BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3594

Length=941
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004238762.1|  PREDICTED: conserved oligomeric Golgi comple...    501   3e-168   Solanum lycopersicum
ref|XP_006357255.1|  PREDICTED: conserved oligomeric Golgi comple...    499   2e-167   Solanum tuberosum [potatoes]
ref|XP_009786961.1|  PREDICTED: conserved oligomeric Golgi comple...    493   5e-165   Nicotiana sylvestris
ref|XP_006587679.1|  PREDICTED: conserved oligomeric Golgi comple...    485   2e-164   
emb|CAN76413.1|  hypothetical protein VITISV_043812                     476   8e-164   Vitis vinifera
ref|XP_004506344.1|  PREDICTED: conserved oligomeric Golgi comple...    488   5e-163   Cicer arietinum [garbanzo]
ref|XP_010062284.1|  PREDICTED: conserved oligomeric Golgi comple...    487   8e-163   Eucalyptus grandis [rose gum]
emb|CDP05334.1|  unnamed protein product                                486   3e-162   Coffea canephora [robusta coffee]
ref|XP_009625424.1|  PREDICTED: conserved oligomeric Golgi comple...    485   5e-162   Nicotiana tomentosiformis
gb|KEH17632.1|  oligomeric component-related/COG complex component      484   6e-162   Medicago truncatula
gb|AIU51131.1|  embryo yellow protein                                   484   8e-162   Manihot esculenta [manioc]
gb|EYU24953.1|  hypothetical protein MIMGU_mgv1a001327mg                484   1e-161   Erythranthe guttata [common monkey flower]
ref|XP_003534367.1|  PREDICTED: conserved oligomeric Golgi comple...    484   1e-161   Glycine max [soybeans]
gb|AIU51119.1|  embryo yellow protein                                   484   1e-161   Glycine max [soybeans]
ref|XP_012090445.1|  PREDICTED: conserved oligomeric Golgi comple...    483   3e-161   Jatropha curcas
ref|XP_006490119.1|  PREDICTED: conserved oligomeric Golgi comple...    482   6e-161   Citrus sinensis [apfelsine]
gb|KHN11738.1|  Conserved oligomeric Golgi complex subunit 7            481   2e-160   Glycine soja [wild soybean]
gb|AIU51115.1|  embryo yellow protein                                   481   2e-160   Carica papaya [mamon]
ref|XP_006421663.1|  hypothetical protein CICLE_v10004313mg             481   2e-160   Citrus clementina [clementine]
ref|XP_011033997.1|  PREDICTED: conserved oligomeric Golgi comple...    481   2e-160   Populus euphratica
gb|KDO65493.1|  hypothetical protein CISIN_1g003266mg                   481   2e-160   Citrus sinensis [apfelsine]
gb|AIU51110.1|  embryo yellow protein                                   479   8e-160   Theobroma cacao [chocolate]
ref|XP_007038383.1|  Oligomeric Golgi complex component-related /...    479   9e-160   
gb|KHN46499.1|  Conserved oligomeric Golgi complex subunit 7            478   3e-159   Glycine soja [wild soybean]
ref|XP_011076371.1|  PREDICTED: conserved oligomeric Golgi comple...    477   5e-159   Sesamum indicum [beniseed]
ref|XP_008439087.1|  PREDICTED: conserved oligomeric Golgi comple...    476   8e-159   Cucumis melo [Oriental melon]
ref|XP_002304412.2|  conserved oligomeric Golgi complex component...    476   1e-158   
ref|XP_002267657.1|  PREDICTED: conserved oligomeric Golgi comple...    476   1e-158   Vitis vinifera
ref|XP_004148143.1|  PREDICTED: conserved oligomeric Golgi comple...    473   1e-157   Cucumis sativus [cucumbers]
ref|XP_007131467.1|  hypothetical protein PHAVU_011G016000g             473   2e-157   Phaseolus vulgaris [French bean]
gb|AIU51138.1|  embryo yellow protein                                   473   2e-157   Phaseolus vulgaris [French bean]
gb|AIU51149.1|  embryo yellow protein                                   471   7e-157   Lactuca sativa [cultivated lettuce]
gb|AIU51114.1|  embryo yellow protein                                   470   3e-156   Gossypium raimondii
ref|XP_002510953.1|  conserved hypothetical protein                     467   5e-155   Ricinus communis
gb|AIU51140.1|  embryo yellow protein                                   465   2e-154   Ricinus communis
ref|XP_010442641.1|  PREDICTED: conserved oligomeric Golgi comple...    453   5e-154   Camelina sativa [gold-of-pleasure]
ref|XP_009374477.1|  PREDICTED: conserved oligomeric Golgi comple...    463   1e-153   Pyrus x bretschneideri [bai li]
ref|XP_008376080.1|  PREDICTED: conserved oligomeric Golgi comple...    462   3e-153   
ref|XP_009340575.1|  PREDICTED: conserved oligomeric Golgi comple...    461   1e-152   Pyrus x bretschneideri [bai li]
gb|KFK26748.1|  hypothetical protein AALP_AA8G288200                    460   2e-152   Arabis alpina [alpine rockcress]
gb|AIU51136.1|  embryo yellow protein                                   460   2e-152   Prunus persica
ref|XP_008234406.1|  PREDICTED: conserved oligomeric Golgi comple...    460   3e-152   Prunus mume [ume]
emb|CDX99921.1|  BnaC09g27840D                                          453   5e-152   
ref|XP_010536539.1|  PREDICTED: conserved oligomeric Golgi comple...    459   5e-152   Tarenaya hassleriana [spider flower]
gb|AIU51103.1|  embryo yellow protein                                   459   8e-152   Arabidopsis lyrata [lyrate rockcress]
ref|XP_002865861.1|  hypothetical protein ARALYDRAFT_495214             458   9e-152   
emb|CDY56655.1|  BnaA02g11250D                                          457   9e-152   Brassica napus [oilseed rape]
ref|XP_009127310.1|  PREDICTED: conserved oligomeric Golgi comple...    458   1e-151   Brassica rapa
gb|AIU51152.1|  embryo yellow protein                                   458   2e-151   Platanus x hispanica [London plane tree]
gb|AIU51116.1|  embryo yellow protein                                   457   4e-151   Capsella rubella
ref|XP_010089680.1|  hypothetical protein L484_001268                   457   4e-151   Morus notabilis
ref|XP_006280007.1|  hypothetical protein CARUB_v10025880mg             457   4e-151   Capsella rubella
ref|XP_010482477.1|  PREDICTED: conserved oligomeric Golgi comple...    457   5e-151   Camelina sativa [gold-of-pleasure]
gb|AIU51104.1|  embryo yellow protein                                   456   6e-151   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199956.1|  COG7-like protein EYE                                 456   6e-151   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF00649.1|  hypothetical protein                                   456   7e-151   Arabidopsis thaliana [mouse-ear cress]
emb|CDX91578.1|  BnaC02g15820D                                          455   8e-151   
ref|XP_007218916.1|  hypothetical protein PRUPE_ppa001391mg             456   1e-150   Prunus persica
ref|XP_010264264.1|  PREDICTED: conserved oligomeric Golgi comple...    456   1e-150   Nelumbo nucifera [Indian lotus]
gb|AIU51147.1|  embryo yellow protein                                   455   2e-150   Schrenkiella parvula
ref|XP_006401980.1|  hypothetical protein EUTSA_v10012691mg             455   2e-150   Eutrema salsugineum [saltwater cress]
ref|XP_010443240.1|  PREDICTED: conserved oligomeric Golgi comple...    455   3e-150   Camelina sativa [gold-of-pleasure]
dbj|BAG15881.1|  conserved oligomeric Golgi complex component 7-r...    455   3e-150   Arabidopsis thaliana [mouse-ear cress]
gb|AIU51120.1|  embryo yellow protein                                   451   4e-150   Illicium henryi
gb|AIU51129.1|  embryo yellow protein                                   453   7e-150   Medicago truncatula
ref|XP_003618191.1|  Conserved oligomeric Golgi complex subunit         453   7e-150   Medicago truncatula
gb|AIU51121.1|  embryo yellow protein                                   453   1e-149   Buxus sinica
gb|AIU51112.1|  embryo yellow protein                                   452   2e-149   Sarcandra glabra
ref|XP_009107451.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    450   2e-148   
gb|AIU51151.1|  embryo yellow protein                                   448   1e-147   Cinnamomum camphora
ref|XP_004307803.1|  PREDICTED: conserved oligomeric Golgi comple...    445   1e-146   Fragaria vesca subsp. vesca
gb|AIU51141.1|  embryo yellow protein                                   424   7e-146   Saruma henryi
gb|AIU51102.1|  embryo yellow protein                                   442   2e-145   Aquilegia coerulea [Rocky Mountain columbine]
emb|CDY00475.1|  BnaA10g07980D                                          441   2e-145   
ref|XP_010692941.1|  PREDICTED: conserved oligomeric Golgi comple...    440   2e-144   Beta vulgaris subsp. vulgaris [field beet]
gb|AIU51125.1|  embryo yellow protein                                   435   1e-142   Chimonanthus praecox [wintersweet]
gb|EPS73811.1|  hypothetical protein M569_00940                         434   4e-142   Genlisea aurea
gb|AIU51106.1|  embryo yellow protein                                   432   2e-141   Magnolia denudata [haku-mokuren]
gb|AIU51154.1|  embryo yellow protein                                   431   5e-141   Houttuynia cordata [chameleon-plant]
ref|XP_006838140.1|  PREDICTED: conserved oligomeric Golgi comple...    423   3e-138   Amborella trichopoda
gb|AIU51128.1|  embryo yellow protein                                   423   5e-138   Aristolochia tagala
ref|XP_010934963.1|  PREDICTED: conserved oligomeric Golgi comple...    411   2e-133   Elaeis guineensis
gb|AIU51143.1|  embryo yellow protein                                   409   1e-132   Yucca filamentosa [Adam's-needle]
ref|XP_008796946.1|  PREDICTED: conserved oligomeric Golgi comple...    408   2e-132   Phoenix dactylifera
gb|AIU51157.1|  embryo yellow protein                                   408   2e-132   Trachycarpus fortunei
ref|XP_009372929.1|  PREDICTED: conserved oligomeric Golgi comple...    397   3e-130   
gb|AIU51127.1|  embryo yellow protein                                   400   3e-129   Asparagus officinalis
gb|AIU51107.1|  embryo yellow protein                                   399   6e-129   Musa acuminata [banana]
ref|XP_009399332.1|  PREDICTED: conserved oligomeric Golgi comple...    399   8e-129   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003618197.1|  Conserved oligomeric Golgi complex subunit         394   1e-127   
gb|AIU51150.1|  embryo yellow protein                                   394   3e-127   Ceratophyllum platyacanthum subsp. oryzetorum
gb|AIU51124.1|  embryo yellow protein                                   394   4e-127   Ceratophyllum demersum [hornwort]
gb|AIU51156.1|  embryo yellow protein                                   393   1e-126   Alisma plantago-aquatica
gb|AIU51108.1|  embryo yellow protein                                   390   2e-125   Pinellia ternata
gb|AIU51142.1|  embryo yellow protein                                   389   1e-124   Dioscorea oppositifolia
ref|XP_006657236.1|  PREDICTED: conserved oligomeric Golgi comple...    380   1e-121   Oryza brachyantha
gb|EEC81147.1|  hypothetical protein OsI_24056                          378   8e-121   Oryza sativa Indica Group [Indian rice]
dbj|BAJ94393.1|  predicted protein                                      375   1e-119   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIU51155.1|  embryo yellow protein                                   372   2e-118   Zea mays [maize]
ref|XP_008658135.1|  PREDICTED: uncharacterized protein LOC100193...    372   2e-118   
dbj|BAJ95800.1|  predicted protein                                      372   3e-118   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIU51144.1|  embryo yellow protein                                   369   1e-117   Setaria italica
dbj|BAD45448.1|  oligomeric golgi complex 7-like                        370   2e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004966309.1|  PREDICTED: conserved oligomeric Golgi comple...    369   2e-117   Setaria italica
ref|XP_002438832.1|  hypothetical protein SORBIDRAFT_10g026850          369   2e-117   Sorghum bicolor [broomcorn]
gb|AIU51153.1|  embryo yellow protein                                   369   3e-117   Ginkgo biloba [ginkgo]
gb|AIU51146.1|  embryo yellow protein                                   369   3e-117   Sorghum bicolor [broomcorn]
gb|AIU51158.1|  embryo yellow protein                                   367   1e-116   Cabomba caroliniana
gb|AIU51130.1|  embryo yellow protein                                   364   2e-115   Canna indica [canna]
gb|AIU51137.1|  embryo yellow protein                                   362   1e-114   Panicum virgatum
ref|XP_001770876.1|  predicted protein                                  352   2e-110   
gb|AIU51111.1|  embryo yellow protein                                   326   6e-101   Acorus calamus [flagroot]
ref|XP_008376425.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    316   9e-99    
gb|EEE66191.1|  hypothetical protein OsJ_22310                          319   1e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002972505.1|  hypothetical protein SELMODRAFT_148467             318   3e-98    
ref|XP_002992562.1|  hypothetical protein SELMODRAFT_135591             315   4e-97    
ref|XP_010062289.1|  PREDICTED: conserved oligomeric Golgi comple...    298   3e-91    Eucalyptus grandis [rose gum]
gb|EMT03910.1|  hypothetical protein F775_26031                         256   2e-75    
gb|EMS57916.1|  hypothetical protein TRIUR3_24838                       255   4e-75    Triticum urartu
ref|XP_003563389.1|  PREDICTED: conserved oligomeric Golgi comple...    253   2e-73    
gb|AIU51109.1|  embryo yellow protein                                   252   3e-73    Brachypodium distachyon [annual false brome]
ref|XP_010442640.1|  PREDICTED: conserved oligomeric Golgi comple...    209   3e-58    Camelina sativa [gold-of-pleasure]
ref|XP_003055554.1|  predicted protein                                  190   5e-51    Micromonas pusilla CCMP1545
ref|XP_005847546.1|  hypothetical protein CHLNCDRAFT_133750             186   8e-50    Chlorella variabilis
ref|XP_002503576.1|  predicted protein                                  171   2e-44    Micromonas commoda
ref|XP_005643872.1|  hypothetical protein COCSUDRAFT_67854              169   9e-44    Coccomyxa subellipsoidea C-169
gb|AIU51133.1|  embryo yellow protein                                   148   1e-39    Persea americana
ref|XP_002953697.1|  component of oligomeric golgi complex 7            154   4e-38    Volvox carteri f. nagariensis
ref|XP_001628559.1|  predicted protein                                  150   5e-37    Nematostella vectensis
emb|CEF98773.1|  Conserved oligomeric Golgi complex subunit 7           150   7e-37    Ostreococcus tauri
ref|XP_786237.3|  PREDICTED: conserved oligomeric Golgi complex s...    139   4e-33    Strongylocentrotus purpuratus [purple urchin]
ref|XP_011680385.1|  PREDICTED: conserved oligomeric Golgi comple...    139   6e-33    Strongylocentrotus purpuratus [purple urchin]
gb|EKC24157.1|  Conserved oligomeric Golgi complex subunit 7            138   1e-32    Crassostrea gigas
ref|XP_006623838.1|  PREDICTED: conserved oligomeric Golgi comple...    137   4e-32    Apis dorsata [rock honeybee]
ref|XP_006623839.1|  PREDICTED: conserved oligomeric Golgi comple...    136   4e-32    Apis dorsata [rock honeybee]
ref|XP_001701937.1|  component of oligomeric golgi complex 7            136   5e-32    Chlamydomonas reinhardtii
ref|XP_394713.2|  PREDICTED: conserved oligomeric Golgi complex s...    134   2e-31    
ref|XP_011431811.1|  PREDICTED: conserved oligomeric Golgi comple...    133   5e-31    Crassostrea gigas
gb|KDR16116.1|  Conserved oligomeric Golgi complex subunit 7            132   1e-30    Zootermopsis nevadensis
ref|XP_011154014.1|  PREDICTED: conserved oligomeric Golgi comple...    132   1e-30    Harpegnathos saltator
ref|XP_011264700.1|  PREDICTED: conserved oligomeric Golgi comple...    132   1e-30    
ref|XP_012141178.1|  PREDICTED: conserved oligomeric Golgi comple...    132   2e-30    Megachile rotundata
ref|XP_011340195.1|  PREDICTED: conserved oligomeric Golgi comple...    132   2e-30    
ref|XP_012141176.1|  PREDICTED: conserved oligomeric Golgi comple...    132   2e-30    Megachile rotundata
ref|XP_011641616.1|  PREDICTED: conserved oligomeric Golgi comple...    131   3e-30    Pogonomyrmex barbatus
emb|CBN81326.1|  Conserved oligomeric Golgi complex subunit 7           128   4e-30    Dicentrarchus labrax [European sea bass]
ref|XP_004351649.1|  hypothetical protein ACA1_397180                   130   4e-30    Acanthamoeba castellanii str. Neff
ref|XP_008299300.1|  PREDICTED: conserved oligomeric Golgi comple...    130   5e-30    Stegastes partitus
ref|XP_011299078.1|  PREDICTED: conserved oligomeric Golgi comple...    130   5e-30    Fopius arisanus
ref|XP_011299070.1|  PREDICTED: conserved oligomeric Golgi comple...    130   7e-30    Fopius arisanus
ref|XP_003397366.1|  PREDICTED: conserved oligomeric Golgi comple...    129   9e-30    Bombus terrestris [large earth bumblebee]
ref|XP_011159533.1|  PREDICTED: conserved oligomeric Golgi comple...    129   9e-30    Solenopsis invicta [imported red fire ant]
ref|XP_005748533.1|  PREDICTED: conserved oligomeric Golgi comple...    130   1e-29    Pundamilia nyererei
ref|XP_005810284.1|  PREDICTED: conserved oligomeric Golgi comple...    129   1e-29    Xiphophorus maculatus
ref|XP_011863988.1|  PREDICTED: conserved oligomeric Golgi comple...    129   1e-29    Vollenhovia emeryi
ref|XP_007513783.1|  predicted protein                                  129   2e-29    Bathycoccus prasinos
ref|XP_011264701.1|  PREDICTED: conserved oligomeric Golgi comple...    129   2e-29    
ref|XP_003490215.1|  PREDICTED: conserved oligomeric Golgi comple...    129   2e-29    
ref|XP_007903979.1|  PREDICTED: conserved oligomeric Golgi comple...    129   3e-29    Callorhinchus milii [Australian ghost shark]
ref|XP_007903980.1|  PREDICTED: conserved oligomeric Golgi comple...    128   3e-29    Callorhinchus milii [Australian ghost shark]
ref|XP_011068677.1|  PREDICTED: conserved oligomeric Golgi comple...    128   3e-29    Acromyrmex echinatior
ref|XP_003341699.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    128   4e-29    Monodelphis domestica
ref|XP_005288959.1|  PREDICTED: conserved oligomeric Golgi comple...    128   4e-29    Chrysemys picta bellii
ref|XP_011693337.1|  PREDICTED: conserved oligomeric Golgi comple...    128   4e-29    Wasmannia auropunctata
ref|XP_003438511.1|  PREDICTED: conserved oligomeric Golgi comple...    128   4e-29    Oreochromis niloticus
ref|XP_004571418.1|  PREDICTED: conserved oligomeric Golgi comple...    128   4e-29    Maylandia zebra
ref|XP_003961343.1|  PREDICTED: conserved oligomeric Golgi comple...    127   6e-29    Takifugu rubripes [tiger puffer]
ref|XP_010791235.1|  PREDICTED: conserved oligomeric Golgi comple...    127   7e-29    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_005935571.1|  PREDICTED: conserved oligomeric Golgi comple...    127   7e-29    Haplochromis burtoni
ref|XP_012055460.1|  PREDICTED: conserved oligomeric Golgi comple...    127   8e-29    Atta cephalotes
ref|XP_007058642.1|  PREDICTED: conserved oligomeric Golgi comple...    127   9e-29    Chelonia mydas [green seaturtle]
ref|XP_009062761.1|  hypothetical protein LOTGIDRAFT_194952             127   9e-29    Lottia gigantea
ref|XP_004080382.1|  PREDICTED: conserved oligomeric Golgi comple...    127   9e-29    Oryzias latipes [Japanese rice fish]
gb|EGI69206.1|  Conserved oligomeric Golgi complex subunit 7            127   9e-29    Acromyrmex echinatior
ref|XP_006808092.1|  PREDICTED: conserved oligomeric Golgi comple...    126   1e-28    Neolamprologus brichardi [lyretail cichlid]
ref|XP_008434639.1|  PREDICTED: conserved oligomeric Golgi comple...    126   1e-28    Poecilia reticulata
ref|XP_007571524.1|  PREDICTED: conserved oligomeric Golgi comple...    126   1e-28    Poecilia formosa
gb|EFA86654.1|  oligomeric Golgi complex component                      126   1e-28    Heterostelium album PN500
ref|XP_007571519.1|  PREDICTED: conserved oligomeric Golgi comple...    126   2e-28    Poecilia formosa
ref|NP_001264493.1|  conserved oligomeric Golgi complex subunit 7       126   2e-28    Gallus gallus [bantam]
ref|XP_003761800.1|  PREDICTED: conserved oligomeric Golgi comple...    125   2e-28    
ref|XP_010568819.1|  PREDICTED: conserved oligomeric Golgi comple...    124   7e-28    Haliaeetus leucocephalus
ref|XP_010568818.1|  PREDICTED: conserved oligomeric Golgi comple...    124   8e-28    Haliaeetus leucocephalus
ref|XP_002128341.1|  PREDICTED: conserved oligomeric Golgi comple...    124   9e-28    Ciona intestinalis [sea vase]
gb|ELT88100.1|  hypothetical protein CAPTEDRAFT_161050                  123   1e-27    Capitella teleta
emb|CAG04322.1|  unnamed protein product                                121   1e-27    Tetraodon nigroviridis
ref|NP_001015714.1|  component of oligomeric golgi complex 7            123   2e-27    Xenopus tropicalis [western clawed frog]
ref|XP_010568814.1|  PREDICTED: conserved oligomeric Golgi comple...    123   2e-27    Haliaeetus leucocephalus
ref|XP_010717801.1|  PREDICTED: conserved oligomeric Golgi comple...    122   2e-27    Meleagris gallopavo [common turkey]
ref|XP_003230252.2|  PREDICTED: conserved oligomeric Golgi comple...    122   2e-27    Anolis carolinensis [Carolina anole]
ref|XP_006637161.1|  PREDICTED: conserved oligomeric Golgi comple...    122   3e-27    Lepisosteus oculatus
ref|XP_010731365.1|  PREDICTED: conserved oligomeric Golgi comple...    122   4e-27    
gb|KFV72508.1|  Conserved oligomeric Golgi complex subunit 7            122   4e-27    Struthio camelus australis
emb|CDQ66102.1|  unnamed protein product                                122   4e-27    Oncorhynchus mykiss
ref|XP_011577714.1|  PREDICTED: conserved oligomeric Golgi comple...    122   4e-27    Aquila chrysaetos canadensis
ref|XP_009665174.1|  PREDICTED: conserved oligomeric Golgi comple...    122   4e-27    Struthio camelus australis
ref|XP_008488587.1|  PREDICTED: conserved oligomeric Golgi comple...    122   5e-27    Calypte anna
ref|NP_001085832.1|  component of oligomeric golgi complex 7            122   5e-27    Xenopus laevis [clawed frog]
gb|KFO95573.1|  Conserved oligomeric Golgi complex subunit 7            122   5e-27    Calypte anna
ref|XP_009893067.1|  PREDICTED: conserved oligomeric Golgi comple...    121   7e-27    Charadrius vociferus
ref|XP_005229099.1|  PREDICTED: conserved oligomeric Golgi comple...    121   8e-27    Falco peregrinus [peregrine]
ref|XP_005598907.1|  PREDICTED: conserved oligomeric Golgi comple...    121   8e-27    
ref|XP_010299541.1|  PREDICTED: conserved oligomeric Golgi comple...    121   8e-27    Balearica regulorum gibbericeps
ref|XP_001916280.1|  PREDICTED: conserved oligomeric Golgi comple...    121   9e-27    
ref|XP_010903275.1|  PREDICTED: conserved oligomeric Golgi comple...    121   1e-26    Esox lucius
ref|XP_005505761.1|  PREDICTED: conserved oligomeric Golgi comple...    121   1e-26    Columba livia [carrier pigeon]
ref|XP_010214546.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    120   1e-26    Tinamus guttatus
ref|XP_004442758.1|  PREDICTED: conserved oligomeric Golgi comple...    120   1e-26    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_008474492.1|  PREDICTED: conserved oligomeric Golgi comple...    116   1e-26    
gb|KGL78321.1|  Conserved oligomeric Golgi complex subunit 7            120   1e-26    Tinamus guttatus
ref|XP_008559723.1|  PREDICTED: conserved oligomeric Golgi comple...    120   2e-26    
ref|XP_006825808.1|  PREDICTED: conserved oligomeric Golgi comple...    114   2e-26    Saccoglossus kowalevskii
ref|XP_010184345.1|  PREDICTED: conserved oligomeric Golgi comple...    120   2e-26    Mesitornis unicolor
ref|XP_009565762.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    120   2e-26    Cuculus canorus
ref|XP_006027196.1|  PREDICTED: conserved oligomeric Golgi comple...    120   2e-26    Alligator sinensis
ref|XP_006268482.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    120   2e-26    
ref|XP_005351192.1|  PREDICTED: conserved oligomeric Golgi comple...    120   3e-26    Microtus ochrogaster [prairie voles]
ref|XP_005054658.1|  PREDICTED: conserved oligomeric Golgi comple...    119   3e-26    Ficedula albicollis
ref|XP_009089982.1|  PREDICTED: conserved oligomeric Golgi comple...    119   4e-26    
ref|XP_005523167.1|  PREDICTED: conserved oligomeric Golgi comple...    119   4e-26    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_003418948.1|  PREDICTED: conserved oligomeric Golgi comple...    119   4e-26    Loxodonta africana [African bush elephant]
ref|XP_004373515.1|  PREDICTED: conserved oligomeric Golgi comple...    119   4e-26    Trichechus manatus latirostris
ref|XP_010390549.1|  PREDICTED: conserved oligomeric Golgi comple...    119   5e-26    Corvus cornix cornix
ref|XP_010568816.1|  PREDICTED: conserved oligomeric Golgi comple...    119   5e-26    Haliaeetus leucocephalus
ref|XP_004453849.1|  PREDICTED: conserved oligomeric Golgi comple...    119   6e-26    Dasypus novemcinctus
ref|XP_005054657.1|  PREDICTED: conserved oligomeric Golgi comple...    119   7e-26    
ref|XP_002711891.2|  PREDICTED: conserved oligomeric Golgi comple...    119   7e-26    
ref|XP_007951381.1|  PREDICTED: conserved oligomeric Golgi comple...    118   8e-26    Orycteropus afer afer
ref|XP_010621761.1|  PREDICTED: conserved oligomeric Golgi comple...    118   9e-26    Fukomys damarensis [Damara mole rat]
ref|XP_005656829.1|  PREDICTED: conserved oligomeric Golgi comple...    117   9e-26    
ref|XP_005323804.1|  PREDICTED: conserved oligomeric Golgi comple...    118   1e-25    Ictidomys tridecemlineatus
ref|XP_006872058.1|  PREDICTED: conserved oligomeric Golgi comple...    118   1e-25    Chrysochloris asiatica
ref|XP_008312851.1|  PREDICTED: conserved oligomeric Golgi comple...    117   1e-25    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_006730882.1|  PREDICTED: conserved oligomeric Golgi comple...    117   1e-25    Leptonychotes weddellii
ref|XP_004398866.1|  PREDICTED: conserved oligomeric Golgi comple...    117   1e-25    Odobenus rosmarus divergens
ref|XP_011577715.1|  PREDICTED: conserved oligomeric Golgi comple...    117   1e-25    Aquila chrysaetos canadensis
ref|XP_007516677.1|  PREDICTED: conserved oligomeric Golgi comple...    117   1e-25    
ref|XP_006148372.1|  PREDICTED: conserved oligomeric Golgi comple...    117   2e-25    Tupaia chinensis
ref|XP_008695386.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    117   2e-25    Ursus maritimus [white bear]
ref|XP_005656828.1|  PREDICTED: conserved oligomeric Golgi comple...    117   2e-25    
ref|XP_007615834.1|  PREDICTED: conserved oligomeric Golgi comple...    117   2e-25    
gb|ELW66292.1|  Conserved oligomeric Golgi complex subunit 7            117   2e-25    Tupaia chinensis
ref|XP_006193181.1|  PREDICTED: conserved oligomeric Golgi comple...    117   2e-25    Camelus ferus
ref|XP_003513853.1|  PREDICTED: conserved oligomeric Golgi comple...    117   2e-25    Cricetulus griseus [Chinese hamsters]
ref|XP_010959320.1|  PREDICTED: conserved oligomeric Golgi comple...    117   2e-25    Camelus bactrianus [camel]
ref|XP_001418731.1|  predicted protein                                  117   2e-25    Ostreococcus lucimarinus CCE9901
ref|XP_006201263.1|  PREDICTED: conserved oligomeric Golgi comple...    117   2e-25    Vicugna pacos
ref|XP_007450043.1|  PREDICTED: conserved oligomeric Golgi comple...    117   3e-25    Lipotes vexillifer [baiji]
ref|XP_004020887.1|  PREDICTED: conserved oligomeric Golgi comple...    117   3e-25    
ref|XP_005697660.1|  PREDICTED: conserved oligomeric Golgi comple...    117   3e-25    Capra hircus [domestic goat]
ref|XP_004855999.1|  PREDICTED: conserved oligomeric Golgi comple...    117   3e-25    Heterocephalus glaber [naked mole rat]
gb|EPY74529.1|  conserved oligomeric Golgi complex subunit 7-like...    117   3e-25    Camelus ferus
ref|XP_004691773.1|  PREDICTED: conserved oligomeric Golgi comple...    116   3e-25    Condylura cristata
ref|XP_010835502.1|  PREDICTED: conserved oligomeric Golgi comple...    116   3e-25    Bison bison bison
ref|XP_004268622.1|  PREDICTED: conserved oligomeric Golgi comple...    116   3e-25    Orcinus orca [Orca]
sp|Q3UM29.1|COG7_MOUSE  RecName: Full=Conserved oligomeric Golgi ...    116   3e-25    Mus musculus [mouse]
ref|NP_001076841.1|  conserved oligomeric Golgi complex subunit 7       116   3e-25    Bos taurus [bovine]
ref|XP_003478248.1|  PREDICTED: conserved oligomeric Golgi comple...    116   4e-25    Cavia porcellus [guinea pig]
ref|XP_005975366.1|  PREDICTED: conserved oligomeric Golgi comple...    116   4e-25    Pantholops hodgsonii [Tibetan antelope]
ref|XP_004332588.1|  PREDICTED: LOW QUALITY PROTEIN: component of...    116   4e-25    
ref|XP_005905382.1|  PREDICTED: conserved oligomeric Golgi comple...    116   4e-25    Bos mutus
ref|XP_006892752.1|  PREDICTED: conserved oligomeric Golgi comple...    116   4e-25    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_007105719.1|  PREDICTED: conserved oligomeric Golgi comple...    116   4e-25    Physeter catodon
ref|XP_011813716.1|  PREDICTED: conserved oligomeric Golgi comple...    115   5e-25    Colobus angolensis palliatus
ref|XP_006003103.1|  PREDICTED: conserved oligomeric Golgi comple...    116   5e-25    Latimeria chalumnae
ref|XP_007198346.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    116   5e-25    Balaenoptera acutorostrata scammoni
ref|XP_004604166.1|  PREDICTED: conserved oligomeric Golgi comple...    116   5e-25    Sorex araneus [Eurasian shrew]
ref|XP_004900784.1|  PREDICTED: conserved oligomeric Golgi comple...    115   6e-25    
ref|NP_001029061.1|  conserved oligomeric Golgi complex subunit 7       115   7e-25    Rattus norvegicus [brown rat]
ref|XP_009007562.1|  PREDICTED: conserved oligomeric Golgi comple...    115   7e-25    Callithrix jacchus [common marmoset]
ref|XP_510875.2|  PREDICTED: conserved oligomeric Golgi complex s...    115   7e-25    Pan troglodytes
ref|XP_004900783.1|  PREDICTED: conserved oligomeric Golgi comple...    115   7e-25    
ref|XP_002802472.1|  PREDICTED: conserved oligomeric Golgi comple...    115   7e-25    
ref|XP_004057400.1|  PREDICTED: conserved oligomeric Golgi comple...    115   8e-25    
dbj|BAE37211.1|  unnamed protein product                                115   8e-25    Mus musculus [mouse]
ref|XP_011843352.1|  PREDICTED: conserved oligomeric Golgi comple...    115   8e-25    Mandrillus leucophaeus
gb|EAW55831.1|  component of oligomeric golgi complex 7, isoform ...    115   8e-25    Homo sapiens [man]
ref|NP_705831.1|  conserved oligomeric Golgi complex subunit 7          115   8e-25    Homo sapiens [man]
gb|KFO58912.1|  Conserved oligomeric Golgi complex subunit 7            115   8e-25    Corvus brachyrhynchos
ref|NP_001070861.1|  conserved oligomeric Golgi complex subunit 7       115   8e-25    
ref|XP_005105726.1|  PREDICTED: conserved oligomeric Golgi comple...    115   8e-25    
ref|XP_005591519.1|  PREDICTED: conserved oligomeric Golgi comple...    115   9e-25    
ref|XP_008631786.1|  PREDICTED: conserved oligomeric Golgi comple...    115   9e-25    
ref|XP_011745473.1|  PREDICTED: conserved oligomeric Golgi comple...    115   9e-25    
ref|XP_006507762.2|  PREDICTED: conserved oligomeric Golgi comple...    115   1e-24    
ref|NP_001028490.2|  conserved oligomeric Golgi complex subunit 7       115   1e-24    
ref|XP_006507763.2|  PREDICTED: conserved oligomeric Golgi comple...    115   1e-24    
ref|XP_011916362.1|  PREDICTED: conserved oligomeric Golgi comple...    115   1e-24    
ref|XP_010356516.1|  PREDICTED: conserved oligomeric Golgi comple...    115   1e-24    
ref|XP_008842039.1|  PREDICTED: conserved oligomeric Golgi comple...    115   1e-24    
ref|XP_006071244.1|  PREDICTED: conserved oligomeric Golgi comple...    115   1e-24    
ref|XP_003813754.1|  PREDICTED: conserved oligomeric Golgi comple...    115   1e-24    
ref|XP_004586873.1|  PREDICTED: conserved oligomeric Golgi comple...    115   1e-24    
ref|XP_004778381.1|  PREDICTED: conserved oligomeric Golgi comple...    115   1e-24    
ref|XP_008150973.1|  PREDICTED: conserved oligomeric Golgi comple...    115   1e-24    
ref|XP_005591518.1|  PREDICTED: conserved oligomeric Golgi comple...    115   1e-24    
ref|XP_974190.1|  PREDICTED: conserved oligomeric Golgi complex s...    114   1e-24    
ref|XP_010198342.1|  PREDICTED: conserved oligomeric Golgi comple...    115   1e-24    
ref|XP_002927171.1|  PREDICTED: conserved oligomeric Golgi comple...    115   1e-24    
gb|EDL17254.1|  component of oligomeric golgi complex 7                 115   1e-24    
ref|XP_004778380.1|  PREDICTED: conserved oligomeric Golgi comple...    114   1e-24    
ref|XP_003998815.1|  PREDICTED: conserved oligomeric Golgi comple...    114   1e-24    
ref|XP_003930238.1|  PREDICTED: conserved oligomeric Golgi comple...    114   2e-24    
ref|XP_006980401.1|  PREDICTED: conserved oligomeric Golgi comple...    114   2e-24    
ref|XP_004706118.1|  PREDICTED: conserved oligomeric Golgi comple...    114   2e-24    
ref|NP_001124794.1|  conserved oligomeric Golgi complex subunit 7       114   3e-24    
ref|XP_008058130.1|  PREDICTED: conserved oligomeric Golgi comple...    113   4e-24    
ref|XP_007233023.1|  PREDICTED: conserved oligomeric Golgi comple...    112   5e-24    
ref|XP_002407978.1|  conserved oligomeric golgi complex subunit, ...    112   6e-24    
ref|XP_006085922.1|  PREDICTED: conserved oligomeric Golgi comple...    112   1e-23    
ref|XP_006085923.1|  PREDICTED: conserved oligomeric Golgi comple...    112   1e-23    
ref|XP_004622945.1|  PREDICTED: conserved oligomeric Golgi comple...    111   2e-23    
ref|XP_009024750.1|  hypothetical protein HELRODRAFT_178406             110   2e-23    
gb|KFV74312.1|  Conserved oligomeric Golgi complex subunit 7            111   2e-23    
ref|XP_003691700.1|  PREDICTED: conserved oligomeric Golgi comple...    110   3e-23    
ref|XP_008202374.1|  PREDICTED: conserved oligomeric Golgi comple...    110   4e-23    
ref|XP_536935.3|  PREDICTED: conserved oligomeric Golgi complex s...    110   4e-23    
ref|XP_008202373.1|  PREDICTED: conserved oligomeric Golgi comple...    110   5e-23    
ref|XP_008566482.1|  PREDICTED: conserved oligomeric Golgi comple...    109   8e-23    
ref|XP_008536012.1|  PREDICTED: conserved oligomeric Golgi comple...    103   9e-23    
ref|XP_637633.1|  oligomeric Golgi complex component                    108   2e-22    
ref|XP_011641617.1|  PREDICTED: conserved oligomeric Golgi comple...    108   2e-22    
ref|XP_004670260.1|  PREDICTED: conserved oligomeric Golgi comple...    108   2e-22    
ref|XP_002109935.1|  hypothetical protein TRIADDRAFT_53345              107   2e-22    
ref|XP_009194445.1|  PREDICTED: conserved oligomeric Golgi comple...    107   3e-22    
ref|XP_011299085.1|  PREDICTED: conserved oligomeric Golgi comple...    107   3e-22    
ref|XP_006753680.1|  PREDICTED: conserved oligomeric Golgi comple...    107   4e-22    
ref|XP_005405155.1|  PREDICTED: conserved oligomeric Golgi comple...    107   5e-22    
ref|XP_011502446.1|  PREDICTED: conserved oligomeric Golgi comple...    106   7e-22    
ref|XP_004360949.1|  oligomeric Golgi complex component                 106   9e-22    
gb|ESA17025.1|  hypothetical protein GLOINDRAFT_345271                  105   2e-21    
gb|EXX54575.1|  hypothetical protein RirG_233350                        105   2e-21    
ref|XP_003795774.1|  PREDICTED: conserved oligomeric Golgi comple...    105   2e-21    
ref|XP_003795773.1|  PREDICTED: conserved oligomeric Golgi comple...    104   3e-21    
ref|XP_011340196.1|  PREDICTED: conserved oligomeric Golgi comple...    104   3e-21    
ref|XP_003261698.2|  PREDICTED: conserved oligomeric Golgi comple...    104   3e-21    
gb|ELR49362.1|  Conserved oligomeric Golgi complex subunit 7            103   6e-21    
gb|KFW84542.1|  Conserved oligomeric Golgi complex subunit 7            102   2e-20    
ref|XP_008926490.1|  PREDICTED: conserved oligomeric Golgi comple...    102   2e-20    
gb|KFP79541.1|  Conserved oligomeric Golgi complex subunit 7            102   2e-20    
ref|XP_011399022.1|  Conserved oligomeric Golgi complex subunit 7       100   3e-20    
gb|EFZ22757.1|  hypothetical protein SINV_01051                         101   4e-20    
gb|KFM79728.1|  Conserved oligomeric Golgi complex subunit 7          94.7    6e-20    
ref|XP_009072086.1|  PREDICTED: conserved oligomeric Golgi comple...    100   1e-19    
ref|XP_009906223.1|  PREDICTED: conserved oligomeric Golgi comple...  99.4    2e-19    
ref|XP_005018689.1|  PREDICTED: conserved oligomeric Golgi comple...  99.0    3e-19    
ref|XP_004176695.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  97.8    5e-19    
ref|XP_011372750.1|  PREDICTED: conserved oligomeric Golgi comple...  97.1    1e-18    
dbj|BAB63059.1|  hypothetical protein                                 96.3    1e-18    
ref|XP_005825555.1|  oligomeric Golgi complex subunit 7               96.7    2e-18    
ref|XP_003285944.1|  hypothetical protein DICPUDRAFT_15317            96.3    2e-18    
emb|CBY32864.1|  unnamed protein product                              94.0    3e-18    
ref|XP_008202375.1|  PREDICTED: conserved oligomeric Golgi comple...  94.7    5e-18    
dbj|GAM17697.1|  hypothetical protein SAMD00019534_008720             94.4    8e-18    
ref|XP_008202376.1|  PREDICTED: conserved oligomeric Golgi comple...  94.4    8e-18    
gb|KFO84349.1|  Conserved oligomeric Golgi complex subunit 7          94.0    9e-18    
ref|XP_007084222.1|  PREDICTED: conserved oligomeric Golgi comple...  94.0    9e-18    
gb|ETN63528.1|  hypothetical protein AND_004755                       93.6    1e-17    
emb|CBY21571.1|  unnamed protein product                              93.2    2e-17    
gb|KFQ05597.1|  Conserved oligomeric Golgi complex subunit 7          93.2    2e-17    
gb|KFQ99971.1|  Conserved oligomeric Golgi complex subunit 7          91.7    5e-17    
gb|KFV17186.1|  Conserved oligomeric Golgi complex subunit 7          91.3    6e-17    
gb|KFV44518.1|  Conserved oligomeric Golgi complex subunit 7          91.3    7e-17    
gb|KFW91579.1|  Conserved oligomeric Golgi complex subunit 7          91.3    8e-17    
gb|KFZ48154.1|  Conserved oligomeric Golgi complex subunit 7          91.3    8e-17    
gb|KFP10525.1|  Conserved oligomeric Golgi complex subunit 7          90.9    8e-17    
gb|KFQ70547.1|  Conserved oligomeric Golgi complex subunit 7          90.9    8e-17    
gb|KFR08003.1|  Conserved oligomeric Golgi complex subunit 7          90.9    9e-17    
gb|EHJ78638.1|  putative component of oligomeric golgi complex 7      90.9    9e-17    
gb|KFP88492.1|  Conserved oligomeric Golgi complex subunit 7          90.9    1e-16    
ref|XP_002073360.1|  GK14089                                          90.9    1e-16    
gb|KFP63966.1|  Conserved oligomeric Golgi complex subunit 7          90.5    1e-16    
gb|KFQ47789.1|  Conserved oligomeric Golgi complex subunit 7          90.1    2e-16    
gb|KFZ67320.1|  Conserved oligomeric Golgi complex subunit 7          90.1    2e-16    
gb|KFQ52210.1|  Conserved oligomeric Golgi complex subunit 7          90.1    2e-16    
gb|KFQ77454.1|  Conserved oligomeric Golgi complex subunit 7          90.1    2e-16    
gb|KFQ15936.1|  Conserved oligomeric Golgi complex subunit 7          89.7    2e-16    
gb|KFP45453.1|  Conserved oligomeric Golgi complex subunit 7          89.7    2e-16    
ref|XP_001357618.1|  GA15960                                          89.7    2e-16    
ref|XP_002058398.1|  GJ14333                                          89.4    3e-16    
ref|XP_010144199.1|  PREDICTED: conserved oligomeric Golgi comple...  89.0    4e-16    
ref|XP_004347003.2|  hypothetical protein CAOG_05318                  89.0    4e-16    
ref|XP_009919154.1|  PREDICTED: conserved oligomeric Golgi comple...  88.2    5e-16    
gb|EEZ99445.1|  hypothetical protein TcasGA2_TC030721                 88.6    5e-16    
ref|XP_009919152.1|  PREDICTED: conserved oligomeric Golgi comple...  88.2    6e-16    
ref|XP_005443671.1|  PREDICTED: conserved oligomeric Golgi comple...  89.0    6e-16    
ref|XP_005494576.1|  PREDICTED: conserved oligomeric Golgi comple...  88.2    6e-16    
ref|XP_009919150.1|  PREDICTED: conserved oligomeric Golgi comple...  88.2    8e-16    
gb|KFQ25509.1|  Conserved oligomeric Golgi complex subunit 7          87.8    9e-16    
ref|XP_011959657.1|  PREDICTED: conserved oligomeric Golgi comple...  87.8    1e-15    
ref|XP_006125865.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  87.4    1e-15    
ref|XP_005405157.1|  PREDICTED: conserved oligomeric Golgi comple...  87.4    1e-15    
ref|XP_005426090.1|  PREDICTED: conserved oligomeric Golgi comple...  87.4    1e-15    
ref|XP_011577716.1|  PREDICTED: conserved oligomeric Golgi comple...  87.0    1e-15    
ref|XP_005405154.1|  PREDICTED: conserved oligomeric Golgi comple...  86.7    2e-15    
ref|XP_008933945.1|  PREDICTED: conserved oligomeric Golgi comple...  86.7    2e-15    
ref|XP_009983312.1|  PREDICTED: conserved oligomeric Golgi comple...  86.7    2e-15    
ref|XP_001945391.2|  PREDICTED: conserved oligomeric Golgi comple...  86.7    2e-15    
ref|XP_009466130.1|  PREDICTED: conserved oligomeric Golgi comple...  86.7    2e-15    
ref|XP_002431030.1|  conserved hypothetical protein                   86.7    2e-15    
emb|CDH53396.1|  mitogen-activated protein kinase kinase              86.7    3e-15    
ref|XP_010295242.1|  PREDICTED: conserved oligomeric Golgi comple...  86.3    3e-15    
ref|XP_009503997.1|  PREDICTED: conserved oligomeric Golgi comple...  86.3    3e-15    
ref|XP_009974505.1|  PREDICTED: conserved oligomeric Golgi comple...  86.3    3e-15    
gb|KJE94721.1|  hypothetical protein CAOG_009840                      86.7    3e-15    
ref|XP_009646382.1|  PREDICTED: conserved oligomeric Golgi comple...  86.3    3e-15    
ref|XP_009815736.1|  PREDICTED: conserved oligomeric Golgi comple...  86.3    3e-15    
ref|XP_010073318.1|  PREDICTED: conserved oligomeric Golgi comple...  86.3    3e-15    
ref|XP_009665180.1|  PREDICTED: conserved oligomeric Golgi comple...  85.9    3e-15    
ref|XP_001510180.1|  PREDICTED: conserved oligomeric Golgi comple...  86.3    3e-15    
ref|XP_005188405.1|  PREDICTED: conserved oligomeric Golgi comple...  86.3    3e-15    
ref|XP_010171643.1|  PREDICTED: conserved oligomeric Golgi comple...  85.9    3e-15    
ref|XP_009930601.1|  PREDICTED: conserved oligomeric Golgi comple...  85.9    4e-15    
ref|XP_009867466.1|  PREDICTED: conserved oligomeric Golgi comple...  85.9    4e-15    
ref|XP_001993908.1|  GH22206                                          85.9    4e-15    
ref|XP_010798085.1|  PREDICTED: conserved oligomeric Golgi comple...  84.7    5e-15    
ref|XP_009696306.1|  PREDICTED: conserved oligomeric Golgi comple...  85.5    5e-15    
ref|XP_005882395.1|  PREDICTED: conserved oligomeric Golgi comple...  85.5    5e-15    
gb|KFU93333.1|  Conserved oligomeric Golgi complex subunit 7          85.1    6e-15    
ref|XP_010010968.1|  PREDICTED: conserved oligomeric Golgi comple...  85.1    6e-15    
ref|XP_009585506.1|  PREDICTED: conserved oligomeric Golgi comple...  85.1    6e-15    
ref|XP_010145231.1|  PREDICTED: conserved oligomeric Golgi comple...  85.1    7e-15    
gb|KFV98617.1|  Conserved oligomeric Golgi complex subunit 7          85.1    7e-15    
ref|XP_009482406.1|  PREDICTED: conserved oligomeric Golgi comple...  85.1    7e-15    
ref|XP_009957143.1|  PREDICTED: conserved oligomeric Golgi comple...  85.1    7e-15    
ref|XP_010125973.1|  PREDICTED: conserved oligomeric Golgi comple...  84.7    8e-15    
gb|KFB52038.1|  AGAP004439-PA-like protein                            84.7    9e-15    
ref|XP_007323090.1|  hypothetical protein SERLADRAFT_418038           84.3    2e-14    
gb|KGB34884.1|  Conserved oligomeric Golgi complex subunit 7          82.8    2e-14    
emb|CDS12214.1|  hypothetical protein LRAMOSA04409                    83.6    2e-14    
ref|XP_010731364.1|  PREDICTED: conserved oligomeric Golgi comple...  82.8    4e-14    
ref|XP_011186252.1|  PREDICTED: conserved oligomeric Golgi comple...  82.8    4e-14    
ref|XP_009428772.1|  PREDICTED: conserved oligomeric Golgi comple...  82.0    6e-14    
ref|XP_005405156.1|  PREDICTED: conserved oligomeric Golgi comple...  82.0    6e-14    
ref|XP_005063464.1|  PREDICTED: conserved oligomeric Golgi comple...  82.0    6e-14    
ref|XP_001955508.1|  GF16218                                          82.0    7e-14    
gb|EAW55830.1|  component of oligomeric golgi complex 7, isoform ...  82.0    7e-14    
ref|XP_010985221.1|  PREDICTED: conserved oligomeric Golgi comple...  82.0    7e-14    
ref|XP_011916366.1|  PREDICTED: conserved oligomeric Golgi comple...  82.0    8e-14    
gb|EJU00574.1|  hypothetical protein DACRYDRAFT_80789                 82.0    8e-14    
ref|XP_012008217.1|  PREDICTED: conserved oligomeric Golgi comple...  81.6    9e-14    
ref|XP_011207193.1|  PREDICTED: conserved oligomeric Golgi comple...  81.3    1e-13    
ref|XP_001981279.1|  GG11984                                          81.3    1e-13    
ref|XP_002001440.1|  GI21972                                          81.3    1e-13    
ref|XP_010339086.1|  PREDICTED: conserved oligomeric Golgi comple...  81.3    1e-13    
ref|XP_313727.3|  AGAP004439-PA                                       80.5    2e-13    
ref|XP_010000872.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    2e-13    
ref|NP_651750.1|  Cog7                                                80.5    2e-13    
gb|EPQ17692.1|  Conserved oligomeric Golgi complex subunit 7          80.5    2e-13    
gb|ERL93874.1|  hypothetical protein D910_11160                       80.1    3e-13    
gb|ELK37852.1|  Conserved oligomeric Golgi complex subunit 7          80.1    3e-13    
ref|XP_002911600.1|  hypothetical protein CC1G_14133                  80.1    3e-13    
ref|XP_002037280.1|  GM12202                                          79.7    3e-13    
ref|XP_002105431.1|  GD17535                                          79.7    4e-13    
gb|KDQ27716.1|  hypothetical protein PLEOSDRAFT_1042517               79.7    4e-13    
ref|XP_002098511.1|  GE10410                                          79.3    6e-13    
ref|XP_011562572.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    7e-13    
ref|XP_004925156.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-12    
ref|XP_005141261.1|  PREDICTED: conserved oligomeric Golgi comple...  76.3    4e-12    
ref|XP_004535745.1|  PREDICTED: conserved oligomeric Golgi comple...  76.3    6e-12    
gb|KFD70340.1|  hypothetical protein M514_06928                       72.0    1e-10    
gb|KIK67210.1|  hypothetical protein GYMLUDRAFT_857700                72.0    1e-10    
gb|KDR75221.1|  hypothetical protein GALMADRAFT_122928                72.0    2e-10    
gb|KJA20734.1|  hypothetical protein HYPSUDRAFT_55890                 72.0    2e-10    
emb|CBJ26225.1|  similar to Conserved oligomeric Golgi complex su...  71.6    2e-10    
gb|KFD52215.1|  hypothetical protein M513_06928                       71.6    2e-10    
ref|XP_007370499.1|  hypothetical protein DICSQDRAFT_140955           71.2    3e-10    
ref|XP_011567455.1|  PREDICTED: conserved oligomeric Golgi comple...  68.9    3e-10    
ref|XP_003030457.1|  hypothetical protein SCHCODRAFT_57227            68.6    2e-09    
gb|KIM77400.1|  hypothetical protein PILCRDRAFT_91140                 68.6    2e-09    
emb|CBK24341.2|  unnamed protein product                              67.0    3e-09    
ref|XP_001844946.1|  conserved hypothetical protein                   68.2    3e-09    
ref|XP_007328323.1|  hypothetical protein AGABI1DRAFT_119285          68.2    3e-09    
gb|EPS95322.1|  hypothetical protein FOMPIDRAFT_20550                 67.8    3e-09    
ref|XP_002610087.1|  hypothetical protein BRAFLDRAFT_115206           67.4    4e-09    
ref|XP_007844055.1|  component of oligomeric golgi complex 7          67.4    5e-09    
gb|KII83859.1|  hypothetical protein PLICRDRAFT_47054                 67.4    6e-09    
gb|EKC98105.1|  hypothetical protein A1Q2_07651                       67.0    7e-09    
gb|EJT49379.1|  hypothetical protein A1Q1_01581                       67.0    7e-09    
gb|KFH66525.1|  hypothetical protein MVEG_07050                       67.0    8e-09    
emb|CDO69070.1|  hypothetical protein BN946_scf184992.g19             66.6    9e-09    
ref|XP_006460818.1|  hypothetical protein AGABI2DRAFT_204063          66.6    9e-09    
ref|XP_007433967.1|  PREDICTED: conserved oligomeric Golgi comple...  62.4    1e-08    
ref|XP_001652664.1|  AAEL007307-PA                                    65.9    1e-08    
emb|CCM00447.1|  predicted protein                                    65.5    2e-08    
ref|XP_011774333.1|  hypothetical protein, conserved                  64.7    4e-08    
ref|XP_845669.1|  hypothetical protein                                64.7    4e-08    
emb|CEL62710.1|  Conserved oligomeric Golgi complex subunit 7 OS=...  64.7    4e-08    
ref|XP_008040978.1|  hypothetical protein TRAVEDRAFT_30567            64.7    5e-08    
gb|ENN72950.1|  hypothetical protein YQE_10421                        61.6    5e-08    
gb|KDN35150.1|  hypothetical protein RSAG8_11838                      64.3    5e-08    
dbj|GAN08447.1|  hypothetical protein MAM1_0205d07959                 63.2    5e-08    
ref|XP_007271520.1|  hypothetical protein FOMMEDRAFT_114459           63.9    7e-08    
gb|KIJ50489.1|  hypothetical protein M422DRAFT_27443                  63.9    8e-08    
gb|KIL65963.1|  hypothetical protein M378DRAFT_76263                  63.5    1e-07    
gb|KIK39828.1|  hypothetical protein CY34DRAFT_14142                  63.2    1e-07    
gb|ELU44402.1|  COG7 domain-containing protein                        62.8    2e-07    
gb|KIY44451.1|  hypothetical protein FISHEDRAFT_51354                 62.8    2e-07    
gb|KIM45255.1|  hypothetical protein M413DRAFT_441937                 62.0    3e-07    
gb|KDQ16859.1|  hypothetical protein BOTBODRAFT_186473                62.0    3e-07    



>ref|XP_004238762.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Solanum 
lycopersicum]
 gb|AIU51145.1| embryo yellow protein, partial [Solanum lycopersicum]
Length=835

 Score =   501 bits (1290),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 247/287 (86%), Positives = 269/287 (94%), Gaps = 2/287 (1%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MMVDLSSFSDEKFDPK+WIN ACQSRHPQDPLDKHL+DLEMKLQM SEEIA SLEE S++
Sbjct  1    MMVDLSSFSDEKFDPKKWINSACQSRHPQDPLDKHLIDLEMKLQMVSEEIAASLEEQSSA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRA RDVIRLRDDALSLRSS+S+ILQKL+KAEGSSAESVATLAKVDTVKRRMEAA
Sbjct  61   ALLRVPRANRDVIRLRDDALSLRSSLSAILQKLKKAEGSSAESVATLAKVDTVKRRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLSSTVE+VF+SGDLPRAAETLANMRHCLSAVGEVAEFANIR+QLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEEVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRRQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLDS+VQPRLTDALSNRKVDVAQEMR+IL RIGRFKSLE+ Y+ VHLKPIK LWEDF+L
Sbjct  181  DRLDSVVQPRLTDALSNRKVDVAQEMRAILLRIGRFKSLEMHYTMVHLKPIKRLWEDFDL  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQQANKV+NEK+E++RLS++ + Q   S ISFS WL SFYDELLLYL
Sbjct  241  RQQANKVANEKSEMDRLSNSQDFQ--PSMISFSSWLTSFYDELLLYL  285



>ref|XP_006357255.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Solanum tuberosum]
 gb|AIU51134.1| embryo yellow protein, partial [Solanum tuberosum]
Length=835

 Score =   499 bits (1284),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 248/287 (86%), Positives = 268/287 (93%), Gaps = 2/287 (1%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MMVDLSSFSDEKFDPK+WIN ACQSRHPQDPLDKHL+DLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMVDLSSFSDEKFDPKKWINSACQSRHPQDPLDKHLMDLEMKLQMVSEEIAASLEEQSAA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRA RDVIRLRDDALSLRSS+S+IL KL+KAEGSSAESVATLAKVDTVKRRMEAA
Sbjct  61   ALLRVPRANRDVIRLRDDALSLRSSLSAILLKLKKAEGSSAESVATLAKVDTVKRRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLSSTVE+VF+SGDLPRAAETLANMRHCLSAVGEVAEFANIR+QLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEEVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRRQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLDS+VQPRLTDALSNRKVDVAQEMR+IL RIGRFKSLEL Y+ VHLKPIK LWEDF+L
Sbjct  181  DRLDSVVQPRLTDALSNRKVDVAQEMRAILLRIGRFKSLELHYTMVHLKPIKRLWEDFDL  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQQANKV+NEK+E++RLS++ + Q   S ISFS WL SFYDELLLYL
Sbjct  241  RQQANKVANEKSEMDRLSNSQDFQ--PSMISFSSWLTSFYDELLLYL  285



>ref|XP_009786961.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nicotiana 
sylvestris]
Length=834

 Score =   493 bits (1268),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 244/287 (85%), Positives = 265/287 (92%), Gaps = 2/287 (1%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MMVDLSSFSDEKFDPK+WIN   QSRHPQDP+DKHLVDLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMVDLSSFSDEKFDPKKWINEVFQSRHPQDPVDKHLVDLEMKLQMVSEEIAASLEEQSAA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPR TRDV RLRDDAL+LRS++S+IL KL+KAEGSSAESVATLAKVD VKRRMEAA
Sbjct  61   ALLRVPRTTRDVSRLRDDALTLRSALSAILLKLKKAEGSSAESVATLAKVDAVKRRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANM HCL+AVGEVAEFANIR+QLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMSHCLAAVGEVAEFANIRRQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLDSMVQPRLTDALSNRKVDVAQEMR+IL RIGRFKSLEL Y+KVH+KPIK LWEDF+L
Sbjct  181  DRLDSMVQPRLTDALSNRKVDVAQEMRAILLRIGRFKSLELHYTKVHIKPIKRLWEDFDL  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQQANKV+NEK+E ERLS+A +   +SS ISFS WLP+FYDELLLYL
Sbjct  241  RQQANKVANEKSETERLSNAQD--FHSSMISFSSWLPNFYDELLLYL  285



>ref|XP_006587679.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X2 [Glycine max]
Length=636

 Score =   485 bits (1248),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 236/287 (82%), Positives = 260/287 (91%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL SFS+E FDPK+WIN ACQSRHPQD LDKHLVD+EMKLQM SEEIA SLEE S++
Sbjct  1    MMLDLGSFSNENFDPKKWINSACQSRHPQDSLDKHLVDMEMKLQMVSEEIAASLEEQSSA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD+MVQPRLTDALSNRKVD AQ++R IL RIGRFKSLE QY KVHLKPIK LWEDF+ 
Sbjct  181  DRLDNMVQPRLTDALSNRKVDAAQDLRGILIRIGRFKSLESQYIKVHLKPIKQLWEDFDS  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            R++A+K +NEKNE+ER SS ++ Q  S  I FS WLPSFYDELLLYL
Sbjct  241  RERASKSANEKNEMERTSSGDDFQSVSPAIPFSSWLPSFYDELLLYL  287



>emb|CAN76413.1| hypothetical protein VITISV_043812 [Vitis vinifera]
Length=444

 Score =   476 bits (1225),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 234/287 (82%), Positives = 260/287 (91%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DLS+FS+EKFD K+WIN ACQ+RHPQ+ L+K LVDLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMIDLSAFSEEKFDAKKWINTACQNRHPQETLEKQLVDLEMKLQMMSEEIAASLEEQSAA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDVIRLRDDA+SLR SVSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRHSVSSILLKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLSSTVEDVF+SGDLP+AAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPKAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLDSMVQPRLTDALSNRKV+VAQ++R IL RIGRFKSLE  Y+KVHLKPI+ LWEDF+ 
Sbjct  181  DRLDSMVQPRLTDALSNRKVEVAQDLRGILIRIGRFKSLEAHYTKVHLKPIRQLWEDFDS  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+ NK++NEKNEVERL S+N+ Q     ISFS WLPSFYDELLLYL
Sbjct  241  KQRTNKLANEKNEVERLLSSNDFQSILPTISFSSWLPSFYDELLLYL  287



>ref|XP_004506344.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Cicer arietinum]
Length=835

 Score =   488 bits (1255),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 237/287 (83%), Positives = 259/287 (90%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MMVDL  FS+E FDPK+WIN ACQSRHPQ+ LDKHLVDLEMKLQM SEEI  SLEE SA+
Sbjct  1    MMVDLFPFSNENFDPKKWINSACQSRHPQESLDKHLVDLEMKLQMVSEEITASLEEQSAA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDVIRLRDD++SLRS+VSSILQKL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDSVSLRSAVSSILQKLKKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD+MVQPRLTDALSNRKVD AQ++R IL RIGRFKSLE QY+KVHLKPIK LWEDFE 
Sbjct  181  DRLDTMVQPRLTDALSNRKVDAAQDLRGILIRIGRFKSLESQYTKVHLKPIKQLWEDFES  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            R++ANK +NEKNE+ER SS  + Q  S  +SFS WLP+FYDELLLYL
Sbjct  241  RERANKSANEKNEIERTSSGGDFQSVSPTMSFSNWLPNFYDELLLYL  287



>ref|XP_010062284.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Eucalyptus grandis]
 gb|KCW90838.1| hypothetical protein EUGRSUZ_A02893 [Eucalyptus grandis]
 gb|AIU51118.1| embryo yellow protein, partial [Eucalyptus grandis]
Length=838

 Score =   487 bits (1254),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 233/287 (81%), Positives = 263/287 (92%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDEKFDPK+WIN ACQ+RHPQD L+KHLVDLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMLDLGPFSDEKFDPKRWINSACQARHPQDSLEKHLVDLEMKLQMTSEEIAASLEEQSAA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRD++RLRDDA+SLR SVS ILQKL+KAEGSSAES++ LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRATRDIVRLRDDAVSLRHSVSGILQKLKKAEGSSAESISALAKVDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAA+TLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAADTLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD+MVQPRLTDALSNRKV+VAQ++R IL RIGRFKSLELQY+KVH+KPIK LWEDF+ 
Sbjct  181  DRLDNMVQPRLTDALSNRKVEVAQDLRGILIRIGRFKSLELQYTKVHMKPIKKLWEDFDS  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+A+K++N+KNE ERLSS+   Q N   +SFS WLPSFYDELLLYL
Sbjct  241  KQRASKMANDKNETERLSSSTNFQQNVQTVSFSSWLPSFYDELLLYL  287



>emb|CDP05334.1| unnamed protein product [Coffea canephora]
Length=845

 Score =   486 bits (1251),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 244/287 (85%), Positives = 269/287 (94%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MMVDLS+FSDEKFDPK+WING CQSRHPQDPLDKHLVDLEMKLQM SEEIA SLEE S++
Sbjct  1    MMVDLSAFSDEKFDPKRWINGVCQSRHPQDPLDKHLVDLEMKLQMVSEEIAASLEEQSSA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDVIRLRDDALSLRSSV+SILQKL KAEGSSAES+ATLAKVDTVKRRMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDALSLRSSVASILQKLIKAEGSSAESIATLAKVDTVKRRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLDSMVQPRLTDAL+NRK+DVA++MR IL RIGRFKSLE+ Y+KVHLK IK LWE+++L
Sbjct  181  DRLDSMVQPRLTDALTNRKIDVAKDMRGILIRIGRFKSLEMHYTKVHLKSIKKLWEEYDL  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQQA+K++NEKNE+ER SS ++ Q +S+  SFS WLPSFYDELLLYL
Sbjct  241  RQQASKLANEKNELERFSSGHDSQSSSTRFSFSSWLPSFYDELLLYL  287



>ref|XP_009625424.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nicotiana 
tomentosiformis]
Length=835

 Score =   485 bits (1248),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 239/287 (83%), Positives = 262/287 (91%), Gaps = 2/287 (1%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            M  DLSSFSDEKFDPK+WINGACQSR+PQDP+ KHL+DLEMKLQM SEEIA SLEE SA+
Sbjct  1    MFGDLSSFSDEKFDPKKWINGACQSRNPQDPVVKHLMDLEMKLQMVSEEIAASLEEQSAA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPR TRDV RLRDD+L+LRS++S+IL KL+KAEGSSAESVATLAKVD VKRRMEAA
Sbjct  61   ALLRVPRTTRDVSRLRDDSLTLRSALSAILLKLKKAEGSSAESVATLAKVDAVKRRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCL+AVGEVAEFANIR+QLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLAAVGEVAEFANIRRQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLDSMVQPRLTDALSNRKVDVAQEMR+IL RIGRFKSLE+ Y+  H+KPIK  WEDF L
Sbjct  181  DRLDSMVQPRLTDALSNRKVDVAQEMRAILLRIGRFKSLEIHYTNFHIKPIKRHWEDFNL  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQQANKV+NEK+E ERLS+A +   +SS ISFS WLPSFYDELLLYL
Sbjct  241  RQQANKVANEKSETERLSNAQD--FHSSTISFSSWLPSFYDELLLYL  285



>gb|KEH17632.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=834

 Score =   484 bits (1247),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 236/287 (82%), Positives = 259/287 (90%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MMVDLS FS+E FDPK+WIN ACQSRHP++ LDKHLVDLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMVDLSPFSNENFDPKKWINSACQSRHPEESLDKHLVDLEMKLQMVSEEIAASLEEQSAA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDVIRLRDDA+SLRS+VS+ILQKL+KAEGSS+ES++ LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSAILQKLKKAEGSSSESISALAKVDVVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQL+VLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLQVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD+MVQPRLTDALSNRKVD AQ++R IL RIGRFKSLE QYSKVHLKPIK LWEDFE 
Sbjct  181  DRLDTMVQPRLTDALSNRKVDAAQDLRGILIRIGRFKSLESQYSKVHLKPIKQLWEDFES  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            R++ANK +NEKNE+ER SS    Q     +SFS WLPSFYDELLLYL
Sbjct  241  RERANKSANEKNEMERTSSGGGFQSIPPALSFSNWLPSFYDELLLYL  287



>gb|AIU51131.1| embryo yellow protein, partial [Manihot esculenta]
Length=833

 Score =   484 bits (1246),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 235/287 (82%), Positives = 262/287 (91%), Gaps = 3/287 (1%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDEKFDPK+WIN ACQ+RHPQ+ LDKHLVDLEMKLQM SEEIAVSLEE SA+
Sbjct  1    MMLDLGPFSDEKFDPKKWINSACQTRHPQESLDKHLVDLEMKLQMVSEEIAVSLEEQSAA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            +L RVPRATRDVIRLRDDA+SLR+SVS ILQKL+KAEGSSAES+A LAKVDTVK+RME A
Sbjct  61   SLLRVPRATRDVIRLRDDAVSLRNSVSGILQKLKKAEGSSAESIAALAKVDTVKQRMETA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
             RLD+MVQPRLTDALSNRKVD AQ++R IL RIGRFKSLE+ Y+KVHL+PIK LWEDF+ 
Sbjct  181  SRLDAMVQPRLTDALSNRKVDTAQDLRGILIRIGRFKSLEMHYTKVHLEPIKQLWEDFDS  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQQA+K + EKNE+E+LS +N+L   S+ +SFS WLPSFYDELLLYL
Sbjct  241  RQQASKFAGEKNELEKLSGSNDL---STTVSFSSWLPSFYDELLLYL  284



>gb|EYU24953.1| hypothetical protein MIMGU_mgv1a001327mg [Erythranthe guttata]
 gb|AIU51132.1| embryo yellow protein, partial [Erythranthe guttata]
Length=839

 Score =   484 bits (1246),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 239/287 (83%), Positives = 264/287 (92%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MMVDLSSFS+EKFDPK+WINGA Q RHPQDP++KHLVDLEMKLQM SEEIA SLEE S+S
Sbjct  1    MMVDLSSFSEEKFDPKRWINGAVQQRHPQDPVEKHLVDLEMKLQMVSEEIASSLEEQSSS  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRA+RDV+RLRDDALSLRSSV++IL  L+KAEGSSAES+ATLAKVDTVKRRMEAA
Sbjct  61   ALLRVPRASRDVLRLRDDALSLRSSVANILLFLKKAEGSSAESIATLAKVDTVKRRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCL+AVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLTAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLDSMVQPRLTDAL+N+KV+VAQEMR IL RIGRFKSLE  Y+KVHLKPIK LWEDFEL
Sbjct  181  DRLDSMVQPRLTDALNNKKVNVAQEMRGILIRIGRFKSLESYYTKVHLKPIKKLWEDFEL  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQQ+NK++NE +E+ R+SS    Q +   ISFSRWLP+FYDELLLYL
Sbjct  241  RQQSNKLANENHEMGRVSSNFGSQSSLPIISFSRWLPNFYDELLLYL  287



>ref|XP_003534367.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X1 [Glycine max]
Length=834

 Score =   484 bits (1245),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 236/287 (82%), Positives = 260/287 (91%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL SFS+E FDPK+WIN ACQSRHPQD LDKHLVD+EMKLQM SEEIA SLEE S++
Sbjct  1    MMLDLGSFSNENFDPKKWINSACQSRHPQDSLDKHLVDMEMKLQMVSEEIAASLEEQSSA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD+MVQPRLTDALSNRKVD AQ++R IL RIGRFKSLE QY KVHLKPIK LWEDF+ 
Sbjct  181  DRLDNMVQPRLTDALSNRKVDAAQDLRGILIRIGRFKSLESQYIKVHLKPIKQLWEDFDS  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            R++A+K +NEKNE+ER SS ++ Q  S  I FS WLPSFYDELLLYL
Sbjct  241  RERASKSANEKNEMERTSSGDDFQSVSPAIPFSSWLPSFYDELLLYL  287



>gb|AIU51119.1| embryo yellow protein, partial [Glycine max]
Length=833

 Score =   484 bits (1245),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 236/287 (82%), Positives = 260/287 (91%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL SFS+E FDPK+WIN ACQSRHPQD LDKHLVD+EMKLQM SEEIA SLEE S++
Sbjct  1    MMLDLGSFSNENFDPKKWINSACQSRHPQDSLDKHLVDMEMKLQMVSEEIAASLEEQSSA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD+MVQPRLTDALSNRKVD AQ++R IL RIGRFKSLE QY KVHLKPIK LWEDF+ 
Sbjct  181  DRLDNMVQPRLTDALSNRKVDAAQDLRGILIRIGRFKSLESQYIKVHLKPIKQLWEDFDS  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            R++A+K +NEKNE+ER SS ++ Q  S  I FS WLPSFYDELLLYL
Sbjct  241  RERASKSANEKNEMERTSSGDDFQSVSPAIPFSSWLPSFYDELLLYL  287



>ref|XP_012090445.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Jatropha 
curcas]
 gb|KDP22425.1| hypothetical protein JCGZ_26256 [Jatropha curcas]
Length=832

 Score =   483 bits (1243),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 237/287 (83%), Positives = 263/287 (92%), Gaps = 4/287 (1%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDEKFDPK+WIN AC+SRHPQ+ LDKHLVDLEMKLQM SEEIAVSLEE SA+
Sbjct  1    MMLDLGPFSDEKFDPKKWINSACKSRHPQESLDKHLVDLEMKLQMVSEEIAVSLEEQSAT  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            +L RVPRATRDVIRLRDDALSLR+SVSSILQKL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   SLLRVPRATRDVIRLRDDALSLRNSVSSILQKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YRTLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD+MVQPRL DALSNRKVD+AQ++R IL RIGRFKSLE+ Y+KVHLKPIK LWEDF+ 
Sbjct  181  DRLDAMVQPRLMDALSNRKVDIAQDLRGILIRIGRFKSLEMHYTKVHLKPIKQLWEDFDS  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQ+ANKV++E++E+ERLSS  +L      ISFS WLPSFYDELLLYL
Sbjct  241  RQRANKVASEEHEMERLSSNTDLH----TISFSSWLPSFYDELLLYL  283



>ref|XP_006490119.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Citrus sinensis]
Length=835

 Score =   482 bits (1241),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 233/287 (81%), Positives = 260/287 (91%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDEKFDPK+WIN ACQ+RH QD LD HLVDLEMKLQM SEEI+ SLEE SAS
Sbjct  1    MMLDLGPFSDEKFDPKKWINSACQTRHSQDSLDNHLVDLEMKLQMVSEEISASLEEQSAS  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RLRDDA+SLR SVS ILQKL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVVRLRDDAISLRGSVSGILQKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSLTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD+MVQPRLTDALSNRK+D+A+++R IL RIGRFKSLEL Y+KVHLK IK LWE+FE 
Sbjct  181  DRLDAMVQPRLTDALSNRKIDIARDLRGILIRIGRFKSLELHYTKVHLKYIKQLWEEFES  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQ+++K++NEKNEVER+SS NE Q ++  + FS WLPSFYDELLLYL
Sbjct  241  RQRSSKIANEKNEVERISSNNEFQSSAPSVMFSSWLPSFYDELLLYL  287



>gb|KHN11738.1| Conserved oligomeric Golgi complex subunit 7 [Glycine soja]
Length=834

 Score =   481 bits (1238),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 235/287 (82%), Positives = 259/287 (90%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL SFS+E FDPK+WIN ACQSRHPQD LDKHLVD+EMKLQM SEEIA SLEE S++
Sbjct  1    MMLDLGSFSNENFDPKKWINSACQSRHPQDSLDKHLVDMEMKLQMVSEEIAASLEEQSSA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD+MVQPRLTDALSNRKVD AQ++R IL RIGRFKSLE QY KVHLKPIK LWE F+ 
Sbjct  181  DRLDNMVQPRLTDALSNRKVDAAQDLRGILIRIGRFKSLESQYIKVHLKPIKQLWEGFDS  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            R++A+K +NEKNE+ER SS ++ Q  S  I FS WLPSFYDELLLYL
Sbjct  241  RERASKSANEKNEMERTSSGDDFQSVSPAIPFSSWLPSFYDELLLYL  287



>gb|AIU51115.1| embryo yellow protein, partial [Carica papaya]
Length=839

 Score =   481 bits (1238),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 231/287 (80%), Positives = 260/287 (91%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSD+KFDPK+W+N ACQ+RHPQD L+KH+VDLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMLDLGPFSDDKFDPKKWMNSACQARHPQDSLEKHMVDLEMKLQMVSEEIAASLEEQSAA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSS+ES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVVRLRDDAVSLRSSVAGILQKLKKAEGSSSESIAALAKVDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD+MVQPRLTDALSNRK+D AQ++R IL RIGRF+SLEL Y+KVHLK IK LWEDF+ 
Sbjct  181  DRLDAMVQPRLTDALSNRKIDTAQDLRGILIRIGRFRSLELHYTKVHLKKIKSLWEDFDA  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQ+ NKV+NEKNE ER SS NEL  +   +SFS WLPSFYDELLLY+
Sbjct  241  RQRTNKVANEKNEFERPSSNNELVSSLPTVSFSSWLPSFYDELLLYI  287



>ref|XP_006421663.1| hypothetical protein CICLE_v10004313mg [Citrus clementina]
 gb|ESR34903.1| hypothetical protein CICLE_v10004313mg [Citrus clementina]
 gb|AIU51113.1| embryo yellow protein, partial [Citrus clementina]
Length=835

 Score =   481 bits (1237),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 232/287 (81%), Positives = 260/287 (91%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDEKFDPK+WIN ACQ+RH QD LD HLVDLEMKLQM SEEI+ SLEE SAS
Sbjct  1    MMLDLGPFSDEKFDPKKWINSACQTRHSQDSLDNHLVDLEMKLQMVSEEISASLEEQSAS  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RLRDDA+SLR SVS ILQKL+KAEGSSAES+A L+KVDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVVRLRDDAISLRGSVSGILQKLKKAEGSSAESIAALSKVDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSLTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD+MVQPRLTDALSNRK+D+A+++R IL RIGRFKSLEL Y+KVHLK IK LWE+FE 
Sbjct  181  DRLDAMVQPRLTDALSNRKIDIARDLRGILIRIGRFKSLELHYTKVHLKYIKQLWEEFES  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQ+++K++NEKNEVER+SS NE Q ++  + FS WLPSFYDELLLYL
Sbjct  241  RQRSSKIANEKNEVERISSNNEFQSSAPSVMFSSWLPSFYDELLLYL  287



>ref|XP_011033997.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Populus euphratica]
 ref|XP_011010844.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Populus euphratica]
Length=831

 Score =   481 bits (1237),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 231/286 (81%), Positives = 262/286 (92%), Gaps = 4/286 (1%)
 Frame = +3

Query  84   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  263
            M+DL  FSD+KFDPK+WIN AC++RHPQ+ LDKHLVDLEMKLQM SEEIA SLEE SA+A
Sbjct  1    MLDLGPFSDDKFDPKKWINSACKTRHPQESLDKHLVDLEMKLQMVSEEIAASLEEQSAAA  60

Query  264  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  443
            L RVPRATRDV+RLRDDA+SLR+SVSSILQKL+KAEG+SAES+A LAKVDTVK+RMEAAY
Sbjct  61   LLRVPRATRDVVRLRDDAVSLRTSVSSILQKLKKAEGTSAESIAALAKVDTVKQRMEAAY  120

Query  444  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  623
            ETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLED
Sbjct  121  ETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLED  180

Query  624  RLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFELR  803
            RLDSMVQPRL DALSNRKVDVAQ++R IL RIGRFKSLE+ Y+KVHLKP++ LWEDFE R
Sbjct  181  RLDSMVQPRLMDALSNRKVDVAQDLRGILMRIGRFKSLEMHYTKVHLKPLRQLWEDFETR  240

Query  804  QQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            Q ANK+++E+NE++RLS +N    +S  ISF+ WLPSFYDELLLYL
Sbjct  241  QHANKLASERNEMDRLSGSN----DSQAISFASWLPSFYDELLLYL  282



>gb|KDO65493.1| hypothetical protein CISIN_1g003266mg [Citrus sinensis]
 gb|AIU51117.1| embryo yellow protein, partial [Citrus sinensis]
Length=835

 Score =   481 bits (1237),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 232/287 (81%), Positives = 260/287 (91%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDEKFDPK+WIN ACQ+RH QD LD HLVDLEMKLQM SEEI+ SLEE SAS
Sbjct  1    MMLDLGPFSDEKFDPKKWINSACQTRHSQDSLDNHLVDLEMKLQMVSEEISASLEEQSAS  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RLRDDA+SLR SVS ILQKL+KAEGSSAES+A L+KVDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVVRLRDDAISLRGSVSGILQKLKKAEGSSAESIAALSKVDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSLTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD+MVQPRLTDALSNRK+D+A+++R IL RIGRFKSLEL Y+KVHLK IK LWE+FE 
Sbjct  181  DRLDAMVQPRLTDALSNRKIDIARDLRGILIRIGRFKSLELHYTKVHLKYIKQLWEEFES  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQ+++K++NEKNEVER+SS NE Q ++  + FS WLPSFYDELLLYL
Sbjct  241  RQRSSKIANEKNEVERISSNNEFQSSAPSVMFSSWLPSFYDELLLYL  287



>gb|AIU51110.1| embryo yellow protein, partial [Theobroma cacao]
Length=831

 Score =   479 bits (1233),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 230/287 (80%), Positives = 264/287 (92%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDEKFDPK+WIN AC+SRHPQD LDKH+VDLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMLDLGPFSDEKFDPKKWINSACKSRHPQDSLDKHMVDLEMKLQMVSEEIAASLEEQSAA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRA+RDV+RLR+DA+SLR SV+ IL KL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVLRLREDAVSLRISVAGILDKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD+MVQPRLTDALSNRK+DVAQ++R IL RIGRFKSLE+ Y+KVHLKPIK LW+DF+ 
Sbjct  181  DRLDTMVQPRLTDALSNRKIDVAQDLRGILIRIGRFKSLEMHYTKVHLKPIKQLWDDFDS  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+A+K++NEK+EVERLS +N+L+ +S  + FS WLPSFYDELLLYL
Sbjct  241  KQRASKLANEKSEVERLSISNDLRSSSPTVFFSSWLPSFYDELLLYL  287



>ref|XP_007038383.1| Oligomeric Golgi complex component-related / COG complex component-related 
[Theobroma cacao]
 gb|EOY22884.1| Oligomeric Golgi complex component-related / COG complex component-related 
[Theobroma cacao]
Length=832

 Score =   479 bits (1233),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 230/287 (80%), Positives = 264/287 (92%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDEKFDPK+WIN AC+SRHPQD LDKH+VDLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMLDLGPFSDEKFDPKKWINSACKSRHPQDSLDKHMVDLEMKLQMVSEEIAASLEEQSAA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRA+RDV+RLR+DA+SLR SV+ IL KL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVLRLREDAVSLRISVAGILDKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD+MVQPRLTDALSNRK+DVAQ++R IL RIGRFKSLE+ Y+KVHLKPIK LW+DF+ 
Sbjct  181  DRLDTMVQPRLTDALSNRKIDVAQDLRGILIRIGRFKSLEMHYTKVHLKPIKQLWDDFDS  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+A+K++NEK+EVERLS +N+L+ +S  + FS WLPSFYDELLLYL
Sbjct  241  KQRASKLANEKSEVERLSISNDLRSSSPTVFFSSWLPSFYDELLLYL  287



>gb|KHN46499.1| Conserved oligomeric Golgi complex subunit 7 [Glycine soja]
Length=834

 Score =   478 bits (1229),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 233/287 (81%), Positives = 257/287 (90%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FS+E FDPK+WIN ACQSRHPQD LDKHLVD+EMKLQM SEEIA SLEE S++
Sbjct  1    MMLDLGPFSNENFDPKKWINSACQSRHPQDSLDKHLVDMEMKLQMVSEEIAASLEEQSSA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD+MVQPRL DALSNRKVD AQ++R IL RIGRFKSLE QY KVHLKPIK LWEDF+ 
Sbjct  181  DRLDNMVQPRLMDALSNRKVDAAQDLRGILIRIGRFKSLESQYVKVHLKPIKQLWEDFDS  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            R++A+K +NEKNE++R SS  + Q  S  I FS WLPSFYDELLLYL
Sbjct  241  RERASKPANEKNEMDRTSSGGDFQSVSPAIPFSSWLPSFYDELLLYL  287



>ref|XP_011076371.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Sesamum 
indicum]
Length=838

 Score =   477 bits (1228),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 234/287 (82%), Positives = 265/287 (92%), Gaps = 1/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MMVDLS+FS+EKFDPK+WINGA Q RHPQDP++KHLVDLEM+LQM SEEIA SLEE S++
Sbjct  1    MMVDLSAFSEEKFDPKKWINGAVQQRHPQDPVEKHLVDLEMRLQMVSEEIAASLEEQSSA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRA+RDV+RLRD+ALSLRSSV++IL  L+KAEGSSAES+ATLAKVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVLRLRDEALSLRSSVANILLFLKKAEGSSAESIATLAKVDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAA+TLANMRHCL+AVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAADTLANMRHCLTAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLDSMVQPRLTD+L+NRKV+VAQEMR IL RIGRFKSLE  Y+KVHLK IK LWE+F+L
Sbjct  181  DRLDSMVQPRLTDSLNNRKVNVAQEMRGILIRIGRFKSLESYYTKVHLKTIKKLWEEFDL  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQQ++K++NEKNEVER SS N  Q N   +SF+RWLPSFYDELLLYL
Sbjct  241  RQQSSKLANEKNEVERASSFNS-QSNMQTMSFARWLPSFYDELLLYL  286



>ref|XP_008439087.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cucumis 
melo]
Length=834

 Score =   476 bits (1226),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 230/287 (80%), Positives = 259/287 (90%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            M +DL  FS E FDPK+WIN ACQ+RHPQ+ LDKHLVDLEMKLQM SEEIA SLEELSA+
Sbjct  1    MNLDLGPFSGENFDPKKWINSACQTRHPQESLDKHLVDLEMKLQMVSEEIAASLEELSAN  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDVIRLRDDA+SLRS+VS ILQKL+KAEGSSAES+A LA+VDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSGILQKLKKAEGSSAESIAALARVDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGL QLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLAQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD+MVQPRLTDAL+NRKVDVAQ++R IL RIGRFKSLE  Y+KVHLKPIK LWEDF+ 
Sbjct  181  DRLDAMVQPRLTDALTNRKVDVAQDLRVILLRIGRFKSLEQNYTKVHLKPIKQLWEDFDS  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+A+KV+NEKNE ER ++ N+ Q +   +SF+ WLPSFYDELLLYL
Sbjct  241  KQRAHKVANEKNEYERPTTNNDFQSSFPSVSFTSWLPSFYDELLLYL  287



>ref|XP_002304412.2| conserved oligomeric Golgi complex component-related family protein 
[Populus trichocarpa]
 gb|EEE79391.2| conserved oligomeric Golgi complex component-related family protein 
[Populus trichocarpa]
 gb|AIU51135.1| embryo yellow protein, partial [Populus trichocarpa]
Length=831

 Score =   476 bits (1226),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 229/286 (80%), Positives = 262/286 (92%), Gaps = 4/286 (1%)
 Frame = +3

Query  84   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  263
            M+DL  FSD+KFDPK+WIN AC++RH Q+ LDKHLVDLEMKLQM SEEIA SLEE SA+A
Sbjct  1    MLDLGPFSDDKFDPKKWINSACKTRHQQESLDKHLVDLEMKLQMVSEEIAASLEEQSAAA  60

Query  264  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  443
            L RVPRATRDV+RLRDDA+SLR+SVSSILQKL+KAEG+SAES+A LAKVDTVK+RMEAAY
Sbjct  61   LLRVPRATRDVVRLRDDAVSLRTSVSSILQKLKKAEGTSAESIAALAKVDTVKQRMEAAY  120

Query  444  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  623
            ETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLED
Sbjct  121  ETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLED  180

Query  624  RLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFELR  803
            RLDSMVQPRL DALSNRKVD+AQ++R IL RIGRFKSLE+ Y+KVHLKP++ LWEDFE R
Sbjct  181  RLDSMVQPRLMDALSNRKVDIAQDLRGILMRIGRFKSLEMHYTKVHLKPLRQLWEDFETR  240

Query  804  QQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            Q+ANK+++E+NE++RLS +N    +S  ISF+ WLPSFYDELLLYL
Sbjct  241  QRANKLASERNEMDRLSGSN----DSPAISFASWLPSFYDELLLYL  282



>ref|XP_002267657.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Vitis 
vinifera]
 emb|CBI24597.3| unnamed protein product [Vitis vinifera]
 gb|AIU51148.1| embryo yellow protein, partial [Vitis vinifera]
Length=838

 Score =   476 bits (1226),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 234/287 (82%), Positives = 260/287 (91%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DLS+FS+EKFD K+WIN ACQ+RHPQ+ L+K LVDLEMKLQM SEEIA SLEE SA+
Sbjct  1    MMIDLSAFSEEKFDAKKWINTACQNRHPQETLEKQLVDLEMKLQMMSEEIAASLEEQSAA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDVIRLRDDA+SLR SVSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRHSVSSILLKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLSSTVEDVF+SGDLP+AAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPKAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLDSMVQPRLTDALSNRKV+VAQ++R IL RIGRFKSLE  Y+KVHLKPI+ LWEDF+ 
Sbjct  181  DRLDSMVQPRLTDALSNRKVEVAQDLRGILIRIGRFKSLEAHYTKVHLKPIRQLWEDFDS  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+ NK++NEKNEVERL S+N+ Q     ISFS WLPSFYDELLLYL
Sbjct  241  KQRTNKLANEKNEVERLLSSNDFQSILPTISFSSWLPSFYDELLLYL  287



>ref|XP_004148143.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cucumis 
sativus]
 gb|KGN57266.1| hypothetical protein Csa_3G175670 [Cucumis sativus]
Length=834

 Score =   473 bits (1218),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 228/287 (79%), Positives = 258/287 (90%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            M +DL  FS E FDPK+WIN ACQ+RHPQ+ LDKHLVDLEMKLQM SEEIA SLEELSA+
Sbjct  1    MNLDLGPFSGENFDPKKWINSACQTRHPQESLDKHLVDLEMKLQMVSEEIAASLEELSAN  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDVIRLRDDA+SLRS+VS IL KL+KAEGSSAES+A LA+VDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSGILLKLKKAEGSSAESIAALARVDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGL QLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLAQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD+MVQPRLTDAL+NRKVDVAQ++R IL RIGRFKSLE  Y+KVHLKPIK LWEDF+ 
Sbjct  181  DRLDAMVQPRLTDALTNRKVDVAQDLRVILLRIGRFKSLEQNYTKVHLKPIKQLWEDFDS  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+A+K++NEKNE ER ++ N+ Q +   +SF+ WLPSFYDELLLYL
Sbjct  241  KQRAHKIANEKNEFERPTTNNDFQSSFPSVSFTSWLPSFYDELLLYL  287



>ref|XP_007131467.1| hypothetical protein PHAVU_011G016000g [Phaseolus vulgaris]
 gb|ESW03461.1| hypothetical protein PHAVU_011G016000g [Phaseolus vulgaris]
Length=834

 Score =   473 bits (1218),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 230/287 (80%), Positives = 256/287 (89%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FS+E FDPK+WIN A QSRHPQD LDKHLVD+EMKLQM SEEIA SLEE S++
Sbjct  1    MMLDLGPFSNENFDPKKWINSASQSRHPQDSLDKHLVDMEMKLQMVSEEIAASLEEQSSA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YDTLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD+MVQPR+TDALS+RK D AQ++R+IL RIGRFKSLE QY KVHLKPIK LWEDF+ 
Sbjct  181  DRLDTMVQPRITDALSSRKADAAQDLRAILIRIGRFKSLESQYIKVHLKPIKQLWEDFDS  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            R++ NK +NEKNE+ER+SS  +    S  I FS WLPSFYDELLLYL
Sbjct  241  RERGNKPANEKNEMERISSGGDFHSVSPAIPFSTWLPSFYDELLLYL  287



>gb|AIU51138.1| embryo yellow protein, partial [Phaseolus vulgaris]
Length=833

 Score =   473 bits (1218),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 230/287 (80%), Positives = 256/287 (89%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FS+E FDPK+WIN A QSRHPQD LDKHLVD+EMKLQM SEEIA SLEE S++
Sbjct  1    MMLDLGPFSNENFDPKKWINSASQSRHPQDSLDKHLVDMEMKLQMVSEEIAASLEEQSSA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YDTLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD+MVQPR+TDALS+RK D AQ++R+IL RIGRFKSLE QY KVHLKPIK LWEDF+ 
Sbjct  181  DRLDTMVQPRITDALSSRKADAAQDLRAILIRIGRFKSLESQYIKVHLKPIKQLWEDFDS  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            R++ NK +NEKNE+ER+SS  +    S  I FS WLPSFYDELLLYL
Sbjct  241  RERGNKPANEKNEMERISSGGDFHSVSPAIPFSTWLPSFYDELLLYL  287



>gb|AIU51149.1| embryo yellow protein, partial [Lactuca sativa]
Length=827

 Score =   471 bits (1213),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 231/288 (80%), Positives = 257/288 (89%), Gaps = 3/288 (1%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL SFSDEKFD K+WIN ACQSRHPQDPLDKHLVDLEMKLQM SEEIA SLEE S++
Sbjct  1    MMIDLGSFSDEKFDAKKWINNACQSRHPQDPLDKHLVDLEMKLQMVSEEIAASLEEQSSA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            A+ RVPRATRDVIRLRDDALSLR SV SIL KL+KAEGSSAES+ATLAKVDTVKRRMEAA
Sbjct  61   AILRVPRATRDVIRLRDDALSLRQSVGSILLKLKKAEGSSAESIATLAKVDTVKRRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLSSTVEDVF+S DLPRAAETLANMRHCL+AVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASKDLPRAAETLANMRHCLTAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLDSMVQPRLTDA++NRK  VAQEMR IL RIGR+KSLE  Y+KVHLKPI+ LWED+E+
Sbjct  181  DRLDSMVQPRLTDAITNRKDKVAQEMREILIRIGRYKSLESHYTKVHLKPIRQLWEDYEM  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSP-ISFSRWLPSFYDELLLYL  941
            +QQ  K   E+N+VE +S++++ Q  S P +SF  WLPSFYD+LLLYL
Sbjct  241  KQQHTKTRTERNQVESISTSHDYQ--SPPTVSFPSWLPSFYDKLLLYL  286



>gb|AIU51114.1| embryo yellow protein, partial [Gossypium raimondii]
 gb|KJB51433.1| hypothetical protein B456_008G216000 [Gossypium raimondii]
Length=830

 Score =   470 bits (1209),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 233/287 (81%), Positives = 265/287 (92%), Gaps = 1/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDEKFDPK+WIN AC+SRHPQD LDKH+VDLEMKLQM SEEIA SLEE S++
Sbjct  1    MMLDLGPFSDEKFDPKKWINSACKSRHPQDSLDKHMVDLEMKLQMVSEEIAASLEEQSSA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RL+DDA+SLR+SV+ IL KL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLQDDAVSLRNSVAGILDKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD+MVQPRLTDALSNRKVDVAQ++R IL RIGRFKSLELQY+KVHLKPIK LW+DF+ 
Sbjct  181  DRLDTMVQPRLTDALSNRKVDVAQDLRGILIRIGRFKSLELQYTKVHLKPIKQLWDDFDS  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +++ +K++NEK+EVERLSS NE Q +S  +SFS WLP+FYDELLLYL
Sbjct  241  KKRVSKLANEKSEVERLSSNNE-QSSSLAVSFSSWLPTFYDELLLYL  286



>ref|XP_002510953.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51555.1| conserved hypothetical protein [Ricinus communis]
Length=832

 Score =   467 bits (1201),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 225/287 (78%), Positives = 259/287 (90%), Gaps = 4/287 (1%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSD+KFDPK+WIN AC+SRHPQ+ LDKHLVDLEMKLQM SEEI+ SLEE SA+
Sbjct  1    MMLDLGPFSDDKFDPKKWINSACKSRHPQESLDKHLVDLEMKLQMVSEEISASLEEQSAA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDVIRLRDDA+SLR+SVS+I QKL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVIRLRDDAVSLRNSVSAIFQKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+R+QLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRRQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD+MVQPRLTDAL NRKVD+AQ++R IL RIGRF+SLE+ Y+KVHLKPIK LWEDF+ 
Sbjct  181  DRLDAMVQPRLTDALCNRKVDIAQDLRGILIRIGRFRSLEMHYTKVHLKPIKQLWEDFDS  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQ+ANK++ EK++  +LS+ ++L      +SF  WLPSFYDELLLYL
Sbjct  241  RQRANKLATEKHDTGKLSTNSDL----PAVSFLSWLPSFYDELLLYL  283



>gb|AIU51140.1| embryo yellow protein, partial [Ricinus communis]
Length=831

 Score =   465 bits (1196),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 224/286 (78%), Positives = 258/286 (90%), Gaps = 4/286 (1%)
 Frame = +3

Query  84   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  263
            M+DL  FSD+KFDPK+WIN AC+SRHPQ+ LDKHLVDLEMKLQM SEEI+ SLEE SA+A
Sbjct  1    MLDLGPFSDDKFDPKKWINSACKSRHPQESLDKHLVDLEMKLQMVSEEISASLEEQSAAA  60

Query  264  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  443
            L RVPRATRDVIRLRDDA+SLR+SVS+I QKL+KAEGSSAES+A LAKVDTVK+RMEAAY
Sbjct  61   LLRVPRATRDVIRLRDDAVSLRNSVSAIFQKLKKAEGSSAESIAALAKVDTVKQRMEAAY  120

Query  444  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  623
            ETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+R+QLEVLED
Sbjct  121  ETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRRQLEVLED  180

Query  624  RLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFELR  803
            RLD+MVQPRLTDAL NRKVD+AQ++R IL RIGRF+SLE+ Y+KVHLKPIK LWEDF+ R
Sbjct  181  RLDAMVQPRLTDALCNRKVDIAQDLRGILIRIGRFRSLEMHYTKVHLKPIKQLWEDFDSR  240

Query  804  QQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            Q+ANK++ EK++  +LS+ ++L      +SF  WLPSFYDELLLYL
Sbjct  241  QRANKLATEKHDTGKLSTNSDL----PAVSFLSWLPSFYDELLLYL  282



>ref|XP_010442641.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like, 
partial [Camelina sativa]
Length=491

 Score =   453 bits (1165),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 215/287 (75%), Positives = 253/287 (88%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +A L++VD+VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIAALSRVDSVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y+TLQDA GLTQLSSTVE VF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDADGLTQLSSTVESVFNSGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL+ MVQPRLTDAL+  KVDV Q++R IL RIGRFKS+ELQYS+V LKPIK LWEDF+ 
Sbjct  181  DRLEKMVQPRLTDALTYHKVDVVQDLRGILIRIGRFKSMELQYSEVRLKPIKQLWEDFDT  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+ NK++NE++E +RLSS +E QL SS  SF+ WLPSFYDE+LLYL
Sbjct  241  KQRTNKLANERSESQRLSSGDEFQLTSSQTSFASWLPSFYDEMLLYL  287



>ref|XP_009374477.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=837

 Score =   463 bits (1192),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 223/288 (77%), Positives = 254/288 (88%), Gaps = 1/288 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSD  FDPK W+N ACQ+RHPQD +DKH+VDLEMK+QM SEEIA SLEE SAS
Sbjct  1    MMLDLGPFSDPNFDPKNWVNSACQARHPQDSVDKHMVDLEMKIQMVSEEIAASLEEQSAS  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RLRDDA+SLRS+VSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVVRLRDDAVSLRSAVSSILDKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS+TVEDVF+SGDLPR AETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSATVEDVFASGDLPRVAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLDSMVQPRLTDA+SNRKV++AQ++R IL RIGRFKS+EL Y+KVHLKPIK LWEDF+ 
Sbjct  181  DRLDSMVQPRLTDAISNRKVEIAQDLRGILIRIGRFKSMELHYTKVHLKPIKQLWEDFDA  240

Query  801  RQ-QANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q   NK++ EK++ ER S+ NE Q  +  I FS WLP+FYDELLLYL
Sbjct  241  KQPPPNKLATEKSQFERPSATNESQSAAPTILFSTWLPNFYDELLLYL  288



>ref|XP_008376080.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Malus domestica]
Length=838

 Score =   462 bits (1190),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 223/288 (77%), Positives = 254/288 (88%), Gaps = 1/288 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSD  FDPK+W+N ACQ+RHPQD +DKH+VDLEMKLQM SEEIA SLEE SAS
Sbjct  1    MMLDLGPFSDPNFDPKKWVNSACQARHPQDSVDKHMVDLEMKLQMVSEEIAASLEEQSAS  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RLRDDA+SLRS+VSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVVRLRDDAVSLRSAVSSILDKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS+TVEDVF+SGDLPR AETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSATVEDVFASGDLPRVAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLDSMVQPRLTDA+SNRKV++AQ++R IL RIGRFKS+EL Y+KVHLKPIK LWEDF+ 
Sbjct  181  DRLDSMVQPRLTDAISNRKVEIAQDLRGILIRIGRFKSMELHYTKVHLKPIKQLWEDFDA  240

Query  801  RQ-QANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q   NK++ EK++ ER S+ NE    +  I FS WLP+FYDELLLYL
Sbjct  241  KQPXPNKLATEKSQFERPSATNESXSAAPTILFSTWLPNFYDELLLYL  288



>ref|XP_009340575.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=837

 Score =   461 bits (1186),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 222/288 (77%), Positives = 255/288 (89%), Gaps = 1/288 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSD  FDPK+W+N ACQ+RHPQD +DKH+VDLEMK+QM SEEIA SLEE SAS
Sbjct  1    MMLDLGPFSDPNFDPKKWVNSACQARHPQDSVDKHMVDLEMKIQMVSEEIAASLEEQSAS  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RLRDDA+SLRS+VSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVVRLRDDAVSLRSAVSSILDKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS+TVEDVF+SGDLPR AETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSATVEDVFASGDLPRVAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLDSMVQPRLTDA+SNRKV++AQ++R IL RIGRFKS+EL Y+KVHLKPIK LWEDF+ 
Sbjct  181  DRLDSMVQPRLTDAISNRKVEIAQDLRGILIRIGRFKSMELHYTKVHLKPIKLLWEDFDA  240

Query  801  RQ-QANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q   NK++ EK++ +R S+ NE Q  +  I FS WLP+FYDELLLYL
Sbjct  241  KQPPPNKLATEKSQFDRPSATNESQSAAPTILFSTWLPNFYDELLLYL  288



>gb|KFK26748.1| hypothetical protein AALP_AA8G288200 [Arabis alpina]
Length=836

 Score =   460 bits (1184),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 220/287 (77%), Positives = 257/287 (90%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDEKFD K+W+N +CQSRHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQSRHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDNVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL++MVQPRLTDAL+  KVDVAQ++R IL RIGRFKSLELQYSKV LKPIK LWEDF+ 
Sbjct  181  DRLEAMVQPRLTDALTYHKVDVAQDLRGILIRIGRFKSLELQYSKVRLKPIKQLWEDFDT  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+ANK++++++E +RLSS +E QL SS  SF+ WLPSFYDELLLY+
Sbjct  241  KQRANKLASDRSESQRLSSGDEFQLTSSQTSFASWLPSFYDELLLYI  287



>gb|AIU51136.1| embryo yellow protein, partial [Prunus persica]
Length=838

 Score =   460 bits (1184),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 221/287 (77%), Positives = 255/287 (89%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSD  F+PK+W+N ACQSRHPQD +DKHLVDLEMKLQM SEEIA SLEE SAS
Sbjct  1    MMLDLGPFSDPNFNPKKWVNSACQSRHPQDSVDKHLVDLEMKLQMVSEEIAASLEEQSAS  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            +L RVPRATRDV+RLRDDA++LRS+VSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   SLLRVPRATRDVVRLRDDAVTLRSAVSSILDKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y+TLQDAAGLTQLS+TVEDVF+SGDLP AAE LA+MRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSATVEDVFASGDLPLAAEHLASMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            D+LDSMVQPRLTDA+ NRKVD+AQ++R IL RIGRFKS+EL Y+KVHLKPIK LWEDF+ 
Sbjct  181  DKLDSMVQPRLTDAIFNRKVDIAQDLRGILIRIGRFKSMELHYTKVHLKPIKQLWEDFDA  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q  NK++ EK++VERLS+ +E Q  +  I FS WLP+FYDELLLYL
Sbjct  241  KQPPNKLATEKSQVERLSTTSESQSTAPAILFSSWLPNFYDELLLYL  287



>ref|XP_008234406.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Prunus 
mume]
Length=839

 Score =   460 bits (1183),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 223/288 (77%), Positives = 256/288 (89%), Gaps = 1/288 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSD  FDPK+W+N ACQSRHPQD +DKHLVDLEMKLQM SEEIA SLEE SAS
Sbjct  1    MMLDLGPFSDPNFDPKKWVNSACQSRHPQDSVDKHLVDLEMKLQMVSEEIAASLEEQSAS  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            +L RVPRATRDV+RLRDDA++LRS+VSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   SLLRVPRATRDVVRLRDDAVTLRSAVSSILDKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y+TLQDAAGLTQLS+TVEDVF+SGDLP AAE LA+MRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSATVEDVFASGDLPLAAEHLASMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            D+LDSMVQPRLTDA+SNRKVD+AQ++R IL RIGRFKS+EL Y+KVHLKPIK LWEDF+ 
Sbjct  181  DKLDSMVQPRLTDAISNRKVDIAQDLRGILIRIGRFKSMELHYTKVHLKPIKQLWEDFDS  240

Query  801  RQ-QANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q   NK++ EK++VERLS+ +E Q  +  I FS WLP+FYDELLLYL
Sbjct  241  KQPPPNKLATEKSQVERLSTTSESQSTAPAILFSSWLPNFYDELLLYL  288



>emb|CDX99921.1| BnaC09g27840D [Brassica napus]
Length=641

 Score =   453 bits (1165),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 220/287 (77%), Positives = 257/287 (90%), Gaps = 4/287 (1%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MMVDL  FSDE+FD K+W+N  CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S S
Sbjct  1    MMVDLGPFSDEEFDAKRWVNSTCQARHPQDSLEKHLVDLEMKLQIASEEIGSSLEEQSGS  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSA+ +ATLA+VD+VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSADCIATLARVDSVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL++MVQPRLTDAL+  KVDVAQ++R IL RIGRFKSLELQYSKV LKPIK LW+DF+ 
Sbjct  181  DRLEAMVQPRLTDALTFHKVDVAQDLRGILIRIGRFKSLELQYSKVRLKPIKQLWDDFDT  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+ NK+++E++E + LSS +ELQL     SF+ WLPSFYDELLLYL
Sbjct  241  KQRPNKLASERSETQTLSSGDELQLT----SFASWLPSFYDELLLYL  283



>ref|XP_010536539.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Tarenaya 
hassleriana]
Length=837

 Score =   459 bits (1181),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 220/287 (77%), Positives = 257/287 (90%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDEKFD K+W+N ACQ+RHPQD L+KHLVDLEMKLQ++SEEIA SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSACQARHPQDSLEKHLVDLEMKLQISSEEIAASLEEQSGG  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            A+ RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +A LA+VD VK+RMEAA
Sbjct  61   AILRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIAALARVDNVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD+MVQPRLTDAL+  KVDVAQ++R IL RIGRFKSLEL YSKV LKPIK LWEDF++
Sbjct  181  DRLDAMVQPRLTDALTYHKVDVAQDLRGILIRIGRFKSLELHYSKVRLKPIKQLWEDFDI  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+A+K+++EK+E +RLS+ +E Q  S  ISF+ WLPSFYDELLLYL
Sbjct  241  KQRASKLASEKDESKRLSTGDEFQSASPQISFASWLPSFYDELLLYL  287



>gb|AIU51103.1| embryo yellow protein, partial [Arabidopsis lyrata]
Length=835

 Score =   459 bits (1180),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 220/287 (77%), Positives = 256/287 (89%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDNVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL++MVQPRLTDAL+  KVDVAQ++R IL RIGRFKSLELQYSKV LKPIK LWEDF+ 
Sbjct  181  DRLEAMVQPRLTDALTYHKVDVAQDLRGILIRIGRFKSLELQYSKVRLKPIKQLWEDFDT  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+ANK++NE++E +RLSS +E +L SS  SF+ WL SFYDELLLYL
Sbjct  241  KQRANKLANERSESQRLSSGDEFRLTSSQTSFASWLTSFYDELLLYL  287



>ref|XP_002865861.1| hypothetical protein ARALYDRAFT_495214 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42120.1| hypothetical protein ARALYDRAFT_495214 [Arabidopsis lyrata subsp. 
lyrata]
Length=836

 Score =   458 bits (1179),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 220/287 (77%), Positives = 256/287 (89%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDNVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL++MVQPRLTDAL+  KVDVAQ++R IL RIGRFKSLELQYSKV LKPIK LWEDF+ 
Sbjct  181  DRLEAMVQPRLTDALTYHKVDVAQDLRGILIRIGRFKSLELQYSKVRLKPIKQLWEDFDT  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+ANK++NE++E +RLSS +E +L SS  SF+ WL SFYDELLLYL
Sbjct  241  KQRANKLANERSESQRLSSGDEFRLTSSQTSFASWLTSFYDELLLYL  287



>emb|CDY56655.1| BnaA02g11250D [Brassica napus]
Length=788

 Score =   457 bits (1176),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 219/287 (76%), Positives = 259/287 (90%), Gaps = 1/287 (0%)
 Frame = +3

Query  84   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  263
            M+DL  FSDEKFD K+W+N +C++RHPQD L++HLVDLEMKLQ+ASEEI  SLEE S  A
Sbjct  1    MLDLGPFSDEKFDAKRWVNSSCKARHPQDSLERHLVDLEMKLQIASEEIGASLEEQSGGA  60

Query  264  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  443
            L RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSAE +ATLA+VD VK+RMEAAY
Sbjct  61   LLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSAECIATLARVDCVKQRMEAAY  120

Query  444  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  623
            +TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLED
Sbjct  121  KTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLED  180

Query  624  RLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFELR  803
            RL++MVQPRLTDAL+  KVDVAQ++R IL RIGRFKSLELQYSKV LKPIK LW+DF+ +
Sbjct  181  RLEAMVQPRLTDALTYHKVDVAQDLRGILIRIGRFKSLELQYSKVRLKPIKQLWDDFDTK  240

Query  804  QQANKVSNEKNEVERLSSANELQLNSSP-ISFSRWLPSFYDELLLYL  941
            Q+ANK+++E++E +RLSS +E+QL SS   SF+ WLP+FYDELLLYL
Sbjct  241  QRANKLASERSETQRLSSGDEVQLTSSTQTSFASWLPTFYDELLLYL  287



>ref|XP_009127310.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Brassica rapa]
Length=829

 Score =   458 bits (1178),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 218/286 (76%), Positives = 259/286 (91%), Gaps = 0/286 (0%)
 Frame = +3

Query  84   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  263
            M+DL  FS+EKFD K+W+N +C++RHPQD L++HLVDLEMKLQ+ASEEI  SLEE S  A
Sbjct  1    MLDLGPFSEEKFDAKRWVNSSCKARHPQDSLERHLVDLEMKLQIASEEIGASLEEQSGGA  60

Query  264  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  443
            L RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSAE +ATLA+VD VK+RMEAAY
Sbjct  61   LLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSAECIATLARVDCVKQRMEAAY  120

Query  444  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  623
            +TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLED
Sbjct  121  KTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLED  180

Query  624  RLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFELR  803
            RL++MVQPRLTDAL+  KVDVAQ++R IL RIGRFKSLELQYSKV LKPIK LW+DF+ +
Sbjct  181  RLEAMVQPRLTDALTYHKVDVAQDLRGILIRIGRFKSLELQYSKVRLKPIKQLWDDFDTK  240

Query  804  QQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            Q+ANK+++E++E +RLSS +E+QL S+  SF+ WLPSFYDELLLYL
Sbjct  241  QRANKLASERSETQRLSSGDEVQLTSAQTSFASWLPSFYDELLLYL  286



>gb|AIU51152.1| embryo yellow protein, partial [Platanus x acerifolia]
Length=839

 Score =   458 bits (1178),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 221/287 (77%), Positives = 256/287 (89%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MMVDL +FS+EKFD K+WIN ACQSRHPQDP+++HL DLEMKLQM SEEIA SLEE S++
Sbjct  1    MMVDLGAFSEEKFDAKKWINAACQSRHPQDPVERHLADLEMKLQMMSEEIAASLEEQSSA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRA+RDVIRLRDDA+SLR+SVS IL KL+KAEGSSAES++ LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVIRLRDDAVSLRNSVSGILLKLKKAEGSSAESISALAKVDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL++MVQPRL DALSNR+V+  Q++R IL RIGR+KSLEL Y+KVHLKPIK LWE+F  
Sbjct  181  DRLETMVQPRLYDALSNRQVEAVQDLRKILIRIGRYKSLELHYTKVHLKPIKQLWEEFVS  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQ+ANK+++EK + ERLSS  E     + +SFS WLPSFYDE+LLYL
Sbjct  241  RQRANKLASEKRDGERLSSVTEFSSGLAVLSFSSWLPSFYDEVLLYL  287



>gb|AIU51116.1| embryo yellow protein, partial [Capsella rubella]
Length=835

 Score =   457 bits (1175),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 219/287 (76%), Positives = 254/287 (89%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIAALARVDNVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETL++MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLSSMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL++MVQPRLTDAL+  KVDVAQ++R IL RIGRFKSLELQYSKV LKPIK LWED++ 
Sbjct  181  DRLEAMVQPRLTDALTYHKVDVAQDLRGILLRIGRFKSLELQYSKVRLKPIKQLWEDYDT  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+ NK +NE++E + LSS +E QL SS  SF+ WLPSFYDELLLYL
Sbjct  241  KQRVNKPANERSESQMLSSGDEFQLTSSQTSFASWLPSFYDELLLYL  287



>ref|XP_010089680.1| hypothetical protein L484_001268 [Morus notabilis]
 gb|EXC36303.1| hypothetical protein L484_001268 [Morus notabilis]
Length=833

 Score =   457 bits (1175),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 230/286 (80%), Positives = 258/286 (90%), Gaps = 3/286 (1%)
 Frame = +3

Query  84   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  263
            M+DL  FS E F+PK+WIN ACQSRHP++ +DKHLVDLEMKLQM SEEI+ SLEE SA+A
Sbjct  1    MLDLGPFSGENFEPKKWINSACQSRHPEESVDKHLVDLEMKLQMVSEEISASLEEQSAAA  60

Query  264  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  443
            L RVPRATRDVIRLRDDA+SLRS+V+SILQKL+KAEGSSAES+A LAKVDTVK+RMEAAY
Sbjct  61   LLRVPRATRDVIRLRDDAVSLRSAVASILQKLKKAEGSSAESIAALAKVDTVKQRMEAAY  120

Query  444  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  623
            ETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLED
Sbjct  121  ETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLED  180

Query  624  RLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFELR  803
            RLD+MVQPRLTDA+S RKVDVAQ +R IL RIGRFKSLE+ Y+KVHLKPIK LWEDF  +
Sbjct  181  RLDAMVQPRLTDAISGRKVDVAQNLRGILIRIGRFKSLEIHYTKVHLKPIKQLWEDFNSK  240

Query  804  QQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            Q+ N+++NEK EVERLSS   +Q +S  ISFS WLPSFYDELLLYL
Sbjct  241  QR-NRLANEKAEVERLSS--NIQSSSPTISFSSWLPSFYDELLLYL  283



>ref|XP_006280007.1| hypothetical protein CARUB_v10025880mg [Capsella rubella]
 gb|EOA12905.1| hypothetical protein CARUB_v10025880mg [Capsella rubella]
Length=836

 Score =   457 bits (1175),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 219/287 (76%), Positives = 254/287 (89%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIAALARVDNVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETL++MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLSSMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL++MVQPRLTDAL+  KVDVAQ++R IL RIGRFKSLELQYSKV LKPIK LWED++ 
Sbjct  181  DRLEAMVQPRLTDALTYHKVDVAQDLRGILLRIGRFKSLELQYSKVRLKPIKQLWEDYDT  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+ NK +NE++E + LSS +E QL SS  SF+ WLPSFYDELLLYL
Sbjct  241  KQRVNKPANERSESQMLSSGDEFQLTSSQTSFASWLPSFYDELLLYL  287



>ref|XP_010482477.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Camelina sativa]
Length=836

 Score =   457 bits (1175),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 218/287 (76%), Positives = 255/287 (89%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +ATLA+VD+VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIATLARVDSVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y+TLQDA GLTQLSSTVE VF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDADGLTQLSSTVESVFNSGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL+ MVQPRLTDAL+  KVDV Q++R IL RIGRFKS+ELQYS+V LKPIK LWEDF+ 
Sbjct  181  DRLEKMVQPRLTDALTYHKVDVVQDLRGILIRIGRFKSMELQYSEVRLKPIKQLWEDFDT  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+ANK++NE++E +RLSS +E QL SS  SF+ WLPSFYDE+LLYL
Sbjct  241  KQRANKLANERSESQRLSSGDEFQLTSSQTSFASWLPSFYDEMLLYL  287



>gb|AIU51104.1| embryo yellow protein, partial [Arabidopsis thaliana]
Length=835

 Score =   456 bits (1174),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 220/287 (77%), Positives = 255/287 (89%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDNVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL++MVQPRLTDAL+  KVDVAQ++R IL RIGRFKSLELQYSKV LKPIK LWEDF+ 
Sbjct  181  DRLEAMVQPRLTDALTYHKVDVAQDLRVILIRIGRFKSLELQYSKVRLKPIKQLWEDFDT  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+ANK++NE++E +RLSS +E Q  SS  SF+ WL SFYDELLLYL
Sbjct  241  KQRANKLANERSESQRLSSGDEFQSTSSQTSFASWLTSFYDELLLYL  287



>ref|NP_199956.1| COG7-like protein EYE [Arabidopsis thaliana]
 dbj|BAB09754.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96080.1| COG complex component-related protein [Arabidopsis thaliana]
Length=836

 Score =   456 bits (1174),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 220/287 (77%), Positives = 255/287 (89%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDNVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL++MVQPRLTDAL+  KVDVAQ++R IL RIGRFKSLELQYSKV LKPIK LWEDF+ 
Sbjct  181  DRLEAMVQPRLTDALTYHKVDVAQDLRVILIRIGRFKSLELQYSKVRLKPIKQLWEDFDT  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+ANK++NE++E +RLSS +E Q  SS  SF+ WL SFYDELLLYL
Sbjct  241  KQRANKLANERSESQRLSSGDEFQSTSSQTSFASWLTSFYDELLLYL  287



>dbj|BAF00649.1| hypothetical protein [Arabidopsis thaliana]
Length=836

 Score =   456 bits (1174),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 220/287 (77%), Positives = 255/287 (89%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDNVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL++MVQPRLTDAL+  KVDVAQ++R IL RIGRFKSLELQYSKV LKPIK LWEDF+ 
Sbjct  181  DRLEAMVQPRLTDALTYHKVDVAQDLRVILIRIGRFKSLELQYSKVRLKPIKQLWEDFDT  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+ANK++NE++E +RLSS +E Q  SS  SF+ WL SFYDELLLYL
Sbjct  241  KQRANKLANERSESQRLSSGDEFQSTSSQTSFASWLTSFYDELLLYL  287



>emb|CDX91578.1| BnaC02g15820D [Brassica napus]
Length=801

 Score =   455 bits (1170),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 216/287 (75%), Positives = 258/287 (90%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FS+EKFD K+W+N +CQ+RHPQD L++ LVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSEEKFDAKRWVNSSCQARHPQDSLERQLVDLEMKLQIASEEIGASLEEQSGG  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSA+ +ATLA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSADCIATLARVDCVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            ++TLQDA+GLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  FKTLQDASGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL++MVQPRLTDAL+  KVDVAQ++R IL RIGRFKSLELQYSKV LKPIK LW+DF+ 
Sbjct  181  DRLEAMVQPRLTDALTYHKVDVAQDLRGILIRIGRFKSLELQYSKVRLKPIKQLWDDFDT  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+ANK+++E++E +RLSS +E QL S+  SF+ WLPSFYDELLLYL
Sbjct  241  KQRANKLASERSETQRLSSGDEFQLTSTQTSFASWLPSFYDELLLYL  287



>ref|XP_007218916.1| hypothetical protein PRUPE_ppa001391mg [Prunus persica]
 gb|EMJ20115.1| hypothetical protein PRUPE_ppa001391mg [Prunus persica]
Length=839

 Score =   456 bits (1172),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 221/288 (77%), Positives = 255/288 (89%), Gaps = 1/288 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSD  F+PK+W+N ACQSRHPQD +DKHLVDLEMKLQM SEEIA SLEE SAS
Sbjct  1    MMLDLGPFSDPNFNPKKWVNSACQSRHPQDSVDKHLVDLEMKLQMVSEEIAASLEEQSAS  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            +L RVPRATRDV+RLRDDA++LRS+VSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   SLLRVPRATRDVVRLRDDAVTLRSAVSSILDKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y+TLQDAAGLTQLS+TVEDVF+SGDLP AAE LA+MRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSATVEDVFASGDLPLAAEHLASMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            D+LDSMVQPRLTDA+ NRKVD+AQ++R IL RIGRFKS+EL Y+KVHLKPIK LWEDF+ 
Sbjct  181  DKLDSMVQPRLTDAIFNRKVDIAQDLRGILIRIGRFKSMELHYTKVHLKPIKQLWEDFDA  240

Query  801  RQQ-ANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q   NK++ EK++VERLS+ +E Q  +  I FS WLP+FYDELLLYL
Sbjct  241  KQPLPNKLATEKSQVERLSTTSESQSTAPAILFSSWLPNFYDELLLYL  288



>ref|XP_010264264.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nelumbo 
nucifera]
Length=839

 Score =   456 bits (1172),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 220/287 (77%), Positives = 258/287 (90%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MMVDL +FSDEKFD K+WIN  CQSRHPQDP++KHL DLEMKLQM SEEIA SLEE S++
Sbjct  1    MMVDLGAFSDEKFDAKKWINVVCQSRHPQDPVEKHLADLEMKLQMISEEIAASLEEQSSA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            +L RVPRA+RDVIRLRDDA+SLR+SV+ IL KL+KAEGSSAESVA LAKVDTVK+RMEAA
Sbjct  61   SLLRVPRASRDVIRLRDDAISLRNSVTGILLKLKKAEGSSAESVAALAKVDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y+TLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEF+N+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFSNVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL++MVQPRL+DALSNRKVD  Q++R+IL RIGRFKSLELQY+KVHLKPI+ LWE+FE 
Sbjct  181  DRLEAMVQPRLSDALSNRKVDAVQDLRNILIRIGRFKSLELQYTKVHLKPIRQLWEEFES  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQ+  K+++E+++ E LS+  E Q   S +SFS WLPSFYDE+LLYL
Sbjct  241  RQRTAKLASERHDGEPLSNVTESQSALSVLSFSSWLPSFYDEVLLYL  287



>gb|AIU51147.1| embryo yellow protein, partial [Schrenkiella parvula]
Length=831

 Score =   455 bits (1170),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 219/287 (76%), Positives = 255/287 (89%), Gaps = 4/287 (1%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +ATLA+VDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIATLARVDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL++MVQPRLTDAL+  KVDVAQ++R IL RIGRFKSLELQYSKV LKPIK LW DF+ 
Sbjct  181  DRLEAMVQPRLTDALTYHKVDVAQDLRGILIRIGRFKSLELQYSKVRLKPIKQLWGDFDT  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+ANK+++E++E +RLSS +E QL     SF+ WLP FYDELLLYL
Sbjct  241  KQRANKLASERSESQRLSSGDEFQLT----SFASWLPGFYDELLLYL  283



>ref|XP_006401980.1| hypothetical protein EUTSA_v10012691mg [Eutrema salsugineum]
 gb|ESQ43433.1| hypothetical protein EUTSA_v10012691mg [Eutrema salsugineum]
Length=832

 Score =   455 bits (1170),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 219/287 (76%), Positives = 255/287 (89%), Gaps = 4/287 (1%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +ATLA+VDTVK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIATLARVDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL++MVQPRLTDAL+  KVDVAQ++R IL RIGRFKSLELQYSKV LKPIK LW DF+ 
Sbjct  181  DRLEAMVQPRLTDALTYHKVDVAQDLRGILIRIGRFKSLELQYSKVRLKPIKQLWGDFDT  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+ANK+++E++E +RLSS +E QL     SF+ WLP FYDELLLYL
Sbjct  241  KQRANKLASERSESQRLSSGDEFQLT----SFASWLPGFYDELLLYL  283



>ref|XP_010443240.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Camelina sativa]
Length=836

 Score =   455 bits (1170),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 217/287 (76%), Positives = 254/287 (89%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +A LA+VD+VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIAALARVDSVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y+TLQDA GLTQLSSTVE VF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDADGLTQLSSTVESVFNSGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL+ MVQPRLTDAL+  KVDV Q++R IL RIGRFKS+ELQYS+V LKPIK LWEDF+ 
Sbjct  181  DRLEKMVQPRLTDALTYHKVDVVQDLRGILIRIGRFKSMELQYSEVRLKPIKQLWEDFDT  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+ANK++NE++E +RLSS +E QL SS  SF+ WLPSFYDE+LLYL
Sbjct  241  KQRANKLANERSESQRLSSGDEFQLTSSQTSFASWLPSFYDEMLLYL  287



>dbj|BAG15881.1| conserved oligomeric Golgi complex component 7-related [Arabidopsis 
thaliana]
Length=836

 Score =   455 bits (1170),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 219/287 (76%), Positives = 254/287 (89%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S  
Sbjct  1    MMLDLGPFSDEKFDAKRWVNSSCQARHPQDSLEKHLVDLEMKLQIASEEIGASLEEQSGG  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDNVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL++MVQPRLTDAL+  KVDVAQ++R IL RIGRFKSLELQYSKV LKPIK LWEDF+ 
Sbjct  181  DRLEAMVQPRLTDALTYHKVDVAQDLRVILXRIGRFKSLELQYSKVRLKPIKQLWEDFDT  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+ANK++NE++E +RLSS +E Q  SS  SF+ WL SFYDEL LYL
Sbjct  241  KQRANKLANERSESQRLSSGDEFQSTSSQTSFASWLTSFYDELRLYL  287



>gb|AIU51120.1| embryo yellow protein, partial [Illicium henryi]
Length=720

 Score =   451 bits (1159),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 213/287 (74%), Positives = 262/287 (91%), Gaps = 3/287 (1%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL +FS+EKFDPK+WINGACQ+R PQDPLDKHL D+EMKLQ+ SEEI+ SL+E S +
Sbjct  1    MMIDLGAFSEEKFDPKKWINGACQARDPQDPLDKHLADMEMKLQLLSEEISSSLDEQSTA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRA+RDVIRLRD+A+SLRSS+S ILQ+L+KAEG SAES+A L+KVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVIRLRDEAISLRSSLSGILQRLKKAEGCSAESIAALSKVDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIR+QLEVLE
Sbjct  121  YETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRRQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL++MVQPRL+DALSNRKV+V +E+R IL RIGRFKS+EL Y+K+H+KPI+HLWE+++ 
Sbjct  181  DRLEAMVQPRLSDALSNRKVEVVKELREILIRIGRFKSVELNYTKIHIKPIRHLWEEYDS  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+AN+++ EK++++R S+A +   N   +SFSRWLP+FYDELLLYL
Sbjct  241  KQKANRLAVEKHDMDRPSAAIDPLPN---VSFSRWLPNFYDELLLYL  284



>gb|AIU51129.1| embryo yellow protein, partial [Medicago truncatula]
Length=827

 Score =   453 bits (1166),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 225/288 (78%), Positives = 250/288 (87%), Gaps = 3/288 (1%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MMVDL  FS+  FDPK+WIN AC SRH Q  LDKHL+DLEMKLQM SEEI+ SLEE S++
Sbjct  1    MMVDLVQFSNSNFDPKKWINTACHSRHSQQSLDKHLIDLEMKLQMLSEEISASLEEQSSA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  VPRATRDV+RLRDDA SLRS+VS IL  L+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLHVPRATRDVVRLRDDAGSLRSAVSVILHNLQKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFTSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD+MVQP LTDALSNRK+D AQ++R +L RIGRFKSLE QYSKVHLKPIK LWED E 
Sbjct  181  DRLDTMVQPPLTDALSNRKIDAAQDLRGVLIRIGRFKSLESQYSKVHLKPIKKLWEDLES  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSP-ISFSRWLPSFYDELLLYL  941
            R+ A+K +NEK+E+E +S+  + Q  SSP ISFS WLPSFYDELLLYL
Sbjct  241  REHASKSANEKSEMETMSTGGDFQ--SSPTISFSNWLPSFYDELLLYL  286



>ref|XP_003618191.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
 gb|AES74409.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=828

 Score =   453 bits (1166),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 225/288 (78%), Positives = 250/288 (87%), Gaps = 3/288 (1%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MMVDL  FS+  FDPK+WIN AC SRH Q  LDKHL+DLEMKLQM SEEI+ SLEE S++
Sbjct  1    MMVDLVQFSNSNFDPKKWINTACHSRHSQQSLDKHLIDLEMKLQMLSEEISASLEEQSSA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  VPRATRDV+RLRDDA SLRS+VS IL  L+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLHVPRATRDVVRLRDDAGSLRSAVSVILHNLQKAEGSSAESIAALAKVDVVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFTSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD+MVQP LTDALSNRK+D AQ++R +L RIGRFKSLE QYSKVHLKPIK LWED E 
Sbjct  181  DRLDTMVQPPLTDALSNRKIDAAQDLRGVLIRIGRFKSLESQYSKVHLKPIKKLWEDLES  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSP-ISFSRWLPSFYDELLLYL  941
            R+ A+K +NEK+E+E +S+  + Q  SSP ISFS WLPSFYDELLLYL
Sbjct  241  REHASKSANEKSEMETMSTGGDFQ--SSPTISFSNWLPSFYDELLLYL  286



>gb|AIU51121.1| embryo yellow protein, partial [Buxus sinica]
Length=839

 Score =   453 bits (1166),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 222/287 (77%), Positives = 252/287 (88%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MMVDL +FSDEKFD K+WIN ACQSRHPQDP +KHL DLEMKLQM SEEIA SLEE S++
Sbjct  1    MMVDLGAFSDEKFDAKKWINAACQSRHPQDPPEKHLADLEMKLQMMSEEIAASLEEQSSA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRA+RDVIRLRDDA+SLR+SVS IL KL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVIRLRDDAMSLRNSVSGILLKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLT+LS++VE VF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTELSASVEGVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            D+L+ MVQPRLTDALS RKV+  Q +R IL RIGRFKS+EL Y+K HLK +K LWEDF+ 
Sbjct  181  DKLEEMVQPRLTDALSYRKVEAVQNLRGILVRIGRFKSVELHYTKFHLKHMKQLWEDFDT  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQ+A+K+ NEK++VERLSS+ E       ISFS WLPSFYDE+LLYL
Sbjct  241  RQRADKLVNEKHDVERLSSSTEPPSTLPIISFSSWLPSFYDEVLLYL  287



>gb|AIU51112.1| embryo yellow protein, partial [Sarcandra glabra]
Length=836

 Score =   452 bits (1164),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 218/287 (76%), Positives = 254/287 (89%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDEKFDPK+WIN ACQS   QDPLDKHL DLEMKLQ+ ++EI  SL+E S +
Sbjct  1    MMIDLGPFSDEKFDPKKWINSACQSLRSQDPLDKHLADLEMKLQVMADEITSSLDEQSGA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRA+RDVIRLRDDA+SLRSSVS IL KL+KAEGSSAESVA LAK+DTVK+RMEAA
Sbjct  61   ALLRVPRASRDVIRLRDDAVSLRSSVSGILLKLKKAEGSSAESVAALAKIDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSA+GEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAIGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL+ MVQPRL+DALSNRKVDV  +MR ILNRIGR KS+ELQY+K+H+KPI+ LWE+F+ 
Sbjct  181  DRLEEMVQPRLSDALSNRKVDVVHDMRQILNRIGRLKSVELQYTKIHVKPIRQLWEEFDS  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQ+ANK+++EK++ ERLSS      N + +SFS WLP+FYDE+LLYL
Sbjct  241  RQRANKLASEKHDGERLSSTAHQSSNVALLSFSSWLPNFYDEVLLYL  287



>ref|XP_009107451.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7-like [Brassica rapa]
Length=831

 Score =   450 bits (1157),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 221/288 (77%), Positives = 257/288 (89%), Gaps = 5/288 (2%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MMVDL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S S
Sbjct  1    MMVDLGPFSDEKFDAKRWVNTSCQARHPQDSLEKHLVDLEMKLQIASEEIGSSLEEQSGS  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSA+ +ATLA+VD+VK+RMEAA
Sbjct  61   ALLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSADCIATLARVDSVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL++MVQPRLTDAL+  KVDVAQ++R IL RIGRFKSLELQYSKV LKPIK LW+DF+ 
Sbjct  181  DRLEAMVQPRLTDALTYHKVDVAQDLRGILIRIGRFKSLELQYSKVRLKPIKQLWDDFDT  240

Query  801  RQQANKVSNEKNEVERLSS-ANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+ NK+S+E++E + LSS  +EL L     SF+ WLPSFYDELLLYL
Sbjct  241  KQRPNKLSSERSETQPLSSGGDELHLT----SFASWLPSFYDELLLYL  284



>gb|AIU51151.1| embryo yellow protein, partial [Cinnamomum camphora]
Length=838

 Score =   448 bits (1153),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 216/287 (75%), Positives = 256/287 (89%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MMVDL +FSDEKFDPK+WIN A  SRHPQDP+DKHL DLEMKLQ+ +EEIA SL+E S +
Sbjct  1    MMVDLGTFSDEKFDPKKWINAASLSRHPQDPIDKHLADLEMKLQVLAEEIASSLDEQSNA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRA+RDVIRLRD+A+SLRSSVS IL KL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVIRLRDEAISLRSSVSGILLKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL+ MV PRL+DALSNRKVD  Q++R IL RIGRFKS+ELQY+K+HLKPI+ LWE+F+ 
Sbjct  181  DRLEEMVHPRLSDALSNRKVDAVQDLRQILIRIGRFKSVELQYTKIHLKPIRKLWEEFDS  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQ+A+K+++EK++ +RLSS  +   +   +SFS WLP+FYDE+LLYL
Sbjct  241  RQRASKLASEKHDADRLSSTADSSSHVPYLSFSSWLPNFYDEVLLYL  287



>ref|XP_004307803.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Fragaria 
vesca subsp. vesca]
Length=832

 Score =   445 bits (1145),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 219/288 (76%), Positives = 250/288 (87%), Gaps = 8/288 (3%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSDE FD K+W+N ACQSRHPQD +DKHL DLEMK+QM SEEI  SLEE SAS
Sbjct  1    MMLDLGPFSDENFDRKKWVNSACQSRHPQDSVDKHLADLEMKIQMVSEEIGASLEEQSAS  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            +L RVPRATR+VIRLRDDA+SLRS+VSSIL KL+KAEG SAES+  LAK D VK+RMEAA
Sbjct  61   SLLRVPRATREVIRLRDDAVSLRSAVSSILDKLKKAEGLSAESIMALAKYDIVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLDSMVQPRLTDA+SNRKV+VAQ++R IL RIGRFKS+EL Y+KVHLKPIK LWEDF+ 
Sbjct  181  DRLDSMVQPRLTDAISNRKVEVAQDLRGILIRIGRFKSMELHYTKVHLKPIKQLWEDFDS  240

Query  801  RQ-QANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q  +NK++ +K       ++NE+Q  +S I FS WLP+FYDELLLYL
Sbjct  241  KQPPSNKLATDK-------TSNEIQSATSGILFSTWLPNFYDELLLYL  281



>gb|AIU51141.1| embryo yellow protein, partial [Saruma henryi]
Length=262

 Score =   424 bits (1089),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 205/262 (78%), Positives = 236/262 (90%), Gaps = 0/262 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            M+VDLS+FSDE FDPK+WIN ACQ RHPQDP+DKHL DLEMKLQ+ SEEI  SL+E S +
Sbjct  1    MIVDLSAFSDENFDPKRWINSACQFRHPQDPVDKHLADLEMKLQLLSEEITSSLDEQSTA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRA+RDVIRLRDDA+SLRS+VS IL KL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVIRLRDDAVSLRSAVSGILLKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQL VLE
Sbjct  121  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLAVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL+ MVQPRL+DALS+RKVD  Q++R IL RIGRFKS+EL Y+K+HLKPIK +WEDF+ 
Sbjct  181  DRLEEMVQPRLSDALSHRKVDAVQDLRQILIRIGRFKSVELLYTKIHLKPIKKIWEDFDS  240

Query  801  RQQANKVSNEKNEVERLSSANE  866
            RQQANK+ NEK++ ER SS +E
Sbjct  241  RQQANKLPNEKHDFERPSSTSE  262



>gb|AIU51102.1| embryo yellow protein, partial [Aquilegia coerulea]
Length=835

 Score =   442 bits (1137),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 217/287 (76%), Positives = 253/287 (88%), Gaps = 4/287 (1%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MMVDL SF+DEKFDPK+WIN   QSRHPQD L+KHL +LEMKLQM SEEI+ SLEE SA+
Sbjct  1    MMVDLGSFTDEKFDPKKWINSTTQSRHPQDSLEKHLSELEMKLQMISEEISASLEEQSAA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRA+RDVIRLRDDALS R+SVS IL KL+KAEGSSAES+  LAKVD VK+RMEAA
Sbjct  61   ALLRVPRASRDVIRLRDDALSFRTSVSGILLKLKKAEGSSAESIDALAKVDIVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS++VEDVF+SGDLP+AAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSASVEDVFASGDLPQAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL++MVQPRL+DALSNRKVD  Q+ R ILNRIGRFKSLEL Y+K+HLKP+K LWEDF+L
Sbjct  181  DRLEAMVQPRLSDALSNRKVDAVQDFRQILNRIGRFKSLELHYTKIHLKPLKLLWEDFDL  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +++ NK+++EK+  E L S +E   +S+ + FS WLPSFYDE+LLYL
Sbjct  241  KRRTNKLASEKHG-ESLGSISE---SSNSLPFSSWLPSFYDEVLLYL  283



>emb|CDY00475.1| BnaA10g07980D [Brassica napus]
Length=788

 Score =   441 bits (1133),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 218/287 (76%), Positives = 255/287 (89%), Gaps = 5/287 (2%)
 Frame = +3

Query  84   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  263
            MVDL  FSDEKFD K+W+N +CQ+RHPQD L+KHLVDLEMKLQ+ASEEI  SLEE S SA
Sbjct  1    MVDLGPFSDEKFDAKRWVNTSCQARHPQDSLEKHLVDLEMKLQIASEEIGSSLEEQSGSA  60

Query  264  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  443
            L RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSA+ +ATLA+VD+VK+RMEAAY
Sbjct  61   LLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSADCIATLARVDSVKQRMEAAY  120

Query  444  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  623
            +TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+RKQLEVLED
Sbjct  121  KTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANVRKQLEVLED  180

Query  624  RLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFELR  803
            RL++MVQPRLTDAL+  KVDVAQ++R IL RIGRFKSLELQYSKV LKPIK LW+DF+ +
Sbjct  181  RLEAMVQPRLTDALTYHKVDVAQDLRGILIRIGRFKSLELQYSKVRLKPIKQLWDDFDTK  240

Query  804  QQANKVSNEKNEVERLSS-ANELQLNSSPISFSRWLPSFYDELLLYL  941
            Q+ NK+++E++E + LSS  +EL L     SF+  LPSFYDELLLYL
Sbjct  241  QRPNKLASERSETQPLSSGGDELHLT----SFASSLPSFYDELLLYL  283



>ref|XP_010692941.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Beta 
vulgaris subsp. vulgaris]
Length=836

 Score =   440 bits (1131),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 224/287 (78%), Positives = 257/287 (90%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MMVDL +FSDEKFD K+WIN A +SRHPQD L+KHLVDLEMKLQ+ SEEI+ SLEE SA+
Sbjct  1    MMVDLGAFSDEKFDAKKWINMAVKSRHPQDALEKHLVDLEMKLQLMSEEISASLEEQSAA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            A+ RVPRATRDVIR+RDDA+SLRSS+SSIL K+++AEGS+A+S+A LAKVDTVK RMEAA
Sbjct  61   AILRVPRATRDVIRIRDDAVSLRSSISSILGKIKQAEGSAADSIAALAKVDTVKFRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL++MVQPRLTDALSNRKV+VAQEMR IL RIGRF+SLE+ Y+KVHLK IK LW+ FE 
Sbjct  181  DRLEAMVQPRLTDALSNRKVEVAQEMRGILVRIGRFQSLEVYYTKVHLKSIKQLWDVFES  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQ++NK++ EKN+ ERL+S NE Q N S +S   WLPSFYDELL YL
Sbjct  241  RQRSNKLATEKNDGERLASLNEFQSNHSALSLLSWLPSFYDELLFYL  287



>gb|AIU51125.1| embryo yellow protein, partial [Chimonanthus praecox]
Length=828

 Score =   435 bits (1118),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 213/287 (74%), Positives = 256/287 (89%), Gaps = 8/287 (3%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +M+DL +FSDEKFDPK+WIN ACQSRHPQ P+D+HL DLEMKLQ+ SEEI+ SL+E S+S
Sbjct  1    IMIDLGAFSDEKFDPKKWINAACQSRHPQQPIDRHLADLEMKLQVLSEEISSSLDEQSSS  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL R+PRA+RDVIRLRD+A+SLRSSVSSIL KL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRIPRASRDVIRLRDEAVSLRSSVSSILLKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL+ MV PRL+ ALSNR+VD  Q++R IL RIGRFKS+E+ Y+K+HLKPI+ LWE+++ 
Sbjct  181  DRLEEMVHPRLSVALSNREVDAVQDLRQILIRIGRFKSVEMLYTKIHLKPIRQLWEEYDS  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQQANK+++EK++VERL S+ +        SFS WLP+FYDE+LLYL
Sbjct  241  RQQANKLASEKHDVERLPSSTD--------SFSSWLPNFYDEVLLYL  279



>gb|EPS73811.1| hypothetical protein M569_00940, partial [Genlisea aurea]
Length=838

 Score =   434 bits (1115),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 214/287 (75%), Positives = 249/287 (87%), Gaps = 6/287 (2%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MMVDL+SFSD+KFDPK+WINGA   RHPQDP++KHLVDLEMKLQM SEEIA SLEE S++
Sbjct  1    MMVDLTSFSDDKFDPKKWINGAVNQRHPQDPVEKHLVDLEMKLQMVSEEIAASLEEQSSA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            A+ R+PRA+RDV+RL+DDALSLRSS++ IL  L+KAEGSSAES+ATLA+VDTVKRRMEAA
Sbjct  61   AILRIPRASRDVLRLQDDALSLRSSIAGILLFLKKAEGSSAESIATLARVDTVKRRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCL+AVGEVAEFANIRKQLEVLE
Sbjct  121  YETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLTAVGEVAEFANIRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLDSMVQ  L DALSNRK +VAQEMR IL RI RFKSLE  Y+K H K +K +W++F+L
Sbjct  181  DRLDSMVQHHLIDALSNRKANVAQEMRGILTRIERFKSLESCYTKFHQKSVKKIWDEFDL  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQ +      KNE  R+S+ ++LQ +   + FSRWLP+FYD+LLLYL
Sbjct  241  RQPS------KNEDGRISNNSDLQPSVPILQFSRWLPNFYDQLLLYL  281



>gb|AIU51106.1| embryo yellow protein, partial [Magnolia denudata]
Length=829

 Score =   432 bits (1110),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 211/287 (74%), Positives = 248/287 (86%), Gaps = 8/287 (3%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MMVDL +FSDEKFDPK+WIN ACQSRH Q+ +D+HL DLEMKLQ+ SEEI+ SL+E S++
Sbjct  1    MMVDLGAFSDEKFDPKKWINAACQSRHHQESIDRHLADLEMKLQLLSEEISSSLDEQSSA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            ALHRVPRA+RDV+RLRDDA+SLRS+VS IL KL+KAEG+S+ESVA LAKVDTVK+RMEAA
Sbjct  61   ALHRVPRASRDVVRLRDDAVSLRSAVSGILVKLKKAEGTSSESVAALAKVDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y+TLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YKTLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL+ MV PRL+DALSNRK+D  Q++R IL RIGRFKS+EL Y+K+HLKPI  LWE F+ 
Sbjct  181  DRLEEMVHPRLSDALSNRKIDAVQDLRKILIRIGRFKSVELHYTKIHLKPILQLWEGFDS  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQQA      K++ ERLSS     + S  +SFS WLP FYDE+LLYL
Sbjct  241  RQQA------KHDGERLSSTTSSNVPS--LSFSSWLPHFYDEVLLYL  279



>gb|AIU51154.1| embryo yellow protein, partial [Houttuynia cordata]
Length=833

 Score =   431 bits (1107),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 207/287 (72%), Positives = 247/287 (86%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MMVDL  F+D+KFD K+WIN ACQ+RHPQ+  DK+L DLEMKLQ+ SEEIA SL+E SA+
Sbjct  1    MMVDLGDFADDKFDAKRWINAACQARHPQEAADKYLADLEMKLQLISEEIAASLDEQSAA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL R+PRATRDV+RLRDDALSLRS+VS+IL KL+KAEGSSAE++A LAKVDTVK+RMEAA
Sbjct  61   ALLRIPRATRDVVRLRDDALSLRSAVSAILLKLKKAEGSSAEAIAALAKVDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQL VLE
Sbjct  121  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLAVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL+ MVQPRL+DAL+NRK +  Q++R IL RIGRFKSLEL Y+K+HLKPIK +W++FE 
Sbjct  181  DRLEEMVQPRLSDALTNRKAEAVQDLRQILIRIGRFKSLELLYTKIHLKPIKKIWDEFET  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +++ +K+ N K + +R S   E   N   + FS WLPSFYDE+LLYL
Sbjct  241  KKRPSKIGNVKLDHDRSSITAETLPNPPSLPFSSWLPSFYDEVLLYL  287



>ref|XP_006838140.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Amborella 
trichopoda]
 gb|ERN00709.1| hypothetical protein AMTR_s00106p00086320 [Amborella trichopoda]
Length=827

 Score =   423 bits (1088),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 204/287 (71%), Positives = 244/287 (85%), Gaps = 11/287 (4%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FS+EKFDPK+WIN ACQ++HPQD +DKHL +LEMKLQ+ SEEI+ SL+ELSAS
Sbjct  1    MMIDLGPFSEEKFDPKKWINAACQAKHPQDSMDKHLAELEMKLQVISEEISSSLDELSAS  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL R+PRA+RDV+RLRDDA+SLRS++S ILQKL KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRIPRASRDVVRLRDDAISLRSAISGILQKLEKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLS VGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSVVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL+ MVQPRL+DALS+RKVD   ++  IL RIGRFKS+EL Y K+HLKPI++LWE FE+
Sbjct  181  DRLEGMVQPRLSDALSHRKVDAVHDLWDILIRIGRFKSIELNYIKIHLKPIRNLWEGFEV  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            R+ ++ +  EK+  E+  S           SFS WLPSF+DE+LLYL
Sbjct  241  RKGSDMLVTEKHVGEKNVS-----------SFSSWLPSFFDEVLLYL  276



>gb|AIU51128.1| embryo yellow protein, partial [Aristolochia tagala]
Length=834

 Score =   423 bits (1087),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 210/287 (73%), Positives = 257/287 (90%), Gaps = 0/287 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MMVDLS+FSDEKFDPK+WIN ACQSRHPQDP+DKHL DLE+KLQ+ SEEI+ SL+E S +
Sbjct  1    MMVDLSAFSDEKFDPKKWINNACQSRHPQDPVDKHLADLELKLQLLSEEISSSLDEQSTA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRA+RDVIRLRDDA+SLRS++S IL KL+KAEGSSA ++A+LAKVDTVK+RMEAA
Sbjct  61   ALLRVPRASRDVIRLRDDAVSLRSAISGILLKLKKAEGSSAAAIASLAKVDTVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLA+MRHCLSAVGEVAEFAN+RKQL VLE
Sbjct  121  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLASMRHCLSAVGEVAEFANVRKQLAVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL+ MVQPRL+DALS+RKVD  Q++R IL RIGRFKSLE  Y+K+H+KPI  +W++ + 
Sbjct  181  DRLEEMVQPRLSDALSHRKVDAVQDLRQILMRIGRFKSLEQLYTKLHIKPINKIWDELDS  240

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+ANK+++E+N+ +R S+ N+   N+ P+SFS WLPSFYDE+LLYL
Sbjct  241  KQRANKLTSERNDSQRQSNMNDPLTNAPPLSFSSWLPSFYDEVLLYL  287



>ref|XP_010934963.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Elaeis 
guineensis]
Length=824

 Score =   411 bits (1056),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 205/287 (71%), Positives = 243/287 (85%), Gaps = 11/287 (4%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            ++VDL  FS+E FDPK+WIN A +SRHPQDPLD+ L DLE  L+ ASE+IA +LE  SA 
Sbjct  2    VVVDLGEFSEEGFDPKRWINAALESRHPQDPLDRFLSDLEENLRAASEKIADALERESAD  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVP A RDV+RLRDDAL+LRS +SSIL KL+KAEG+SAES+A LAK+DTVK+RMEAA
Sbjct  62   ALRRVPLACRDVVRLRDDALALRSIISSILLKLKKAEGTSAESIAALAKIDTVKQRMEAA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL+ MVQPRL+DALSNRKVD  Q++R IL RIGRFKSLELQY+K+H+KP+K LWEDF+ 
Sbjct  182  DRLEEMVQPRLSDALSNRKVDDVQDLRRILIRIGRFKSLELQYTKMHIKPLKILWEDFDS  241

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            R++ +K+     E+ER         NS+ +SFS WLPSFYDE+LLYL
Sbjct  242  RRRTSKL-----EMERHGD------NSTSVSFSSWLPSFYDEVLLYL  277



>gb|AIU51143.1| embryo yellow protein, partial [Yucca filamentosa]
Length=822

 Score =   409 bits (1051),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 206/287 (72%), Positives = 243/287 (85%), Gaps = 11/287 (4%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            ++VDL  FSDE FDPK+WIN A +SRHPQDPLD+ L DLE  L+ ASE+I+ SLE  S+ 
Sbjct  2    VVVDLVEFSDESFDPKRWINAALESRHPQDPLDRFLSDLEENLRSASEKISDSLERESSD  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVP A RDV RLR+DA+ LRS+VSSILQKL+KAEG+SAES+A LAK+DTVK+RMEAA
Sbjct  62   ALRRVPLAVRDVARLREDAIQLRSAVSSILQKLKKAEGTSAESIAALAKIDTVKQRMEAA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL+ MVQPRL+DALS+RKV+  Q++R IL RIGRFKSLEL Y+K+HLKP++ LWEDF+ 
Sbjct  182  DRLEEMVQPRLSDALSSRKVEAVQDLRRILIRIGRFKSLELLYTKMHLKPLRKLWEDFDS  241

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQ+ANK+  EK+  +R SS          ISFS WLPSFYDE+LLYL
Sbjct  242  RQRANKLEMEKHG-DRPSS----------ISFSSWLPSFYDEVLLYL  277



>ref|XP_008796946.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Phoenix 
dactylifera]
Length=824

 Score =   408 bits (1049),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 203/287 (71%), Positives = 240/287 (84%), Gaps = 11/287 (4%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +++DL  FS+E FDPK+WIN A  SRHPQDPLD+ L DLE  L+ ASE+IA +LE  SA 
Sbjct  2    VVLDLGEFSEEGFDPKRWINAALDSRHPQDPLDRFLSDLEENLRAASEKIADALERESAD  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVP A RDV+RLRDDAL+LRS +SSIL KL+KAEG+SAES+A LAK+DTVK+RMEAA
Sbjct  62   ALRRVPLACRDVVRLRDDALALRSVISSILLKLKKAEGTSAESIAALAKIDTVKQRMEAA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS++VEDVF+SGDLP+AAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YETLQDAAGLTQLSASVEDVFASGDLPQAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL+ MVQPRL+DALSNRKVD  Q++R IL RIGRFKSLEL Y+K+H+KP+K LWEDF+ 
Sbjct  182  DRLEEMVQPRLSDALSNRKVDHVQDLRRILIRIGRFKSLELHYTKMHIKPLKILWEDFDS  241

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQ+A K+  EK+             NS+ +SFS WLPSFYDE+LLYL
Sbjct  242  RQRARKLEMEKHGD-----------NSTSVSFSSWLPSFYDEVLLYL  277



>gb|AIU51157.1| embryo yellow protein, partial [Trachycarpus fortunei]
Length=821

 Score =   408 bits (1048),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 203/287 (71%), Positives = 241/287 (84%), Gaps = 11/287 (4%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +++DL  FS+E FDPK+WIN A +SRHPQDPL++ L DLE  L+ ASE+IA +LE  SA 
Sbjct  2    VVLDLGEFSEEGFDPKRWINAALESRHPQDPLERFLSDLEENLRAASEKIADALERESAD  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVP A RDV+RLRDDAL+LRS +SSIL KL+KAEG+SAES+A LAK+DTVK+RMEAA
Sbjct  62   ALRRVPVACRDVVRLRDDALALRSVISSILLKLKKAEGTSAESIAALAKIDTVKQRMEAA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL+ MVQPRL+DALSNRKVD  Q++R IL RIGRFKSLEL Y+K+H+KP+K LWEDF+ 
Sbjct  182  DRLEEMVQPRLSDALSNRKVDDVQDLRRILIRIGRFKSLELLYTKMHIKPLKILWEDFDS  241

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQ+ +K+  EK+             NS+ ISFS WLPSFYDE+LLYL
Sbjct  242  RQRTSKLEMEKHGD-----------NSTSISFSSWLPSFYDEVLLYL  277



>ref|XP_009372929.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=651

 Score =   397 bits (1021),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 191/238 (80%), Positives = 214/238 (90%), Gaps = 0/238 (0%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSD  FDP++W+N ACQ+RH QD +DKH+VDLEMKLQM SEEIA SLEE SAS
Sbjct  1    MMLDLGPFSDPNFDPRKWVNSACQTRHTQDSVDKHMVDLEMKLQMVSEEIAASLEEQSAS  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+RLRDDA+SLRS+VSSIL KL+KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVVRLRDDAVSLRSAVSSILDKLKKAEGSSAESIAALAKVDIVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YET QDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETSQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            DRLDSMVQPRLTDA+SNRKV++ Q++R IL RIGRFKS+EL Y+KVHLKPIK     F
Sbjct  181  DRLDSMVQPRLTDAISNRKVEIVQDLRGILIRIGRFKSMELHYTKVHLKPIKQCMVAF  238



>gb|AIU51127.1| embryo yellow protein, partial [Asparagus officinalis]
Length=822

 Score =   400 bits (1027),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 200/287 (70%), Positives = 237/287 (83%), Gaps = 11/287 (4%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            ++VDL  FS+E FDPK+WIN A +SRHPQDP+D+ L DLE  L+ ASE+I+ SLE  S+ 
Sbjct  2    VVVDLVEFSEESFDPKRWINAALESRHPQDPIDRFLSDLEENLRSASEKISDSLERESSD  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVP A RDV RLR+DA+ LRS+V+SILQKL+KAEG+SAE +A LAK+DTVK+RMEAA
Sbjct  62   ALRRVPAAVRDVARLREDAIQLRSAVNSILQKLKKAEGTSAEHIAALAKIDTVKQRMEAA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS++VEDVF+SGDL RAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YETLQDAAGLTQLSASVEDVFASGDLSRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD MVQPRL+DAL+NRKV+  Q++R IL RIGRFKSLEL Y K+HLKP++  WEDF+L
Sbjct  182  DRLDEMVQPRLSDALTNRKVEAVQDLRRILIRIGRFKSLELLYIKMHLKPLRKRWEDFDL  241

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQ+A+K+  EK           L    S ISFS WLPSFYDE+LLYL
Sbjct  242  RQRASKLETEK-----------LGERPSSISFSSWLPSFYDEVLLYL  277



>gb|AIU51107.1| embryo yellow protein, partial [Musa acuminata]
Length=814

 Score =   399 bits (1025),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 197/287 (69%), Positives = 236/287 (82%), Gaps = 11/287 (4%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            ++VD+  F +E FDPK+WIN A +SRHPQDPLD++L DLE  L+ ++++IA +L+  SA 
Sbjct  2    VVVDVGEFGEEGFDPKRWINAALESRHPQDPLDRYLSDLEENLRTSADKIADALDRESAD  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVP A RDV+RLRDDALSLRS VSSIL  L KAEG+SAES+A +AK+D+VK+RMEAA
Sbjct  62   ALRRVPLACRDVLRLRDDALSLRSLVSSILLALSKAEGTSAESIAAIAKIDSVKQRMEAA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL+ MVQPRL DAL NRKVD  Q++R IL RIGRFKSLELQY K+ +KP+K LWE F+ 
Sbjct  182  DRLEEMVQPRLFDALQNRKVDTVQDLRRILVRIGRFKSLELQYIKLGIKPLKKLWERFDS  241

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQQA+K+  EK+              ++PISFS WLPSFYDE+LLYL
Sbjct  242  RQQAHKLETEKH-----------HEYTNPISFSSWLPSFYDEILLYL  277



>ref|XP_009399332.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Musa 
acuminata subsp. malaccensis]
Length=818

 Score =   399 bits (1024),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 197/287 (69%), Positives = 236/287 (82%), Gaps = 11/287 (4%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            ++VD+  F +E FDPK+WIN A +SRHPQDPLD++L DLE  L+ ++++IA +L+  SA 
Sbjct  2    VVVDVGEFGEEGFDPKRWINAALESRHPQDPLDRYLSDLEENLRTSADKIADALDRESAD  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVP A RDV+RLRDDALSLRS VSSIL  L KAEG+SAES+A +AK+D+VK+RMEAA
Sbjct  62   ALRRVPLACRDVLRLRDDALSLRSLVSSILLALSKAEGTSAESIAAIAKIDSVKQRMEAA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL+ MVQPRL DAL NRKVD  Q++R IL RIGRFKSLELQY K+ +KP+K LWE F+ 
Sbjct  182  DRLEEMVQPRLFDALQNRKVDTVQDLRRILVRIGRFKSLELQYIKLGIKPLKKLWERFDS  241

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQQA+K+  EK+              ++PISFS WLPSFYDE+LLYL
Sbjct  242  RQQAHKLETEKH-----------HEYTNPISFSSWLPSFYDEILLYL  277



>ref|XP_003618197.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
 gb|AES74415.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=755

 Score =   394 bits (1012),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 204/287 (71%), Positives = 229/287 (80%), Gaps = 21/287 (7%)
 Frame = +3

Query  84   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  263
            M+DL SFS+  FDPK+WIN AC SRH Q     HL+DLEMKLQM SEEI+ SLEE S++A
Sbjct  3    MIDLVSFSNSNFDPKKWINTACNSRHSQ-----HLIDLEMKLQMLSEEISASLEEQSSAA  57

Query  264  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  443
            L RVPRATRDVI LRDDA SL S+VS IL  L+K  GSSAES+A LAKVD VK+RME AY
Sbjct  58   LLRVPRATRDVICLRDDAGSLCSAVSVILHNLQKRNGSSAESIAALAKVDVVKQRMEVAY  117

Query  444  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  623
            ETLQDAAGLTQLSSTVEDVF SGDLP AAETLANMRHCLSAVGEVAEFANIRKQLEVLED
Sbjct  118  ETLQDAAGLTQLSSTVEDVFDSGDLPCAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  177

Query  624  RLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFELR  803
            RLD+M             +D AQ++  +L RIGRFKSLE QYSKVHLKPIK LWED E R
Sbjct  178  RLDTM-------------IDAAQDLCGVLIRIGRFKSLESQYSKVHLKPIKQLWEDLESR  224

Query  804  QQANKVSNEKNEVERLSSANELQLNSSP-ISFSRWLPSFYDELLLYL  941
            ++ANK +NEK+E+E +S+  + Q  SSP +SFS WLPSFYDELLLYL
Sbjct  225  ERANKSANEKSEMETMSTGGDFQ--SSPTVSFSNWLPSFYDELLLYL  269



>gb|AIU51150.1| embryo yellow protein, partial [Ceratophyllum platyacanthum subsp. 
oryzetorum]
Length=813

 Score =   394 bits (1013),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 189/287 (66%), Positives = 237/287 (83%), Gaps = 17/287 (6%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL++FS+ KFDPK+WIN ACQ+RHPQDP++KHL DLEMKLQ+ SEEI+ SL+E S++
Sbjct  1    MMIDLNAFSEVKFDPKKWINAACQNRHPQDPVEKHLTDLEMKLQLISEEISSSLDEQSSA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            +L RVPRA+RDV+RLR+DA++L++SV+ ILQKL KAEG+++ESVA LA VD VK+RMEAA
Sbjct  61   SLLRVPRASRDVVRLREDAMTLKASVTGILQKLIKAEGTASESVAALATVDIVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCL+AVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLTAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL+ MVQPRL+DA++NRKV+  Q +R IL RIGR+KSLE  Y+K+H+ PI+ LWE    
Sbjct  181  DRLEGMVQPRLSDAIANRKVEEVQNLRKILIRIGRYKSLEFLYTKIHIIPIQRLWE----  236

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
                   +N+  +VE +        N    SF  WLP+FYDE+LLYL
Sbjct  237  ------AANDNLDVEAIG-------NVESDSFPSWLPNFYDEILLYL  270



>gb|AIU51124.1| embryo yellow protein, partial [Ceratophyllum demersum]
Length=813

 Score =   394 bits (1013),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 189/287 (66%), Positives = 237/287 (83%), Gaps = 17/287 (6%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL++FS+ KFDPK+WIN ACQ+RHPQDP++KHL DLEMKLQ+ SEEI+ SL+E S++
Sbjct  1    MMIDLNAFSEVKFDPKKWINAACQNRHPQDPVEKHLTDLEMKLQLISEEISSSLDEQSSA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            +L RVPRA+RDV+RLR+DA++L++SV+ ILQKL KAEG+++ESVA LA VD VK+RMEAA
Sbjct  61   SLLRVPRASRDVVRLREDAMTLKASVTGILQKLIKAEGTASESVAALATVDIVKQRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCL+AVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLTAVGEVAEFANVRKQLEVLE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL+ MVQPRL+DA++NRKV+  Q +R IL RIGR+KSLE  Y+K+H+ PI+ LWE    
Sbjct  181  DRLEGMVQPRLSDAIANRKVEEVQNLRKILIRIGRYKSLEFLYTKIHIIPIQRLWE----  236

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
                   +N+  +VE +        N    SF  WLP+FYDE+LLYL
Sbjct  237  ------AANDNLDVEAIG-------NVESDSFPSWLPNFYDEILLYL  270



>gb|AIU51156.1| embryo yellow protein, partial [Alisma plantago-aquatica]
Length=823

 Score =   393 bits (1010),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 189/287 (66%), Positives = 235/287 (82%), Gaps = 6/287 (2%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            ++VDL+ F+DE FDPK+WIN A  SRHPQDP+D+++ DLE  L+ ++E IA +LE  S  
Sbjct  2    VVVDLTEFADEAFDPKRWINAALDSRHPQDPIDRYISDLEENLRASAENIADALERESTD  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVP A RDV+RLRD+A+SLR+ VS ILQKL KA+GSSAE+++ +AK+D VK+RME+A
Sbjct  62   ALRRVPVAVRDVLRLRDEAISLRAVVSGILQKLNKADGSSAEAISAIAKIDVVKKRMESA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE
Sbjct  122  YETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  181

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD MVQPRL+DALSNRKVD  Q+ R IL RIGRFKSLE+ Y+K +++PIK LW++++ 
Sbjct  182  DRLDQMVQPRLSDALSNRKVDAVQDFRRILVRIGRFKSLEMNYTKHYVQPIKKLWDEYDS  241

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            R Q N   ++K   E++S A+       P+ F RWLP+FYD +LLYL
Sbjct  242  RFQGNNSGSDKFVAEKVSDAH------VPLLFPRWLPNFYDGVLLYL  282



>gb|AIU51108.1| embryo yellow protein, partial [Pinellia ternata]
Length=829

 Score =   390 bits (1002),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 190/288 (66%), Positives = 242/288 (84%), Gaps = 5/288 (2%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            ++VDL  F++E FDPK+WIN + ++RHPQDPLD+++ DLE  L+ ++E IA +LE+ SA 
Sbjct  2    VVVDLGEFAEEGFDPKRWINASLEARHPQDPLDRYISDLEESLRSSAENIADTLEKESAD  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVP A RDV+RLRD+A +LRS VSSIL KL+KA  +S+ESV  L+++D VKRRMEAA
Sbjct  62   ALRRVPLAVRDVLRLRDEAHALRSVVSSILLKLKKAGETSSESVEALSRIDAVKRRMEAA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS+TVEDVF+SGDLPR AETLANMRHCLSAVGEVAEFAN+RK+LEVLE
Sbjct  122  YETLQDAAGLTQLSATVEDVFASGDLPRVAETLANMRHCLSAVGEVAEFANVRKRLEVLE  181

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL+ MVQPRL+DALSNRKVD  Q+++ IL RIGR+KSLE  Y+++++KPIK +WE+F+ 
Sbjct  182  DRLEDMVQPRLSDALSNRKVDAVQDLQRILIRIGRYKSLEQHYTRMNIKPIKKIWEEFDS  241

Query  801  RQQANKVSNEKNEVERL-SSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQQANK+ N+KN++E L   A+ +QL     +FS WLP+FYDE+LLYL
Sbjct  242  RQQANKLENDKNDMEHLVGGASTVQL----FNFSSWLPNFYDEVLLYL  285



>gb|AIU51142.1| embryo yellow protein, partial [Dioscorea oppositifolia]
Length=831

 Score =   389 bits (998),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 193/287 (67%), Positives = 239/287 (83%), Gaps = 4/287 (1%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +++DL  F +E FD K+WINGA +SRHPQDPLD +L DLE  L+ AS++IA +L+  SA 
Sbjct  2    VVLDLGEFGEEGFDAKRWINGALESRHPQDPLDHYLADLEESLRSASDKIADALDRDSAD  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            +L R+P A RD++RLRDDA +LR  VS++L  L +AEG+SAES+AT+A++DTVKRRMEAA
Sbjct  62   SLRRLPLACRDLLRLRDDAHALRHLVSALLTNLAQAEGTSAESIATIARIDTVKRRMEAA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL+ MVQPRL+DALSNRK+D  Q++R IL RIGRFKSLE +Y+K+H KP+K LWEDFEL
Sbjct  182  DRLEEMVQPRLSDALSNRKIDAVQDLRRILIRIGRFKSLETRYTKMHTKPLKKLWEDFEL  241

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q++ K   EK+  E+ S+  +    SS  SFS WLPSFYDE+LLYL
Sbjct  242  KQRSTKHEMEKHG-EKPSNILD---ASSNASFSSWLPSFYDEVLLYL  284



>ref|XP_006657236.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Oryza brachyantha]
Length=824

 Score =   380 bits (977),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 188/287 (66%), Positives = 228/287 (79%), Gaps = 10/287 (3%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            ++VD S F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  SA 
Sbjct  2    VVVDASEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRSAADDAAAALERDSAD  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVP A RD +RLRDDA+SLRS ++S+LQ L +AEGSSAES+  LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVSLRSHLASVLQSLSQAEGSSAESITALARIDTVKQRMEAA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RLD MVQPRL DALSNRKVD  Q++R IL RIGRFKSLE+QY+K+H KP+K LWEDF+L
Sbjct  182  ERLDDMVQPRLVDALSNRKVDAVQDLRGILIRIGRFKSLEVQYTKIHAKPLKKLWEDFDL  241

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+AN+V  EK   E +S           +SF+ WLP+FYDE LLYL
Sbjct  242  KQRANRVEMEKYGGESISG----------VSFASWLPNFYDETLLYL  278



>gb|EEC81147.1| hypothetical protein OsI_24056 [Oryza sativa Indica Group]
Length=825

 Score =   378 bits (971),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 187/287 (65%), Positives = 229/287 (80%), Gaps = 10/287 (3%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            ++VD S F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  SA 
Sbjct  2    VVVDASEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRSAADDAAAALERDSAD  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVP A RD +RLRDDA+SLRS ++S+LQ L +AEGSSAES+  LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVSLRSHLASVLQSLSQAEGSSAESITALARIDTVKQRMEAA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RLD MVQPRL DALSNRKVD  Q++R IL RIGRFKSLE+QY+K+H+KP+K LWEDF+L
Sbjct  182  ERLDDMVQPRLVDALSNRKVDAVQDLRGILIRIGRFKSLEVQYTKIHVKPLKKLWEDFDL  241

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+A +V  EK   E ++S          +SF+ WLP+FYDE LLYL
Sbjct  242  KQRAKRVEMEKYGGESINS----------LSFASWLPNFYDETLLYL  278



>dbj|BAJ94393.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=823

 Score =   375 bits (963),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 185/287 (64%), Positives = 226/287 (79%), Gaps = 11/287 (4%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            ++VD + F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++   +LE  SA 
Sbjct  2    VVVDAAEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRAAADDAGAALERDSAD  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVP A RD +RLRDDAL+LRS ++S+L  L +AEGSSAES+  LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDALALRSHLASVLHSLSQAEGSSAESITALARIDTVKQRMEAA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YTTLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RLD MVQPRL DALSNRK++  Q++R IL RIGRFKSLE+QY+K+H+KP+K LWEDF+L
Sbjct  182  ERLDEMVQPRLLDALSNRKIEAVQDLRGILTRIGRFKSLEVQYTKIHIKPLKKLWEDFDL  241

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+AN+   EK   E         +NS  I FS WLPSFYDE LLYL
Sbjct  242  KQRANRAEMEKRGGE---------INS--ILFSSWLPSFYDETLLYL  277



>gb|AIU51155.1| embryo yellow protein, partial [Zea mays]
Length=818

 Score =   372 bits (954),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 185/287 (64%), Positives = 227/287 (79%), Gaps = 10/287 (3%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            ++VD S F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  S  
Sbjct  2    VVVDASEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRSAADDAAAALERDSGD  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVP A RD +RLRDDA++LRS ++S+LQ L  AEGSSAES+A LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRSHLASVLQSLSLAEGSSAESIAALARIDTVKQRMEAA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RLD MVQPRL DALSNRKVD  Q++R IL RI RFKSLE+QY+K+H+KP+K LW+DFEL
Sbjct  182  ERLDEMVQPRLVDALSNRKVDAVQDLRGILIRINRFKSLEVQYTKIHVKPLKKLWDDFEL  241

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+++KV  EK   E +S           +SFS WLP+FYDE LLYL
Sbjct  242  KQRSSKVDMEKLSGESISG----------LSFSSWLPNFYDETLLYL  278



>ref|XP_008658135.1| PREDICTED: uncharacterized protein LOC100193995 isoform X1 [Zea 
mays]
 gb|AFW87715.1| hypothetical protein ZEAMMB73_766806 [Zea mays]
Length=820

 Score =   372 bits (954),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 185/287 (64%), Positives = 227/287 (79%), Gaps = 10/287 (3%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            ++VD S F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  S  
Sbjct  2    VVVDASEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRSAADDAAAALERDSGD  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVP A RD +RLRDDA++LRS ++S+LQ L  AEGSSAES+A LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRSHLASVLQSLSLAEGSSAESIAALARIDTVKQRMEAA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RLD MVQPRL DALSNRKVD  Q++R IL RI RFKSLE+QY+K+H+KP+K LW+DFEL
Sbjct  182  ERLDEMVQPRLVDALSNRKVDAVQDLRGILIRINRFKSLEVQYTKIHVKPLKKLWDDFEL  241

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+++KV  EK   E +S           +SFS WLP+FYDE LLYL
Sbjct  242  KQRSSKVDMEKLSGESISG----------LSFSSWLPNFYDETLLYL  278



>dbj|BAJ95800.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=823

 Score =   372 bits (954),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 184/287 (64%), Positives = 225/287 (78%), Gaps = 11/287 (4%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            ++VD + F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++   +LE  SA 
Sbjct  2    VVVDAAEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRAAADDAGAALERDSAD  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVP A RD +RLRDDAL+LRS ++S+L  L +AEGSSAES+  LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDALALRSHLASVLHSLSQAEGSSAESITALARIDTVKQRMEAA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YTTLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RL  MVQPRL DALSNRK++  Q++R IL RIGRFKSLE+QY+K+H+KP+K LWEDF+L
Sbjct  182  ERLVEMVQPRLLDALSNRKIEAVQDLRGILTRIGRFKSLEVQYTKIHIKPLKKLWEDFDL  241

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+AN+   EK   E         +NS  I FS WLPSFYDE LLYL
Sbjct  242  KQRANRAEMEKRGGE---------INS--ILFSSWLPSFYDETLLYL  277



>gb|AIU51144.1| embryo yellow protein, partial [Setaria italica]
Length=818

 Score =   369 bits (948),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 184/287 (64%), Positives = 227/287 (79%), Gaps = 10/287 (3%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            ++VD S F  E FDPKQWIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  S  
Sbjct  2    VVVDASEFGAEGFDPKQWINAALDARHPSEPLDRFLADAEERLRAAADDAAAALERDSGD  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVP A RD +RLRDDA++LR+ ++S+LQ L  AEGSSAES+A LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRAHLASVLQSLSLAEGSSAESIAALAQIDTVKQRMEAA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RLD MVQPRL DALSNRKVD  Q++R IL RI RFKSLE QY+K+H+KP+K LWEDF+L
Sbjct  182  ERLDEMVQPRLVDALSNRKVDAVQDLRGILIRIERFKSLEAQYTKIHVKPLKKLWEDFDL  241

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+A++V  EK   E +++          +SFS WLP+FYDE LLYL
Sbjct  242  KQRASRVDMEKLGGESINA----------LSFSSWLPNFYDETLLYL  278



>dbj|BAD45448.1| oligomeric golgi complex 7-like [Oryza sativa Japonica Group]
Length=873

 Score =   370 bits (951),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 187/294 (64%), Positives = 229/294 (78%), Gaps = 17/294 (6%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            ++VD S F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  SA 
Sbjct  2    VVVDASEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRSAADDAAAALERDSAD  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVP A RD +RLRDDA+SLRS ++S+LQ L +AEGSSAES+  LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVSLRSHLASVLQSLSQAEGSSAESITALARIDTVKQRMEAA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  621  DRLDSMVQPRLTDALSNR-------KVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKH  779
            +RLD MVQPRL DALSNR       KVD  Q++R IL RIGRFKSLE+QY+K+H+KP+K 
Sbjct  182  ERLDDMVQPRLVDALSNRKPTNFGWKVDAVQDLRGILIRIGRFKSLEVQYTKIHVKPLKK  241

Query  780  LWEDFELRQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            LWEDF+L+Q+A +V  EK   E ++S          +SF+ WLP+FYDE LLYL
Sbjct  242  LWEDFDLKQRAKRVEMEKYGGESINS----------LSFASWLPNFYDETLLYL  285



>ref|XP_004966309.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Setaria italica]
Length=820

 Score =   369 bits (948),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 184/287 (64%), Positives = 227/287 (79%), Gaps = 10/287 (3%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            ++VD S F  E FDPKQWIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  S  
Sbjct  2    VVVDASEFGAEGFDPKQWINAALDARHPSEPLDRFLADAEERLRAAADDAAAALERDSGD  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVP A RD +RLRDDA++LR+ ++S+LQ L  AEGSSAES+A LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRAHLASVLQSLSLAEGSSAESIAALAQIDTVKQRMEAA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RLD MVQPRL DALSNRKVD  Q++R IL RI RFKSLE QY+K+H+KP+K LWEDF+L
Sbjct  182  ERLDEMVQPRLVDALSNRKVDAVQDLRGILIRIERFKSLEAQYTKIHVKPLKKLWEDFDL  241

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+A++V  EK   E +++          +SFS WLP+FYDE LLYL
Sbjct  242  KQRASRVDMEKLGGESINA----------LSFSSWLPNFYDETLLYL  278



>ref|XP_002438832.1| hypothetical protein SORBIDRAFT_10g026850 [Sorghum bicolor]
 gb|EER90199.1| hypothetical protein SORBIDRAFT_10g026850 [Sorghum bicolor]
Length=820

 Score =   369 bits (947),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 184/287 (64%), Positives = 226/287 (79%), Gaps = 10/287 (3%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            ++VD S F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  S  
Sbjct  2    VVVDASEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRSAADDAAAALERDSGD  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVP A RD +RLRDDA++LRS ++S+LQ L  AEGSSAES+A LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRSHLASVLQSLSLAEGSSAESIAALARIDTVKQRMEAA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RLD MVQPRL DALSNRKVD  Q++R IL RI RFKSLE QY+K+H+KP+K LWEDF+L
Sbjct  182  ERLDEMVQPRLVDALSNRKVDAVQDLRGILIRIDRFKSLEAQYTKIHVKPLKKLWEDFDL  241

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q++++V  EK   E +S           +SFS WLP+FYDE LLYL
Sbjct  242  KQRSSRVDMEKLSGESISG----------LSFSSWLPNFYDETLLYL  278



>gb|AIU51153.1| embryo yellow protein, partial [Ginkgo biloba]
Length=816

 Score =   369 bits (946),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 180/262 (69%), Positives = 220/262 (84%), Gaps = 0/262 (0%)
 Frame = +3

Query  156  RHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASALHRVPRATRDVIRLRDDALSLRSS  335
            RHP+DP++KHL DLEMKLQ+ SEEIA SL+E SA+AL RVPRA+RDVIR+RDDA++LRS+
Sbjct  1    RHPEDPVEKHLGDLEMKLQVMSEEIASSLDEQSAAALLRVPRASRDVIRVRDDAIALRSA  60

Query  336  VSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGD  515
            VS ILQKL+KAEGSSAES+A LA+VDTVK+RMEAAYETLQDAAGLT+LS+TVEDVF+SGD
Sbjct  61   VSGILQKLKKAEGSSAESIAALARVDTVKQRMEAAYETLQDAAGLTKLSATVEDVFASGD  120

Query  516  LPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDRLDSMVQPRLTDALSNRKVDVAQE  695
            L +AAETLANMRHCLS VGEVAEFAN+++QLEVLEDRL+ MVQPRL++A+SNRKVD AQ 
Sbjct  121  LSQAAETLANMRHCLSVVGEVAEFANVKRQLEVLEDRLEGMVQPRLSEAISNRKVDAAQG  180

Query  696  MRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFELRQQANKVSNEKNEVERLSSANELQL  875
            +R IL RIGR+K LE QY+++ +KP++ LWEDF+  +  N+  NEK   +R   +     
Sbjct  181  LRYILIRIGRYKYLEQQYTRIRMKPLRRLWEDFDSGKMINRADNEKQVGDRQPESMGAIN  240

Query  876  NSSPISFSRWLPSFYDELLLYL  941
            N    SFS WLP FYDE+LL L
Sbjct  241  NGPSRSFSSWLPHFYDEVLLAL  262



>gb|AIU51146.1| embryo yellow protein, partial [Sorghum bicolor]
Length=818

 Score =   369 bits (946),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 184/287 (64%), Positives = 226/287 (79%), Gaps = 10/287 (3%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            ++VD S F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++ A +LE  S  
Sbjct  2    VVVDASEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRSAADDAAAALERDSGD  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVP A RD +RLRDDA++LRS ++S+LQ L  AEGSSAES+A LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRSHLASVLQSLSLAEGSSAESIAALARIDTVKQRMEAA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RLD MVQPRL DALSNRKVD  Q++R IL RI RFKSLE QY+K+H+KP+K LWEDF+L
Sbjct  182  ERLDEMVQPRLVDALSNRKVDAVQDLRGILIRIDRFKSLEAQYTKIHVKPLKKLWEDFDL  241

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q++++V  EK   E +S           +SFS WLP+FYDE LLYL
Sbjct  242  KQRSSRVDMEKLSGESISG----------LSFSSWLPNFYDETLLYL  278



>gb|AIU51158.1| embryo yellow protein, partial [Cabomba caroliniana]
Length=804

 Score =   367 bits (941),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 181/255 (71%), Positives = 217/255 (85%), Gaps = 1/255 (0%)
 Frame = +3

Query  177  DKHLVDLEMKLQMASEEIAVSLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQK  356
            DKHL DLEMKLQ+ SEEIA SL+E S +AL RVPR+TRDV+RLRDDA SLRS+V  ILQ+
Sbjct  1    DKHLADLEMKLQLLSEEIAASLDEQSQAALLRVPRSTRDVVRLRDDASSLRSAVLLILQR  60

Query  357  LRKAEGSSAESVATLAKVDTVKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAET  536
            L+KAEGSSAES+  LA++D VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAET
Sbjct  61   LKKAEGSSAESITALAEIDMVKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAET  120

Query  537  LANMRHCLSAVGEVAEFANIRKQLEVLEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNR  716
            LANMRHCLSAVGEVAEFAN+RKQLEVLEDRLD+MVQPRL+DA+SN+KVD  Q  R IL  
Sbjct  121  LANMRHCLSAVGEVAEFANVRKQLEVLEDRLDAMVQPRLSDAISNQKVDEVQSFREILIL  180

Query  717  IGRFKSLELQYSKVHLKPIKHLWEDFELRQQANKVSNEKNEVERLSSANELQLNSSPISF  896
            IGR KS+EL Y+K+H+KPI+ LWEDFE +Q +N++S  ++  ER    ++L  N SP  F
Sbjct  181  IGRLKSVELIYTKIHIKPIRKLWEDFESKQVSNRLSYGQDG-ERRGGLSDLASNPSPFLF  239

Query  897  SRWLPSFYDELLLYL  941
            + WLP+FYDE+LLYL
Sbjct  240  ASWLPNFYDEVLLYL  254



>gb|AIU51130.1| embryo yellow protein, partial [Canna indica]
Length=815

 Score =   364 bits (934),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 193/287 (67%), Positives = 231/287 (80%), Gaps = 11/287 (4%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            ++VD+  F +E FDPK+WIN A  SRHPQDPLD+ L DLE  L+ ++++I+ +L+  SA 
Sbjct  2    VVVDVGEFGEEGFDPKRWINAALDSRHPQDPLDRFLSDLEENLRASADKISDALDRESAD  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVP A RDV+RLRDDALSLRS VSSIL  L KAEG+SAES+A +AK+D VK+RMEAA
Sbjct  62   ALRRVPLACRDVLRLRDDALSLRSLVSSILLSLNKAEGTSAESIAAIAKIDIVKQRMEAA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRL+ MVQPRL DAL  RKV+  Q++R IL RIGRFKSLELQY K+ +KP+K LWE F+ 
Sbjct  182  DRLEEMVQPRLFDALQYRKVEDVQDLRRILVRIGRFKSLELQYIKIGIKPLKKLWEGFDS  241

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            RQQANK+  EK+           + +S  +SF  WLPSFYDE+LLYL
Sbjct  242  RQQANKLELEKH-----------RDHSKSLSFFSWLPSFYDEVLLYL  277



>gb|AIU51137.1| embryo yellow protein, partial [Panicum virgatum]
Length=818

 Score =   362 bits (928),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 185/287 (64%), Positives = 226/287 (79%), Gaps = 10/287 (3%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            ++VD S F  E FDPKQWIN A  +RHP +PLD+ L D E +L+ A+E+ A +LE  S  
Sbjct  2    VVVDASEFGAEGFDPKQWINAALDARHPSEPLDRFLADAEERLRAAAEDAAAALERDSGD  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVP A RD +RLRDDA++LR+ ++S+LQ L  AEGSSAES+A LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRAHLASVLQSLNLAEGSSAESIAALAQIDTVKQRMEAA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  122  YTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  181

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RLD MVQPRL DALSNRKVD  Q++R IL RI RFKSLE QY+K+H+KP+K LWEDF+L
Sbjct  182  ERLDEMVQPRLVDALSNRKVDAVQDLRGILIRIERFKSLEAQYTKIHVKPLKKLWEDFDL  241

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+A++V  EK   E ++           +SFS WLP+FYDE LLYL
Sbjct  242  KQRASRVDMEKLGGESING----------LSFSSWLPNFYDETLLYL  278



>ref|XP_001770876.1| predicted protein [Physcomitrella patens]
 gb|EDQ64400.1| predicted protein [Physcomitrella patens]
Length=849

 Score =   352 bits (903),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 178/299 (60%), Positives = 227/299 (76%), Gaps = 17/299 (6%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL+SF D+KF  K W+N AC++RHP D LDK+L DLE+KLQ+ +E IA SLEE SA 
Sbjct  1    MMLDLASFGDDKFHAKSWVNAACKARHPDDSLDKYLGDLEIKLQLMAENIAASLEEQSAQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRA+RDV R+RDDALSLRS+VS++LQKL++AEG+SAESVA LA+VD VK+RMEAA
Sbjct  61   ALLRVPRASRDVFRVRDDALSLRSTVSAVLQKLQQAEGTSAESVAALARVDAVKQRMEAA  120

Query  441  YETL-QDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  617
            +ETL QDAAGL +LS++VEDVF+SG+LP+AAETLA MR CL+ VGEV EFAN+++QLE L
Sbjct  121  HETLQQDAAGLAKLSASVEDVFASGNLPQAAETLAQMRRCLAVVGEVPEFANVKRQLEGL  180

Query  618  EDRLDSMVQPRLTDALSNRK-VDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            EDRL+ MVQPRL DAL+ RK V+  Q +R IL  IGR+KSLE  Y++V ++P+K LWE+F
Sbjct  181  EDRLEGMVQPRLADALTQRKVVESTQGLRDILITIGRYKSLEQHYTRVRMRPLKRLWEEF  240

Query  795  ELRQQA----------NKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            E  +            N V  ++      +SA     N S  SF+ WLP +YDE+LL L
Sbjct  241  EAVKVGIPLAKPAATDNSVGGDRRPATMPNSA-----NGSTTSFAEWLPHYYDEVLLVL  294



>gb|AIU51111.1| embryo yellow protein, partial [Acorus calamus]
Length=827

 Score =   326 bits (836),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 169/287 (59%), Positives = 224/287 (78%), Gaps = 7/287 (2%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +++DLS+F DE+FD K+WIN           +D+H  DLE  L  A + I+  L + ++ 
Sbjct  2    VVLDLSAFDDERFDAKRWINTQDPPSMASSAMDRHFSDLEESLHEAFDRISADLSKRTSE  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            A+  VP A RDV RLRD+ALSLRSSVSSIL KL++AEGS+AES+A LAK+DTVK+RMEAA
Sbjct  62   AMLSVPHAARDVARLRDEALSLRSSVSSILSKLKQAEGSAAESIAVLAKIDTVKQRMEAA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            + TLQ+AAGLT+LS++VE VF+SGDL +AAETLA MR  L AVGEVAEFAN+RKQLEVLE
Sbjct  122  HTTLQEAAGLTELSASVESVFASGDLRQAAETLAQMRRRLFAVGEVAEFANVRKQLEVLE  181

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            DRLD MVQP+L+DALSNRKVD+ Q++R IL RIGRF+SLE+ Y+K+H+KPI+ LW++F+ 
Sbjct  182  DRLDEMVQPQLSDALSNRKVDLVQDLRQILMRIGRFRSLEIHYTKMHVKPIRKLWDEFDT  241

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +QQA K + +       ++A+    +S+ +SFS WLP+FYDE+LL+L
Sbjct  242  KQQAGKPAGD-------NAADAFPRSSTSLSFSSWLPNFYDEVLLHL  281



>ref|XP_008376425.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Malus domestica]
Length=648

 Score =   316 bits (810),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 173/198 (87%), Gaps = 6/198 (3%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM+DL  FSD  FDP++W+N ACQ+RH QD +DKH VDLEMKLQM  EEIA SLEE SAS
Sbjct  1    MMLDLGPFSDRNFDPRKWVNSACQTRHTQDSVDKHTVDLEMKLQMVXEEIAASLEEQSAS  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVPRATRDV+R+RDDA      VSSIL K +KAEGSSAES+A LAKVD VK+RMEAA
Sbjct  61   ALLRVPRATRDVVRIRDDA------VSSILDKFKKAEGSSAESMAALAKVDIVKQRMEAA  114

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            YETLQDAAGLTQLS+TVEDVF+SGDLP AAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  115  YETLQDAAGLTQLSATVEDVFASGDLPLAAETLANMRHCLSAVGEVAEFANLRKQLEVLE  174

Query  621  DRLDSMVQPRLTDALSNR  674
            DRLDSMVQPRLTDA+ ++
Sbjct  175  DRLDSMVQPRLTDAIQSQ  192



>gb|EEE66191.1| hypothetical protein OsJ_22310 [Oryza sativa Japonica Group]
Length=790

 Score =   319 bits (818),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 166/287 (58%), Positives = 203/287 (71%), Gaps = 45/287 (16%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            ++VD S F  E FDPK+WIN A  +RHP +PLD+ L D E +L+ A+++ A +LE     
Sbjct  2    VVVDASEFGAEGFDPKRWINAALDARHPSEPLDRFLADAEERLRSAADDAAAALE-----  56

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
                           RD A               +AEGSSAES+  LA++DTVK+RMEAA
Sbjct  57   ---------------RDSA---------------EAEGSSAESITALARIDTVKQRMEAA  86

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  87   YATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVRKQLEVLE  146

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RLD MVQPRL DALSNRKVD  Q++R IL RIGRFKSLE+QY+K+H+KP+K LWEDF+L
Sbjct  147  ERLDDMVQPRLVDALSNRKVDAVQDLRGILIRIGRFKSLEVQYTKIHVKPLKKLWEDFDL  206

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+A +V  EK   E ++S          +SF+ WLP+FYDE LLYL
Sbjct  207  KQRAKRVEMEKYGGESINS----------LSFASWLPNFYDETLLYL  243



>ref|XP_002972505.1| hypothetical protein SELMODRAFT_148467 [Selaginella moellendorffii]
 gb|EFJ26591.1| hypothetical protein SELMODRAFT_148467 [Selaginella moellendorffii]
Length=779

 Score =   318 bits (814),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 160/286 (56%), Positives = 208/286 (73%), Gaps = 21/286 (7%)
 Frame = +3

Query  84   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  263
            MVD+++F  E FDPK W+N AC++RHP +  ++ L DLEMKLQ+ASE+IA +LE+ S +A
Sbjct  1    MVDMAAFGQEGFDPKAWVNAACRARHPDEDAERQLSDLEMKLQLASEDIAAALEDQSTAA  60

Query  264  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  443
            L R+PRA RDV RL DDALSLRS+VS +L KLR AEG SA SVA L++VD VK+RMEAA+
Sbjct  61   LLRIPRALRDVSRLHDDALSLRSTVSGMLLKLRTAEGLSAGSVAALSRVDLVKQRMEAAH  120

Query  444  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  623
            +TL+DAAGL QL ++VE VF+SG+L  AA TLANMR CL+ VGEV EFA+++++LE LE+
Sbjct  121  KTLKDAAGLAQLCASVETVFASGNLDEAAGTLANMRRCLAVVGEVPEFASVKRELEALEN  180

Query  624  RLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFELR  803
            RLD MVQ RLTDAL+ RKV+  Q  R+IL  IGR+ SLE QYSKV LKP++ LW+++E  
Sbjct  181  RLDGMVQTRLTDALTQRKVESVQAFRAILLTIGRYNSLEQQYSKVRLKPLRRLWDEYE--  238

Query  804  QQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
               + V + K                    F  WLP+FYD++LL L
Sbjct  239  SSTDGVGSGK-------------------PFIEWLPTFYDQVLLTL  265



>ref|XP_002992562.1| hypothetical protein SELMODRAFT_135591 [Selaginella moellendorffii]
 gb|EFJ06368.1| hypothetical protein SELMODRAFT_135591 [Selaginella moellendorffii]
Length=779

 Score =   315 bits (807),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 159/286 (56%), Positives = 208/286 (73%), Gaps = 21/286 (7%)
 Frame = +3

Query  84   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  263
            MVD+++F +E FDPK W+N AC++RHP +  ++ L DLEMKLQ+ASE+IA +LE+ S +A
Sbjct  1    MVDMAAFGEEGFDPKAWVNAACRARHPDEDAERQLSDLEMKLQLASEDIAAALEDQSTAA  60

Query  264  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  443
            L R+PRA RDV RL DDALSLRS+VS +L KLR AE  SA SVA L++VD VK+RMEAA+
Sbjct  61   LLRIPRALRDVSRLHDDALSLRSTVSGMLLKLRTAESLSAGSVAALSRVDLVKQRMEAAH  120

Query  444  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  623
            +TL+DAAGL QL ++VE VF+SG+L  AA TLANMR CL+ VGEV EFA+++++LE LE+
Sbjct  121  KTLKDAAGLAQLCASVETVFASGNLDEAAGTLANMRRCLAVVGEVPEFASVKRELEALEN  180

Query  624  RLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFELR  803
            RLD MVQ RLTDAL+ RKV+  Q  R+IL  IGR+ SLE QYSKV LKP++ LW+++E  
Sbjct  181  RLDGMVQTRLTDALTQRKVESVQAFRAILLTIGRYNSLEQQYSKVRLKPLRRLWDEYE--  238

Query  804  QQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
               + V + K                    F  WLP+FYD++LL L
Sbjct  239  SSTDGVGSGK-------------------PFIEWLPTFYDQVLLTL  265



>ref|XP_010062289.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Eucalyptus grandis]
Length=722

 Score =   298 bits (763),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = +3

Query  429  MEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQL  608
            MEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAA+TLANMRHCLSAVGEVAEFAN+RKQL
Sbjct  1    MEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAADTLANMRHCLSAVGEVAEFANVRKQL  60

Query  609  EVLEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWE  788
            EVLEDRLD+MVQPRLTDALSNRKV+VAQ++R IL RIGRFKSLELQY+KVH+KPIK LWE
Sbjct  61   EVLEDRLDNMVQPRLTDALSNRKVEVAQDLRGILIRIGRFKSLELQYTKVHMKPIKKLWE  120

Query  789  DFELRQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            DF+ +Q+A+K++N+KNE ERLSS+   Q N   +SFS WLPSFYDELLLYL
Sbjct  121  DFDSKQRASKMANDKNETERLSSSTNFQQNVQTVSFSSWLPSFYDELLLYL  171



>gb|EMT03910.1| hypothetical protein F775_26031 [Aegilops tauschii]
Length=697

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 139/171 (81%), Gaps = 11/171 (6%)
 Frame = +3

Query  429  MEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQL  608
            MEAAY TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+RKQL
Sbjct  1    MEAAYTTLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVRKQL  60

Query  609  EVLEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWE  788
            EVLE+RLD MVQPRL DALSNRK+D  Q++R IL RIGRFKSLE+QY+K+H+KP+K LWE
Sbjct  61   EVLEERLDEMVQPRLLDALSNRKIDAVQDLRGILTRIGRFKSLEVQYTKIHMKPLKKLWE  120

Query  789  DFELRQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            DF+L+Q+AN+   EK   E  S           +SFS WLPSFYDE LLYL
Sbjct  121  DFDLKQRANRAEVEKRGGEITS-----------VSFSSWLPSFYDETLLYL  160



>gb|EMS57916.1| hypothetical protein TRIUR3_24838 [Triticum urartu]
Length=706

 Score =   255 bits (652),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 139/171 (81%), Gaps = 11/171 (6%)
 Frame = +3

Query  429  MEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQL  608
            MEAAY TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+RKQL
Sbjct  1    MEAAYTTLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVRKQL  60

Query  609  EVLEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWE  788
            EVLE+RLD MVQPRL DALSNRK+D  Q++R IL RIGRFKSLE+QY+K+H+KP+K LWE
Sbjct  61   EVLEERLDEMVQPRLLDALSNRKIDAVQDLRGILTRIGRFKSLEVQYTKIHIKPLKKLWE  120

Query  789  DFELRQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            DF+L+Q+AN+   EK   E  S           +SFS WLPSFYDE LLYL
Sbjct  121  DFDLKQRANRAEVEKRGGEITS-----------VSFSSWLPSFYDETLLYL  160



>ref|XP_003563389.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Brachypodium 
distachyon]
Length=825

 Score =   253 bits (646),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 145/296 (49%), Positives = 194/296 (66%), Gaps = 27/296 (9%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            ++VD S F  + FDPK+WIN A  +RHP + LD+ L D E +L+ A ++   +LE  SA 
Sbjct  2    VVVDASEFGADGFDPKRWINAALDARHPSETLDRFLADAEERLRAAVDDAGAALERDSAD  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVP A RD +RLRDDA++LRS V+S+LQ L +AEGSSAES+  LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRSHVASVLQSLSQAEGSSAESITALARIDTVKQRMEAA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEV    N  K+L+   
Sbjct  122  YATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVRNPPNFEKRLKKFT  181

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIG-------RFKSLELQYSKV--HLKPI  773
              LD + +      L          +R++++ +G        + ++ L +S    H+KP+
Sbjct  182  PFLDPLQRKFFFTLLFCY-------LRTLVSALGIMSVCSSGYDTMGLSWSHTLDHVKPL  234

Query  774  KHLWEDFELRQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            + + E+F+L+Q+A++V  EK   E LSS +           S WLPSFYDE LLYL
Sbjct  235  RTM-EEFDLKQRAHRVEMEKRGGESLSSVSF----------SSWLPSFYDETLLYL  279



>gb|AIU51109.1| embryo yellow protein, partial [Brachypodium distachyon]
Length=784

 Score =   252 bits (643),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 141/287 (49%), Positives = 182/287 (63%), Gaps = 47/287 (16%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            ++VD S F  + FDPK+WIN A  +RHP + LD+ L D E +L+ A ++   +LE  SA 
Sbjct  2    VVVDASEFGADGFDPKRWINAALDARHPSETLDRFLADAEERLRAAVDDAGAALERDSAD  61

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL RVP A RD +RLRDDA++LRS V+S+LQ L +AEGSSAES+  LA++DTVK+RMEAA
Sbjct  62   ALRRVPLACRDALRLRDDAVALRSHVASVLQSLSQAEGSSAESITALARIDTVKQRMEAA  121

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
            Y TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGE AE   I K+     
Sbjct  122  YATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEGAEIPQILKK-----  176

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
                                            + R+ ++ L +S  H+KP++ + E+F+L
Sbjct  177  -------------------------------GLKRYDTMGLSWSHTHVKPLRTM-EEFDL  204

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            +Q+A++V  EK   E LSS +           S WLPSFYDE LLYL
Sbjct  205  KQRAHRVEMEKRGGESLSSVSF----------SSWLPSFYDETLLYL  241



>ref|XP_010442640.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Camelina sativa]
Length=681

 Score =   209 bits (533),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +3

Query  546  MRHCLSAVGEVAEFANIRKQLEVLEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGR  725
            MR+CLSAVGEVAEFAN+RKQLEVLEDRL+ MVQPRLTDAL+  KVDV Q++R IL RIGR
Sbjct  1    MRNCLSAVGEVAEFANVRKQLEVLEDRLEKMVQPRLTDALTYHKVDVVQDLRGILIRIGR  60

Query  726  FKSLELQYSKVHLKPIKHLWEDFELRQQANKVSNEKNEVERLSSANELQLNSSPISFSRW  905
            FKS+ELQYS+V LKPIK LWEDF+ +Q+ NK++NE++E +RLSS +E QL SS  SF+ W
Sbjct  61   FKSMELQYSEVRLKPIKQLWEDFDTKQRTNKLANERSESQRLSSGDEFQLTSSQTSFASW  120

Query  906  LPSFYDELLLYL  941
            LPSFYDE+LLYL
Sbjct  121  LPSFYDEMLLYL  132



>ref|XP_003055554.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60806.1| predicted protein [Micromonas pusilla CCMP1545]
Length=809

 Score =   190 bits (482),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 107/284 (38%), Positives = 171/284 (60%), Gaps = 13/284 (5%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            M + ++ F D  FD K W+N AC      + ++K L ++EMKLQ+A+E+I+++LEE S +
Sbjct  1    MSISMADFDDPSFDVKPWVNAACAGCPDDESVEKFLAEVEMKLQLAAEDISLALEEQSNA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
             L+R+PRA  ++ R+  D  +L++ V  IL++L  AEGSS ESV  L +VD VK RMEAA
Sbjct  61   GLNRIPRAVAEIDRVEHDTKALQTRVQGILKRLNDAEGSSRESVRRLTRVDAVKGRMEAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             +TL++AAGL +L ++VEDVF++G++   A+ LA+MR  L  VG V EF +  ++++ LE
Sbjct  121  RDTLREAAGLAELMASVEDVFAAGNVRSMADVLASMRRALKVVGGVPEFQDAPEKVDALE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVH-LKPIKHLWEDFE  797
             RL+ +++P L  AL+      A+E+R +L   GR  +L   Y++   + P+   W  F 
Sbjct  181  RRLEQILKPELVKALTASDAIKAEEIRDVLKITGRLNALTATYAETRVVAPMLREWNAF-  239

Query  798  LRQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDEL  929
                A+ V +E        SA +++       F  WLP +  +L
Sbjct  240  ---HADGVEDESRATP--PSAADVR------RFVEWLPGYARKL  272



>ref|XP_005847546.1| hypothetical protein CHLNCDRAFT_133750 [Chlorella variabilis]
 gb|EFN55444.1| hypothetical protein CHLNCDRAFT_133750 [Chlorella variabilis]
Length=753

 Score =   186 bits (473),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 104/295 (35%), Positives = 168/295 (57%), Gaps = 40/295 (14%)
 Frame = +3

Query  84   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  263
            M DL++FSD  FDPK +IN AC  +   +PL++ L +LEMKL +++E++ + L++ S  A
Sbjct  1    MTDLNAFSDAAFDPKLFINQACTGKTGDEPLERFLAELEMKLHLSAEDVGLYLQDHSGRA  60

Query  264  LHRVPRATRDVIRLR----------DDALSLRSSVSSILQKLRKA-EGSSAESVATLAKV  410
            + R+P A ++++R++          DD  +LR S ++ L++L  A  G +A  V  L  V
Sbjct  61   MQRIPAAAKELLRIKVRVRLADRNSDDVATLRGSAAAALKQLEDAGSGQAAAVVGQLQAV  120

Query  411  DTVKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGE-VAEF  587
            DTVKRRME A  TL++AAGL+ L   V+D F+SG+L R A+TLA MR  L+ VG+ VAEF
Sbjct  121  DTVKRRMEDACSTLKEAAGLSALFQQVDDHFASGNLRRVADTLAGMRRGLAVVGDSVAEF  180

Query  588  ANIRKQLEVLEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLK  767
               R +L  LE+R  +MV+  LT A + ++ + A  +  +L+ + R  +L+  Y    L 
Sbjct  181  RGGRDRLARLEERFAAMVEAPLTAAFAKQEGEEAAALAGMLDTVERGDALQRLYCAARLP  240

Query  768  PIKHLWEDFELRQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
            P++ LW+ +                            ++   F+ WLP FY++++
Sbjct  241  PLQALWDGY----------------------------TAGTPFASWLPGFYNQVV  267



>ref|XP_002503576.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64834.1| predicted protein [Micromonas sp. RCC299]
Length=770

 Score =   171 bits (434),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/284 (34%), Positives = 166/284 (58%), Gaps = 14/284 (5%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            M  + + FSD  FD K W+N AC      + ++K+L ++EMKLQ+ +E+I+++LEE S +
Sbjct  1    MSFNPAEFSDANFDVKAWVNSACAGCPRGESMEKYLSEVEMKLQLVAEDISLALEEQSVA  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
             L R+PRA  ++ R+  ++ +L++ ++ IL++L +AE  S  SV  L  +D VK RME  
Sbjct  61   GLQRIPRAVAEIDRVELESKNLQTRIAGILKRLDEAETGSRASVNLLRDIDAVKGRMELT  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             +TL +AAGL +L  + +DVF+ G++   A+ +A+MR  L  VG V EF +  +++E LE
Sbjct  121  RDTLAEAAGLAELMRSADDVFAGGNVRSMADIVASMRRSLKVVGSVPEFEDAPERVEALE  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVH-LKPIKHLWEDFE  797
             RL+  V+P L  AL+N     A E+R++L+  GR  +L   Y++V  ++P++  W+ F 
Sbjct  181  HRLEQAVKPELVKALANENAFRASELRNVLDVSGRITALIHAYAEVRVVEPLRREWDAF-  239

Query  798  LRQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDEL  929
                  K           ++ +E Q       F+ WLP + +++
Sbjct  240  ------KKGAVPAGPAATAATSEAQ------RFAEWLPGYCEKV  271



>ref|XP_005643872.1| hypothetical protein COCSUDRAFT_67854 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19328.1| hypothetical protein COCSUDRAFT_67854 [Coccomyxa subellipsoidea 
C-169]
Length=731

 Score =   169 bits (428),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 94/278 (34%), Positives = 155/278 (56%), Gaps = 29/278 (10%)
 Frame = +3

Query  90   DLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASALH  269
            DL++F ++ F+PK WIN AC ++  ++ L++ L DLE++L +A+E+I  +LE  S  AL 
Sbjct  6    DLAAFQEDSFEPKNWINAACDNKPSEESLERFLTDLELRLHLAAEDIDAALEIDSTRALQ  65

Query  270  RVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYET  449
            R+P A ++V  +R D   L++ VS  L  +  A  ++  +VA + +++ VK RMEAA  T
Sbjct  66   RIPAAVQEVSHVRGDVTGLKADVSRGLGTVSAAASAATGNVALIVELERVKNRMEAACST  125

Query  450  LQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDRL  629
            L++A  L+   + VE VF+ GDL R A TLA++R  L+ VG+V EF     +L+ LE+R 
Sbjct  126  LKEATELSAHFTQVEAVFAEGDLQRIAATLASIRQGLALVGDVPEFKGGAARLQALEERF  185

Query  630  DSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFELRQQ  809
               ++P ++ AL+ R+ D    + ++++ +GR   LE  Y    +  ++ LW+ FE R  
Sbjct  186  HQNIEPAVSSALAARQADRVANLAALMSSLGRESELEGLYVAARMPMLQGLWDGFEGR--  243

Query  810  ANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYD  923
                                        F+ WLPSFY+
Sbjct  244  ---------------------------GFASWLPSFYE  254



>gb|AIU51133.1| embryo yellow protein, partial [Persea americana]
Length=185

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 94/113 (83%), Gaps = 1/113 (1%)
 Frame = +3

Query  603  QLEVLEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHL  782
            QLEVLEDRL+ MV PRL+DALSNRKVD  Q++R IL RIG FKS+ELQY+K+HLKPI+ L
Sbjct  1    QLEVLEDRLEEMVHPRLSDALSNRKVDAVQDLRQILIRIG-FKSVELQYTKIHLKPIRKL  59

Query  783  WEDFELRQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLLYL  941
            WE+F+ RQ+A+K+++EK++ +RLSS  +   +   +SFS WLP+FYDE+LLYL
Sbjct  60   WEEFDSRQRASKLASEKHDADRLSSTADSSSHVPYLSFSSWLPNFYDEVLLYL  112



>ref|XP_002953697.1| component of oligomeric golgi complex 7 [Volvox carteri f. nagariensis]
 gb|EFJ45321.1| component of oligomeric golgi complex 7 [Volvox carteri f. nagariensis]
Length=957

 Score =   154 bits (390),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 129/195 (66%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   MVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  263
            M D++ F+++ FDP  WIN AC SR  ++PL+K L +LEM+LQ+++E+I  +L + SA A
Sbjct  1    MADVADFAEDTFDPITWINQACGSRPVEEPLEKFLAELEMRLQLSAEDIEATLSDNSAQA  60

Query  264  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  443
            + R+P A +++ RL+ D   ++  V  + Q +++    +  SVA ++++  VK  ME+A 
Sbjct  61   MRRIPFAIQEIYRLQGDIQGMQDQVQVMAQTVQRDATEAQSSVAHISELHRVKANMESAC  120

Query  444  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  623
             +L+ A  L+ L   VEDVF++GDLP+ AE LA+MR  LS VG+V EF   R++L  LED
Sbjct  121  NSLKQATELSGLFVKVEDVFAAGDLPKVAEILASMRRSLSLVGDVPEFRAGRQKLRALED  180

Query  624  RLDSMVQPRLTDALS  668
            RL + V+  L +AL+
Sbjct  181  RLQTQVEGSLGEALA  195



>ref|XP_001628559.1| predicted protein [Nematostella vectensis]
 gb|EDO36496.1| predicted protein [Nematostella vectensis]
Length=713

 Score =   150 bits (379),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 139/235 (59%), Gaps = 0/235 (0%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  266
            +D S FS++ FD K+W+N A ++R  + P+D H   L MKLQ+  +E+  +LEE S  A+
Sbjct  1    MDFSKFSNDNFDVKEWVNSALRARDDKIPVDAHASTLVMKLQLFIQEVNNALEETSVQAV  60

Query  267  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  446
            + +PR  R++  ++ +A  LR  +  + + ++K E ++A+S+  L ++DTVK  M+AA +
Sbjct  61   NNIPRVVREIDNVQHEASLLREQMHMVKEDIKKVEENTAQSMKMLMELDTVKSHMQAASQ  120

Query  447  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  626
             LQ+A   T LSS V+ VF SGD+   ++ L  M   L+ + +V ++A  R+ LE L++R
Sbjct  121  GLQEADNWTTLSSDVDKVFESGDIIAISDKLVGMHKSLNVLQDVPDYAERRRMLEGLKNR  180

Query  627  LDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWED  791
            L++++ P++  A +N  +D  +    I   I R   L+  Y + H   ++  W +
Sbjct  181  LEALLSPKIVAAFNNHCLDETKSYVKIFTAIDRLDQLQNYYIRCHKTKLQQAWNN  235



>emb|CEF98773.1| Conserved oligomeric Golgi complex subunit 7 [Ostreococcus tauri]
Length=786

 Score =   150 bits (379),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 91/254 (36%), Positives = 149/254 (59%), Gaps = 7/254 (3%)
 Frame = +3

Query  81   MMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            MM D   F  + FD  +WIN  C++R    P+++ L DLE++ Q+ SE+ A +LEE S  
Sbjct  16   MMRD---FESDGFDRARWINERCRARG-DVPVERFLSDLELQTQLVSEDAARALEERSRE  71

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            A  RVPRATR++ R+     +LR    ++L +L + E  S  SV  L ++D  KRRME+A
Sbjct  72   ATSRVPRATREIERVERRVEALREETRAMLTRLDEVEEVSRASVDALRQLDAAKRRMESA  131

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             ETLQ+  GL  L + V+ +F+SG++   ++ LA M+  L+ VG+V EFA+ + ++   E
Sbjct  132  KETLQETNGLADLMANVDGIFASGNIRSMSDALARMKRALAVVGDVPEFADGQDKVNAFE  191

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLK-PIKHLWEDFE  797
             +L+ +V+P L  A  +     A+E+R +L   GR  +LE  Y++  +  P+   W+  E
Sbjct  192  HKLEGIVRPALVTAFESHNSTAARELRDVLLATGRGSALESTYAETRVTGPLMKQWKTRE  251

Query  798  LRQQANKVSNEKNE  839
              ++A   ++ K+E
Sbjct  252  --REAAAATSGKSE  263



>ref|XP_786237.3| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Strongylocentrotus purpuratus]
Length=762

 Score =   139 bits (351),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 93/285 (33%), Positives = 144/285 (51%), Gaps = 28/285 (10%)
 Frame = +3

Query  84   MVDLSSFSDEKFDPKQWINGA--CQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSA  257
            M+D S F D  FD K W+N A   Q   P+   D H   L MKLQ+  +E+  SLEE S 
Sbjct  1    MMDFSKFLDANFDVKDWVNAAFKAQKDSPEQK-DAHAATLVMKLQLFIQEVNNSLEETSQ  59

Query  258  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  437
             AL  +PR  RDV  +R +A  L+  +  + + ++K E  ++ES+  L ++DT+K RM+A
Sbjct  60   QALQNLPRVLRDVEAVRQEAGFLKDQMQLVKEDIKKVEEDTSESMKMLLEIDTIKSRMKA  119

Query  438  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  617
            A + LQ+A   T L + V++VF+S D+   A+ L  M+H LS +    ++    + LEVL
Sbjct  120  ASDALQEADNWTTLMADVDEVFASKDVQLIADKLLAMQHSLSMLAHCGDYDERCQSLEVL  179

Query  618  EDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFE  797
            ++RL++++ P+L  A ++  ++ AQ    I   + R   L   Y K H            
Sbjct  180  KNRLEALLSPQLVSAFNSHSLEAAQRYVKIFKDMDRLSQLRNYYYKCH------------  227

Query  798  LRQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
                  K S      +   +  E  L       + WLPSFY+ LL
Sbjct  228  ------KSSLLLQWQQLQETNREKVL-------AEWLPSFYETLL  259



>ref|XP_011680385.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Strongylocentrotus purpuratus]
Length=762

 Score =   139 bits (350),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 93/285 (33%), Positives = 144/285 (51%), Gaps = 28/285 (10%)
 Frame = +3

Query  84   MVDLSSFSDEKFDPKQWINGA--CQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSA  257
            M+D S F D  FD K W+N A   Q   P+   D H   L MKLQ+  +E+  SLEE S 
Sbjct  1    MMDFSKFLDANFDVKDWVNAAFKAQKDSPEQK-DAHAATLVMKLQLFIQEVNNSLEETSQ  59

Query  258  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  437
             AL  +PR  RDV  +R +A  L+  +  + + ++K E  ++ES+  L ++DT+K RM+A
Sbjct  60   QALQNLPRVLRDVEAVRQEAGFLKDQMQLVKEDIKKVEEDTSESMKMLLEIDTIKSRMKA  119

Query  438  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  617
            A + LQ+A   T L + V++VF+S D+   A+ L  M+H LS +    ++    + LEVL
Sbjct  120  ASDALQEADNWTTLMADVDEVFASKDVQLIADKLLAMQHSLSMLAHCGDYDERCQSLEVL  179

Query  618  EDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFE  797
            ++RL++++ P+L  A ++  ++ AQ    I   + R   L   Y K H            
Sbjct  180  KNRLEALLSPQLVSAFNSHSLEAAQRYVKIFKDMDRLSQLRNYYYKCH------------  227

Query  798  LRQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
                  K S      +   +  E  L       + WLPSFY+ LL
Sbjct  228  ------KSSLLLQWQQLQETNREKVL-------AEWLPSFYETLL  259



>gb|EKC24157.1| Conserved oligomeric Golgi complex subunit 7 [Crassostrea gigas]
Length=774

 Score =   138 bits (348),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 89/289 (31%), Positives = 154/289 (53%), Gaps = 30/289 (10%)
 Frame = +3

Query  75   GKMMVDLSSFSDEKFDPKQWINGACQSRHPQDPL---DKHLVDLEMKLQMASEEIAVSLE  245
            GK+ +D S F D+ FD K+W+N A +S+  +DP+   D++   L MKLQM  +E+   +E
Sbjct  17   GKLKMDYSKFLDDNFDAKEWVNTAFRSQ--KDPVAAKDQYATTLVMKLQMFIQEVNNIIE  74

Query  246  ELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKR  425
            E S  A+  +PR  R++  ++ +A  L+  +  + Q ++K E  +A+S+ TL K+D +K 
Sbjct  75   ETSQQAVQNLPRVIRELDAVKQEAALLQDQMKMVKQDIQKVEHDTAKSMQTLLKLDAIKS  134

Query  426  RMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQ  605
            RM +A E L++A   T LSS VE+VF S D+      L  M++ L  + +  ++A+  + 
Sbjct  135  RMTSAAEALREADNWTTLSSDVEEVFQSQDIKAITLKLKGMQNSLLMLVDTPDYADRCQH  194

Query  606  LEVLEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLW  785
            LE L++RL++++ P+L  A + + ++ AQ    I   I R   L   Y++ H   +   W
Sbjct  195  LETLKNRLEAVLSPQLVQAFTTQSLETAQTYTQIFTDIDRVPQLYKYYTRCHKVTLLGAW  254

Query  786  EDFELRQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
                           KN +E  ++A++        +   WL  +YD LL
Sbjct  255  ---------------KNIIE--ANADD--------TLKEWLTEYYDLLL  278



>ref|XP_006623838.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X1 [Apis dorsata]
Length=760

 Score =   137 bits (344),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 92/287 (32%), Positives = 150/287 (52%), Gaps = 29/287 (10%)
 Frame = +3

Query  78   KMMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSA  257
            K   D+S+FS++ FD K WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S 
Sbjct  24   KYFQDVSAFSEDTFDVKDWINKTFKSVEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQ  83

Query  258  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  437
            S L  +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL K+D +K  ++ 
Sbjct  84   SVLSSLPRVLRDTQFLQQEALALREKMIAVKQEIEKVEKDTASSMATLEKIDRIKTDLQT  143

Query  438  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  617
            A + L +A   T L++ VE+VF SGD+   A  L +M+  L+ +  V ++ + + QLE L
Sbjct  144  AKQGLHEADNWTVLANDVEEVFESGDVEAIANKLFSMQKSLAMLVNVIDYEDKKLQLEGL  203

Query  618  EDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLK-PIKHLW-ED  791
            ++RL+++  P+L  A +   ++ ++    I N+I R   L L+Y    LK  +   W   
Sbjct  204  KNRLEAIASPKLVQAFTAANLEQSKIYVDIFNKIERLPQL-LKYYHNCLKVSLGQEWRRT  262

Query  792  FELRQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
             EL Q  N                           S WL ++YD+LL
Sbjct  263  IELAQDEN--------------------------VSYWLHTYYDKLL  283



>ref|XP_006623839.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X2 [Apis dorsata]
Length=734

 Score =   136 bits (343),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 91/284 (32%), Positives = 150/284 (53%), Gaps = 29/284 (10%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  266
            +D+S+FS++ FD K WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVSAFSEDTFDVKDWINKTFKSVEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  267  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  446
              +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL K+D +K  ++ A +
Sbjct  61   SSLPRVLRDTQFLQQEALALREKMIAVKQEIEKVEKDTASSMATLEKIDRIKTDLQTAKQ  120

Query  447  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  626
             L +A   T L++ VE+VF SGD+   A  L +M+  L+ +  V ++ + + QLE L++R
Sbjct  121  GLHEADNWTVLANDVEEVFESGDVEAIANKLFSMQKSLAMLVNVIDYEDKKLQLEGLKNR  180

Query  627  LDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLK-PIKHLW-EDFEL  800
            L+++  P+L  A +   ++ ++    I N+I R   L L+Y    LK  +   W    EL
Sbjct  181  LEAIASPKLVQAFTAANLEQSKIYVDIFNKIERLPQL-LKYYHNCLKVSLGQEWRRTIEL  239

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
             Q  N                           S WL ++YD+LL
Sbjct  240  AQDEN--------------------------VSYWLHTYYDKLL  257



>ref|XP_001701937.1| component of oligomeric golgi complex 7 [Chlamydomonas reinhardtii]
 gb|EDP06912.1| component of oligomeric golgi complex 7 [Chlamydomonas reinhardtii]
Length=758

 Score =   136 bits (343),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 115/182 (63%), Gaps = 0/182 (0%)
 Frame = +3

Query  99   SFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASALHRVP  278
            +F ++ FDP  WIN AC ++   +PL+K L +LEM+LQ+ +E+I  +L + SA A+ R+P
Sbjct  8    AFGEDGFDPISWINNACNNKATDEPLEKFLAELEMRLQLNAEDIEATLSDNSAQAMRRIP  67

Query  279  RATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYETLQD  458
             A +++ RL+ D   ++  V  +   +++    +  SV  ++++  VK  ME A  +L++
Sbjct  68   FAIQEIYRLQGDIQGMQDQVQVLAGSVQRDATDARGSVEHISQLHLVKANMENACNSLKE  127

Query  459  AAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDRLDSM  638
            A  L+ L   VE+VF++GDLP+ AE LA+MR  LS VG+V EF   R++L  LEDRL + 
Sbjct  128  ATELSGLFVKVEEVFAAGDLPKVAEILASMRRSLSLVGDVPEFRAGRQKLRALEDRLQTQ  187

Query  639  VQ  644
            V 
Sbjct  188  VH  189



>ref|XP_394713.2| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Apis 
mellifera]
Length=733

 Score =   134 bits (338),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 89/284 (31%), Positives = 150/284 (53%), Gaps = 29/284 (10%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  266
            +D+S+FS++ FD K WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVSAFSEDTFDVKDWINKTFKSVEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  267  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  446
              +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL K+D +K  ++ A +
Sbjct  61   SSLPRVLRDTQFLQQEALALREKMVAVKQEIEKVEKDTASSMATLEKIDRIKTDLQTAKQ  120

Query  447  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  626
             L +A   + L++ VE++F SGD+   A  L +M+  L+ +  V ++ + + QLE L++R
Sbjct  121  GLHEADNWSVLANDVEEIFESGDVEAIANKLFSMQKSLAMLVNVIDYEDKKLQLEGLKNR  180

Query  627  LDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLK-PIKHLW-EDFEL  800
            L+++  P+L  A +   ++ ++    I N+I R   L L+Y    LK  +   W    EL
Sbjct  181  LEAIASPKLVQAFTAANLEQSKVYVDIFNKIERLPQL-LKYYHNCLKVSLGQEWRRTIEL  239

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
             Q  N                           S WL ++YD+LL
Sbjct  240  AQDEN--------------------------VSYWLHTYYDKLL  257



>ref|XP_011431811.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Crassostrea gigas]
Length=754

 Score =   133 bits (335),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 87/285 (31%), Positives = 151/285 (53%), Gaps = 30/285 (11%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPL---DKHLVDLEMKLQMASEEIAVSLEELSA  257
            +D S F D+ FD K+W+N A +S+  +DP+   D++   L MKLQM  +E+   +EE S 
Sbjct  1    MDYSKFLDDNFDAKEWVNTAFRSQ--KDPVAAKDQYATTLVMKLQMFIQEVNNIIEETSQ  58

Query  258  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  437
             A+  +PR  R++  ++ +A  L+  +  + Q ++K E  +A+S+ TL K+D +K RM +
Sbjct  59   QAVQNLPRVIRELDAVKQEAALLQDQMKMVKQDIQKVEHDTAKSMQTLLKLDAIKSRMTS  118

Query  438  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  617
            A E L++A   T LSS VE+VF S D+      L  M++ L  + +  ++A+  + LE L
Sbjct  119  AAEALREADNWTTLSSDVEEVFQSQDIKAITLKLKGMQNSLLMLVDTPDYADRCQHLETL  178

Query  618  EDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFE  797
            ++RL++++ P+L  A + + ++ AQ    I   I R   L   Y++ H   +   W    
Sbjct  179  KNRLEAVLSPQLVQAFTTQSLETAQTYTQIFTDIDRVPQLYKYYTRCHKVTLLGAW----  234

Query  798  LRQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
                       KN +E  ++A++        +   WL  +YD LL
Sbjct  235  -----------KNIIE--ANADD--------TLKEWLTEYYDLLL  258



>gb|KDR16116.1| Conserved oligomeric Golgi complex subunit 7 [Zootermopsis nevadensis]
Length=742

 Score =   132 bits (333),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/282 (29%), Positives = 141/282 (50%), Gaps = 25/282 (9%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  266
            +D+++FSD+ F+ K WIN   +S   Q+  D  +  L MKLQ+  +++  +LE+ S   L
Sbjct  1    MDVAAFSDDNFEVKNWINKTFKSAEAQENRDAFVSSLVMKLQLYVQQVNSALEDTSQQVL  60

Query  267  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  446
              +PR  RD   L  +AL LR  + S+ Q++ K E  +A+S+ TL ++D +K  ++AA E
Sbjct  61   QSLPRVMRDTEILHQEALLLRDKMHSVKQEIAKVEQDTAQSMKTLERIDRIKTELQAAKE  120

Query  447  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  626
             L +A   T L++ +E+VF SGD+   +  L +M+  L  +  V ++ +   QLE L++R
Sbjct  121  ALHEADNWTVLATDLEEVFESGDIQSISAKLVSMQQSLRILANVPDYEDRHLQLEGLKNR  180

Query  627  LDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFELRQ  806
            L++M  P L  A ++  ++ ++    +   I R   L   Y K     +   W       
Sbjct  181  LEAMASPLLVQAFTSASIEQSRVFVKVFTAIDRLPQLLKYYHKCQKGVLMQQWR------  234

Query  807  QANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
              N V  E++E                   + W+  FYD LL
Sbjct  235  --NLVEMEQDE-----------------GIAEWMHKFYDTLL  257



>ref|XP_011154014.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Harpegnathos 
saltator]
 gb|EFN88360.1| Conserved oligomeric Golgi complex subunit 7 [Harpegnathos saltator]
Length=735

 Score =   132 bits (332),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/283 (30%), Positives = 145/283 (51%), Gaps = 27/283 (10%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  266
            +D+S+FS++ FD K+WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVSAFSEDNFDVKEWINRTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  267  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  446
              +PR  RD   L+ + L+LR  + ++ Q++ K E  +A S+A L K+D +K  ++ A +
Sbjct  61   SSLPRILRDTQLLQQETLALREKMVAVKQEIAKVEKDTASSMAMLEKIDRIKTELQTAKQ  120

Query  447  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  626
             L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + + QLE L++R
Sbjct  121  GLHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDKKLQLEGLKNR  180

Query  627  LDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLW-EDFELR  803
            L++M  PRL  A +   ++ ++    I +++ R   L   Y       +   W    EL 
Sbjct  181  LEAMASPRLVQAFTAANLEQSKIYVDIFSKMERLPQLLKYYHNCLKVSLGQEWRRTIELA  240

Query  804  QQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
            Q  N                           + WL ++YD+LL
Sbjct  241  QDEN--------------------------VTYWLHTYYDKLL  257



>ref|XP_011264700.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Camponotus floridanus]
Length=747

 Score =   132 bits (332),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/289 (29%), Positives = 146/289 (51%), Gaps = 27/289 (9%)
 Frame = +3

Query  69   DPGKMMVDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEE  248
            D   +M D+S+FS++ FD K+WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE
Sbjct  7    DGAALMQDVSAFSEDSFDVKEWINRTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEE  66

Query  249  LSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRR  428
             S S L  +PR  RD   L+ + L+LR  + ++ Q++ K E  +A S+A L K+D +K  
Sbjct  67   TSQSVLSSLPRILRDTQLLQQETLALREKMVAVKQEIAKVEKDTASSMAMLEKIDRIKTE  126

Query  429  MEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQL  608
            ++ A + L +A   T L++ +E+VF SGD+   +  L +M+  L  +  V ++ + + QL
Sbjct  127  LQTAKQGLHEADNWTVLANDMEEVFESGDIEAISNKLFSMQKSLVMLANVVDYEDKKLQL  186

Query  609  EVLEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLW-  785
            E L++RL+++  PRL  A +   ++ ++    I +++ R   L   Y       +   W 
Sbjct  187  EGLKNRLEAIASPRLVQAFTAANLEQSKTYVDIFSKMKRLPQLLKYYHNCLKVSLGQEWR  246

Query  786  EDFELRQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
               EL Q  N                           + WL ++YD+LL
Sbjct  247  RTIELAQDEN--------------------------VTYWLHTYYDKLL  269



>ref|XP_012141178.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Megachile rotundata]
 ref|XP_012141179.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Megachile rotundata]
Length=736

 Score =   132 bits (331),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 84/283 (30%), Positives = 146/283 (52%), Gaps = 27/283 (10%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  266
            +D+S+FS++ FD K WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVSAFSEDTFDVKDWINKTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  267  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  446
              +PR  RD   L+ +A++L   + ++ Q++ K E  +A S+ATL ++D +K  ++AA +
Sbjct  61   SSLPRVLRDTQLLQQEAIALSEKMVAVKQEIEKVEKDTASSMATLERIDKIKTDLQAAKQ  120

Query  447  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  626
             L +A   + L++ VE+VF SGD+   A  L +M+  L+ +  V ++ + + QLE L++R
Sbjct  121  GLHEADNWSVLANDVEEVFESGDIEAIANKLFSMQKSLAMLVNVVDYEDKKFQLEGLKNR  180

Query  627  LDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLW-EDFELR  803
            L++M  P+L  A +   ++ ++    I +++ R   L   Y       +   W    EL 
Sbjct  181  LEAMASPKLVQAFTAANLEQSKVYVDIFDKMDRLPQLLKYYHNCLKVSLGQEWRRTIELA  240

Query  804  QQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
            Q  N                           S WL ++YD+LL
Sbjct  241  QDEN--------------------------VSYWLHTYYDKLL  257



>ref|XP_011340195.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Cerapachys biroi]
 gb|EZA53204.1| Conserved oligomeric Golgi complex subunit [Cerapachys biroi]
Length=735

 Score =   132 bits (331),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 84/283 (30%), Positives = 145/283 (51%), Gaps = 27/283 (10%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  266
            +D+S+FSD+ FD K+WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVSAFSDDSFDVKEWINRTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  267  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  446
              +PR  RD   L+ + ++LR  + ++ Q++ K E  +A S+A L K+D +K  ++ A +
Sbjct  61   SSLPRILRDTQLLQQETVALREKMVAVKQEIAKVERDTASSMAMLEKIDRIKTELQTAKQ  120

Query  447  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  626
             L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + + QLE L++R
Sbjct  121  GLHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDKKLQLEGLKNR  180

Query  627  LDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLW-EDFELR  803
            L++M  PRL  A +   ++ ++    I +++ R   L   Y       +   W    EL 
Sbjct  181  LEAMASPRLVQAFTAANLEQSKVYVDIFSKMERLPQLLKYYHNCLKVSLAQEWRRTIELA  240

Query  804  QQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
            Q  N                           + WL ++YD+LL
Sbjct  241  QDEN--------------------------VTYWLHTYYDKLL  257



>ref|XP_012141176.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Megachile rotundata]
 ref|XP_012141177.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Megachile rotundata]
Length=742

 Score =   132 bits (331),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 87/283 (31%), Positives = 149/283 (53%), Gaps = 29/283 (10%)
 Frame = +3

Query  90   DLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASALH  269
            D+S+FS++ FD K WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L 
Sbjct  8    DVSAFSEDTFDVKDWINKTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVLS  67

Query  270  RVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYET  449
             +PR  RD   L+ +A++L   + ++ Q++ K E  +A S+ATL ++D +K  ++AA + 
Sbjct  68   SLPRVLRDTQLLQQEAIALSEKMVAVKQEIEKVEKDTASSMATLERIDKIKTDLQAAKQG  127

Query  450  LQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDRL  629
            L +A   + L++ VE+VF SGD+   A  L +M+  L+ +  V ++ + + QLE L++RL
Sbjct  128  LHEADNWSVLANDVEEVFESGDIEAIANKLFSMQKSLAMLVNVVDYEDKKFQLEGLKNRL  187

Query  630  DSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLK-PIKHLW-EDFELR  803
            ++M  P+L  A +   ++ ++    I +++ R   L L+Y    LK  +   W    EL 
Sbjct  188  EAMASPKLVQAFTAANLEQSKVYVDIFDKMDRLPQL-LKYYHNCLKVSLGQEWRRTIELA  246

Query  804  QQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
            Q  N                           S WL ++YD+LL
Sbjct  247  QDEN--------------------------VSYWLHTYYDKLL  263



>ref|XP_011641616.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Pogonomyrmex barbatus]
Length=735

 Score =   131 bits (329),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 83/283 (29%), Positives = 145/283 (51%), Gaps = 27/283 (10%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  266
            +D+++FS++ F+ K+WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVAAFSEDSFNVKEWINRTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  267  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  446
              +PR  RD   L+ + L+LR  + ++ Q++ K E  +A S+ATL K+D +K  ++ A +
Sbjct  61   SSLPRILRDTQLLQQETLALREKMVAVKQEIAKIEKDTASSMATLEKIDRIKTELQTAKQ  120

Query  447  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  626
             L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + + QLE L++R
Sbjct  121  GLHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLTMLANVVDYEDKKLQLEGLKNR  180

Query  627  LDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLW-EDFELR  803
            L++M  PRL  A +   ++ ++    I  ++ R   L   Y       +   W    EL 
Sbjct  181  LEAMASPRLVQAFTAANLEQSKIYVDIFGKMERLPQLLKYYHNCLKVSLGQEWRRTIELA  240

Query  804  QQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
            Q  N                           + WL ++YD+LL
Sbjct  241  QDEN--------------------------VTYWLHTYYDKLL  257



>emb|CBN81326.1| Conserved oligomeric Golgi complex subunit 7 [Dicentrarchus labrax]
Length=445

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 81/284 (29%), Positives = 141/284 (50%), Gaps = 29/284 (10%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F D+ FD K+W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKEWVNGAFRVVQKDAPGKADTHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQVKGRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E LQ+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++     LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDLAVISSKLTSMQNSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RL+++  P++    ++  +D A+    +   I R   L   Y K H   +  +W+D   
Sbjct  181  NRLEALASPQIVATFNSMSIDQAKLFVKVFTEIDRMPQLLAYYYKCHKGQLVSMWQD---  237

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
                                    L+ S +S ++ L  FYD LL
Sbjct  238  ------------------------LSQSELSLNQQLSEFYDTLL  257



>ref|XP_004351649.1| hypothetical protein ACA1_397180 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR22872.1| hypothetical protein ACA1_397180 [Acanthamoeba castellanii str. 
Neff]
Length=699

 Score =   130 bits (327),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/253 (31%), Positives = 132/253 (52%), Gaps = 22/253 (9%)
 Frame = +3

Query  183  HLVDLEMKLQMASEEIAVSLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLR  362
            ++  L +KLQ+ S E+  SL E SA +L  +P++ R +  +R +A +L++ ++S  + L 
Sbjct  11   YVSTLVLKLQLLSSELNHSLREFSAKSLRNIPKSIRSIESVRKEASALQTQITSFAETLE  70

Query  363  KAEGSSAESVATLAKVDTVKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLA  542
            K EG++  S+  LA +DTVK  ME     L +A  L +LS  V++VF + D  R A+ + 
Sbjct  71   KIEGNADNSLEVLAALDTVKMSMEKCSSILVEAEKLKRLSEDVDNVFRTNDFRRIADHIL  130

Query  543  NMRHCLSAVGEVAEFANIRKQLEVLEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIG  722
             M+  L  + E+ +F + ++QL + +DRL+ M +P L  A +  + +       +  +I 
Sbjct  131  GMKQSLDILKEIPQFQDNQRQLMLYQDRLEGMTRPHLLAAFNKHETEATLNFVDVFQKID  190

Query  723  RFKSLELQYSKVHLKPIKHLWEDFELRQQANKVSNEKNEVERLSSANELQLNSSPISFSR  902
            R K L+  Y +  L P++  W  F+ R +A + S+                     SF  
Sbjct  191  RKKQLQQHYYRCRLVPLEQQWHTFK-RPEAGRSSS---------------------SFVD  228

Query  903  WLPSFYDELLLYL  941
            WLPSFYD +L  L
Sbjct  229  WLPSFYDSVLATL  241



>ref|XP_008299300.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Stegastes 
partitus]
Length=769

 Score =   130 bits (328),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 84/284 (30%), Positives = 140/284 (49%), Gaps = 29/284 (10%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F D+ FD K W+NGA +      P   D H   L MKLQ+  +E+  S+EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKDAPGKADTHAATLVMKLQLFIQEVNNSIEESSNQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQVKGRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E LQ+A   + LS+ +E+ F + DL   +  L +M++ LS + +  +++     LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDLAVISSKLTSMQNSLSMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RL++M  P++    ++  +D A+    +   I R   L   Y K H   +  +W+D   
Sbjct  181  NRLEAMASPQIVATFNSMSIDQAKLFVKVFTEIDRMPQLLAYYYKCHKGQLVSIWQD---  237

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
                                    L+ S +S ++ L  FYD LL
Sbjct  238  ------------------------LSQSELSLNQQLSEFYDTLL  257



>ref|XP_011299078.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Fopius arisanus]
Length=736

 Score =   130 bits (327),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 87/283 (31%), Positives = 157/283 (55%), Gaps = 25/283 (9%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  266
            +D+S+FS++ FD K+WIN   +S    +  D  +  L MKLQ+  +++  SLEE S S L
Sbjct  1    MDVSAFSEKDFDVKEWINKTFKSTEELEDKDAFVSSLVMKLQLYVQQVNGSLEETSQSVL  60

Query  267  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  446
              +PR  RD   L+ +AL+L+  ++++ Q++ K E  +A S+  L K+  VK  ++ A +
Sbjct  61   SSLPRILRDTQLLQQEALALKDKMATVKQEIAKVEKDTALSMTALEKMARVKTELQVAKQ  120

Query  447  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  626
            +L +A   + L++ +E+VF SGD+ +    + +M+  LS +    ++ + + QLE L++R
Sbjct  121  SLHEADNWSVLANDLEEVFESGDIEKIGGKVFSMQKSLSMLANAVDYEDKKLQLEGLKNR  180

Query  627  LDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFELRQ  806
            L++M  P+L  A + R +D ++   +I +++ R   L L+Y +  LK    L E++   +
Sbjct  181  LEAMASPKLVQAFTIRNLDESKIYVNIFSKMDRLPQL-LKYYQNCLKV--SLCEEW---R  234

Query  807  QANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLL  935
            +  +VS E N                    + WL +FYD+LLL
Sbjct  235  KIREVSMEDN-------------------VTSWLNTFYDKLLL  258



>ref|XP_011299070.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Fopius arisanus]
Length=750

 Score =   130 bits (326),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 87/282 (31%), Positives = 156/282 (55%), Gaps = 25/282 (9%)
 Frame = +3

Query  90   DLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASALH  269
            D+S+FS++ FD K+WIN   +S    +  D  +  L MKLQ+  +++  SLEE S S L 
Sbjct  16   DVSAFSEKDFDVKEWINKTFKSTEELEDKDAFVSSLVMKLQLYVQQVNGSLEETSQSVLS  75

Query  270  RVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYET  449
             +PR  RD   L+ +AL+L+  ++++ Q++ K E  +A S+  L K+  VK  ++ A ++
Sbjct  76   SLPRILRDTQLLQQEALALKDKMATVKQEIAKVEKDTALSMTALEKMARVKTELQVAKQS  135

Query  450  LQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDRL  629
            L +A   + L++ +E+VF SGD+ +    + +M+  LS +    ++ + + QLE L++RL
Sbjct  136  LHEADNWSVLANDLEEVFESGDIEKIGGKVFSMQKSLSMLANAVDYEDKKLQLEGLKNRL  195

Query  630  DSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFELRQQ  809
            ++M  P+L  A + R +D ++   +I +++ R   L L+Y +  LK    L E++   ++
Sbjct  196  EAMASPKLVQAFTIRNLDESKIYVNIFSKMDRLPQL-LKYYQNCLKV--SLCEEW---RK  249

Query  810  ANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELLL  935
              +VS E N                    + WL +FYD+LLL
Sbjct  250  IREVSMEDN-------------------VTSWLNTFYDKLLL  272



>ref|XP_003397366.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Bombus terrestris]
Length=735

 Score =   129 bits (325),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 87/284 (31%), Positives = 150/284 (53%), Gaps = 29/284 (10%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  266
            +D+S+FS++ FD K WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVSAFSEDTFDVKDWINKTFKSVEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  267  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  446
              +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL ++D +K  ++ A +
Sbjct  61   SSLPRVLRDTQLLQQEALALREKMVAVKQEIEKVEKDTASSMATLERIDKIKTDLQIAKQ  120

Query  447  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  626
             L +A   + L++ VE+VF SGD+   A  L +M+  L+ +  V ++ + + QLE L++R
Sbjct  121  GLHEADNWSILANDVEEVFESGDIEAIANKLFSMQKSLAMLVNVIDYEDKKLQLEGLKNR  180

Query  627  LDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLK-PIKHLW-EDFEL  800
            L+++  P+L  A +   ++ ++    I +++ R   L L+Y    LK  +   W    EL
Sbjct  181  LEAIASPKLVQAFTAANLEQSKIYVDIFSKMERLPQL-LKYYHNCLKVSLGQEWRRTIEL  239

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
             Q  N                           S WL ++YD+LL
Sbjct  240  AQDEN--------------------------VSYWLHTYYDKLL  257



>ref|XP_011159533.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Solenopsis 
invicta]
Length=735

 Score =   129 bits (325),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 82/283 (29%), Positives = 145/283 (51%), Gaps = 27/283 (10%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  266
            +D+ +FS++ FD K+WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVGAFSEDSFDVKEWINRTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  267  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  446
              +PR  RD   L+ + L+LR  + ++ Q++ K E  +A S+ATL ++D +K  ++ A +
Sbjct  61   SSLPRILRDTQLLQQETLALREKMVAVKQEIAKIEKDTASSMATLERIDRIKTELQTAKQ  120

Query  447  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  626
             L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + + QLE L++R
Sbjct  121  GLHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDKKLQLEGLKNR  180

Query  627  LDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLW-EDFELR  803
            L+++  PRL  A +   ++ ++    I +++ R   L   Y       +   W    EL 
Sbjct  181  LEAIASPRLVQAFTAANLEQSKTYVDIFSKMERLPQLLKYYHNCLKVSLGQEWRRTIELA  240

Query  804  QQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
            Q  N                           + WL ++YD+LL
Sbjct  241  QDEN--------------------------VTYWLRTYYDKLL  257



>ref|XP_005748533.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pundamilia nyererei]
Length=769

 Score =   130 bits (326),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/284 (30%), Positives = 140/284 (49%), Gaps = 29/284 (10%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F D+ FD K W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKDAPGKADAHAATLVMKLQVFIQEVNNAIEESSNQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVMVKEDIKKFEQETVQSMQVLVEIDQVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E LQ+A   + LS+ +E+ F + D    +  L +M++ L+ + +  ++++    LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDFKVISSKLTSMQNSLAMLVDTPDYSDKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RL++M  P++  A ++  VD A+    +   I R   L   Y K H   +  +W+D   
Sbjct  181  NRLEAMASPQIVAAFNSMSVDQAKLFVKVFTEIDRMPQLLAYYYKCHKGQLLSIWQDL--  238

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
                              S +EL LN         L  FYD LL
Sbjct  239  ------------------SQSELNLNQQ-------LSEFYDTLL  257



>ref|XP_005810284.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Xiphophorus maculatus]
Length=769

 Score =   129 bits (325),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/284 (29%), Positives = 141/284 (50%), Gaps = 29/284 (10%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F D+ FD K W+NGA +    + P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKMVQKEAPGKADTHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            ALH +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALHNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E LQ+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++     LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDLEVISSKLTSMQNSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RL++M  P++    ++  +  A+    +   I R   L   Y K H   +  +W+D   
Sbjct  181  NRLEAMASPQIVATFNSMSLGQAKVFVKVFTEIDRMPQLLAYYYKCHKGQLVTIWQD---  237

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
                                    L+ S +S ++ L  FYD LL
Sbjct  238  ------------------------LSQSELSLNQQLSEFYDTLL  257



>ref|XP_011863988.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like, 
partial [Vollenhovia emeryi]
Length=687

 Score =   129 bits (324),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/221 (33%), Positives = 131/221 (59%), Gaps = 1/221 (0%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  266
            +D+++FS++ FD K+WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVAAFSEDSFDVKEWINRTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  267  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  446
              +PR  RD   L+ + L+L+  + ++ Q++ K E  +A S+ATL K+D +K  ++ A +
Sbjct  61   SSLPRILRDTQLLQQETLALKEKMVAVKQEIAKIEKDTASSMATLEKIDRIKTELQTAKQ  120

Query  447  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  626
             L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + + QLE L++R
Sbjct  121  GLHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDKKLQLEGLKNR  180

Query  627  LDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQY  749
            L+++  PRL  A +   ++ ++    I  ++ R   L L+Y
Sbjct  181  LEAIASPRLVQAFTAANLEQSKTYVDIFGKMERLPQL-LKY  220



>ref|XP_007513783.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16308.1| predicted protein [Bathycoccus prasinos]
Length=978

 Score =   129 bits (325),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 96/321 (30%), Positives = 161/321 (50%), Gaps = 41/321 (13%)
 Frame = +3

Query  93   LSSFSDEKFDPKQWINGACQSRHPQDPLDKHL------------------VDLEMKLQMA  218
            +  F+D +FDP  ++N A +     D   KHL                   +LEM+LQ+ 
Sbjct  1    MEEFNDPRFDPIHYVNVAARQCFNNDEKKKHLQHKANDITDENVELERLLSELEMRLQLL  60

Query  219  SEEIAVSLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVAT  398
             E+I++ LE  S   + R+P A  ++  L ++  SL ++V +I + L + E  S +S+  
Sbjct  61   GEDISLQLERESQLGVKRIPTAIGEIEVLEENVESLTNTVKNISRSLDETEFPSKQSIER  120

Query  399  LAKVDTVKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEV  578
            L K+D VK RME A +TL +AAGL +L  +V+ VF+  ++   A+ L  M+  L+ VG+V
Sbjct  121  LRKIDEVKSRMERARDTLSEAAGLAELMHSVDSVFNGENVSNMADALVRMKRGLAIVGDV  180

Query  579  AEFANIRKQLEVLEDRLDSMVQPRLTDALSNRK-------------------VDVAQEMR  701
             EFA+ R ++ VLE RL+S  +P L  AL   K                   +  A++ R
Sbjct  181  PEFADGRDRIAVLESRLESAARPALLRALEMDKGVNMSSSTTMVSSSGSRDSIKFARDAR  240

Query  702  SILNRIGRFKSLELQYSKVH-LKPIKHLWEDFELRQQANK-VSNEKNEVERLSSANELQL  875
              L  IG+ +S+E  Y++   + P    W  FE +   +  + NE +     +S N+ + 
Sbjct  241  DALRSIGKNESIEGAYAEARVVSPAMEFWVAFEEKTYNDGLIMNENSPPNDTNSNNDKKT  300

Query  876  NSSPI--SFSRWLPSFYDELL  932
            +      +F+ +LP FYD ++
Sbjct  301  DEDAANEAFANFLPQFYDFVI  321



>ref|XP_011264701.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Camponotus floridanus]
 gb|EFN62526.1| Conserved oligomeric Golgi complex subunit 7 [Camponotus floridanus]
Length=735

 Score =   129 bits (323),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 82/283 (29%), Positives = 144/283 (51%), Gaps = 27/283 (10%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  266
            +D+S+FS++ FD K+WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVSAFSEDSFDVKEWINRTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  267  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  446
              +PR  RD   L+ + L+LR  + ++ Q++ K E  +A S+A L K+D +K  ++ A +
Sbjct  61   SSLPRILRDTQLLQQETLALREKMVAVKQEIAKVEKDTASSMAMLEKIDRIKTELQTAKQ  120

Query  447  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  626
             L +A   T L++ +E+VF SGD+   +  L +M+  L  +  V ++ + + QLE L++R
Sbjct  121  GLHEADNWTVLANDMEEVFESGDIEAISNKLFSMQKSLVMLANVVDYEDKKLQLEGLKNR  180

Query  627  LDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLW-EDFELR  803
            L+++  PRL  A +   ++ ++    I +++ R   L   Y       +   W    EL 
Sbjct  181  LEAIASPRLVQAFTAANLEQSKTYVDIFSKMKRLPQLLKYYHNCLKVSLGQEWRRTIELA  240

Query  804  QQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
            Q  N                           + WL ++YD+LL
Sbjct  241  QDEN--------------------------VTYWLHTYYDKLL  257



>ref|XP_003490215.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Bombus impatiens]
Length=783

 Score =   129 bits (323),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/282 (30%), Positives = 145/282 (51%), Gaps = 27/282 (10%)
 Frame = +3

Query  90   DLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASALH  269
            D+S+FS++ FD K WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L 
Sbjct  50   DVSAFSEDIFDVKDWINKTFKSVEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVLS  109

Query  270  RVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYET  449
             +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL ++D +K  ++ A + 
Sbjct  110  SLPRVLRDTQLLQQEALALREKMVAVKQEIEKVEKDTASSMATLERIDKIKTDLQIAKQG  169

Query  450  LQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDRL  629
            L +A   + L++ VE+VF SGD+   A  L +M+  L+ +  V ++ + + QLE L++RL
Sbjct  170  LHEADNWSILANDVEEVFESGDIEAIANKLFSMQKSLAMLVNVIDYEDKKLQLEGLKNRL  229

Query  630  DSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLW-EDFELRQ  806
            +++  P+L  A +   ++ ++    I +++ R   L   Y       +   W    EL Q
Sbjct  230  EAIASPKLVQAFTAANLEQSKVYVDIFSKMERLPQLLKYYHNCLKVSLGQEWRRTIELAQ  289

Query  807  QANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
              N                           S WL ++YD+LL
Sbjct  290  DEN--------------------------VSYWLHTYYDKLL  305



>ref|XP_007903979.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Callorhinchus milii]
Length=766

 Score =   129 bits (323),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 77/253 (30%), Positives = 140/253 (55%), Gaps = 4/253 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQS--RHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F D+ F+ K W+NGA Q+  +     +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDNFEVKDWVNGAFQAVQKDGTGKVDSHAATLVMKLQLFIQEVNNAIEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PRA RDV  L+ +A  L+  +  + + +RK E  +A+S+  L ++D VK RM+AA
Sbjct  61   ALQNMPRALRDVEALKQEASFLKDQMILVKEDIRKFEQETAQSMQVLVEIDEVKSRMQAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             + LQ+A   + LS+ +E+ F + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  ADALQEADKWSTLSADIEETFKTQDVATISAKLTSMQSSLAMLADTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RL+++  P++  A +++ V+ A+    +   I R   L   Y K H   +  +W+  EL
Sbjct  181  NRLEALASPQIVAAFNSQSVEQAKLFVKVFVEIDRRPQLLTYYYKCHKGQLLCVWQ--EL  238

Query  801  RQQANKVSNEKNE  839
             Q   ++ ++  E
Sbjct  239  AQSETRLEHQLTE  251



>ref|XP_007903980.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Callorhinchus milii]
Length=687

 Score =   128 bits (321),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 77/253 (30%), Positives = 140/253 (55%), Gaps = 4/253 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQS--RHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F D+ F+ K W+NGA Q+  +     +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDNFEVKDWVNGAFQAVQKDGTGKVDSHAATLVMKLQLFIQEVNNAIEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PRA RDV  L+ +A  L+  +  + + +RK E  +A+S+  L ++D VK RM+AA
Sbjct  61   ALQNMPRALRDVEALKQEASFLKDQMILVKEDIRKFEQETAQSMQVLVEIDEVKSRMQAA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             + LQ+A   + LS+ +E+ F + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  ADALQEADKWSTLSADIEETFKTQDVATISAKLTSMQSSLAMLADTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RL+++  P++  A +++ V+ A+    +   I R   L   Y K H   +  +W+  EL
Sbjct  181  NRLEALASPQIVAAFNSQSVEQAKLFVKVFVEIDRRPQLLTYYYKCHKGQLLCVWQ--EL  238

Query  801  RQQANKVSNEKNE  839
             Q   ++ ++  E
Sbjct  239  AQSETRLEHQLTE  251



>ref|XP_011068677.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Acromyrmex 
echinatior]
Length=735

 Score =   128 bits (322),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/227 (33%), Positives = 132/227 (58%), Gaps = 1/227 (0%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  266
            +D+++FS++ FD K+WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVAAFSEDSFDVKEWINRTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  267  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  446
              +PR  RD + L+ + L+LR  + ++ Q++ K E  +A S+A L K+D +K  ++ A +
Sbjct  61   SSLPRILRDTLLLQQETLALREKMVAVKQEIAKIEKDTASSMAMLEKIDRIKTELQTAKQ  120

Query  447  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  626
             L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + + QLE L++R
Sbjct  121  GLHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDKKLQLEGLKNR  180

Query  627  LDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLK  767
            L+++  PRL  A +    + ++    I  ++ R   L L+Y    LK
Sbjct  181  LEAIASPRLVQAFTAANSEQSKIYVDIFGKMERLPQL-LKYYHNCLK  226



>ref|XP_003341699.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Monodelphis domestica]
Length=769

 Score =   128 bits (322),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 73/238 (31%), Positives = 134/238 (56%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  + F+ K+WINGA ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLADDFEVKEWINGAFKAVPKEAPGKVDGHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEIDQVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+ F + D+   +  L +M++ L+ + +  ++++    LE L+
Sbjct  121  AESLQEADKWSTLSADIEETFKTQDVTVISAKLTSMQNSLTMLVDTPDYSDKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A +++ VD A+    +   I R   L   Y K H   +   W+D 
Sbjct  181  NRLEAMASPQIVAAFNSQSVDQAKVFVKVFTEIDRMPQLLAYYYKCHKAQLLASWQDL  238



>ref|XP_005288959.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Chrysemys 
picta bellii]
Length=770

 Score =   128 bits (321),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 74/239 (31%), Positives = 131/239 (55%), Gaps = 3/239 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP---LDKHLVDLEMKLQMASEEIAVSLEELSA  257
            +D S F  E F+ K+W+NGA ++   QD    +D H   L MKLQ+  +E+  ++EE S 
Sbjct  1    MDFSKFLAEDFEVKRWVNGAFRAVQQQDAPGKVDAHAATLVMKLQLFIQEVNNAVEETSH  60

Query  258  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  437
             AL  +PR  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ 
Sbjct  61   QALQNMPRVLRDVEALKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVELDRVKSRMQL  120

Query  438  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  617
            A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++     LE L
Sbjct  121  AAESLQEADKWSTLSADIEETFKTQDVSVISAKLTGMQNSLAMLVDTPDYSEKCVHLEAL  180

Query  618  EDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            ++RL++M  P++    + + VD A+    +   I R   L   Y K H   +  +W+D 
Sbjct  181  KNRLEAMASPQIVATFNAQSVDQAKVFVKVFTEIDRMPQLLAYYYKCHKVQLVTVWQDL  239



>ref|XP_011693337.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Wasmannia 
auropunctata]
Length=735

 Score =   128 bits (321),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 74/227 (33%), Positives = 132/227 (58%), Gaps = 1/227 (0%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  266
            +D+++FS++ FD K+WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L
Sbjct  1    MDVAAFSEDSFDVKEWINRTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVL  60

Query  267  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  446
              +PR  RD   L+ + L+LR  + ++ Q++ K E  +A S+A L K+D +K  ++ A +
Sbjct  61   SSLPRILRDTQLLQQETLALREKMVAVKQEIAKIEKDTASSMAMLEKIDRIKTELQTAKQ  120

Query  447  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  626
             L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + + QLE L++R
Sbjct  121  GLHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDKKLQLEGLKNR  180

Query  627  LDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLK  767
            L+++  PRL  A +   ++ ++    I  ++ R   L L+Y    LK
Sbjct  181  LEAIASPRLVHAFTAANLEQSKTYVDIFGKMERLPQL-LKYYHNCLK  226



>ref|XP_003438511.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Oreochromis 
niloticus]
Length=769

 Score =   128 bits (321),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 73/237 (31%), Positives = 127/237 (54%), Gaps = 2/237 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F D+ FD K W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKDAPGKADAHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVMVKEDIKKFEQETVQSMQVLVEIDQVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E LQ+A   + LS+ +E+ F + D    +  L +M++ L+ + +  ++++    LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDFKVISSKLTSMQNSLAMLVDTPDYSDKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWED  791
            +RL++M  P++    ++  VD A+    +   I R   L   Y K H   +  +W+D
Sbjct  181  NRLEAMASPQIVATFNSMSVDQAKLFVKVFTEIDRMPQLLAYYYKCHKGQLLSIWQD  237



>ref|XP_004571418.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Maylandia zebra]
Length=769

 Score =   128 bits (321),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 84/284 (30%), Positives = 139/284 (49%), Gaps = 29/284 (10%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F D+ FD K W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKDAPGKADAHAATLVMKLQVFIQEVNNAIEESSNQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVMVKEDIKKFEQETVQSMQVLVEIDQVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E LQ+A   + LS+ +E+ F + D    +  L +M++ L+ + +  ++++    LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDFKVISSKLTSMQNSLAMLVDTPDYSDKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RL++M  P++    ++  VD A+    +   I R   L   Y K H   +  +W+D   
Sbjct  181  NRLEAMASPQIVATFNSMSVDQAKLFVKVFTEIDRMPQLLAYYYKCHKGQLLSIWQDL--  238

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
                              S +EL LN         L  FYD LL
Sbjct  239  ------------------SQSELNLNQQ-------LSEFYDTLL  257



>ref|XP_003961343.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Takifugu 
rubripes]
Length=769

 Score =   127 bits (320),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 74/238 (31%), Positives = 125/238 (53%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F D+ FD K W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKDAPGKADTHAATLVMKLQLFIQEVNNAIEETSNQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVESLKQEASFLKDQMVLVKEDIRKFEQDTVQSMQVLVEIDKVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E LQ+A   + LS+ +E+ F + DL   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDLAIISSKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL+++  P++    ++   D A+    I   I R   L   Y K H   +  +W+D 
Sbjct  181  NRLEALASPQIVATFNSMTTDRAKLFVKIFTEIDRMPQLLAYYYKCHKGQLVSMWQDL  238



>ref|XP_010791235.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Notothenia 
coriiceps]
Length=769

 Score =   127 bits (319),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 81/284 (29%), Positives = 141/284 (50%), Gaps = 29/284 (10%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F D++FD K W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDEFDVKDWVNGAFKVVQKDAPGKADTHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTVQSMQVLVEIDQVKGRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E LQ+A   + LS+ +E+ F + D+   +  L +M++ L+ + +  +++     LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDMAVISSKLTSMQNSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RL+++  P++    ++  +D A+    +   I R   L   Y K H   +  +W+D   
Sbjct  181  NRLEALASPQIVATFNSMSLDQAKLFVKVFTEIDRMPQLLAYYYKCHKGQLVSMWQD---  237

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
                                    L+ S +S ++ L  FYD LL
Sbjct  238  ------------------------LSQSELSLNQQLSEFYDTLL  257



>ref|XP_005935571.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Haplochromis burtoni]
Length=769

 Score =   127 bits (319),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 84/284 (30%), Positives = 138/284 (49%), Gaps = 29/284 (10%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F D+ FD K W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKDAPGKADAHAATLVMKLQVFIQEVNNAIEESSNQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVMVKEDIKKFEQETVQSMQVLVEIDQVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E LQ+A   + LS+ +E+ F + D    +  L +M+  L+ + +  ++++    LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDFKVISSKLTSMQSSLAMLVDTPDYSDKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RL++M  P++    ++  VD A+    +   I R   L   Y K H   +  +W+D   
Sbjct  181  NRLEAMASPQIVATFNSMSVDQAKLFVKVFTEIDRMPQLLAYYYKCHKGQLLSIWQDL--  238

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
                              S +EL LN         L  FYD LL
Sbjct  239  ------------------SQSELNLNQQ-------LSEFYDTLL  257



>ref|XP_012055460.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Atta 
cephalotes]
Length=808

 Score =   127 bits (319),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 132/226 (58%), Gaps = 1/226 (0%)
 Frame = +3

Query  90   DLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASALH  269
            D+++FS++ FD K+WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L 
Sbjct  75   DVAAFSEDSFDVKEWINRTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVLS  134

Query  270  RVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYET  449
             +PR  RD   L+ + L+LR  + ++ Q++ K E  +A S+A L K+D +K  ++ A + 
Sbjct  135  SLPRILRDTQLLQQETLALREKMIAVKQEIAKIEKDTASSMAMLEKIDRIKTELQTAKQG  194

Query  450  LQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDRL  629
            L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + + QLE L++RL
Sbjct  195  LHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDKKLQLEGLKNRL  254

Query  630  DSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLK  767
            +++  PRL  A +   ++ ++    I +++ R   L L+Y    LK
Sbjct  255  EAIASPRLVQAFTAANLEQSKIYVDIFDKMERLPQL-LKYYHNCLK  299



>ref|XP_007058642.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Chelonia 
mydas]
 gb|EMP36935.1| Conserved oligomeric Golgi complex subunit 7 [Chelonia mydas]
Length=770

 Score =   127 bits (319),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 73/239 (31%), Positives = 132/239 (55%), Gaps = 3/239 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP---LDKHLVDLEMKLQMASEEIAVSLEELSA  257
            +D S F  + F+ K+W+NGA ++   QD    +D H   L MKLQ+  +E+  ++EE S 
Sbjct  1    MDFSKFLADDFEVKRWVNGAFRAVQQQDAPSKVDAHAATLVMKLQLFIQEVNNAVEETSH  60

Query  258  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  437
             AL  +PR  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ 
Sbjct  61   QALQNMPRVLRDVEALKQEATFLKEQMVLVKEDIKKFEEDTAQSMQVLVELDRVKSRMQL  120

Query  438  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  617
            A E+LQ+A   + LS+ +E+ F + D+   +  L +M++ L+ + +  +++     LE L
Sbjct  121  AAESLQEADKWSTLSADIEETFKTQDVSVISAKLTSMQNSLAMLVDTPDYSEKCVHLEAL  180

Query  618  EDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            ++RL++M  P++    + + VD A+    +   I R   L   Y K H   +  +W+D 
Sbjct  181  KNRLEAMASPQIVATFNAQSVDQAKVFVKVFTEIDRMPQLLAYYYKCHKVQLVTVWQDL  239



>ref|XP_009062761.1| hypothetical protein LOTGIDRAFT_194952 [Lottia gigantea]
 gb|ESO86524.1| hypothetical protein LOTGIDRAFT_194952 [Lottia gigantea]
Length=737

 Score =   127 bits (318),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 76/239 (32%), Positives = 131/239 (55%), Gaps = 5/239 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPL---DKHLVDLEMKLQMASEEIAVSLEELSA  257
            +D S F D+ FD K+W+N A   R+ +D     D++   L MKLQM  +E+   LEE S 
Sbjct  1    MDYSKFLDDSFDAKEWVNAA--FRNHKDTAVSKDQYATTLVMKLQMFIQEVNNILEEASQ  58

Query  258  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  437
             AL  +PR  R++  +R +A  L+  +  + + ++K E S+A+S+  L K+D +K RM+ 
Sbjct  59   QALQNLPRVMREIDAVRQEASLLQDQMRMVKEDIQKVEQSTAQSMQVLLKLDGIKGRMKT  118

Query  438  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  617
              E L++A   T LS+ VE+VF S D+    + L  M+  L  + +  ++A+  + LE L
Sbjct  119  TAEALKEADNWTTLSADVEEVFHSNDIQAITDKLTGMQQSLQMLVDTPDYADRCQHLEKL  178

Query  618  EDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            ++RL++++ P+L  A + + ++ A+    + + I R   L   Y K H   +   W D 
Sbjct  179  KNRLEAILSPQLIAAFNTQSLESAKMYTKMFDNIERLPQLYKYYHKCHKGKLLENWRDI  237



>ref|XP_004080382.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Oryzias 
latipes]
Length=769

 Score =   127 bits (318),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 71/238 (30%), Positives = 127/238 (53%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQ--SRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F D+ FD K W+NGA +  S+      D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVSKEAPGKADTHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEAFFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDKVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E LQ+A   + LS+ +E+ F + D    +  L +M++ L+ + +  +++     LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDFALISSKLTSMQNSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++    ++  ++ A+    +   I R   L   Y K H   +  +W+D 
Sbjct  181  NRLEAMASPQIVATFNSMSIEQAKLFVKVFTEIDRMPQLLAYYYKCHKGQLVSVWQDL  238



>gb|EGI69206.1| Conserved oligomeric Golgi complex subunit 7 [Acromyrmex echinatior]
Length=864

 Score =   127 bits (319),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 131/226 (58%), Gaps = 1/226 (0%)
 Frame = +3

Query  90   DLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASALH  269
            D+++FS++ FD K+WIN   +S   Q+  D  +  L MKLQ+  +++  +LEE S S L 
Sbjct  131  DVAAFSEDSFDVKEWINRTFKSAEAQENKDAFVSSLVMKLQLYVQQVNGALEETSQSVLS  190

Query  270  RVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYET  449
             +PR  RD + L+ + L+LR  + ++ Q++ K E  +A S+A L K+D +K  ++ A + 
Sbjct  191  SLPRILRDTLLLQQETLALREKMVAVKQEIAKIEKDTASSMAMLEKIDRIKTELQTAKQG  250

Query  450  LQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDRL  629
            L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + + QLE L++RL
Sbjct  251  LHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDKKLQLEGLKNRL  310

Query  630  DSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLK  767
            +++  PRL  A +    + ++    I  ++ R   L L+Y    LK
Sbjct  311  EAIASPRLVQAFTAANSEQSKIYVDIFGKMERLPQL-LKYYHNCLK  355



>ref|XP_006808092.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Neolamprologus brichardi]
Length=769

 Score =   126 bits (317),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 81/284 (29%), Positives = 140/284 (49%), Gaps = 29/284 (10%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F D+ FD K W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKDAPGKADAHAATLVMKLQVFIQEVNNAIEESSNQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVMVKEDIKKFEQETVQSMQVLVEIDQVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E LQ+A   + LS+ +E+ F + D    +  L +M++ L+ + +  ++++    LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDFKVISSKLTSMQNSLAMLVDTPDYSDKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RL++M  P++    ++  V+ A+    +   I R   L   Y K H   +  +W+D   
Sbjct  181  NRLEAMASPQIVATFNSMSVEQAKLFVKVFTEIDRMPQLLAYYYKCHKGQLLSIWQD---  237

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
                                    L+ S +S ++ L  FYD LL
Sbjct  238  ------------------------LSQSELSLNQQLSEFYDTLL  257



>ref|XP_008434639.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Poecilia 
reticulata]
Length=769

 Score =   126 bits (317),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 81/284 (29%), Positives = 140/284 (49%), Gaps = 29/284 (10%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F D+ FD K W+NGA +    + P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKMVQKEAPGKADTHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E LQ+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++     LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDLEVISSKLTSMQNSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RL++M  P++    ++  +  A+    +   I R   L   Y K H   +  +W+D   
Sbjct  181  NRLEAMASPQIVATFNSMSLGQAKVFVKVFTEIDRMPQLLAYYYKCHKGQLVSIWQD---  237

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
                                    L+ S +S ++ L  FYD LL
Sbjct  238  ------------------------LSQSELSLNQQLSEFYDTLL  257



>ref|XP_007571524.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Poecilia formosa]
Length=769

 Score =   126 bits (317),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 81/284 (29%), Positives = 140/284 (49%), Gaps = 29/284 (10%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F D+ FD K W+NGA +    + P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKMVQKEAPGKADTHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E LQ+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++     LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDLEVISSKLTSMQNSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RL++M  P++    ++  +  A+    +   I R   L   Y K H   +  +W+D   
Sbjct  181  NRLEAMASPQIVATFNSMSLGQAKVFVKVFTEIDRMPQLLAYYYKCHKGQLVSIWQD---  237

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
                                    L+ S +S ++ L  FYD LL
Sbjct  238  ------------------------LSQSELSLNQQLSEFYDTLL  257



>gb|EFA86654.1| oligomeric Golgi complex component [Polysphondylium pallidum 
PN500]
Length=785

 Score =   126 bits (317),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/305 (28%), Positives = 153/305 (50%), Gaps = 37/305 (12%)
 Frame = +3

Query  102  FSDEKFDPKQWING--------ACQSRHP-------QDPLDKHL---VDLEMKLQMASEE  227
            FS + F+ KQWIN         + QS+         +  L+ H+    D+  KLQ+ S E
Sbjct  19   FSSDTFNTKQWINNLLKPANSTSSQSQTNDVFNYSIESDLEVHINRASDILSKLQIYSLE  78

Query  228  IAVSLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAK  407
            + +SLE  ++ +L  VP+A R++ R+R +++SL+  V  I Q +     +++++VA ++ 
Sbjct  79   LNMSLENKASDSLLYVPKAVREIDRVRKESVSLKQKVKHINQTIASMHANTSDTVARISS  138

Query  408  VDTVKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEF  587
            +DTV++R++    +L +A  L   SS ++ +F S D  + A+TL  ++  L+ + ++ EF
Sbjct  139  LDTVRKRIDQCIISLNEAEKLLSFSSGLDKLFQSADYLKIADTLEGVKQSLAVLSDIPEF  198

Query  588  ANIRKQLEVLEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLK  767
               ++  +  +DRL+S+V+P+L  AL +R ++       I   I R +   + Y  V L+
Sbjct  199  REQQRHFQAHQDRLESLVRPQLIGALQSRDLESCVNYLKIFQSIKREQQFLIHYYNVRLE  258

Query  768  PIKHLWEDFELRQQANKVSNEKNEVERLSSANELQLNSSPI---------SFSRWLPSFY  920
            PIK LW  +      +             SA      S P          + ++W   FY
Sbjct  259  PIKALWSSYAGGSSKSPA----------GSATSPGTTSPPQQQQQQLIVPNLNQWCQGFY  308

Query  921  DELLL  935
            DE++L
Sbjct  309  DEVIL  313



>ref|XP_007571519.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Poecilia formosa]
Length=769

 Score =   126 bits (317),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/284 (29%), Positives = 140/284 (49%), Gaps = 29/284 (10%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F D+ FD K W+NGA +    + P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKMVQKEAPGKADTHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E LQ+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++     LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDLEVISSKLTSMQNSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RL++M  P++    ++  +  A+    +   I R   L   Y K H   +  +W+D   
Sbjct  181  NRLEAMASPQIVATFNSMSLGQAKVFVKVFTEIDRMPQLLAYYYKCHKGQLVSIWQD---  237

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
                                    L+ S +S ++ L  FYD LL
Sbjct  238  ------------------------LSQSELSLNQQLSEFYDTLL  257



>ref|NP_001264493.1| conserved oligomeric Golgi complex subunit 7 [Gallus gallus]
Length=769

 Score =   126 bits (317),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/238 (32%), Positives = 129/238 (54%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D+S F  + F+ K W+N A ++     P   D H   L MKLQ+  +E+   +EE S  
Sbjct  1    MDISRFMADDFEVKSWVNAAFRAGQQDAPGQADAHASTLVMKLQVFIQEVNNVVEEASQQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            ALH +PR  R+V  LR +A  LR  +  + + +R+ E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALHSMPRVLREVEALRQEAAFLREQMVLVKEDIRRFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   T LS+ +E+   + D+   A  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWTTLSADIEETLKTQDVSAIAAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A +++ VD A+    +   I R   L   Y K H   +  +W+D 
Sbjct  181  NRLEAMASPQIVAAFNSQSVDQAKMFVKVFTEIDRMPQLLAYYYKCHKVQLVAVWQDL  238



>ref|XP_003761800.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Sarcophilus 
harrisii]
Length=655

 Score =   125 bits (315),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/238 (30%), Positives = 133/238 (56%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQS--RHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  + F+ K+WINGA ++  +     +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLADDFEVKEWINGAFRAAPKEASGKVDGHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEIDQVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+ F + D+   +  L +M++ L+ + +  ++++    LE L+
Sbjct  121  AESLQEADKWSTLSADIEETFKTQDVAVISAKLTSMQNSLTMLVDTPDYSDKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A +++ VD A+    +   I R   L   Y K H   +   W+D 
Sbjct  181  NRLEAMASPQIVAAFNSQSVDQAKVFVKVFTEIDRMPQLLAYYFKCHKAQLLASWQDL  238



>ref|XP_010568819.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X5 [Haliaeetus leucocephalus]
Length=639

 Score =   124 bits (310),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 131/238 (55%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKSWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  R+V  L+ +A  L+  ++ + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMTLVKEDIKKFEEDTAQSMQVLVEIDQVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A +++ VD A+    +   I R   L   Y K H   +  +W+D 
Sbjct  181  NRLEAMASPQIVAAFNSQSVDQAKTFVKVFTEIDRMPQLLAYYYKCHKVQLVAVWQDL  238



>ref|XP_010568818.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X4 [Haliaeetus leucocephalus]
Length=671

 Score =   124 bits (310),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 131/238 (55%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKSWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  R+V  L+ +A  L+  ++ + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMTLVKEDIKKFEEDTAQSMQVLVEIDQVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A +++ VD A+    +   I R   L   Y K H   +  +W+D 
Sbjct  181  NRLEAMASPQIVAAFNSQSVDQAKTFVKVFTEIDRMPQLLAYYYKCHKVQLVAVWQDL  238



>ref|XP_002128341.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ciona 
intestinalis]
Length=765

 Score =   124 bits (311),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 79/282 (28%), Positives = 137/282 (49%), Gaps = 18/282 (6%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  266
            +D S FSD+ FD K+W+NG  +S+  +   + +   L  KLQ   +E+  SLEE+S  A+
Sbjct  1    MDFSKFSDDNFDVKEWVNGVFRSQKDEQQKEAYTATLVTKLQRYIQEVNRSLEEISQQAV  60

Query  267  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  446
              +PR  RDV  L+ +A  L   +  + +++R  E  ++ S+  L K+D+V+ R+E A  
Sbjct  61   GNLPRVLRDVETLKKEATFLWQQMQQVKEEIRSVEQRTSHSMEVLVKIDSVRSRVEQASA  120

Query  447  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  626
             L++A   + L+S +ED+F SGD+   A  L +M+  L  +    ++ +    LE L++R
Sbjct  121  ALKEADNWSSLASAIEDIFRSGDIEAVAAQLQSMQASLVVLRNSPDYDDKVLHLEALKNR  180

Query  627  LDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFELRQ  806
            L++ V P +     N     A +  +I   + R       Y K H   +   W++     
Sbjct  181  LETAVSPSVVATFMNHNTAEANKYHTIFRNLDRLAEFRNYYLKCHRARVNGKWQEI----  236

Query  807  QANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
                VS E  + + ++   +  L          L  FY+ LL
Sbjct  237  ----VSGENGDSKPVTETTDFAL----------LGEFYELLL  264



>gb|ELT88100.1| hypothetical protein CAPTEDRAFT_161050 [Capitella teleta]
Length=754

 Score =   123 bits (309),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 128/235 (54%), Gaps = 1/235 (0%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  266
            +D S F DE FD K+W+N A ++       D++   L MKLQM  +E+   +EE    ++
Sbjct  1    MDYSKFLDESFDVKEWVNAAFRANKDSSQ-DQYATTLVMKLQMFIQEVNNLIEESCLQSV  59

Query  267  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  446
            + +PR  R++  L+ +A+ L+  +  I   ++K E  +++S+ TL K+DTVK RM+ A E
Sbjct  60   NNLPRVMRELEALKQEAVLLQDQMKMIKFDIQKVEQDTSQSMLTLLKLDTVKTRMKDASE  119

Query  447  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  626
             LQ+A   T L S ++D++ SG++   A  L  ++  L  + +V ++    + LE L++R
Sbjct  120  ALQEADNWTSLLSGLDDIYESGNVNEIAAKLVGLQQSLLILTDVPDYEERCQYLETLKNR  179

Query  627  LDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWED  791
            L++++ P++  A S   ++ AQ    I   I R   L   Y K H   +   W D
Sbjct  180  LEALLSPQVVAAFSAHSLESAQMYVKIFTDIDRLPQLYKYYHKCHRVSLLQQWRD  234



>emb|CAG04322.1| unnamed protein product [Tetraodon nigroviridis]
Length=470

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 126/240 (53%), Gaps = 4/240 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F D+ FD K W+NGA +    + P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKEAPGKADTHAATLVMKLQLFIQEVNNAIEETSNQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +P+  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPKVLRDVESLKQEASFLKDQMVLVKEDIRKFEQDTVQSMQVLVEIDKVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E LQ+A   + LS+ +E+ F + DL   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDLALISSKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKV--DVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL+++  P++    ++     + A+    I   I R   L   Y K H   +  +W+D 
Sbjct  181  NRLEALASPQIVGTFNSMSTGKNRAKLFVKIFTEIDRMPQLLAYYYKCHKGQLVSIWQDL  240



>ref|NP_001015714.1| component of oligomeric golgi complex 7 [Xenopus (Silurana) tropicalis]
 gb|AAH89645.1| MGC107838 protein [Xenopus (Silurana) tropicalis]
Length=768

 Score =   123 bits (308),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/238 (30%), Positives = 133/238 (56%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  + F+ K W+N A +S     P  +D H   L MKLQ+  +E+  S+EE+S  
Sbjct  1    MDFSRFLADDFEVKDWVNAAFKSVQKDAPAKVDAHASTLVMKLQLFIQEVNNSVEEISHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  RDV  +R +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEAVRQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEMDKVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             ++LQ+A   + LS+ +E+ F + ++   +E L +M+  L+ + +  +++     LE L+
Sbjct  121  ADSLQEADKWSTLSADIEETFKTQNITVISEKLTSMQVSLTMLVDTPDYSEKCVYLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A +++ VD A+    + + I R   L   Y K H   +  +W++ 
Sbjct  181  NRLEAMCSPQIVAAFNSQSVDQAKMFVKVFSEIDRMPQLLAYYYKCHKVQLVTVWQEL  238



>ref|XP_010568814.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Haliaeetus leucocephalus]
Length=769

 Score =   123 bits (308),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 131/238 (55%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKSWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  R+V  L+ +A  L+  ++ + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMTLVKEDIKKFEEDTAQSMQVLVEIDQVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A +++ VD A+    +   I R   L   Y K H   +  +W+D 
Sbjct  181  NRLEAMASPQIVAAFNSQSVDQAKTFVKVFTEIDRMPQLLAYYYKCHKVQLVAVWQDL  238



>ref|XP_010717801.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Meleagris 
gallopavo]
Length=769

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 130/239 (54%), Gaps = 4/239 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP---LDKHLVDLEMKLQMASEEIAVSLEELSA  257
            +D+S F  + F+ K W+N A ++   QD     D H   L MKLQ+  +E+   +EE S 
Sbjct  1    MDISRFMADDFEVKSWVNAAFRAGQ-QDAAGQTDAHASTLVMKLQVFIQEVNNVVEEASQ  59

Query  258  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  437
             ALH +PR  R+V  LR +A  LR  +  + + +R+ E  +A+S+  L ++D VK RM+ 
Sbjct  60   QALHSMPRVLREVEALRQEAAFLREQMVLVKEDIRRFEEDTAQSMQVLVEIDRVKSRMQL  119

Query  438  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  617
            A E+LQ+A   T LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L
Sbjct  120  AAESLQEADKWTTLSADIEETLKTQDVSAISAKLTSMQSSLAMLVDTPDYSEKCVHLEAL  179

Query  618  EDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            ++RL++M  P++  A +++ VD A+    +   I R   L   Y K H   +  +W+D 
Sbjct  180  KNRLEAMASPQIVAAFNSQSVDQAKMFVKVFTEIDRMPQLLAYYYKCHKVQLVAVWQDL  238



>ref|XP_003230252.2| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Anolis carolinensis]
Length=768

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 131/238 (55%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F +E F+ K W+NGA ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLEEDFEVKSWVNGAFRAMQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSQQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQSMPRVLREVEALKQEAAFLKEQMVLVREDIKKLEQDTAQSMQVLVQLDQVKSRMQMA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             ++LQ+A   + LS+ +E+ F + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  ADSLQEADKWSTLSADIEETFKTQDVSVISAKLTSMQSSLAVLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL+++  P++  A + + VD ++    +   I R   L   Y K H   +   W+D 
Sbjct  181  NRLEALASPQIVAAFNAQSVDQSRVFVKVFTEIDRMPQLLAYYYKCHKVQLVSAWQDL  238



>ref|XP_006637161.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Lepisosteus oculatus]
Length=728

 Score =   122 bits (307),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 122/227 (54%), Gaps = 2/227 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F D+ FD K+W+NGA +    + P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKEWVNGAFRMVQKEAPGKADGHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTVQSMQVLVEIDQVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E LQ+A   + LS+ +E+ F + DL   +  L +M   L+ + +  +++     LE L+
Sbjct  121  AEALQEADKWSTLSADIEETFKTQDLSVISSKLTSMTSSLAMLADTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVH  761
            +RL+++  P++    +++  D A+    +   I R   L   Y K H
Sbjct  181  NRLEALASPQIVATFNSQSTDQAKLFVKVFTEIDRMPQLLAYYYKCH  227



>ref|XP_010731365.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Larimichthys crocea]
Length=769

 Score =   122 bits (306),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 79/284 (28%), Positives = 139/284 (49%), Gaps = 29/284 (10%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F D+ FD K W+NGA +      P   D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKVVQKDAPGKADTHAATLVMKLQLFIQEVNNAIEESSNQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM  A
Sbjct  61   ALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQVKSRMHLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             + LQ+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++     LE L+
Sbjct  121  ADALQEADKWSTLSADIEETFKTQDLAVISSKLTSMQNSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFEL  800
            +RL+++  P++    ++  +D A+    +   I R   L   Y K H   +  +W++   
Sbjct  181  NRLEALASPQIVATFNSMSMDQAKLFVKVFTEIDRMPQLLAYYYKCHKGQLVSMWQE---  237

Query  801  RQQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
                                    L+ S +S ++ L  FYD LL
Sbjct  238  ------------------------LSQSELSLNQQLSEFYDTLL  257



>gb|KFV72508.1| Conserved oligomeric Golgi complex subunit 7, partial [Struthio 
camelus australis]
Length=768

 Score =   122 bits (306),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/238 (30%), Positives = 129/238 (54%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  + F+ K W+NGA ++     P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLADDFEVKSWVNGAFKAVQQDAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEALKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A + + VD A+    +   I R   L   Y K H   +  +W+D 
Sbjct  181  NRLEAMASPQIVAAFNAQSVDQAKMFVKVFTEIDRMPQLLAYYYKCHKVQLVAVWQDL  238



>emb|CDQ66102.1| unnamed protein product [Oncorhynchus mykiss]
Length=768

 Score =   122 bits (306),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 80/283 (28%), Positives = 138/283 (49%), Gaps = 28/283 (10%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQ-SRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  263
            +D S F D+ FD K W+NGA +  +      D H   L MKLQ+  +E+  ++EE S  A
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKMQKDVPGKADAHAATLVMKLQLFIQEVNNAIEESSNQA  60

Query  264  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  443
            L  +PR  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D VK RM  A 
Sbjct  61   LQNMPRVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTVQSMQVLVELDQVKSRMHLAS  120

Query  444  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  623
            + LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++     LE L++
Sbjct  121  DALQEADKWSTLSADIEETFKTQDMAVISSKLTAMQNSLAMLVDTPDYSEKCVHLEALKN  180

Query  624  RLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFELR  803
            RL+++  P++    ++  VD A+    +   I R   L   Y K H   +  +W+D    
Sbjct  181  RLEALASPQIVATFNSMSVDQAKLFVKVFTEIDRMPQLLAYYYKCHKGQLVSVWQD----  236

Query  804  QQANKVSNEKNEVERLSSANELQLNSSPISFSRWLPSFYDELL  932
                                   L+ S +S ++ L  FYD LL
Sbjct  237  -----------------------LSQSELSLNQQLAEFYDTLL  256



>ref|XP_011577714.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Aquila chrysaetos canadensis]
Length=769

 Score =   122 bits (306),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 130/238 (55%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKSWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDQVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A +++ VD A+    +   I R   L   Y K H   +  +W+D 
Sbjct  181  NRLEAMASPQIVAAFNSQSVDQAKTFVKVFTEIDRMPQLLAYYYKCHKVQLVAMWQDL  238



>ref|XP_009665174.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Struthio camelus australis]
Length=769

 Score =   122 bits (306),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/238 (30%), Positives = 129/238 (54%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  + F+ K W+NGA ++     P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLADDFEVKSWVNGAFKAVQQDAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEALKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A + + VD A+    +   I R   L   Y K H   +  +W+D 
Sbjct  181  NRLEAMASPQIVAAFNAQSVDQAKMFVKVFTEIDRMPQLLAYYYKCHKVQLVAVWQDL  238



>ref|XP_008488587.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Calypte 
anna]
Length=769

 Score =   122 bits (305),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 130/238 (55%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKGWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVTVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A +++ VD A+    +   I R   L   Y K H   +  +W+D 
Sbjct  181  NRLEAMTSPQIVTAFNSQSVDQAKTFVKVFTEIDRMPQLLAYYYKCHKVQLVAVWQDL  238



>ref|NP_001085832.1| component of oligomeric golgi complex 7 [Xenopus laevis]
 gb|AAH73403.1| MGC80865 protein [Xenopus laevis]
Length=768

 Score =   122 bits (305),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 73/238 (31%), Positives = 131/238 (55%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPL--DKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  + F+ K+W+N A +S     P   D H   L MKLQ+  +E+  S+EE+S  
Sbjct  1    MDFSRFLADDFEVKEWVNAAFKSVQKDAPAKADAHASTLVMKLQLFIQEVNNSVEEISHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  RDV  +R +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDVEAVRQEASFLKEQMILVKEDIKKFEQDTAQSMHVLVEMDKVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+   + ++   +E L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQNISVISEKLTSMQVSLTMLVDTPDYSEKCVYLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A ++R VD A+    + + I R   L   Y K H   +   W++ 
Sbjct  181  NRLEAMCSPQIVAAFNSRSVDQARMFVKVFSEIDRMPQLLAYYYKCHKVQLVTAWQEL  238



>gb|KFO95573.1| Conserved oligomeric Golgi complex subunit 7, partial [Calypte 
anna]
Length=768

 Score =   122 bits (305),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 130/238 (55%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKGWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVTVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A +++ VD A+    +   I R   L   Y K H   +  +W+D 
Sbjct  181  NRLEAMTSPQIVTAFNSQSVDQAKTFVKVFTEIDRMPQLLAYYYKCHKVQLVAVWQDL  238



>ref|XP_009893067.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Charadrius 
vociferus]
 gb|KGL86030.1| Conserved oligomeric Golgi complex subunit 7 [Charadrius vociferus]
Length=769

 Score =   121 bits (304),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 130/238 (55%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKSWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A +++ VD A+    +   I R   L   Y K H   +  +W+D 
Sbjct  181  NRLEAMASPQIVAAFNSQSVDQAKTFVKVFTEIDRMPQLLAYYYKCHKVQLVAVWQDL  238



>ref|XP_005229099.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Falco 
peregrinus]
Length=769

 Score =   121 bits (304),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 130/238 (55%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKSWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A +++ VD A+    +   I R   L   Y K H   +  +W+D 
Sbjct  181  NRLEAMASPQIVAAFNSQSVDQAKTFVKVFTEIDRMPQLLAYYYKCHKVHLVAVWQDL  238



>ref|XP_005598907.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Equus caballus]
Length=748

 Score =   121 bits (303),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 71/240 (30%), Positives = 130/240 (54%), Gaps = 5/240 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  254
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVKHAVEETS  59

Query  255  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  434
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  435  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  614
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTPDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  615  LEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            L++RL+++  P++    S++ +D ++    I   I R   L   Y K H  P+   W++ 
Sbjct  180  LKNRLEALASPQIVAVFSSQSIDQSKAFVKIFTEIDRMPQLLAYYYKCHKVPLLAAWQEL  239



>ref|XP_010299541.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Balearica 
regulorum gibbericeps]
 gb|KFO10285.1| Conserved oligomeric Golgi complex subunit 7 [Balearica regulorum 
gibbericeps]
Length=769

 Score =   121 bits (303),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 130/238 (55%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKSWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A +++ VD A+    +   I R   L   Y K H   +  +W+D 
Sbjct  181  NRLEAMASPQIVAAFNSQSVDQAKTFVKVFTEIDRMPQLLAYYYKCHKVQLVAVWQDL  238



>ref|XP_001916280.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Equus caballus]
Length=770

 Score =   121 bits (303),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 71/240 (30%), Positives = 130/240 (54%), Gaps = 5/240 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  254
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVKHAVEETS  59

Query  255  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  434
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  435  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  614
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTPDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  615  LEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            L++RL+++  P++    S++ +D ++    I   I R   L   Y K H  P+   W++ 
Sbjct  180  LKNRLEALASPQIVAVFSSQSIDQSKAFVKIFTEIDRMPQLLAYYYKCHKVPLLAAWQEL  239



>ref|XP_010903275.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
 ref|XP_010903283.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
 ref|XP_010903290.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
Length=768

 Score =   121 bits (303),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/237 (30%), Positives = 124/237 (52%), Gaps = 1/237 (0%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQ-SRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASA  263
            +D S F D+ FD K W+NGA +  +      D H   L MKLQ+  +E+  ++EE S  A
Sbjct  1    MDFSKFLDDDFDVKDWVNGAFKMQKDAPGKADAHAATLVMKLQLFIQEVNNAIEESSNQA  60

Query  264  LHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  443
            L  +PR  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D VK RM  A 
Sbjct  61   LQNMPRVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTVQSMQVLVELDQVKSRMHLAA  120

Query  444  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  623
            + LQ+A   + LS+ +E+ F + DL   +  L  M++ L+ + +  +++     LE L++
Sbjct  121  DALQEADKWSTLSADIEETFKTQDLAVISSKLTAMQNSLAMLVDTPDYSEKCVHLEALKN  180

Query  624  RLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            RL+++  P++    ++   D A+    +   I R   L   Y K H   +  +W+D 
Sbjct  181  RLEALASPQIVATFNSMSTDQAKLFVKVFTEIDRMPQLLAYYYKCHKGQLVGVWQDL  237



>ref|XP_005505761.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Columba 
livia]
Length=769

 Score =   121 bits (303),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 130/238 (55%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKGWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEQDTAQSMQVLVEIDRVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A +++ VD A+    +   I R   L   Y K H   +  +W+D 
Sbjct  181  NRLEAMASPQIVAAFNSQAVDQAKTFVKVFTEIDRMPQLLAYYYKCHKVQLVAVWQDL  238



>ref|XP_010214546.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Tinamus guttatus]
Length=768

 Score =   120 bits (302),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 129/238 (54%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  + F+ K W+NGA ++     P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLADDFEVKSWVNGAFRAVQQDAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  R++  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRELEALKQEATFLKEQMVLVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A + + VD A+    +   I R   L   Y K H   +  +W+D 
Sbjct  181  NRLEAMASPQIVAAFNAQSVDQAKMFVKVFTEIDRMPQLLAYYYKCHKVQLVAVWQDL  238



>ref|XP_004442758.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ceratotherium 
simum simum]
Length=770

 Score =   120 bits (302),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/240 (30%), Positives = 131/240 (55%), Gaps = 5/240 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  254
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  255  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  434
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEEDTSQSMQVLVEIDQVKSRMQ  119

Query  435  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  614
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  615  LEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            L++RL+++  P++  A +++ VD ++    +   I R   L   Y K H  P+   W++ 
Sbjct  180  LKNRLEALASPQIVAAFTSQSVDQSKVFVKVFTEIDRMPQLLAYYYKCHKVPLLAAWQEL  239



>ref|XP_008474492.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Diaphorina citri]
Length=272

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 127/225 (56%), Gaps = 0/225 (0%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  266
            +D+S+FS + FD K WIN + ++   QD    ++ ++  KLQ+  +++   LEE++   +
Sbjct  1    MDISAFSSDNFDVKNWINESLKNVKDQDNKSVYVGNMVKKLQLYVQQVNSGLEEMNEQVV  60

Query  267  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  446
              +PR  RD   L  +A  L+  +S++ Q++   E ++  S+A+L ++D +K  + +A +
Sbjct  61   ASLPRIMRDANVLSQEAEMLQQKMSAVKQEIIDVEKNTRASMASLERIDKIKSELLSAKQ  120

Query  447  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  626
            +L +A   T +++ +E++F  GD+   A  + +M+ CL+ +    ++ + R QLE L+++
Sbjct  121  SLHEADNWTLMTTDIEEIFERGDIEGIAAKIVSMQQCLAVLTHTPDYEDKRLQLETLKNQ  180

Query  627  LDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVH  761
            L+++  P L  A +++ +D A +   I + + R   L   Y K  
Sbjct  181  LEAIASPHLVQAFTSKHLDDAHKFVRIFSSMERLPQLLSYYDKCQ  225



>gb|KGL78321.1| Conserved oligomeric Golgi complex subunit 7, partial [Tinamus 
guttatus]
Length=752

 Score =   120 bits (301),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 129/238 (54%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  + F+ K W+NGA ++     P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLADDFEVKSWVNGAFRAVQQDAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  R++  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRELEALKQEATFLKEQMVLVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A + + VD A+    +   I R   L   Y K H   +  +W+D 
Sbjct  181  NRLEAMASPQIVAAFNAQSVDQAKMFVKVFTEIDRMPQLLAYYYKCHKVQLVAVWQDL  238



>ref|XP_008559723.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Microplitis 
demolitor]
Length=771

 Score =   120 bits (301),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/221 (30%), Positives = 130/221 (59%), Gaps = 0/221 (0%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSASAL  266
            +D+++FS + F+ K WIN   +S   Q+  D ++  L MKLQ+  +++  ++E+ S S L
Sbjct  1    MDIAAFSKDDFNIKDWINKILESLDSQNDKDAYVGSLIMKLQLYVQQVNGNIEDTSQSVL  60

Query  267  HRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYE  446
              +PR  R+   L+ +A+SL+  +S +  ++ K E  ++ S+ +LAK+D +K  +E A +
Sbjct  61   ASLPRIFRETQLLQQEAVSLKDKMSVVKDEIAKIEKDTSLSINSLAKIDKIKCDLEKAKQ  120

Query  447  TLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDR  626
            +L +A   + L++ VED F +GD+   ++ + +M+  LS +    ++   + QLE L++R
Sbjct  121  SLHEADNWSVLANEVEDSFETGDIEMISKKIFSMQKSLSMLTNTIDYEEKKLQLEGLKNR  180

Query  627  LDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQY  749
            L+++  P+L  A + R ++ ++   +I  +I R   LE  Y
Sbjct  181  LEAIASPQLVQAFTTRNLEQSKVYVTIFTQISRLDQLEKYY  221



>ref|XP_006825808.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like, 
partial [Saccoglossus kowalevskii]
Length=207

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 113/197 (57%), Gaps = 7/197 (4%)
 Frame = +3

Query  90   DLSSFSDEKFDPKQWINGACQSRH--PQ--DPLDKHLVDLEMKLQMASEEIAVSLEELSA  257
            D S F D+ FD K+W+N A +++   PQ  D L   LV    KLQ+  +E+  SLEE S 
Sbjct  10   DFSKFLDDNFDVKEWVNAAFRTQRDTPQQKDALASTLV---TKLQLFIQEVNNSLEETSQ  66

Query  258  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  437
             AL   PR  RDV  +R +A  L+  +  + + ++K E  +A+S+  L ++D +K RM++
Sbjct  67   QALQNFPRVLRDVEAVRQEAAFLQEQMQMVKEDIKKVEQDTAQSMQMLLELDVIKSRMQS  126

Query  438  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  617
            A   L++A   T L + ++D+F S D+   A+ L  M+H LS +    ++    + LE L
Sbjct  127  ASSALKEADNWTTLMADIDDLFQSQDVHAIAKKLLAMQHSLSLLAHCGDYEERAQYLETL  186

Query  618  EDRLDSMVQPRLTDALS  668
            ++RL+++V P+L  A +
Sbjct  187  KNRLETLVSPQLITAFN  203



>ref|XP_010184345.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Mesitornis 
unicolor]
 gb|KFQ27417.1| Conserved oligomeric Golgi complex subunit 7 [Mesitornis unicolor]
Length=769

 Score =   120 bits (301),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 129/238 (54%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKSWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A +++ VD A+    +   I R   L   Y K H   +   W+D 
Sbjct  181  NRLEAMASPQIVAAFNSQSVDQAKTFVKVFTEIDRMPQLLAYYYKCHKVQLVAAWQDL  238



>ref|XP_009565762.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Cuculus canorus]
Length=768

 Score =   120 bits (301),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 128/238 (54%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  E F+ K W+N A ++     P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSEDFEVKGWVNAAFRAVQHDGPAKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEVIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTXDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A +++ +D A+    +   I R   L   Y K H   +   W+D 
Sbjct  181  NRLEAMASPQIVAAFNSQSIDQAKTFVKVFTEIDRMPQLLAYYYKCHKVQLVAAWQDL  238



>ref|XP_006027196.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Alligator 
sinensis]
Length=769

 Score =   120 bits (300),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/238 (29%), Positives = 128/238 (54%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  + F+ K W+NGA ++     P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLADDFEVKSWVNGAFRAGQQDAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  RD+  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDMEALKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+ F + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  SESLQEADKWSTLSADIEETFKTQDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL+++  P++    + +  D A+    +   I R   L   Y K H   +  +W+D 
Sbjct  181  NRLEALASPQIVATFNAQSADQAKVFVKVFTEIDRMPQLLAYYYKCHKVQLVAVWQDL  238



>ref|XP_006268482.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Alligator mississippiensis]
Length=771

 Score =   120 bits (300),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/238 (29%), Positives = 128/238 (54%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  + F+ K W+NGA ++     P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLADDFEVKSWVNGAFRAGQQDAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  RD+  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLRDMEALKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+ F + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETFKTQDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL+++  P++    + +  D A+    +   I R   L   Y K H   +  +W+D 
Sbjct  181  NRLEALASPQIVATFNAQSADQAKVFVKVFTEIDRMPQLLAYYYKCHKVQLVAVWQDL  238



>ref|XP_005351192.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Microtus 
ochrogaster]
Length=770

 Score =   120 bits (300),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/240 (30%), Positives = 131/240 (55%), Gaps = 5/240 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  254
            +D S F  + FD K WIN A ++  P+D +    D H  +L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLADDFDVKDWINAAFKAG-PKDGVAGKADGHAANLVMKLQLFIQEVNHAVEETS  59

Query  255  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  434
              AL  +P+  RDV  L+ +A  L+  +  + + +RK E  +++S+  L ++D VK RM+
Sbjct  60   LQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIRKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  435  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  614
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDVAVISAKLTGMQNSLVMLVDTPDYSEKCVHLEA  179

Query  615  LEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            L++RL+++  P++  A +++ VD ++    +   I R   L   Y K H   +   W++ 
Sbjct  180  LKNRLEALASPQIVAAFTSQSVDQSKVFVKVFTEIDRMPQLLAYYYKCHKVQLLATWQEL  239



>ref|XP_005054658.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Ficedula albicollis]
Length=769

 Score =   119 bits (299),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/238 (29%), Positives = 131/238 (55%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  ++F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDEFEVKGWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDQVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSLISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A +++ VD A+    +   I R   L   Y K H   +  +W++ 
Sbjct  181  NRLEAMASPQIVAAFNSQSVDQAKMFVKVFTEIDRMPQLLAYYYKCHKVQLVAVWQEL  238



>ref|XP_009089982.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Serinus 
canaria]
Length=769

 Score =   119 bits (298),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/238 (29%), Positives = 131/238 (55%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  ++F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDEFEVKGWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSLISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A +++ VD A+    +   I R   L   Y K H   +  +W++ 
Sbjct  181  NRLEAMASPQIVAAFNSQSVDQAKMFVKVFTEIDRMPQLLAYYYKCHKVQLVAVWQEL  238



>ref|XP_005523167.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Pseudopodoces 
humilis]
Length=769

 Score =   119 bits (298),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/238 (29%), Positives = 131/238 (55%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  ++F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDEFEVKGWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSLISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A +++ VD A+    +   I R   L   Y K H   +  +W++ 
Sbjct  181  NRLEAMASPQIVAAFNSQSVDQAKMFVKVFTEIDRMPQLLAYYYKCHKVQLVAVWQEL  238



>ref|XP_003418948.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Loxodonta 
africana]
Length=770

 Score =   119 bits (298),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 132/250 (53%), Gaps = 10/250 (4%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  254
            +D S F  + FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLADDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  255  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  434
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEIDQVKSRMQ  119

Query  435  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  614
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  615  LEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWE--  788
            L++RL+++  P++    S++ VD A+    I   I R   L   Y K H   +   W+  
Sbjct  180  LKNRLEALASPQIVTVFSSQSVDQAKMFVKIFTEIDRMPQLLAYYYKCHKVQLLATWQEL  239

Query  789  ---DFELRQQ  809
               D  L QQ
Sbjct  240  CQSDLSLDQQ  249



>ref|XP_004373515.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Trichechus 
manatus latirostris]
Length=770

 Score =   119 bits (298),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/240 (29%), Positives = 130/240 (54%), Gaps = 5/240 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  254
            +D S F  + FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLADDFDVKEWINAAFRAG-PKEAAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  255  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  434
              AL  +P+  RD+  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDIEALKQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEIDQVKSRMQ  119

Query  435  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  614
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAMISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  615  LEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            L++RL+++V P++     ++ +D A+    +   I R   L   Y K H   +  +W++ 
Sbjct  180  LKNRLEALVSPQIVAVFGSQSIDQAKAFVKVFTEIDRMPQLLAYYYKCHKVQLLAVWQEL  239



>ref|XP_010390549.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Corvus 
cornix cornix]
Length=769

 Score =   119 bits (298),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/238 (29%), Positives = 130/238 (55%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  ++F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDEFEVKGWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L  + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSLISAKLTSMQSSLGMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A +++ VD A+    +   I R   L   Y K H   +  +W++ 
Sbjct  181  NRLEAMASPQIVAAFNSQSVDQAKMFVKVFTEIDRMPQLLAYYYKCHKVHLVAVWQEL  238



>ref|XP_010568816.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Haliaeetus leucocephalus]
Length=728

 Score =   119 bits (297),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/227 (30%), Positives = 126/227 (56%), Gaps = 2/227 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKSWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  R+V  L+ +A  L+  ++ + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMTLVKEDIKKFEEDTAQSMQVLVEIDQVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVH  761
            +RL++M  P++  A +++ VD A+    +   I R   L   Y K H
Sbjct  181  NRLEAMASPQIVAAFNSQSVDQAKTFVKVFTEIDRMPQLLAYYYKCH  227



>ref|XP_004453849.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Dasypus 
novemcinctus]
Length=770

 Score =   119 bits (297),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 71/240 (30%), Positives = 131/240 (55%), Gaps = 5/240 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP----LDKHLVDLEMKLQMASEEIAVSLEELS  254
            +D S F  + FD K+WIN A ++  P++     +D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLADDFDVKEWINAAFRAG-PKEAAAGKVDGHAATLVMKLQVFIQEVNHAVEETS  59

Query  255  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  434
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEIDQVKSRMQ  119

Query  435  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  614
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  615  LEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            L++RL+++  P++  A +++ VD A+    +   I R   L   Y K H   +   W++ 
Sbjct  180  LKNRLEALASPQIVAAFNSQSVDQAKVFVKVFTAIDRMPQLLAYYYKCHKVQLLSTWQEL  239



>ref|XP_005054657.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Ficedula albicollis]
Length=776

 Score =   119 bits (297),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 69/238 (29%), Positives = 131/238 (55%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  ++F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDEFEVKGWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDQVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSLISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL++M  P++  A +++ VD A+    +   I R   L   Y K H   +  +W++ 
Sbjct  181  NRLEAMASPQIVAAFNSQSVDQAKMFVKVFTEIDRMPQLLAYYYKCHKVQLVAVWQEL  238



>ref|XP_002711891.2| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Oryctolagus 
cuniculus]
Length=847

 Score =   119 bits (297),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 130/240 (54%), Gaps = 5/240 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  254
            +D S F  + FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  78   MDFSKFLADDFDVKEWINAAFKAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  136

Query  255  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  434
              AL  +PR  RDV  L+ +A  L+  +  + + +RK E  +++S+  L ++D VK RM+
Sbjct  137  HQALQNMPRVLRDVEALKQEASFLKEQMILVKEDIRKFEQDTSQSMQVLVEIDQVKSRMQ  196

Query  435  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  614
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++     LE 
Sbjct  197  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLAMLVDTPDYSEKCVHLEA  256

Query  615  LEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            L++RL+++  P++  A + + VD ++    +   + R   L   Y K H   +   W++ 
Sbjct  257  LKNRLEALASPQIVAAFTTQSVDQSKAFVKVFTEVDRMPQLLAYYYKCHKVQLLTAWQEL  316



>ref|XP_007951381.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Orycteropus 
afer afer]
Length=731

 Score =   118 bits (295),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 73/240 (30%), Positives = 129/240 (54%), Gaps = 5/240 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  254
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  255  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  434
              AL  +PR  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+
Sbjct  60   HLALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTAQSMQVLVEIDQVKSRMQ  119

Query  435  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  614
             A E+LQ+A   + LS+ +E+ F + DL   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDLAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  615  LEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            L++RL+++  P++    S++ VD A+    +   + R   L   Y K H   +   W++ 
Sbjct  180  LKNRLEALASPQIVAVFSSQSVDQAKVFVKVFTDVDRMPQLLAYYYKCHKVRLLAAWQEL  239



>ref|XP_010621761.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Fukomys 
damarensis]
 gb|KFO33512.1| Conserved oligomeric Golgi complex subunit 7 [Fukomys damarensis]
Length=770

 Score =   118 bits (296),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 73/250 (29%), Positives = 135/250 (54%), Gaps = 10/250 (4%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  254
            +D S F  + FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE+S
Sbjct  1    MDFSKFLADDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEEMS  59

Query  255  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  434
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  435  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  614
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLTMLVDTPDYSEKCVHLEA  179

Query  615  LEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWE--  788
            L++RL+++  P++  A +++ VD ++    +   I R   L   Y K H   +   W+  
Sbjct  180  LKNRLEALASPQIVAAFTSQSVDQSKMFVKVFTEIDRMPQLLAYYYKCHKVQLLAAWQEL  239

Query  789  ---DFELRQQ  809
               D  L QQ
Sbjct  240  CQTDLPLAQQ  249



>ref|XP_005656829.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Sus scrofa]
Length=651

 Score =   117 bits (294),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 69/240 (29%), Positives = 131/240 (55%), Gaps = 5/240 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  254
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  255  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  434
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  435  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  614
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDVTVISAKLTGMQNSLTMLVDTPDYSEKCVHLEA  179

Query  615  LEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            L++RL+++  P++  A +++ +D ++    +   I R   L   Y K H   +   W++ 
Sbjct  180  LKNRLEALASPQIVAAFTSQSIDQSKVFVKVFTEIDRMPQLLAYYYKCHKVQLLAAWQEL  239



>ref|XP_005323804.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ictidomys 
tridecemlineatus]
Length=770

 Score =   118 bits (295),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 131/240 (55%), Gaps = 5/240 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  254
            +D S F  + FD K+WIN A ++  P+D      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLADDFDVKEWINAAFRAG-PKDSAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  255  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  434
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  435  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  614
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDITVISAKLTGMQNSLTMLVDTPDYSEKCVHLEA  179

Query  615  LEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            L++RL+++  P++  A +++ VD ++    +   I R   L   Y K H   +   W++ 
Sbjct  180  LKNRLEALASPQIVAAFTSQSVDQSKIFVKVFTEIDRMPQLLAYYYKCHKVQLLAAWQEL  239



>ref|XP_006872058.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Chrysochloris 
asiatica]
Length=770

 Score =   118 bits (295),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/240 (30%), Positives = 129/240 (54%), Gaps = 5/240 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  254
            +D S F  + FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLADDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  255  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  434
              AL  +P+  RDV  L+ +A  L+  +  I + ++K E  +A+S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKDQMILIKEDIKKFEQDTAQSMQVLVEIDQVKSRMQ  119

Query  435  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  614
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M+  L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTEMQISLMMLVDTPDYSEKCVHLEA  179

Query  615  LEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            L++RL+++  P++  A +++ VD A+    I   I R   L   Y K H   +   W++ 
Sbjct  180  LKNRLEAICSPQIVAAFNSQAVDQAKMFMKIFTEIDRMPQLLAYYYKCHKVQLLATWQEL  239



>ref|XP_008312851.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cynoglossus 
semilaevis]
Length=769

 Score =   117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/254 (28%), Positives = 133/254 (52%), Gaps = 6/254 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGA---CQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSA  257
            +D S F  + FD K+W+NGA    Q   P  P D H   L MKLQ+  +E+  ++EE S 
Sbjct  1    MDFSKFLGDDFDVKEWVNGAFKVVQKDVPGKP-DTHAATLVMKLQLFIQEVNNAIEESSN  59

Query  258  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  437
             AL  +PR  RDV  ++ +A  L+  +  + + ++K E  +  S+  L ++D +K RM+ 
Sbjct  60   QALQNMPRVLRDVDAVKQEASFLKEQMVLVKEDIQKFEQDTVRSMQVLVEIDQIKSRMQV  119

Query  438  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  617
            A + LQ+A   + LS+ +E+ F + D    +  L +M++ L+ + +  +++     LE L
Sbjct  120  AADALQEADKWSTLSADIEETFKTQDFAVISSKLTSMQNSLAMLVDTPDYSEKCVHLEAL  179

Query  618  EDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDFE  797
            ++RL+++  P++    +   +D A+    +   I R   L   Y K H   +  +W+  E
Sbjct  180  KNRLEALASPQIVGTFNLMSLDQAKLFVKVFTEIDRMPQLLAYYYKCHKGRLVSIWQ--E  237

Query  798  LRQQANKVSNEKNE  839
            L Q  + ++ + +E
Sbjct  238  LSQSEHSLNQQLSE  251



>ref|XP_006730882.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Leptonychotes 
weddellii]
Length=731

 Score =   117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/239 (29%), Positives = 128/239 (54%), Gaps = 3/239 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQ---DPLDKHLVDLEMKLQMASEEIAVSLEELSA  257
            +D S F  E FD K+WIN A ++   +      D H   L MKLQ+  +E+  ++EE S 
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRTGSKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETSH  60

Query  258  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  437
             AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+ 
Sbjct  61   QALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQL  120

Query  438  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  617
            A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE L
Sbjct  121  AAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEAL  180

Query  618  EDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            ++RL+++  P++  A +++ VD ++    +   I R   L   Y K H   +   W++ 
Sbjct  181  KNRLEALASPQIVAAFTSQSVDQSRVFVKVFTEIDRMPQLLTYYYKCHKAQLLAAWQEL  239



>ref|XP_004398866.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Odobenus 
rosmarus divergens]
Length=770

 Score =   117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/239 (29%), Positives = 128/239 (54%), Gaps = 3/239 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQ---DPLDKHLVDLEMKLQMASEEIAVSLEELSA  257
            +D S F  E FD K+WIN A ++   +      D H   L MKLQ+  +E+  ++EE S 
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRTGSKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETSH  60

Query  258  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  437
             AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+ 
Sbjct  61   QALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQL  120

Query  438  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  617
            A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE L
Sbjct  121  AAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEAL  180

Query  618  EDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            ++RL+++  P++  A +++ VD ++    +   I R   L   Y K H   +   W++ 
Sbjct  181  KNRLEALASPQIVAAFTSQSVDQSRVFVKVFTEIDRMPQLLTYYYKCHKAQLLAAWQEL  239



>ref|XP_011577715.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Aquila chrysaetos canadensis]
Length=728

 Score =   117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/227 (30%), Positives = 125/227 (55%), Gaps = 2/227 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDP--LDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  + F+ K W+N A ++   + P  +D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSRFLSDDFEVKSWVNAAFRAVQQEAPGKVDAHAATLVMKLQLFIQEVNNAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A
Sbjct  61   ALQNMPRVLREVEVLKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDQVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+   + D+   +  L +M+  L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETLKTQDVSVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVH  761
            +RL++M  P++  A +++ VD A+    +   I R   L   Y K H
Sbjct  181  NRLEAMASPQIVAAFNSQSVDQAKTFVKVFTEIDRMPQLLAYYYKCH  227



>ref|XP_007516677.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Erinaceus 
europaeus]
Length=759

 Score =   117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/238 (29%), Positives = 127/238 (53%), Gaps = 2/238 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGA--CQSRHPQDPLDKHLVDLEMKLQMASEEIAVSLEELSAS  260
            +D S F  E FD K+WIN A    S+      D H   L MKLQ+  +E+  ++EE S  
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAGSKEAAGKADGHAATLVMKLQLFIQEVNHAVEETSHQ  60

Query  261  ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  440
            AL  +P+  RDV  L+ +A  L+  +  + + +RK E  +++S+  L ++D VK RM+ A
Sbjct  61   ALQNMPKVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTSQSMQVLVEIDQVKSRMQLA  120

Query  441  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  620
             E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++     LE L+
Sbjct  121  AESLQEADKWSTLSADIEETFKTQDIGVISAKLTGMQNSLAMLVDTPQYSEKCVHLEALK  180

Query  621  DRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            +RL+++  P +  A +++ ++ ++    I   + R   L   Y K H   +   W++ 
Sbjct  181  NRLEALASPHIVAAFASQSLEQSRMFVKIFTEVDRMPQLLAYYYKGHKAQLFATWQEL  238



>ref|XP_006148372.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Tupaia 
chinensis]
Length=770

 Score =   117 bits (293),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/240 (29%), Positives = 131/240 (55%), Gaps = 5/240 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  254
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  255  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  434
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   LQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  435  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  614
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  615  LEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            L++RL+++  P++  A +++ VD ++    +   + R   L   Y K H   +  +W++ 
Sbjct  180  LKNRLEALASPQIVAAFTSQSVDQSKVFVKVFTEVDRMPQLLAYYYKCHKVQLLAVWQEL  239



>ref|XP_008695386.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Ursus maritimus]
Length=761

 Score =   117 bits (293),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/239 (29%), Positives = 128/239 (54%), Gaps = 3/239 (1%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQ---DPLDKHLVDLEMKLQMASEEIAVSLEELSA  257
            +D S F  E FD K+WIN A ++   +      D H   L MKLQ+  +E+  ++EE S 
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRTGSKEAAAGKADGHAATLVMKLQLFIQEVNHAVEETSH  60

Query  258  SALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEA  437
             AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+ 
Sbjct  61   QALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQL  120

Query  438  AYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  617
            A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE L
Sbjct  121  AAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEAL  180

Query  618  EDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            ++RL+++  P++  A +++ VD ++    +   I R   L   Y K H   +   W++ 
Sbjct  181  KNRLEALASPQIVAAFTSQSVDQSRVFVKVFTEIDRMPQLLAYYYKCHKAQLLAAWQEL  239



>ref|XP_005656828.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Sus scrofa]
Length=755

 Score =   117 bits (293),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/240 (29%), Positives = 131/240 (55%), Gaps = 5/240 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  254
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  255  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  434
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  435  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  614
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDVTVISAKLTGMQNSLTMLVDTPDYSEKCVHLEA  179

Query  615  LEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            L++RL+++  P++  A +++ +D ++    +   I R   L   Y K H   +   W++ 
Sbjct  180  LKNRLEALASPQIVAAFTSQSIDQSKVFVKVFTEIDRMPQLLAYYYKCHKVQLLAAWQEL  239



>ref|XP_007615834.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cricetulus 
griseus]
Length=770

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/240 (30%), Positives = 129/240 (54%), Gaps = 5/240 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  254
            +D S F  + FD K WIN A ++  P+D      D H   L MKLQ+  +E+  S+EE S
Sbjct  1    MDFSKFLADDFDVKDWINAAFRAG-PKDGAAGKADGHAATLVMKLQLFIQEVNHSVEETS  59

Query  255  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  434
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   LQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  435  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  614
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDVAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  615  LEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            L++RL+++  P++  A +++ VD ++    +   I R   L   Y K H   +   W++ 
Sbjct  180  LKNRLEALASPQIVAAFTSQSVDQSKVFVKVFTEIDRMPQLLAYYYKCHKVQLLAAWQEL  239



>gb|ELW66292.1| Conserved oligomeric Golgi complex subunit 7 [Tupaia chinensis]
Length=981

 Score =   117 bits (294),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/244 (29%), Positives = 132/244 (54%), Gaps = 5/244 (2%)
 Frame = +3

Query  75   GKMMVDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSL  242
            G   +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++
Sbjct  44   GGAAMDFSKFLAEDFDVKEWINAAFRA-GPKEAAAGKADGHAATLVMKLQLFIQEVNHAV  102

Query  243  EELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVK  422
            EE S  AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK
Sbjct  103  EETSLQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVK  162

Query  423  RRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRK  602
             RM+ A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++    
Sbjct  163  SRMQLAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCV  222

Query  603  QLEVLEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHL  782
             LE L++RL+++  P++  A +++ VD ++    +   + R   L   Y K H   +  +
Sbjct  223  HLEALKNRLEALASPQIVAAFTSQSVDQSKVFVKVFTEVDRMPQLLAYYYKCHKVQLLAV  282

Query  783  WEDF  794
            W++ 
Sbjct  283  WQEL  286



>ref|XP_006193181.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Camelus 
ferus]
Length=770

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 129/240 (54%), Gaps = 5/240 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  254
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAVKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  255  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  434
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  435  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  614
             A E+LQ+A   + LS+ +E+ F + D    +  L  M+  L+ + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDTAVISAKLTGMQTSLTMLADTPDYSEKCVHLEA  179

Query  615  LEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            L++RL+++  P++  A +++ VD ++    +   I R   L   Y K H   +   W++ 
Sbjct  180  LKNRLEALASPQIVAAFTSQSVDQSKVFVKVFTEIDRMPQLLAYYYKCHKVQLLAAWQEL  239



>ref|XP_003513853.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cricetulus 
griseus]
 gb|EGV91994.1| Conserved oligomeric Golgi complex subunit 7 [Cricetulus griseus]
Length=770

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/240 (30%), Positives = 129/240 (54%), Gaps = 5/240 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  254
            +D S F  + FD K WIN A ++  P+D      D H   L MKLQ+  +E+  S+EE S
Sbjct  1    MDFSKFLADDFDVKDWINAAFRAG-PKDGAAGKADGHAATLVMKLQLFIQEVNHSVEETS  59

Query  255  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  434
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   LQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  435  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  614
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDVAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  615  LEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            L++RL+++  P++  A +++ VD ++    +   I R   L   Y K H   +   W++ 
Sbjct  180  LKNRLEALASPQIVAAFTSQSVDQSKVFVKVFTEIDRMPQLLAYYYKCHKVQLLAAWQEL  239



>ref|XP_010959320.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Camelus 
bactrianus]
 ref|XP_010985220.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Camelus dromedarius]
Length=770

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 129/240 (54%), Gaps = 5/240 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  254
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAVKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  255  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  434
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  435  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  614
             A E+LQ+A   + LS+ +E+ F + D    +  L  M+  L+ + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDTAVISAKLTGMQTSLTMLADTPDYSEKCVHLEA  179

Query  615  LEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            L++RL+++  P++  A +++ VD ++    +   I R   L   Y K H   +   W++ 
Sbjct  180  LKNRLEALASPQIVAAFTSQSVDQSKVFVKVFTEIDRMPQLLAYYYKCHKVQLLAAWQEL  239



>ref|XP_001418731.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97024.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=816

 Score =   117 bits (293),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 83/254 (33%), Positives = 138/254 (54%), Gaps = 30/254 (12%)
 Frame = +3

Query  93   LSSFSDEKFDPKQWIN-----------GACQSRHPQD-------------------PLDK  182
            L  FS + FD  +WIN           G+ +    +D                   PL++
Sbjct  12   LRDFSSDDFDRVRWINEQTRARIGDAGGSGRDATARDGSAVVARAVGEGTRGTSASPLER  71

Query  183  HLVDLEMKLQMASEEIAVSLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLR  362
             L DLE++LQ+  E++++SLEE S   + RVP+A +++  +      L   V  IL +L 
Sbjct  72   FLADLELQLQLLGEDLSMSLEERSREGVARVPKAVKEIEVVEGRVKRLHEEVRGILDRLD  131

Query  363  KAEGSSAESVATLAKVDTVKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLA  542
            + E  S  SV  L ++D  K+RME+A ETLQ+A GL  L ++V+ +F+SG++   +E+LA
Sbjct  132  EVESESRASVEALRQLDAAKQRMESARETLQEANGLADLMASVDGIFASGNIRNMSESLA  191

Query  543  NMRHCLSAVGEVAEFANIRKQLEVLEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIG  722
             M+  L+ VG+V EFA+ + ++   E +L+++V+P L  AL ++    A+E R +L   G
Sbjct  192  RMKRGLAVVGDVPEFADGQDKVNAFEHKLEAIVRPALITALESQNSTAAREHRDVLRTTG  251

Query  723  RFKSLELQYSKVHL  764
            R  +LE  Y+   +
Sbjct  252  RGSALESIYADTRV  265



>ref|XP_006201263.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Vicugna 
pacos]
Length=770

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 130/240 (54%), Gaps = 5/240 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  254
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAVKADGHAATLVMKLQLFIQEVNHAVEETS  59

Query  255  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  434
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  435  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  614
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M+  L+ + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQTSLTMLVDTPDYSEKCVHLEA  179

Query  615  LEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            L++RL+++  P++  A +++ VD ++    +   I R   L   Y K H   +   W++ 
Sbjct  180  LKNRLEALASPQIVAAFTSQSVDQSKVFVKVFTEIDRMPQLLAYYYKCHKVQLLAAWQEL  239



>ref|XP_007450043.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Lipotes 
vexillifer]
Length=770

 Score =   117 bits (292),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 74/250 (30%), Positives = 133/250 (53%), Gaps = 10/250 (4%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQD----PLDKHLVDLEMKLQMASEEIAVSLEELS  254
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRA-GPKEVAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  255  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  434
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  435  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  614
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  615  LEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWE--  788
            L++RL+++  P++  A +++ VD ++    +   I R   L   Y K H   +   W+  
Sbjct  180  LKNRLEALASPQIVAAFTSQSVDQSKVFVKVFTEIDRMPQLLAYYYKCHKVQLLAAWQEL  239

Query  789  ---DFELRQQ  809
               D  L QQ
Sbjct  240  CQTDLPLDQQ  249



>ref|XP_004020887.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Ovis aries]
 ref|XP_012008216.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Ovis aries musimon]
Length=770

 Score =   117 bits (292),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/240 (29%), Positives = 131/240 (55%), Gaps = 5/240 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  254
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  255  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  434
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  435  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  614
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  615  LEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            L++RL+++  P++  A +++ +D ++    + + I R   L   Y K H   +   W++ 
Sbjct  180  LKNRLEALASPQIVAAFTSQSIDQSKMFVKVFSEIDRMPQLLAYYYKCHKVQLLAAWQEL  239



>ref|XP_005697660.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Capra 
hircus]
Length=770

 Score =   117 bits (292),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/240 (29%), Positives = 131/240 (55%), Gaps = 5/240 (2%)
 Frame = +3

Query  87   VDLSSFSDEKFDPKQWINGACQSRHPQDPL----DKHLVDLEMKLQMASEEIAVSLEELS  254
            +D S F  E FD K+WIN A ++  P++      D H   L MKLQ+  +E+  ++EE S
Sbjct  1    MDFSKFLAEDFDVKEWINAAFRAG-PKEAAAGKADSHAATLVMKLQLFIQEVNHAVEETS  59

Query  255  ASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRME  434
              AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D VK RM+
Sbjct  60   HQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQ  119

Query  435  AAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEV  614
             A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++     LE 
Sbjct  120  LAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEKCVHLEA  179

Query  615  LEDRLDSMVQPRLTDALSNRKVDVAQEMRSILNRIGRFKSLELQYSKVHLKPIKHLWEDF  794
            L++RL+++  P++  A +++ +D ++    + + I R   L   Y K H   +   W++ 
Sbjct  180  LKNRLEALASPQIVAAFTSQSIDQSKMFVKVFSEIDRMPQLLAYYYKCHKVQLLAAWQEL  239



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2241263107768