112



>ref|WP_009036471.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Indibacter 
alkaliphilus]
 gb|EOZ95046.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Indibacter 
alkaliphilus LW1]
Length=659

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = +3

Query  555  LLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIA  734
            L++ + KYC+ +    RRKT  V VG V +G ++PI +Q+MTT DT D  G++EQ +++ 
Sbjct  5    LMLDKNKYCDSLTGYSRRKTIPVKVGEVIIGGDNPIVVQSMTTVDTMDTQGSIEQCVRMI  64

Query  735  DTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            ++G  ++RIT    KEA+   EIK  L++K Y+ PLVADIHF P+ A
Sbjct  65   ESGCQLIRITAPSIKEAENLREIKRGLLEKGYSTPLVADIHFTPNAA  111



>gb|ACT64770.1| (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Artemisia 
annua]
Length=617

 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +3

Query  723  MKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            M+IAD GADIVRITVQGK+EADACFEIKN+LVQKNYNIPLVADIHFAPSVAL
Sbjct  1    MQIADRGADIVRITVQGKREADACFEIKNTLVQKNYNIPLVADIHFAPSVAL  52



>ref|XP_008817266.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Plasmodium 
inui San Antonio 1]
 gb|EUD66257.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Plasmodium 
inui San Antonio 1]
Length=814

 Score =   104 bits (259),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = +3

Query  570  QKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGAD  749
            +KYCE   +  R  TR V +GN+ +G  + I IQTMT+ DT++V   V Q+ K  + GAD
Sbjct  97   KKYCECTKRYRRLPTREVTIGNIKIGGNNKIAIQTMTSCDTRNVDECVYQIKKCKELGAD  156

Query  750  IVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            ++R+TVQG +EA+A + IK  L+ +N  IPLVADIHF P ++L
Sbjct  157  LIRLTVQGVQEAEASYRIKEKLLAENITIPLVADIHFNPKISL  199



>emb|CDS45871.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Plasmodium chabaudi chabaudi]
Length=826

 Score =   103 bits (258),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 75/118 (64%), Gaps = 0/118 (0%)
 Frame = +3

Query  525  EVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVA  704
            +++   +   L+   +KYCE   +  R  T  V +GNV +G  + I IQTMT+ DT++V 
Sbjct  100  QIKTDEDKYNLIKDIKKYCECTKRYKRLPTHEVQIGNVKIGGNNKIAIQTMTSCDTRNVE  159

Query  705  GTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
              V Q+ K  + GAD+VR+TVQG +E +A + IK+ L+ +N  IPLVADIHF P +AL
Sbjct  160  ECVNQIKKCKELGADLVRLTVQGVQEVEASYRIKDILLSQNITIPLVADIHFNPKIAL  217



>ref|XP_743307.1| GcpE protein [Plasmodium chabaudi chabaudi]
 emb|CAH81161.1| GcpE protein, putative [Plasmodium chabaudi chabaudi]
Length=813

 Score =   103 bits (258),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 75/118 (64%), Gaps = 0/118 (0%)
 Frame = +3

Query  525  EVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVA  704
            +++   +   L+   +KYCE   +  R  T  V +GNV +G  + I IQTMT+ DT++V 
Sbjct  87   QIKTDEDXYNLIKDIKKYCECTKRYKRLPTHEVQIGNVKIGGNNKIAIQTMTSCDTRNVE  146

Query  705  GTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
              V Q+ K  + GAD+VR+TVQG +E +A + IK+ L+ +N  IPLVADIHF P +AL
Sbjct  147  ECVNQIKKCKELGADLVRLTVQGVQEVEASYRIKDILLSQNITIPLVADIHFNPKIAL  204



>ref|WP_013407896.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Leadbetterella 
byssophila]
 gb|ADQ16846.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leadbetterella 
byssophila DSM 17132]
Length=639

 Score =   103 bits (256),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 66/100 (66%), Gaps = 0/100 (0%)
 Frame = +3

Query  576  YCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIV  755
            YC  + +  RR T+ V +G++ LGSE+PIRIQ+MTT DT D AG+V Q +++ ++G ++V
Sbjct  4    YCNSLTEYSRRITQQVKIGDLGLGSEYPIRIQSMTTVDTMDTAGSVAQCIRMIESGCELV  63

Query  756  RITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            RIT    KEA     IK  L    YN PLVADIHF P+ A
Sbjct  64   RITAPSVKEAQNLENIKRELRAAGYNTPLVADIHFTPNAA  103



>ref|WP_025278548.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Barnesiella 
viscericola]
 gb|AHF12588.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Barnesiella 
viscericola DSM 18177]
Length=603

 Score =   102 bits (255),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = +3

Query  603  RRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITVQGKKE  782
            RRK+  V +G+  LG E+PIRIQ+MT T T D  G+VEQ ++I + GAD VR+T QG +E
Sbjct  8    RRKSSVVHIGDTPLGGEYPIRIQSMTNTSTLDTPGSVEQCIRIIEAGADYVRLTAQGVRE  67

Query  783  ADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            A+   EIK  L+ + Y+ PL+ADIHF P  A
Sbjct  68   AENLAEIKKGLLARGYHTPLIADIHFNPKAA  98



>ref|WP_039866655.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Pedobacter 
sp. BAL39]
Length=653

 Score =   103 bits (256),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 65/100 (65%), Gaps = 0/100 (0%)
 Frame = +3

Query  576  YCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIV  755
            YC  + K  R  TR V +G+V +G  +PIRIQ+MTTTDT +   TVEQ +++ ++G + V
Sbjct  14   YCNSLTKYSRFLTREVTIGDVPMGGLNPIRIQSMTTTDTMNTIATVEQTIRMVESGCEYV  73

Query  756  RITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            RIT    KEAD    IK  L  + YN+PLVADIHF P+ A
Sbjct  74   RITAPSMKEADNLANIKKELRYRGYNVPLVADIHFTPNAA  113



>ref|WP_009185621.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Cecembia 
lonarensis]
 gb|EKB48817.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Cecembia 
lonarensis LW9]
Length=659

 Score =   103 bits (256),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 68/106 (64%), Gaps = 0/106 (0%)
 Frame = +3

Query  558  LVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIAD  737
            L+ + +YC  +    RRKT  V VG+V +G + PI +Q+MTT DT D  G+VEQ +++ D
Sbjct  6    LLEKIRYCNSLTSYSRRKTIPVKVGDVIIGGDSPIVVQSMTTVDTMDTIGSVEQCIRMID  65

Query  738  TGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
             G  ++RIT    KEA+   EIK  L+ + YN PLVADIHF P+ A
Sbjct  66   AGCQLIRITAPSIKEAENLREIKKELLNRGYNTPLVADIHFTPNAA  111



>ref|WP_012925967.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Spirosoma 
linguale]
 gb|ADB37416.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Spirosoma 
linguale DSM 74]
Length=678

 Score =   103 bits (256),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 70/110 (64%), Gaps = 5/110 (5%)
 Frame = +3

Query  546  GSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVM  725
            GSP+L     Y   + + VRRKT TV +G+V +GS++PIR+Q+MTT DT D  G+VEQ +
Sbjct  21   GSPVL-----YTPSLTQYVRRKTSTVTIGDVPMGSDYPIRVQSMTTVDTMDTKGSVEQTI  75

Query  726  KIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            ++ + G + VRIT    KEA     I+  L  + Y  PLVADIHF P+ A
Sbjct  76   RMIEAGCEYVRITAPSVKEAQNLENIRKELRARGYTTPLVADIHFTPNAA  125



>gb|EHQ25285.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Mucilaginibacter 
paludis DSM 18603]
Length=693

 Score =   103 bits (256),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 65/100 (65%), Gaps = 0/100 (0%)
 Frame = +3

Query  576  YCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIV  755
            YC  + +  R  TR V +G+V +G  +PIRIQ+MTTT+T D  GTVEQ +++ D G + V
Sbjct  13   YCNSLTEYSRFVTREVTIGDVPMGGNNPIRIQSMTTTNTMDTLGTVEQSIRMVDAGCEYV  72

Query  756  RITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            RIT    KEA    EIK  L ++ Y +PLVADIHF P+ A
Sbjct  73   RITAPSIKEAQNLAEIKKELRKRGYTVPLVADIHFTPNAA  112



>ref|WP_040627083.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Mucilaginibacter 
paludis]
Length=685

 Score =   102 bits (255),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 65/100 (65%), Gaps = 0/100 (0%)
 Frame = +3

Query  576  YCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIV  755
            YC  + +  R  TR V +G+V +G  +PIRIQ+MTTT+T D  GTVEQ +++ D G + V
Sbjct  5    YCNSLTEYSRFVTREVTIGDVPMGGNNPIRIQSMTTTNTMDTLGTVEQSIRMVDAGCEYV  64

Query  756  RITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            RIT    KEA    EIK  L ++ Y +PLVADIHF P+ A
Sbjct  65   RITAPSIKEAQNLAEIKKELRKRGYTVPLVADIHFTPNAA  104



>ref|XP_680310.1| GcpE protein [Plasmodium berghei strain ANKA]
 emb|CAH98435.1| GcpE protein, putative [Plasmodium berghei]
 emb|CDS45196.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Plasmodium berghei ANKA]
Length=819

 Score =   103 bits (256),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 69/103 (67%), Gaps = 0/103 (0%)
 Frame = +3

Query  570  QKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGAD  749
            +KYCE   +  R  TR V +GN+ +G  + I IQTMT+ DT++V   V Q+ +    GAD
Sbjct  108  KKYCECTKRYKRLPTREVKIGNIKIGGNNKISIQTMTSCDTRNVEECVNQIKRCKGLGAD  167

Query  750  IVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            +VR+TVQG +E +A + IK+ L+ +N  IPLVADIHF P +AL
Sbjct  168  LVRLTVQGVQEVEASYRIKDMLLSQNITIPLVADIHFNPKIAL  210



>gb|EUD69889.1| (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase [Plasmodium 
vinckei petteri]
Length=807

 Score =   103 bits (256),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 75/118 (64%), Gaps = 0/118 (0%)
 Frame = +3

Query  525  EVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVA  704
            +++   +   L+   +KYCE   +  R  T  V +GNV +G  + I IQTMT+ DT++V 
Sbjct  81   QIKTDEDKYNLIKDIKKYCECTKRYKRLPTHEVQIGNVKIGGNNKIAIQTMTSCDTRNVE  140

Query  705  GTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
              V Q+ K  + GAD+VR+TVQG +E +A + IK+ L+ +N  IPLVADIHF P +AL
Sbjct  141  ECVNQIKKCKELGADLVRLTVQGVQEIEASYRIKDILLSQNITIPLVADIHFNPKIAL  198



>ref|WP_010422549.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Anaerophaga 
thermohalophila]
Length=626

 Score =   102 bits (255),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 65/100 (65%), Gaps = 0/100 (0%)
 Frame = +3

Query  576  YCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIV  755
            YC    + +R KT  V  GN+ +G + PIRIQ+MTTT+T +   T EQ  +IAD G ++V
Sbjct  8    YCNSFFQYLRNKTVPVKAGNITIGGDSPIRIQSMTTTNTLNTRETSEQTKRIADAGGELV  67

Query  756  RITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            RIT QG++EA     IK +L    Y+IPLVAD+HF PS A
Sbjct  68   RITTQGRREALNLKNIKEALQSAGYDIPLVADVHFNPSAA  107



>ref|WP_014020335.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Cyclobacterium 
marinum]
 gb|AEL26042.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Cyclobacterium 
marinum DSM 745]
Length=663

 Score =   102 bits (255),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 69/102 (68%), Gaps = 0/102 (0%)
 Frame = +3

Query  570  QKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGAD  749
            Q+YC  +    RRKT  V +G++ +G ++PI +Q+MTT DT D  G++EQ +++ D+G +
Sbjct  10   QQYCNSLTNYSRRKTIPVRIGDITIGGDNPIVVQSMTTVDTMDTQGSIEQCIRMIDSGCE  69

Query  750  IVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            +VRIT    KEA+    IK+ L ++ YN PLVADIHF P+ A
Sbjct  70   LVRITAPSIKEAENLQAIKDGLRKRGYNTPLVADIHFTPNAA  111



>ref|WP_045753255.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Sphingobacterium 
sp. PM2-P1-29]
 emb|CDS92835.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Sphingobacterium 
sp. PM2-P1-29]
Length=670

 Score =   102 bits (255),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 66/109 (61%), Gaps = 0/109 (0%)
 Frame = +3

Query  549  SPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMK  728
            S LL     YC       R KTR V +G+V +G ++PIRIQ+MTT DT D  G+VEQ +K
Sbjct  4    SKLLTLPDIYCNSQTTYSRWKTREVQIGDVPMGGDNPIRIQSMTTIDTMDTLGSVEQTIK  63

Query  729  IADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            + D G + VRIT    KEA+    IK  L  + Y +PLVADIHF P+ A
Sbjct  64   MVDAGCEYVRITAPSIKEANNLANIKKELRLRGYQVPLVADIHFTPNAA  112



>ref|WP_026464184.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Adhaeribacter 
aquaticus]
Length=658

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 67/102 (66%), Gaps = 0/102 (0%)
 Frame = +3

Query  570  QKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGAD  749
            + YC  + + +RR TR V +G + +G  +PIR+Q+MTT DT D  G+VEQ +++ + G +
Sbjct  3    KNYCPSLTQYIRRTTREVKIGEIPVGGNNPIRVQSMTTVDTMDTLGSVEQTIRMVEAGCE  62

Query  750  IVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
             VRIT    KEA+    IK  L ++ YN+PL+ADIHF P+ A
Sbjct  63   YVRITAPSVKEAENLRNIKAELRKRGYNVPLIADIHFTPNAA  104



>ref|WP_009132918.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Alistipes 
indistinctus]
 gb|EHB93341.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Alistipes 
indistinctus YIT 12060]
Length=589

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 66/103 (64%), Gaps = 0/103 (0%)
 Frame = +3

Query  570  QKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGAD  749
            +KYC+ +    R  TR V VG+V +G  +P+RIQ+MT TDT D   +  QV +IA  G +
Sbjct  2    RKYCDSLTAYARAATRPVAVGSVVIGGGNPVRIQSMTNTDTNDTEASAAQVRRIAGAGGE  61

Query  750  IVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            IVR+T QG++EA     I+  L ++  ++PLVADIHF P  AL
Sbjct  62   IVRLTAQGRREAANLAAIRARLREEGCSVPLVADIHFVPEAAL  104



>ref|WP_044222153.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Flammeovirga 
pacifica]
Length=654

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 69/103 (67%), Gaps = 0/103 (0%)
 Frame = +3

Query  567  RQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGA  746
            +  YC +I+   RR+T  V +G + +G  +PIR+Q+MTT DT D  G++E+V+++ D+G 
Sbjct  3    KHWYCNNINAYNRRQTVEVNIGGIPMGGNNPIRVQSMTTVDTMDTEGSIEEVIRMVDSGC  62

Query  747  DIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            + VRIT    KEA     IK+ L ++ Y++PLVADIHF P+ A
Sbjct  63   EYVRITAPSIKEAQNLKAIKDGLKERGYDVPLVADIHFTPNAA  105



>ref|WP_020888417.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Cyclobacterium 
qasimii]
 gb|EPR65220.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Cyclobacterium 
qasimii M12-11B]
Length=663

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 68/102 (67%), Gaps = 0/102 (0%)
 Frame = +3

Query  570  QKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGAD  749
            Q+YC  +    RRKT  V +G++ +G ++PI +Q+MTT DT D  G++EQ +++ D+G +
Sbjct  10   QQYCNSLTNYSRRKTIPVRIGDIIIGGDNPIVVQSMTTVDTMDTLGSIEQCIRMIDSGCE  69

Query  750  IVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            +VRIT    KEA+    IK  L ++ YN PLVADIHF P+ A
Sbjct  70   LVRITAPSIKEAENLRHIKEGLKKRGYNTPLVADIHFTPNAA  111



>ref|WP_008863068.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Barnesiella 
intestinihominis]
 gb|EJZ62014.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Barnesiella 
intestinihominis YIT 11860]
Length=603

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = +3

Query  603  RRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITVQGKKE  782
            RRK+  V +GN  LG E+P+RIQ+MT T T D A +V+Q ++I   GAD VR+T QG +E
Sbjct  8    RRKSSIVQIGNTPLGGEYPVRIQSMTNTSTLDTAASVDQCIRIIQAGADYVRLTAQGVRE  67

Query  783  ADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            A+   EIK  L+ + Y  PLVADIHF P  A
Sbjct  68   AENLGEIKRELIARGYTTPLVADIHFNPKAA  98



>gb|EQB83053.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Sphingobacterium 
sp. IITKGP-BTPF85]
Length=670

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 67/109 (61%), Gaps = 0/109 (0%)
 Frame = +3

Query  549  SPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMK  728
            S LL     YC       R KTR V +G+V +G ++PIRIQ+MTT DT D  G+VEQ ++
Sbjct  4    SKLLTLPGIYCNSQTTYSRWKTREVQIGDVPMGGDNPIRIQSMTTIDTMDTMGSVEQTIR  63

Query  729  IADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            + D G + VRIT    KEA+    IK  L  + Y++PLVADIHF P+ A
Sbjct  64   MVDAGCEYVRITAPSIKEANNLANIKQELRARGYHVPLVADIHFTPNAA  112



>ref|XP_001610211.1| gcpE protein [Babesia bovis]
 gb|EDO06643.1| gcpE protein [Babesia bovis]
Length=772

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 72/116 (62%), Gaps = 6/116 (5%)
 Frame = +3

Query  549  SPLLVPR------QKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGT  710
            +PL +P         YCE + + +R  TR V +GNV +G   PI +QTMT++DT D+  T
Sbjct  70   APLCIPNCNTASNNVYCESVTERIRFPTREVRIGNVTIGGNRPIALQTMTSSDTYDIDAT  129

Query  711  VEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            V+Q++     GA +VR+ VQ  +EA A   IK  L+ +  N+PLVADIH++P VAL
Sbjct  130  VKQIITCHQYGASLVRLAVQSPREAKASAVIKEKLLSQGCNVPLVADIHYSPKVAL  185



>ref|WP_021891692.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Bacteroides 
sp. CAG:20]
 emb|CCX94040.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Bacteroides 
sp. CAG:20]
Length=603

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = +3

Query  603  RRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITVQGKKE  782
            RRK+  V +GN  LG E+P+RIQ+MT T T D A +V+Q ++I   GAD VR+T QG +E
Sbjct  8    RRKSSIVQIGNTPLGGEYPVRIQSMTNTSTLDTAASVDQCIRIIQAGADYVRLTAQGVRE  67

Query  783  ADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            A+   EIK  L+ + Y  PLVADIHF P  A
Sbjct  68   AENLGEIKRELIARGYTTPLVADIHFNPKAA  98



>ref|WP_037525485.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Sphingobacterium 
sp. IITKGP-BTPF85]
Length=677

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 67/109 (61%), Gaps = 0/109 (0%)
 Frame = +3

Query  549  SPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMK  728
            S LL     YC       R KTR V +G+V +G ++PIRIQ+MTT DT D  G+VEQ ++
Sbjct  11   SKLLTLPGIYCNSQTTYSRWKTREVQIGDVPMGGDNPIRIQSMTTIDTMDTMGSVEQTIR  70

Query  729  IADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            + D G + VRIT    KEA+    IK  L  + Y++PLVADIHF P+ A
Sbjct  71   MVDAGCEYVRITAPSIKEANNLANIKQELRARGYHVPLVADIHFTPNAA  119



>ref|WP_041873454.1| hypothetical protein, partial [Verrucomicrobia bacterium SCGC 
AAA164-O14]
Length=209

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 68/102 (67%), Gaps = 0/102 (0%)
 Frame = +3

Query  573  KYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADI  752
            +YC+++    RR++R V VGNV +G  +P+ +Q+M T+DT+D    V++V+++AD G ++
Sbjct  6    RYCKNLFNYSRRESREVTVGNVKVGGGNPVVVQSMITSDTRDTHACVKEVLQLADAGCEV  65

Query  753  VRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VRIT Q +K A+    I+N +   N  +PLVADIHF P  A 
Sbjct  66   VRITAQTRKYAENLENIRNGVRAANCGVPLVADIHFKPDAAF  107



>ref|WP_008627688.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Mariniradius 
saccharolyticus]
 gb|EMS33361.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Mariniradius 
saccharolyticus AK6]
Length=663

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 71/106 (67%), Gaps = 0/106 (0%)
 Frame = +3

Query  558  LVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIAD  737
            L+ + KYC+ +    RRKT  V VG+V +G ++PI +Q+MTT DT D  G+VEQ +++ +
Sbjct  6    LLEKIKYCDSLTSYSRRKTIPVRVGDVIIGGDNPIVVQSMTTVDTMDTQGSVEQCIRMIE  65

Query  738  TGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            +G  ++RIT    KEA+    I+N L ++ YN PLVADIHF P+ A
Sbjct  66   SGCQLIRITAPSIKEAENLQNIRNELRKRGYNTPLVADIHFTPNAA  111



>ref|XP_001608540.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (GcpE) [Plasmodium 
vivax Sal-1]
 gb|EDL42516.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (GcpE), 
putative [Plasmodium vivax]
Length=820

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 69/103 (67%), Gaps = 0/103 (0%)
 Frame = +3

Query  570  QKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGAD  749
            +KYCE   +  R  TR V + N+ +G  + I IQTMTT DT++V   V Q+ K  + GAD
Sbjct  86   KKYCECTKRYRRLPTREVPIDNIKIGGSNKIAIQTMTTCDTRNVDECVYQIKKCKELGAD  145

Query  750  IVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            ++R+TVQG +EA+A + IK  L+ +N  IPLVADIHF P ++L
Sbjct  146  LIRLTVQGVQEAEASYHIKEKLLAQNITIPLVADIHFNPKISL  188



>ref|XP_765233.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Theileria 
parva strain Muguga]
 gb|EAN32950.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Theileria parva]
Length=801

 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 67/101 (66%), Gaps = 0/101 (0%)
 Frame = +3

Query  576  YCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIV  755
            YCE+++K  R  TR V +G V +G  HPI IQTMT+ DT DV  TV+Q++K+ + G+D+V
Sbjct  65   YCENVYKRERFPTRCVKIGKVTIGGNHPIAIQTMTSCDTNDVQQTVDQILKVQEYGSDMV  124

Query  756  RITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            RITVQ  +E  +   IK  L   N +IPL+AD HF   VA+
Sbjct  125  RITVQSPREVKSSELIKEKLNSLNCDIPLIADTHFNAKVAM  165



>ref|WP_007658562.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Pontibacter 
sp. BAB1700]
 gb|EJF08957.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Pontibacter 
sp. BAB1700]
Length=657

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 67/100 (67%), Gaps = 0/100 (0%)
 Frame = +3

Query  576  YCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIV  755
            YC  + +  RR+T  V +G+V +G+ HPIR+Q+MTT DT D  G+VEQ +++ + G + +
Sbjct  5    YCPSLTEYKRRETIEVHIGDVPMGAHHPIRVQSMTTVDTMDTLGSVEQCIRMIEAGCEYI  64

Query  756  RITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            RIT    KEA+    IK+ L ++ YN PLVADIHF P+ A
Sbjct  65   RITAPSIKEAENLRNIKDELRRRGYNTPLVADIHFTPNAA  104



>ref|WP_038700675.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Sphingobacterium 
sp. ML3W]
 gb|AIM38576.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Sphingobacterium 
sp. ML3W]
Length=670

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 67/109 (61%), Gaps = 0/109 (0%)
 Frame = +3

Query  549  SPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMK  728
            S LL     YC       R KTR V +G+V +G ++PIRIQ+MTT DT D  G+VEQ ++
Sbjct  4    SKLLTLPGIYCNSQTTYSRWKTREVQIGDVPMGGDNPIRIQSMTTIDTMDTMGSVEQTIR  63

Query  729  IADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            + D G + VRIT    KEA+    IK  L  + Y++PLVADIHF P+ A
Sbjct  64   MVDAGCEYVRITAPSIKEANNLANIKKELRLRGYHVPLVADIHFTPNAA  112



>gb|AEA43526.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Fluviicola 
taffensis DSM 16823]
Length=644

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 68/100 (68%), Gaps = 0/100 (0%)
 Frame = +3

Query  576  YCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIV  755
            +C  +    R +TR V VG   +G ++PIRIQ+MTTTD+ D AG+++Q +++ D G ++V
Sbjct  15   FCTDLFHRERFETREVKVGITTIGGKNPIRIQSMTTTDSMDTAGSIDQSIRMIDAGCELV  74

Query  756  RITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            R+T   KKEA+    IK  LV++ YN PLVADIHF P+ A
Sbjct  75   RLTAPSKKEAENLRVIKKELVKRGYNTPLVADIHFTPNAA  114



>ref|WP_014559193.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Ignavibacterium 
album]
 gb|AFH48034.1| (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase [Ignavibacterium 
album JCM 16511]
Length=666

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 65/102 (64%), Gaps = 0/102 (0%)
 Frame = +3

Query  570  QKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGAD  749
            +KYC  + K  R KTR V +G++ LG  +PIRIQ+MTTTDT +   TV Q +++ + G +
Sbjct  9    KKYCNSLTKYSRYKTREVYIGDIPLGGNNPIRIQSMTTTDTMNTEATVAQTIRMVEAGCE  68

Query  750  IVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
             VRIT     EA     IKN L ++ Y +PL+ADIHF P+ A
Sbjct  69   YVRITAPSINEARNLENIKNELRKRGYKVPLIADIHFTPNAA  110



>ref|WP_010883016.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Chlamydia pneumoniae]
 ref|NP_224573.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydophila 
pneumoniae CWL029]
 sp|Q9Z8H0.1|ISPG_CHLPN RecName: Full=4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(flavodoxin); AltName: Full=1-hydroxy-2-methyl-2-(E)-butenyl 
4-diphosphate synthase [Chlamydia pneumoniae]
 gb|AAD18517.1| GcpE Protein [Chlamydophila pneumoniae CWL029]
 gb|AAF38230.1| gcpE protein [Chlamydophila pneumoniae AR39]
 dbj|BAA98581.1| GcpE protein [Chlamydophila pneumoniae J138]
 gb|AAP98316.1| AarC [Chlamydophila pneumoniae TW-183]
Length=613

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  603  RRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITVQGKKE  782
            RRKT TV +GN+ +GS+H I+ Q+MTTT T D+  TVEQ+  +A+   DIVR+TVQG KE
Sbjct  12   RRKTHTVRIGNLYIGSDHSIKTQSMTTTLTTDIDSTVEQIYALAEHNCDIVRVTVQGIKE  71

Query  783  ADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            A AC +IK  L+    NIPLVADIHF P  A+
Sbjct  72   AQACEKIKERLIALGLNIPLVADIHFFPQAAM  103



>ref|WP_043024168.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Fluviicola 
taffensis]
Length=632

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 68/100 (68%), Gaps = 0/100 (0%)
 Frame = +3

Query  576  YCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIV  755
            +C  +    R +TR V VG   +G ++PIRIQ+MTTTD+ D AG+++Q +++ D G ++V
Sbjct  3    FCTDLFHRERFETREVKVGITTIGGKNPIRIQSMTTTDSMDTAGSIDQSIRMIDAGCELV  62

Query  756  RITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            R+T   KKEA+    IK  LV++ YN PLVADIHF P+ A
Sbjct  63   RLTAPSKKEAENLRVIKKELVKRGYNTPLVADIHFTPNAA  102



>ref|WP_018122659.1| hypothetical protein [Wohlfahrtiimonas chitiniclastica]
Length=405

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = +3

Query  600  VRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITVQGKK  779
            VRR+T  VMVG V +GS++PIR+Q+MT TDT+DVA T +Q++++AD G+++VRITV  +K
Sbjct  6    VRRQTTQVMVGKVGIGSDYPIRVQSMTNTDTEDVAATTQQIIELADVGSELVRITVNTEK  65

Query  780  EADACFEIKNSLVQKNYNIPLVADIHF  860
             A++  +I + L+++ Y+ P++ D HF
Sbjct  66   AAESVPKIVDELLKRGYDTPVIGDFHF  92



>ref|WP_026995433.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Flectobacillus 
major]
Length=679

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 68/101 (67%), Gaps = 0/101 (0%)
 Frame = +3

Query  573  KYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADI  752
            +YC+ +    RRKT  V +G++ +GS+ PIR+Q+MTT DT D  G+VEQ +++ ++G ++
Sbjct  16   QYCDSLTAYSRRKTVQVNIGDLWMGSDFPIRVQSMTTVDTMDTIGSVEQTIRMIESGCEL  75

Query  753  VRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            VRIT    KEA     I+  L ++ YN+PL ADIHF P+ A
Sbjct  76   VRITAPSVKEAQNLDNIRKELRKRGYNVPLAADIHFTPNAA  116



>ref|WP_009217671.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Bacteroidetes 
oral taxon 274]
 gb|EFI17660.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Bacteroidetes 
oral taxon 274 str. F0058]
Length=384

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +3

Query  603  RRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITVQGKKE  782
            RR+T  V VGN+ +G  +P+R+QTMT TDT D+ G+VEQ+ +    GA+I+R+T QG++E
Sbjct  3    RRQTIEVRVGNIGIGGSNPVRVQTMTNTDTNDIEGSVEQIKRCVAAGAEIIRLTTQGERE  62

Query  783  ADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
             ++  EIK  L      +PLVAD+HF+ SVAL
Sbjct  63   VNSVAEIKRRLAAVGIVVPLVADVHFSSSVAL  94



>ref|WP_013926162.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Runella 
slithyformis]
 gb|AEI46837.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Runella 
slithyformis DSM 19594]
Length=667

 Score =   101 bits (251),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = +3

Query  576  YCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIV  755
            Y   + + +RRKT TV +G++ LGSE+PIR+Q+MTT DT +  G++EQV+++ ++G + V
Sbjct  19   YSRSLTEYLRRKTITVKIGDIPLGSEYPIRVQSMTTVDTMNTEGSIEQVIRMVESGCEYV  78

Query  756  RITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            RIT    KEA     I+  L  + Y++PL+ADIHF P+ A
Sbjct  79   RITAPSVKEAQNLENIRKGLRARGYSVPLIADIHFTPNAA  118



>dbj|GAO29200.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Geofilum 
rubicundum JCM 15548]
Length=642

 Score =   101 bits (251),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 72/118 (61%), Gaps = 6/118 (5%)
 Frame = +3

Query  525  EVQPASEGSPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVA  704
            E   A++ SPL      +C+ +    R  TR V VG + +G  HP+R+Q+MTTT++ +  
Sbjct  8    ETGDATKRSPL------FCDSLFAYKRNITRAVQVGTIGIGGSHPVRLQSMTTTNSLETE  61

Query  705  GTVEQVMKIADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
             T EQ ++IA  G ++VRIT QG++EA     I+  +  K Y+ PLVADIHF P+ AL
Sbjct  62   ATAEQCLRIARAGGELVRITTQGRREALNLEAIQQYIRHKGYDFPLVADIHFNPNAAL  119



>ref|WP_028070631.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Sphingobacterium 
thalpophilum]
Length=671

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 64/100 (64%), Gaps = 0/100 (0%)
 Frame = +3

Query  576  YCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIV  755
            YC       R KTR + +G+V +G ++PIRIQ+MTT DT D  G+VEQ +++ + G + V
Sbjct  16   YCNSKVDYSRWKTREIQIGDVPMGGDNPIRIQSMTTVDTMDTLGSVEQTIRMVEAGCEYV  75

Query  756  RITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            RIT    KEA     IKN L ++ Y +PLVADIHF P+ A
Sbjct  76   RITAPSIKEAQNLANIKNELRKRGYKVPLVADIHFTPNAA  115



>ref|WP_014772391.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Belliella 
baltica]
 gb|AFL84411.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Belliella 
baltica DSM 15883]
Length=659

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 69/106 (65%), Gaps = 0/106 (0%)
 Frame = +3

Query  558  LVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIAD  737
            L+ + KYC  +    RRKT  V VG+V +G E+PI IQ+MTT DT D  G+VEQ +++ +
Sbjct  6    LIDKIKYCNSLTSYSRRKTIPVKVGDVTIGGENPIVIQSMTTVDTMDTQGSVEQCIRMIE  65

Query  738  TGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            +G  ++RIT    KEA+    IK+ L ++ Y  PLVADIHF P+ A
Sbjct  66   SGCQLIRITAPSMKEAENLQIIKDELRKRGYTTPLVADIHFTPNAA  111



>ref|WP_044211885.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Saccharicrinis 
fermentans]
 dbj|GAF01577.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Saccharicrinis 
fermentans DSM 9555 = JCM 21142]
Length=613

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 65/105 (62%), Gaps = 0/105 (0%)
 Frame = +3

Query  561  VPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADT  740
            + +  YC  I    R  T  V +GN+ LG++HPI +Q+MTTT+T D   TV Q+  I D 
Sbjct  1    MSKSHYCIDIFNYTRYHTSEVQIGNLRLGAKHPIVVQSMTTTNTNDTEATVHQIKNIFDA  60

Query  741  GADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            G  +VR+T QG++EA     IK  L Q+ Y+ PLVADIHF P+ A
Sbjct  61   GGQMVRMTTQGQREAGNLKAIKEELKQQGYDGPLVADIHFNPNAA  105



>ref|XP_004829307.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Babesia equi]
 gb|AFZ79641.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Babesia equi strain WA]
Length=770

 Score =   100 bits (250),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 65/101 (64%), Gaps = 0/101 (0%)
 Frame = +3

Query  576  YCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIV  755
            YCE I   +R  TR V +G V +G   PI +QTMT++DT DV  TV+Q++K    GA +V
Sbjct  88   YCESISNRIRFPTRCVKIGKVTIGGNSPIALQTMTSSDTNDVDATVDQILKSRQHGASMV  147

Query  756  RITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            R+TVQ  +EA +   IK  L+    +IPL+ADIHF P VAL
Sbjct  148  RLTVQSPREAKSSVAIKEKLLSIGCDIPLIADIHFNPKVAL  188



>ref|WP_011458136.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Chlamydophila felis]
 sp|Q254D2.1|ISPG_CHLFF RecName: Full=4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(flavodoxin); AltName: Full=1-hydroxy-2-methyl-2-(E)-butenyl 
4-diphosphate synthase [Chlamydophila felis Fe/C-56]
 dbj|BAE81356.1| 1-hydroxy-2-methyl-2-butenyl 4-diphosphate synthase [Chlamydophila 
felis Fe/C-56]
Length=606

 Score =   100 bits (249),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 64/95 (67%), Gaps = 0/95 (0%)
 Frame = +3

Query  594  KTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITVQG  773
            +T RR T +V +G++ +GSEH I++Q+MTTT T DV  TV Q+  + +   DI R+TVQG
Sbjct  9    QTARRYTHSVKIGSLFVGSEHSIKMQSMTTTPTSDVDATVAQICSLVEAKCDIARVTVQG  68

Query  774  KKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
             KEA AC  IK  L+    +IPLVADIHF P  A+
Sbjct  69   VKEAQACEHIKERLLTMGLDIPLVADIHFFPQAAM  103



>ref|WP_019245958.1| hypothetical protein [Candidatus Alistipes marseilloanorexicus]
Length=536

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 66/102 (65%), Gaps = 0/102 (0%)
 Frame = +3

Query  573  KYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADI  752
            K+C+ + +  RR T  V +G V +G ++PIR+Q+MT TDT D   +V QV +IA  G +I
Sbjct  3    KFCDSLTRFSRRPTDEVRIGTVGVGGDNPIRLQSMTNTDTNDTEASVAQVERIAAAGGEI  62

Query  753  VRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            VR+T QG++EA     I+  L  +   +PLVADIHF P+ AL
Sbjct  63   VRLTAQGRREAANLGRIRALLDNRGCRVPLVADIHFLPAAAL  104



>ref|WP_015265930.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Echinicola 
vietnamensis]
 gb|AGA78371.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Echinicola 
vietnamensis DSM 17526]
Length=661

 Score =   100 bits (248),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 71/105 (68%), Gaps = 0/105 (0%)
 Frame = +3

Query  561  VPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADT  740
            + + KYC+ + +  RRKT  V +G+V +G ++PI +Q+MTT DT D  G++E+ +++  +
Sbjct  7    IAKTKYCDSLTRYSRRKTIPVQIGDVVIGGDNPIVVQSMTTKDTMDTEGSIEECIRMIKS  66

Query  741  GADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            G +++RIT    KEA+    IK  L ++ Y++PLVADIHF P+ A
Sbjct  67   GCELIRITAPSIKEAENLRHIKAGLAERGYHVPLVADIHFTPNAA  111



>ref|WP_025761675.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Dyadobacter 
tibetensis]
Length=669

 Score =   100 bits (248),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 67/100 (67%), Gaps = 0/100 (0%)
 Frame = +3

Query  576  YCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIV  755
            YC  + +  RR+T TV +G++ +GS HPIRIQ+MTT DT D  G++E+V+++ ++G + V
Sbjct  14   YCPSLTQYQRRETITVNIGDIPMGSAHPIRIQSMTTVDTMDTQGSIEEVIRMVESGCEYV  73

Query  756  RITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            RIT    KEA     I+  L +   N+PL+ADIHF P+ A
Sbjct  74   RITAPSVKEAQNLENIRKGLRKLGVNVPLIADIHFTPNAA  113



>ref|WP_003011709.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Sphingobacterium 
spiritivorum]
 gb|EEI94061.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Sphingobacterium 
spiritivorum ATCC 33300]
Length=675

 Score =   100 bits (248),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 65/109 (60%), Gaps = 0/109 (0%)
 Frame = +3

Query  549  SPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMK  728
            S LL     YC       R  TR V +G++ +G  +PIRIQ+MTT DT D  G+VEQ ++
Sbjct  7    SNLLSLPGGYCNSKTDYSRWVTREVNIGDIPMGGNNPIRIQSMTTIDTMDTMGSVEQTIR  66

Query  729  IADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            + D G + VRIT    KEA+    IK  L  + YN+PLVADIHF P+ A
Sbjct  67   MVDAGCEYVRITAPSIKEAENLANIKKELRNRGYNVPLVADIHFTPNAA  115



>ref|WP_002992820.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Sphingobacterium 
spiritivorum]
 gb|EFK57249.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Sphingobacterium 
spiritivorum ATCC 33861]
Length=675

 Score =   100 bits (248),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 65/109 (60%), Gaps = 0/109 (0%)
 Frame = +3

Query  549  SPLLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMK  728
            S LL     YC       R  TR V +G++ +G  +PIRIQ+MTT DT D  G+VEQ ++
Sbjct  7    SNLLSLPGGYCNSKTDYSRWVTREVNIGDIPMGGNNPIRIQSMTTIDTMDTMGSVEQTIR  66

Query  729  IADTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            + D G + VRIT    KEA+    IK  L  + YN+PLVADIHF P+ A
Sbjct  67   MVDAGCEYVRITAPSIKEAENLANIKKELRNRGYNVPLVADIHFTPNAA  115



>ref|WP_039749913.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Hassallia 
byssoidea]
 gb|KIF31853.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Hassallia 
byssoidea VB512170]
Length=660

 Score = 99.8 bits (247),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 68/107 (64%), Gaps = 0/107 (0%)
 Frame = +3

Query  555  LLVPRQKYCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIA  734
            L+   ++YC  + +  RRKT  V +G+V LG  +PIRIQ+MTT DT D  G+VEQV+++ 
Sbjct  3    LVTTTRQYCNSLTEYSRRKTIEVKIGDVPLGGNNPIRIQSMTTVDTMDTRGSVEQVLRMV  62

Query  735  DTGADIVRITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
             +G + VRIT    KEA     IK  L  +  N+PLVADIHF P+ A
Sbjct  63   ASGCEYVRITAPSLKEAQNLEAIKKELRARGCNVPLVADIHFTPNAA  109



>ref|WP_014944975.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
psittaci]
 gb|AFS24520.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
psittaci M56]
Length=606

 Score = 99.8 bits (247),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 65/95 (68%), Gaps = 0/95 (0%)
 Frame = +3

Query  594  KTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITVQG  773
            + VRR T +V +GN+ +GS+H I+ Q+MTTT T DV  TVEQ+  + +   +IVR+TVQG
Sbjct  9    QAVRRYTHSVKIGNLYVGSDHSIKTQSMTTTPTADVDATVEQICALVEARCEIVRVTVQG  68

Query  774  KKEADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
             KE+ AC  IK  L+    ++PLVADIHF P  A+
Sbjct  69   IKESQACEHIKERLIALGIDVPLVADIHFFPQAAM  103



>ref|WP_010662104.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Marinilabilia 
salmonicolor]
Length=623

 Score = 99.8 bits (247),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = +3

Query  576  YCEHIHKTVRRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIV  755
            +C+   +  R KT  V VGNV +G ++P+ IQ+MTTT+T D   TVEQ +KI++ G ++V
Sbjct  7    FCDSYFQYNRLKTDPVNVGNVIIGGDNPVIIQSMTTTNTLDTLATVEQGIKISEAGGELV  66

Query  756  RITVQGKKEADACFEIKNSLVQKNYNIPLVADIHFAPSVA  875
            RIT QG++EA     IK  L+++N  +PLVAD+HF P+ A
Sbjct  67   RITTQGRREATNLEFIKKGLMERNCTVPLVADVHFNPAAA  106



>ref|WP_041523399.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Gilvimarinus 
agarilyticus]
Length=370

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 65/92 (71%), Gaps = 5/92 (5%)
 Frame = +3

Query  603  RRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAGTVEQVMKIADTGADIVRITVQGKKE  782
            RRK+R +MVGNVA+G + PI +Q+MT TDT DVA TVEQV +I   GADIVR++V   + 
Sbjct  9    RRKSRQIMVGNVAVGGDAPIAVQSMTNTDTHDVAATVEQVNRIHSAGADIVRVSVPTLEA  68

Query  783  ADACFEIKNSLVQKNYNIPLVADIHFAPSVAL  878
            ADA  EI+     K  ++PLVADIHF   +AL
Sbjct  69   ADAFGEIR-----KQVSVPLVADIHFDYRIAL  95



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1991073159785