BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3592

Length=783
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010665155.1|  PREDICTED: polypyrimidine tract-binding prot...    427   3e-148   
ref|XP_010665151.1|  PREDICTED: polypyrimidine tract-binding prot...    428   9e-146   Vitis vinifera
ref|XP_009597471.1|  PREDICTED: polypyrimidine tract-binding prot...    422   1e-143   Nicotiana tomentosiformis
emb|CDP17953.1|  unnamed protein product                                421   3e-143   Coffea canephora [robusta coffee]
ref|XP_009768478.1|  PREDICTED: polypyrimidine tract-binding prot...    424   2e-142   Nicotiana sylvestris
ref|XP_007151988.1|  hypothetical protein PHAVU_004G092400g             419   2e-142   Phaseolus vulgaris [French bean]
ref|XP_009621582.1|  PREDICTED: polypyrimidine tract-binding prot...    419   2e-142   Nicotiana tomentosiformis
gb|KCW69168.1|  hypothetical protein EUGRSUZ_F02695                     415   2e-142   Eucalyptus grandis [rose gum]
gb|KCW69167.1|  hypothetical protein EUGRSUZ_F02695                     415   4e-142   Eucalyptus grandis [rose gum]
ref|XP_009765394.1|  PREDICTED: polypyrimidine tract-binding prot...    418   8e-142   Nicotiana sylvestris
ref|XP_006473079.1|  PREDICTED: polypyrimidine tract-binding prot...    418   8e-142   Citrus sinensis [apfelsine]
ref|XP_008463064.1|  PREDICTED: polypyrimidine tract-binding prot...    418   8e-142   Cucumis melo [Oriental melon]
ref|XP_007019550.1|  Polypyrimidine tract-binding protein 3             427   1e-141   
ref|XP_006434490.1|  hypothetical protein CICLE_v10001148mg             417   1e-141   
ref|XP_003518587.1|  PREDICTED: polypyrimidine tract-binding prot...    417   2e-141   Glycine max [soybeans]
ref|XP_003548101.1|  PREDICTED: polypyrimidine tract-binding prot...    416   2e-141   
ref|XP_011078771.1|  PREDICTED: polypyrimidine tract-binding prot...    416   3e-141   Sesamum indicum [beniseed]
ref|XP_010062097.1|  PREDICTED: polypyrimidine tract-binding prot...    416   3e-141   
ref|XP_011656467.1|  PREDICTED: polypyrimidine tract-binding prot...    416   3e-141   Cucumis sativus [cucumbers]
gb|KHN00751.1|  Polypyrimidine tract-binding protein like 3             415   8e-141   Glycine soja [wild soybean]
ref|XP_002302167.2|  polypyrimidine tract-binding family protein        414   2e-140   Populus trichocarpa [western balsam poplar]
ref|NP_001274797.1|  polypyrimidine tract-binding protein homolog...    414   2e-140   Solanum tuberosum [potatoes]
ref|XP_011042880.1|  PREDICTED: polypyrimidine tract-binding prot...    414   2e-140   Populus euphratica
ref|XP_009336734.1|  PREDICTED: polypyrimidine tract-binding prot...    414   2e-140   Pyrus x bretschneideri [bai li]
ref|XP_004252004.1|  PREDICTED: polypyrimidine tract-binding prot...    414   2e-140   Solanum lycopersicum
ref|XP_009336732.1|  PREDICTED: polypyrimidine tract-binding prot...    414   2e-140   Pyrus x bretschneideri [bai li]
ref|XP_012080721.1|  PREDICTED: polypyrimidine tract-binding prot...    414   2e-140   Jatropha curcas
gb|ACI43571.1|  RBP50                                                   414   3e-140   Cucurbita maxima [Boston marrow]
ref|XP_008369222.1|  PREDICTED: polypyrimidine tract-binding prot...    414   3e-140   
ref|XP_012080720.1|  PREDICTED: polypyrimidine tract-binding prot...    413   4e-140   Jatropha curcas
ref|XP_008237510.1|  PREDICTED: polypyrimidine tract-binding prot...    413   5e-140   Prunus mume [ume]
ref|XP_007201036.1|  hypothetical protein PRUPE_ppa005775mg             413   5e-140   Prunus persica
gb|EYU20662.1|  hypothetical protein MIMGU_mgv1a006642mg                411   3e-139   Erythranthe guttata [common monkey flower]
ref|XP_006386305.1|  hypothetical protein POPTR_0002s06660g             411   4e-139   Populus trichocarpa [western balsam poplar]
ref|XP_007143560.1|  hypothetical protein PHAVU_007G081900g             410   5e-139   Phaseolus vulgaris [French bean]
ref|XP_011042879.1|  PREDICTED: polypyrimidine tract-binding prot...    410   8e-139   Populus euphratica
ref|XP_006434492.1|  hypothetical protein CICLE_v10001148mg             410   8e-139   Citrus clementina [clementine]
gb|KJB28976.1|  hypothetical protein B456_005G078200                    410   9e-139   Gossypium raimondii
ref|XP_006473080.1|  PREDICTED: polypyrimidine tract-binding prot...    410   9e-139   Citrus sinensis [apfelsine]
gb|KHG00384.1|  hypothetical protein F383_17340                         410   1e-138   Gossypium arboreum [tree cotton]
ref|XP_012080719.1|  PREDICTED: polypyrimidine tract-binding prot...    410   1e-138   
ref|XP_003536416.1|  PREDICTED: polypyrimidine tract-binding prot...    409   1e-138   Glycine max [soybeans]
gb|KCW71107.1|  hypothetical protein EUGRSUZ_F04205                     404   3e-138   Eucalyptus grandis [rose gum]
ref|NP_001242751.1|  uncharacterized protein LOC100819672               407   5e-138   
ref|XP_006605400.1|  PREDICTED: uncharacterized protein LOC100819...    408   6e-138   
ref|XP_010260994.1|  PREDICTED: polypyrimidine tract-binding prot...    408   7e-138   Nelumbo nucifera [Indian lotus]
gb|KHN46405.1|  Polypyrimidine tract-binding protein like 3             408   7e-138   Glycine soja [wild soybean]
ref|XP_010063840.1|  PREDICTED: polypyrimidine tract-binding prot...    407   1e-137   Eucalyptus grandis [rose gum]
ref|XP_004290497.1|  PREDICTED: polypyrimidine tract-binding prot...    407   1e-137   Fragaria vesca subsp. vesca
ref|XP_011044257.1|  PREDICTED: polypyrimidine tract-binding prot...    405   5e-137   Populus euphratica
ref|XP_010246265.1|  PREDICTED: polypyrimidine tract-binding prot...    405   8e-137   Nelumbo nucifera [Indian lotus]
ref|XP_006351367.1|  PREDICTED: polypyrimidine tract-binding prot...    405   1e-136   
ref|XP_011044256.1|  PREDICTED: polypyrimidine tract-binding prot...    404   3e-136   Populus euphratica
ref|XP_010260993.1|  PREDICTED: polypyrimidine tract-binding prot...    404   3e-136   Nelumbo nucifera [Indian lotus]
gb|AEG89704.1|  polypyrimidine tract-binding protein 6                  403   7e-136   Solanum tuberosum [potatoes]
ref|XP_008384421.1|  PREDICTED: LOW QUALITY PROTEIN: polypyrimidi...    401   1e-135   
ref|XP_011044254.1|  PREDICTED: polypyrimidine tract-binding prot...    401   2e-135   Populus euphratica
ref|XP_011044253.1|  PREDICTED: polypyrimidine tract-binding prot...    399   1e-134   Populus euphratica
ref|XP_004249306.1|  PREDICTED: polypyrimidine tract-binding prot...    400   1e-134   Solanum lycopersicum
emb|CBI21552.3|  unnamed protein product                                396   2e-134   Vitis vinifera
ref|XP_002306709.2|  hypothetical protein POPTR_0005s21660g             401   3e-134   
ref|XP_002277938.2|  PREDICTED: polypyrimidine tract-binding prot...    397   9e-134   Vitis vinifera
emb|CAN82466.1|  hypothetical protein VITISV_002663                     398   2e-133   Vitis vinifera
ref|XP_003592082.1|  Polypyrimidine tract-binding protein-like pr...    396   3e-133   Medicago truncatula
ref|XP_010681101.1|  PREDICTED: polypyrimidine tract-binding prot...    395   1e-132   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010912014.1|  PREDICTED: polypyrimidine tract-binding prot...    395   1e-132   Elaeis guineensis
ref|XP_010912015.1|  PREDICTED: polypyrimidine tract-binding prot...    394   1e-132   Elaeis guineensis
ref|XP_010927400.1|  PREDICTED: polypyrimidine tract-binding prot...    394   2e-132   Elaeis guineensis
ref|XP_006395995.1|  hypothetical protein EUTSA_v10004261mg             392   5e-132   Eutrema salsugineum [saltwater cress]
ref|XP_009385102.1|  PREDICTED: polypyrimidine tract-binding prot...    393   6e-132   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008785843.1|  PREDICTED: polypyrimidine tract-binding prot...    392   8e-132   
ref|XP_002893943.1|  predicted protein                                  391   2e-131   Arabidopsis lyrata subsp. lyrata
ref|XP_010527313.1|  PREDICTED: polypyrimidine tract-binding prot...    390   5e-131   Tarenaya hassleriana [spider flower]
ref|XP_010461394.1|  PREDICTED: polypyrimidine tract-binding prot...    390   6e-131   Camelina sativa [gold-of-pleasure]
ref|XP_010479003.1|  PREDICTED: polypyrimidine tract-binding prot...    390   6e-131   Camelina sativa [gold-of-pleasure]
ref|XP_010479002.1|  PREDICTED: polypyrimidine tract-binding prot...    390   6e-131   
ref|XP_010500100.1|  PREDICTED: polypyrimidine tract-binding prot...    390   7e-131   Camelina sativa [gold-of-pleasure]
ref|XP_004496454.1|  PREDICTED: polypyrimidine tract-binding prot...    390   8e-131   
ref|NP_175010.2|  polypyrimidine tract-binding protein 3                389   2e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004496452.1|  PREDICTED: polypyrimidine tract-binding prot...    390   3e-130   
ref|XP_008793925.1|  PREDICTED: polypyrimidine tract-binding prot...    388   3e-130   Phoenix dactylifera
ref|XP_009393413.1|  PREDICTED: polypyrimidine tract-binding prot...    388   4e-130   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010527312.1|  PREDICTED: polypyrimidine tract-binding prot...    387   8e-130   Tarenaya hassleriana [spider flower]
ref|XP_010533404.1|  PREDICTED: polypyrimidine tract-binding prot...    386   2e-129   Tarenaya hassleriana [spider flower]
emb|CDY36013.1|  BnaA08g04480D                                          385   3e-129   Brassica napus [oilseed rape]
ref|XP_010533402.1|  PREDICTED: polypyrimidine tract-binding prot...    385   3e-129   Tarenaya hassleriana [spider flower]
emb|CDY47859.1|  BnaCnng15550D                                          385   7e-129   Brassica napus [oilseed rape]
ref|XP_003619162.1|  Polypyrimidine tract-binding protein-like pr...    381   1e-128   
ref|XP_010533403.1|  PREDICTED: polypyrimidine tract-binding prot...    383   2e-128   Tarenaya hassleriana [spider flower]
ref|XP_010533405.1|  PREDICTED: polypyrimidine tract-binding prot...    383   5e-128   Tarenaya hassleriana [spider flower]
ref|XP_010533406.1|  PREDICTED: polypyrimidine tract-binding prot...    382   5e-128   Tarenaya hassleriana [spider flower]
gb|KGN45884.1|  hypothetical protein Csa_6G017000                       382   9e-128   Cucumis sativus [cucumbers]
ref|XP_009107488.1|  PREDICTED: polypyrimidine tract-binding prot...    380   2e-127   Brassica rapa
ref|NP_001266083.1|  polypyrimidine tract-binding protein homolog...    380   4e-127   Cicer arietinum [garbanzo]
gb|EPS74228.1|  hypothetical protein M569_00523                         380   5e-127   Genlisea aurea
gb|AES75380.2|  polypyrimidine tract-binding-like protein               380   6e-127   Medicago truncatula
ref|XP_006303776.1|  hypothetical protein CARUB_v10012016mg             379   6e-127   
ref|NP_001077673.1|  polypyrimidine tract-binding protein 3             378   2e-126   Arabidopsis thaliana [mouse-ear cress]
gb|ERN15979.1|  hypothetical protein AMTR_s00175p00061780               380   3e-126   Amborella trichopoda
ref|XP_010106865.1|  Polypyrimidine tract-binding protein-3-like ...    379   5e-126   
ref|XP_009411926.1|  PREDICTED: polypyrimidine tract-binding prot...    377   6e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011627104.1|  PREDICTED: polypyrimidine tract-binding prot...    377   8e-126   
ref|XP_011627103.1|  PREDICTED: polypyrimidine tract-binding prot...    377   8e-126   Amborella trichopoda
ref|XP_002524303.1|  polypyrimidine tract binding protein, putative     375   5e-125   
gb|KHG00385.1|  hypothetical protein F383_17340                         363   3e-120   Gossypium arboreum [tree cotton]
ref|XP_010927403.1|  PREDICTED: polypyrimidine tract-binding prot...    358   1e-118   
ref|XP_011622853.1|  PREDICTED: polypyrimidine tract-binding prot...    358   3e-118   
ref|XP_006842980.1|  PREDICTED: polypyrimidine tract-binding prot...    358   4e-118   Amborella trichopoda
ref|XP_011622852.1|  PREDICTED: polypyrimidine tract-binding prot...    358   4e-118   
ref|XP_010680298.1|  PREDICTED: polypyrimidine tract-binding prot...    355   2e-117   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009411927.1|  PREDICTED: polypyrimidine tract-binding prot...    352   4e-116   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW81821.1|  hypothetical protein ZEAMMB73_476847                    348   4e-116   
emb|CBH32581.1|  RNA recognition domain containing protein              345   1e-115   Triticum aestivum [Canadian hard winter wheat]
gb|KJB28978.1|  hypothetical protein B456_005G078200                    349   3e-115   Gossypium raimondii
ref|NP_001169470.1|  uncharacterized protein LOC100383343               349   8e-115   Zea mays [maize]
gb|AFW68313.1|  hypothetical protein ZEAMMB73_143783                    342   8e-115   
ref|NP_001055652.1|  Os05g0437300                                       348   1e-114   
ref|XP_009621583.1|  PREDICTED: polypyrimidine tract-binding prot...    347   1e-114   Nicotiana tomentosiformis
ref|XP_002441164.1|  hypothetical protein SORBIDRAFT_09g021560          348   2e-114   Sorghum bicolor [broomcorn]
ref|XP_004961956.1|  PREDICTED: polypyrimidine tract-binding prot...    347   3e-114   Setaria italica
ref|XP_003568375.1|  PREDICTED: polypyrimidine tract-binding prot...    347   4e-114   Brachypodium distachyon [annual false brome]
ref|XP_008655270.1|  PREDICTED: uncharacterized protein LOC100383...    350   4e-114   
ref|XP_008644687.1|  PREDICTED: polypyrimidine tract-binding prot...    347   6e-114   
ref|XP_006654460.1|  PREDICTED: polypyrimidine tract-binding prot...    347   6e-114   Oryza brachyantha
emb|CBH32582.1|  RNA recognition domain containing protein,expressed    347   6e-114   Triticum aestivum [Canadian hard winter wheat]
gb|EEC71864.1|  hypothetical protein OsI_04570                          346   9e-114   Oryza sativa Indica Group [Indian rice]
gb|AFW78165.1|  hypothetical protein ZEAMMB73_011466                    346   9e-114   
ref|XP_003564696.1|  PREDICTED: polypyrimidine tract-binding prot...    345   2e-113   Brachypodium distachyon [annual false brome]
gb|EMT30091.1|  Polypyrimidine tract-binding protein-3-like protein     347   3e-113   
ref|XP_006665040.1|  PREDICTED: polypyrimidine tract-binding prot...    344   5e-113   Oryza brachyantha
gb|EMS55211.1|  Polypyrimidine tract-binding protein-like protein 3     347   8e-113   Triticum urartu
ref|XP_010232611.1|  PREDICTED: polypyrimidine tract-binding prot...    344   1e-112   Brachypodium distachyon [annual false brome]
gb|KEH25911.1|  polypyrimidine tract-binding-like protein               338   3e-112   Medicago truncatula
ref|XP_006654459.1|  PREDICTED: polypyrimidine tract-binding prot...    342   4e-112   Oryza brachyantha
ref|XP_008644686.1|  PREDICTED: polypyrimidine tract-binding prot...    342   4e-112   
gb|ADE76165.1|  unknown                                                 341   1e-111   Picea sitchensis
gb|AIZ74340.1|  polypyrimidine tract-binding protein                    340   3e-111   Pinus massoniana [Chinese red pine]
gb|KDP30748.1|  hypothetical protein JCGZ_15177                         335   1e-109   Jatropha curcas
ref|NP_001044916.1|  Os01g0867800                                       335   2e-109   
ref|XP_003632518.1|  PREDICTED: polypyrimidine tract-binding prot...    333   5e-109   
gb|ADE75620.1|  unknown                                                 330   5e-107   Picea sitchensis
ref|XP_003592083.1|  Polypyrimidine tract-binding protein-like pr...    325   8e-106   
ref|XP_001761356.1|  predicted protein                                  322   3e-104   
ref|XP_003619163.1|  Polypyrimidine tract-binding protein-like pr...    314   8e-103   
ref|XP_002973098.1|  hypothetical protein SELMODRAFT_173175             318   1e-102   
ref|XP_001759167.1|  predicted protein                                  273   2e-85    
ref|NP_001169809.1|  uncharacterized protein LOC100383701               264   2e-82    Zea mays [maize]
gb|EMS57308.1|  Polypyrimidine tract-binding protein-like protein 3     242   1e-74    Triticum urartu
gb|AAV59307.1|  putative polypyrimidine track-binding protein           225   3e-67    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006386304.1|  hypothetical protein POPTR_0002s06660g             200   2e-58    
gb|EFA84392.1|  RNA-binding region RNP-1 domain-containing protein      203   4e-58    Heterostelium album PN500
ref|XP_004368076.1|  hnRNPL/PTB/hephaestus splicing factor subfam...    199   7e-56    Acanthamoeba castellanii str. Neff
dbj|GAM28251.1|  hypothetical protein SAMD00019534_114270               198   2e-55    Acytostelium subglobosum LB1
ref|XP_008560050.1|  PREDICTED: polypyrimidine tract-binding prot...    197   4e-55    
ref|XP_011310459.1|  PREDICTED: polypyrimidine tract-binding prot...    197   7e-55    Fopius arisanus
dbj|GAM25404.1|  hypothetical protein SAMD00019534_085790               192   6e-54    Acytostelium subglobosum LB1
ref|XP_008345274.1|  PREDICTED: polypyrimidine tract-binding prot...    181   1e-53    
ref|XP_008560051.1|  PREDICTED: polypyrimidine tract-binding prot...    192   2e-53    Microplitis demolitor
ref|XP_011175574.1|  PREDICTED: polypyrimidine tract-binding prot...    193   2e-53    
ref|XP_008560049.1|  PREDICTED: polypyrimidine tract-binding prot...    192   4e-53    Microplitis demolitor
ref|XP_008560046.1|  PREDICTED: polypyrimidine tract-binding prot...    192   4e-53    
ref|XP_008560048.1|  PREDICTED: polypyrimidine tract-binding prot...    192   4e-53    
ref|XP_004354746.1|  RNA-binding region RNP-1 domain-containing p...    192   7e-53    Cavenderia fasciculata
gb|ELU04990.1|  hypothetical protein CAPTEDRAFT_200421                  189   1e-52    Capitella teleta
gb|KFM66418.1|  Polypyrimidine tract-binding protein 2                  188   3e-52    Stegodyphus mimosarum
ref|XP_001842351.1|  polypyrimidine tract binding protein               189   3e-52    Culex quinquefasciatus
ref|XP_001636058.1|  predicted protein                                  187   3e-52    Nematostella vectensis
ref|XP_011645100.1|  PREDICTED: polypyrimidine tract-binding prot...    189   5e-52    Pogonomyrmex barbatus
ref|XP_008401682.1|  PREDICTED: polypyrimidine tract-binding prot...    186   6e-52    
dbj|BAO03403.1|  polypyrimidine tract binding protein 1b splicing...    184   6e-52    Oryzias latipes [Japanese rice fish]
ref|XP_001848742.1|  polypyrimidine tract binding protein               189   7e-52    Culex quinquefasciatus
ref|XP_012139258.1|  PREDICTED: polypyrimidine tract-binding prot...    188   7e-52    Megachile rotundata
ref|XP_012139257.1|  PREDICTED: polypyrimidine tract-binding prot...    188   8e-52    Megachile rotundata
ref|XP_012139256.1|  PREDICTED: polypyrimidine tract-binding prot...    188   1e-51    Megachile rotundata
ref|XP_012139255.1|  PREDICTED: polypyrimidine tract-binding prot...    188   1e-51    Megachile rotundata
ref|XP_012139254.1|  PREDICTED: polypyrimidine tract-binding prot...    188   1e-51    Megachile rotundata
ref|XP_012139253.1|  PREDICTED: polypyrimidine tract-binding prot...    188   1e-51    Megachile rotundata
ref|XP_010753398.1|  PREDICTED: polypyrimidine tract-binding prot...    186   2e-51    
ref|XP_010753397.1|  PREDICTED: polypyrimidine tract-binding prot...    186   3e-51    
ref|XP_010753396.1|  PREDICTED: polypyrimidine tract-binding prot...    186   3e-51    
ref|XP_007569508.1|  PREDICTED: LOW QUALITY PROTEIN: polypyrimidi...    186   6e-51    
ref|XP_008212882.1|  PREDICTED: polypyrimidine tract-binding prot...    185   9e-51    
ref|XP_008212881.1|  PREDICTED: polypyrimidine tract-binding prot...    186   9e-51    
ref|XP_008212880.1|  PREDICTED: polypyrimidine tract-binding prot...    186   1e-50    
ref|XP_008283570.1|  PREDICTED: polypyrimidine tract-binding prot...    184   1e-50    Stegastes partitus
ref|XP_008212884.1|  PREDICTED: polypyrimidine tract-binding prot...    185   1e-50    
ref|XP_008212883.1|  PREDICTED: polypyrimidine tract-binding prot...    185   1e-50    
ref|XP_008212875.1|  PREDICTED: polypyrimidine tract-binding prot...    185   1e-50    Nasonia vitripennis
ref|XP_008212879.1|  PREDICTED: polypyrimidine tract-binding prot...    185   1e-50    Nasonia vitripennis
ref|XP_007075804.1|  PREDICTED: polypyrimidine tract-binding prot...    181   1e-50    
ref|XP_006610361.1|  PREDICTED: polypyrimidine tract-binding prot...    185   1e-50    Apis dorsata [rock honeybee]
ref|XP_001603240.2|  PREDICTED: polypyrimidine tract-binding prot...    185   1e-50    
ref|XP_008212870.1|  PREDICTED: polypyrimidine tract-binding prot...    185   2e-50    Nasonia vitripennis
ref|XP_008212874.1|  PREDICTED: polypyrimidine tract-binding prot...    185   2e-50    
ref|XP_006610363.1|  PREDICTED: polypyrimidine tract-binding prot...    184   2e-50    Apis dorsata [rock honeybee]
ref|XP_006610365.1|  PREDICTED: polypyrimidine tract-binding prot...    184   2e-50    Apis dorsata [rock honeybee]
ref|XP_006610362.1|  PREDICTED: polypyrimidine tract-binding prot...    184   2e-50    Apis dorsata [rock honeybee]
ref|XP_006610359.1|  PREDICTED: polypyrimidine tract-binding prot...    185   2e-50    Apis dorsata [rock honeybee]
ref|XP_008283569.1|  PREDICTED: polypyrimidine tract-binding prot...    184   2e-50    Stegastes partitus
ref|XP_006610360.1|  PREDICTED: polypyrimidine tract-binding prot...    184   2e-50    Apis dorsata [rock honeybee]
ref|XP_008283568.1|  PREDICTED: polypyrimidine tract-binding prot...    184   2e-50    Stegastes partitus
ref|XP_008212871.1|  PREDICTED: polypyrimidine tract-binding prot...    185   2e-50    Nasonia vitripennis
ref|XP_003401618.1|  PREDICTED: polypyrimidine tract-binding prot...    185   2e-50    Bombus terrestris [large earth bumblebee]
ref|XP_005470623.1|  PREDICTED: polypyrimidine tract-binding prot...    183   2e-50    Oreochromis niloticus
ref|XP_003693343.1|  PREDICTED: polypyrimidine tract-binding prot...    184   2e-50    Apis florea [dwarf honeybee]
ref|XP_003491847.1|  PREDICTED: polypyrimidine tract-binding prot...    184   2e-50    
ref|XP_006610358.1|  PREDICTED: polypyrimidine tract-binding prot...    184   3e-50    Apis dorsata [rock honeybee]
ref|XP_008283567.1|  PREDICTED: polypyrimidine tract-binding prot...    184   3e-50    Stegastes partitus
ref|XP_011472629.1|  PREDICTED: polypyrimidine tract-binding prot...    183   3e-50    Oryzias latipes [Japanese rice fish]
ref|XP_008183515.1|  PREDICTED: polypyrimidine tract-binding prot...    185   3e-50    Acyrthosiphon pisum
ref|XP_006610356.1|  PREDICTED: polypyrimidine tract-binding prot...    184   4e-50    Apis dorsata [rock honeybee]
ref|XP_006610357.1|  PREDICTED: polypyrimidine tract-binding prot...    184   4e-50    Apis dorsata [rock honeybee]
gb|ELV09317.1|  Polypyrimidine tract-binding protein 1                  183   4e-50    Tupaia chinensis
ref|XP_006610353.1|  PREDICTED: polypyrimidine tract-binding prot...    184   4e-50    Apis dorsata [rock honeybee]
ref|XP_006610354.1|  PREDICTED: polypyrimidine tract-binding prot...    184   4e-50    Apis dorsata [rock honeybee]
ref|XP_006610355.1|  PREDICTED: polypyrimidine tract-binding prot...    184   5e-50    Apis dorsata [rock honeybee]
ref|XP_006815130.1|  PREDICTED: polypyrimidine tract-binding prot...    184   5e-50    Saccoglossus kowalevskii
ref|XP_011472630.1|  PREDICTED: polypyrimidine tract-binding prot...    183   5e-50    
ref|XP_011472627.1|  PREDICTED: polypyrimidine tract-binding prot...    183   5e-50    
ref|XP_011472628.1|  PREDICTED: polypyrimidine tract-binding prot...    183   6e-50    
ref|XP_006815129.1|  PREDICTED: polypyrimidine tract-binding prot...    184   6e-50    Saccoglossus kowalevskii
ref|XP_011472626.1|  PREDICTED: polypyrimidine tract-binding prot...    183   7e-50    
ref|XP_011495872.1|  PREDICTED: polypyrimidine tract-binding prot...    183   7e-50    Ceratosolen solmsi marchali
ref|XP_010865898.1|  PREDICTED: polypyrimidine tract-binding prot...    178   7e-50    
ref|XP_011495870.1|  PREDICTED: polypyrimidine tract-binding prot...    183   1e-49    Ceratosolen solmsi marchali
ref|XP_011495869.1|  PREDICTED: polypyrimidine tract-binding prot...    183   1e-49    Ceratosolen solmsi marchali
ref|XP_006803670.1|  PREDICTED: polypyrimidine tract-binding prot...    181   1e-49    Neolamprologus brichardi [lyretail cichlid]
ref|XP_011495871.1|  PREDICTED: polypyrimidine tract-binding prot...    182   1e-49    Ceratosolen solmsi marchali
ref|XP_006803669.1|  PREDICTED: polypyrimidine tract-binding prot...    181   2e-49    Neolamprologus brichardi [lyretail cichlid]
ref|XP_005475708.1|  PREDICTED: polypyrimidine tract-binding prot...    181   2e-49    
ref|XP_006803668.1|  PREDICTED: polypyrimidine tract-binding prot...    181   2e-49    Neolamprologus brichardi [lyretail cichlid]
ref|XP_004569390.1|  PREDICTED: polypyrimidine tract-binding prot...    181   2e-49    Maylandia zebra
ref|XP_009304155.1|  PREDICTED: polypyrimidine tract-binding prot...    181   2e-49    Danio rerio [leopard danio]
ref|XP_004561995.1|  PREDICTED: polypyrimidine tract-binding prot...    180   2e-49    
ref|XP_005947655.1|  PREDICTED: polypyrimidine tract-binding prot...    180   3e-49    
ref|XP_004569391.1|  PREDICTED: polypyrimidine tract-binding prot...    181   3e-49    Maylandia zebra
ref|XP_005155995.1|  PREDICTED: polypyrimidine tract-binding prot...    181   3e-49    Danio rerio [leopard danio]
ref|XP_005748480.1|  PREDICTED: polypyrimidine tract-binding prot...    180   3e-49    Pundamilia nyererei
gb|KFZ65284.1|  Polypyrimidine tract-binding protein 2                  174   3e-49    Podiceps cristatus
ref|NP_001116126.1|  polypyrimidine tract-binding protein 1             181   3e-49    Danio rerio [leopard danio]
ref|XP_005462343.1|  PREDICTED: polypyrimidine tract-binding prot...    177   4e-49    
ref|XP_009019582.1|  hypothetical protein HELRODRAFT_94426              181   4e-49    Helobdella robusta
gb|AAH91854.1|  Ptbp1b protein                                          181   4e-49    Danio rerio [leopard danio]
ref|XP_005947654.1|  PREDICTED: polypyrimidine tract-binding prot...    181   6e-49    Haplochromis burtoni
ref|XP_005808441.1|  PREDICTED: polypyrimidine tract-binding prot...    179   6e-49    
ref|XP_007542687.1|  PREDICTED: polypyrimidine tract-binding prot...    179   1e-48    
ref|XP_004572121.1|  PREDICTED: polypyrimidine tract-binding prot...    177   1e-48    
gb|KFQ80980.1|  Polypyrimidine tract-binding protein 2                  173   1e-48    Phoenicopterus ruber ruber
ref|XP_007240255.1|  PREDICTED: polypyrimidine tract-binding prot...    179   2e-48    Astyanax mexicanus [blind cave fish]
ref|XP_004572120.1|  PREDICTED: polypyrimidine tract-binding prot...    177   2e-48    
ref|XP_005813499.1|  PREDICTED: polypyrimidine tract-binding prot...    177   3e-48    
ref|XP_007542685.1|  PREDICTED: polypyrimidine tract-binding prot...    179   3e-48    Poecilia formosa
gb|KFM02470.1|  Polypyrimidine tract-binding protein 2                  178   3e-48    Aptenodytes forsteri
ref|XP_005939354.1|  PREDICTED: polypyrimidine tract-binding prot...    177   3e-48    Haplochromis burtoni
ref|XP_007899197.1|  PREDICTED: polypyrimidine tract-binding prot...    179   3e-48    Callorhinchus milii [Australian ghost shark]
dbj|BAG58340.1|  unnamed protein product                                174   3e-48    Homo sapiens [man]
ref|XP_006805222.1|  PREDICTED: polypyrimidine tract-binding prot...    177   3e-48    Neolamprologus brichardi [lyretail cichlid]
emb|CDQ90388.1|  unnamed protein product                                178   3e-48    Oncorhynchus mykiss
gb|ACN10491.1|  Polypyrimidine tract-binding protein 2                  178   3e-48    Salmo salar
ref|XP_007899194.1|  PREDICTED: polypyrimidine tract-binding prot...    178   4e-48    Callorhinchus milii [Australian ghost shark]
ref|XP_004572119.1|  PREDICTED: polypyrimidine tract-binding prot...    177   4e-48    
ref|XP_007250456.1|  PREDICTED: polypyrimidine tract-binding prot...    177   4e-48    Astyanax mexicanus [blind cave fish]
ref|XP_004572118.1|  PREDICTED: polypyrimidine tract-binding prot...    177   4e-48    
ref|XP_007899193.1|  PREDICTED: polypyrimidine tract-binding prot...    178   4e-48    Callorhinchus milii [Australian ghost shark]
ref|XP_007250455.1|  PREDICTED: polypyrimidine tract-binding prot...    177   4e-48    
ref|XP_006805223.1|  PREDICTED: polypyrimidine tract-binding prot...    177   4e-48    Neolamprologus brichardi [lyretail cichlid]
gb|KFU92770.1|  Polypyrimidine tract-binding protein 1                  177   4e-48    Chaetura pelagica
ref|XP_007904703.1|  PREDICTED: polypyrimidine tract-binding prot...    177   5e-48    Callorhinchus milii [Australian ghost shark]
ref|XP_007238922.1|  PREDICTED: polypyrimidine tract-binding prot...    177   5e-48    Astyanax mexicanus [blind cave fish]
ref|XP_007899192.1|  PREDICTED: polypyrimidine tract-binding prot...    178   5e-48    Callorhinchus milii [Australian ghost shark]
ref|XP_007238923.1|  PREDICTED: polypyrimidine tract-binding prot...    177   5e-48    Astyanax mexicanus [blind cave fish]
ref|XP_007542686.1|  PREDICTED: polypyrimidine tract-binding prot...    178   5e-48    Poecilia formosa
ref|XP_006805218.1|  PREDICTED: polypyrimidine tract-binding prot...    177   5e-48    Neolamprologus brichardi [lyretail cichlid]
ref|XP_006805219.1|  PREDICTED: polypyrimidine tract-binding prot...    177   5e-48    Neolamprologus brichardi [lyretail cichlid]
ref|XP_005939353.1|  PREDICTED: polypyrimidine tract-binding prot...    177   5e-48    Haplochromis burtoni
ref|XP_005753163.1|  PREDICTED: polypyrimidine tract-binding prot...    177   5e-48    Pundamilia nyererei
ref|XP_005462342.1|  PREDICTED: polypyrimidine tract-binding prot...    177   6e-48    
ref|XP_006805221.1|  PREDICTED: polypyrimidine tract-binding prot...    177   6e-48    Neolamprologus brichardi [lyretail cichlid]
ref|XP_006805220.1|  PREDICTED: polypyrimidine tract-binding prot...    177   6e-48    Neolamprologus brichardi [lyretail cichlid]
ref|XP_003386453.1|  PREDICTED: polypyrimidine tract-binding prot...    176   6e-48    
ref|XP_007524853.1|  PREDICTED: polypyrimidine tract-binding prot...    177   6e-48    
dbj|BAB71743.1|  PTB-like protein S                                     174   6e-48    
ref|XP_008400839.1|  PREDICTED: polypyrimidine tract-binding prot...    177   6e-48    
ref|XP_007904698.1|  PREDICTED: polypyrimidine tract-binding prot...    177   6e-48    
ref|XP_007904701.1|  PREDICTED: polypyrimidine tract-binding prot...    177   6e-48    
ref|XP_003457553.1|  PREDICTED: polypyrimidine tract-binding prot...    177   7e-48    
ref|XP_007904705.1|  PREDICTED: polypyrimidine tract-binding prot...    177   7e-48    
gb|EPQ05824.1|  Polypyrimidine tract-binding protein 2                  172   7e-48    
ref|XP_007904700.1|  PREDICTED: polypyrimidine tract-binding prot...    177   8e-48    
ref|XP_007524852.1|  PREDICTED: polypyrimidine tract-binding prot...    177   8e-48    
ref|XP_007904702.1|  PREDICTED: polypyrimidine tract-binding prot...    177   8e-48    
gb|EHB16932.1|  Polypyrimidine tract-binding protein 1                  177   9e-48    
ref|XP_008431885.1|  PREDICTED: polypyrimidine tract-binding prot...    176   9e-48    
ref|XP_011616990.1|  PREDICTED: polypyrimidine tract-binding prot...    177   9e-48    
ref|XP_002127727.3|  PREDICTED: polypyrimidine tract-binding prot...    176   1e-47    
ref|XP_009303446.1|  PREDICTED: polypyrimidine tract-binding prot...    176   1e-47    
ref|XP_011616986.1|  PREDICTED: polypyrimidine tract-binding prot...    177   1e-47    
ref|XP_004711005.1|  PREDICTED: polypyrimidine tract-binding prot...    176   1e-47    
ref|XP_011616989.1|  PREDICTED: polypyrimidine tract-binding prot...    176   1e-47    
ref|XP_011616988.1|  PREDICTED: polypyrimidine tract-binding prot...    176   1e-47    
ref|XP_005991998.1|  PREDICTED: polypyrimidine tract-binding prot...    177   1e-47    
ref|XP_004711004.1|  PREDICTED: polypyrimidine tract-binding prot...    176   1e-47    
ref|XP_010194772.1|  PREDICTED: polypyrimidine tract-binding prot...    171   1e-47    
ref|XP_005797119.1|  PREDICTED: polypyrimidine tract-binding prot...    176   1e-47    
ref|XP_011616985.1|  PREDICTED: polypyrimidine tract-binding prot...    177   1e-47    
ref|XP_010747775.1|  PREDICTED: polypyrimidine tract-binding prot...    176   1e-47    
ref|XP_011616984.1|  PREDICTED: polypyrimidine tract-binding prot...    177   1e-47    
ref|XP_010747774.1|  PREDICTED: polypyrimidine tract-binding prot...    176   2e-47    
ref|XP_008400840.1|  PREDICTED: polypyrimidine tract-binding prot...    176   2e-47    
gb|KFQ17337.1|  Polypyrimidine tract-binding protein 1                  176   2e-47    
ref|XP_007245175.1|  PREDICTED: polypyrimidine tract-binding prot...    176   2e-47    
ref|XP_008920485.1|  PREDICTED: polypyrimidine tract-binding prot...    175   2e-47    
ref|XP_010125583.1|  PREDICTED: polypyrimidine tract-binding prot...    174   2e-47    
ref|XP_007245174.1|  PREDICTED: polypyrimidine tract-binding prot...    176   2e-47    
emb|CDQ68644.1|  unnamed protein product                                177   2e-47    
ref|XP_010000152.1|  PREDICTED: LOW QUALITY PROTEIN: polypyrimidi...    177   2e-47    
gb|KFP24475.1|  Polypyrimidine tract-binding protein 2                  171   2e-47    
ref|XP_008628481.1|  PREDICTED: polypyrimidine tract-binding prot...    175   2e-47    
ref|XP_008920484.1|  PREDICTED: polypyrimidine tract-binding prot...    175   2e-47    
ref|XP_008628479.1|  PREDICTED: polypyrimidine tract-binding prot...    175   2e-47    
ref|XP_008628476.1|  PREDICTED: polypyrimidine tract-binding prot...    175   2e-47    
ref|XP_005422147.1|  PREDICTED: polypyrimidine tract-binding prot...    175   2e-47    
ref|XP_008297271.1|  PREDICTED: polypyrimidine tract-binding prot...    176   2e-47    
ref|XP_008920480.1|  PREDICTED: polypyrimidine tract-binding prot...    175   2e-47    
ref|XP_005422148.1|  PREDICTED: polypyrimidine tract-binding prot...    175   2e-47    
ref|XP_005163402.1|  PREDICTED: polypyrimidine tract-binding prot...    175   3e-47    
ref|XP_008920482.1|  PREDICTED: polypyrimidine tract-binding prot...    175   3e-47    
ref|XP_008920483.1|  PREDICTED: polypyrimidine tract-binding prot...    175   3e-47    
ref|XP_008628480.1|  PREDICTED: polypyrimidine tract-binding prot...    175   3e-47    
ref|XP_008628477.1|  PREDICTED: polypyrimidine tract-binding prot...    175   3e-47    
ref|XP_009086766.1|  PREDICTED: polypyrimidine tract-binding prot...    175   3e-47    
ref|XP_003277021.1|  PREDICTED: polypyrimidine tract-binding prot...    175   3e-47    
ref|NP_001274106.1|  polypyrimidine tract binding protein 2             175   3e-47    
ref|XP_010730505.1|  PREDICTED: LOW QUALITY PROTEIN: polypyrimidi...    176   3e-47    
ref|NP_001018313.1|  polypyrimidine tract binding protein 1a            176   3e-47    
ref|XP_005422146.1|  PREDICTED: polypyrimidine tract-binding prot...    175   3e-47    
gb|KFW79576.1|  Polypyrimidine tract-binding protein 2                  175   3e-47    
ref|XP_010407472.1|  PREDICTED: polypyrimidine tract-binding prot...    175   3e-47    
ref|NP_001026106.1|  polypyrimidine tract-binding protein 1             175   3e-47    
ref|XP_008305630.1|  PREDICTED: polypyrimidine tract-binding prot...    174   3e-47    
ref|NP_001093477.1|  polypyrimidine tract-binding protein 2             175   3e-47    
gb|KFO56544.1|  Polypyrimidine tract-binding protein 2                  175   3e-47    
ref|XP_008709569.1|  PREDICTED: LOW QUALITY PROTEIN: polypyrimidi...    175   4e-47    
ref|XP_009915795.1|  PREDICTED: polypyrimidine tract-binding prot...    175   4e-47    
ref|XP_009086765.1|  PREDICTED: polypyrimidine tract-binding prot...    175   4e-47    
ref|XP_009086763.1|  PREDICTED: polypyrimidine tract-binding prot...    175   4e-47    
ref|XP_005050455.1|  PREDICTED: polypyrimidine tract-binding prot...    175   4e-47    
ref|XP_005482117.1|  PREDICTED: polypyrimidine tract-binding prot...    175   4e-47    
ref|XP_011819377.1|  PREDICTED: polypyrimidine tract-binding prot...    175   4e-47    
ref|XP_008183516.1|  PREDICTED: polypyrimidine tract-binding prot...    176   4e-47    
ref|XP_002190438.2|  PREDICTED: polypyrimidine tract-binding prot...    175   4e-47    
ref|XP_005050454.1|  PREDICTED: polypyrimidine tract-binding prot...    175   4e-47    
ref|XP_005482116.1|  PREDICTED: polypyrimidine tract-binding prot...    175   4e-47    
ref|XP_009086764.1|  PREDICTED: polypyrimidine tract-binding prot...    175   4e-47    
ref|XP_005050456.1|  PREDICTED: polypyrimidine tract-binding prot...    175   4e-47    
ref|XP_005482115.1|  PREDICTED: polypyrimidine tract-binding prot...    175   4e-47    
ref|XP_008183518.1|  PREDICTED: polypyrimidine tract-binding prot...    176   4e-47    
ref|XP_005428597.1|  PREDICTED: LOW QUALITY PROTEIN: polypyrimidi...    176   4e-47    
ref|XP_008183514.1|  PREDICTED: polypyrimidine tract-binding prot...    176   4e-47    
ref|XP_010125582.1|  PREDICTED: polypyrimidine tract-binding prot...    174   4e-47    
ref|XP_005737652.1|  PREDICTED: polypyrimidine tract-binding prot...    174   4e-47    
ref|XP_011436716.1|  PREDICTED: polypyrimidine tract-binding prot...    175   5e-47    
ref|XP_008332904.1|  PREDICTED: polypyrimidine tract-binding prot...    175   5e-47    
ref|XP_006808479.1|  PREDICTED: polypyrimidine tract-binding prot...    174   5e-47    
ref|XP_010161389.1|  PREDICTED: polypyrimidine tract-binding prot...    174   5e-47    
ref|XP_008324417.1|  PREDICTED: polypyrimidine tract-binding prot...    174   5e-47    
ref|XP_010125579.1|  PREDICTED: polypyrimidine tract-binding prot...    174   5e-47    
ref|XP_010161396.1|  PREDICTED: polypyrimidine tract-binding prot...    174   5e-47    
ref|XP_010161418.1|  PREDICTED: polypyrimidine tract-binding prot...    174   5e-47    
ref|XP_008300240.1|  PREDICTED: polypyrimidine tract-binding prot...    172   5e-47    
ref|XP_009578945.1|  PREDICTED: polypyrimidine tract-binding prot...    172   5e-47    
ref|XP_010750711.1|  PREDICTED: polypyrimidine tract-binding prot...    175   5e-47    
ref|XP_003453220.1|  PREDICTED: polypyrimidine tract-binding prot...    174   5e-47    
ref|XP_010125577.1|  PREDICTED: polypyrimidine tract-binding prot...    174   5e-47    
ref|XP_010125580.1|  PREDICTED: polypyrimidine tract-binding prot...    174   5e-47    
ref|XP_011436715.1|  PREDICTED: polypyrimidine tract-binding prot...    175   5e-47    
ref|XP_008183513.1|  PREDICTED: polypyrimidine tract-binding prot...    176   5e-47    
ref|XP_010125581.1|  PREDICTED: polypyrimidine tract-binding prot...    174   5e-47    
ref|XP_008305629.1|  PREDICTED: polypyrimidine tract-binding prot...    174   5e-47    
ref|XP_011436714.1|  PREDICTED: polypyrimidine tract-binding prot...    175   5e-47    
ref|XP_010125576.1|  PREDICTED: polypyrimidine tract-binding prot...    174   6e-47    
ref|XP_011436713.1|  PREDICTED: polypyrimidine tract-binding prot...    175   6e-47    
ref|XP_010161426.1|  PREDICTED: polypyrimidine tract-binding prot...    174   6e-47    
ref|XP_011603303.1|  PREDICTED: polypyrimidine tract-binding prot...    174   6e-47    
ref|XP_008183512.1|  PREDICTED: polypyrimidine tract-binding prot...    176   6e-47    
ref|XP_010004945.1|  PREDICTED: polypyrimidine tract-binding prot...    174   6e-47    
ref|XP_010004948.1|  PREDICTED: polypyrimidine tract-binding prot...    174   6e-47    
ref|XP_010004944.1|  PREDICTED: polypyrimidine tract-binding prot...    174   6e-47    
ref|XP_008305628.1|  PREDICTED: polypyrimidine tract-binding prot...    174   6e-47    
ref|XP_011603302.1|  PREDICTED: polypyrimidine tract-binding prot...    174   6e-47    
ref|XP_008305627.1|  PREDICTED: polypyrimidine tract-binding prot...    174   7e-47    
ref|XP_005610460.1|  PREDICTED: polypyrimidine tract-binding prot...    173   7e-47    
ref|XP_010308246.1|  PREDICTED: polypyrimidine tract-binding prot...    174   7e-47    
ref|XP_010004947.1|  PREDICTED: polypyrimidine tract-binding prot...    174   7e-47    
ref|XP_010308254.1|  PREDICTED: polypyrimidine tract-binding prot...    174   7e-47    
ref|XP_010004949.1|  PREDICTED: polypyrimidine tract-binding prot...    174   7e-47    
ref|XP_008305626.1|  PREDICTED: polypyrimidine tract-binding prot...    174   7e-47    
gb|KFP45249.1|  Polypyrimidine tract-binding protein 2                  174   8e-47    
ref|XP_007485073.1|  PREDICTED: polypyrimidine tract-binding prot...    174   8e-47    
ref|XP_010308238.1|  PREDICTED: polypyrimidine tract-binding prot...    174   8e-47    
ref|XP_010308230.1|  PREDICTED: polypyrimidine tract-binding prot...    174   8e-47    
ref|XP_011436711.1|  PREDICTED: polypyrimidine tract-binding prot...    175   8e-47    
gb|KFO07460.1|  Polypyrimidine tract-binding protein 2                  174   8e-47    
ref|XP_011436708.1|  PREDICTED: polypyrimidine tract-binding prot...    175   8e-47    
gb|KFZ49942.1|  Polypyrimidine tract-binding protein 2                  174   9e-47    
ref|XP_006169074.1|  PREDICTED: polypyrimidine tract-binding prot...    173   9e-47    
ref|XP_011436709.1|  PREDICTED: polypyrimidine tract-binding prot...    175   9e-47    
ref|XP_011436706.1|  PREDICTED: polypyrimidine tract-binding prot...    175   9e-47    
ref|XP_010713909.1|  PREDICTED: polypyrimidine tract-binding prot...    172   9e-47    
ref|XP_010174624.1|  PREDICTED: polypyrimidine tract-binding prot...    168   9e-47    
ref|XP_006190987.1|  PREDICTED: polypyrimidine tract-binding prot...    174   1e-46    
ref|XP_010713912.1|  PREDICTED: polypyrimidine tract-binding prot...    172   1e-46    
ref|XP_010713910.1|  PREDICTED: polypyrimidine tract-binding prot...    172   1e-46    
ref|XP_011436707.1|  PREDICTED: polypyrimidine tract-binding prot...    175   1e-46    
ref|XP_006190986.1|  PREDICTED: polypyrimidine tract-binding prot...    174   1e-46    
ref|XP_009288728.1|  PREDICTED: polypyrimidine tract-binding prot...    173   1e-46    
gb|KFU96454.1|  Polypyrimidine tract-binding protein 2                  174   1e-46    
ref|XP_010223826.1|  PREDICTED: polypyrimidine tract-binding prot...    173   1e-46    
ref|XP_011603299.1|  PREDICTED: polypyrimidine tract-binding prot...    174   1e-46    
ref|XP_011603300.1|  PREDICTED: polypyrimidine tract-binding prot...    174   1e-46    
gb|EPQ08049.1|  Polypyrimidine tract-binding protein 1                  174   1e-46    
ref|XP_011603301.1|  PREDICTED: polypyrimidine tract-binding prot...    174   1e-46    
ref|XP_010743896.1|  PREDICTED: polypyrimidine tract-binding prot...    174   1e-46    
ref|XP_010223827.1|  PREDICTED: polypyrimidine tract-binding prot...    173   1e-46    
ref|XP_010223828.1|  PREDICTED: polypyrimidine tract-binding prot...    173   1e-46    
ref|XP_009082185.1|  PREDICTED: polypyrimidine tract-binding prot...    173   1e-46    
ref|XP_007109281.1|  PREDICTED: polypyrimidine tract-binding prot...    173   1e-46    
ref|XP_010713914.1|  PREDICTED: polypyrimidine tract-binding prot...    173   1e-46    
ref|XP_007485072.1|  PREDICTED: polypyrimidine tract-binding prot...    174   1e-46    
ref|XP_004378584.1|  PREDICTED: polypyrimidine tract-binding prot...    174   1e-46    
ref|XP_008309726.1|  PREDICTED: LOW QUALITY PROTEIN: polypyrimidi...    175   1e-46    
ref|XP_005866730.1|  PREDICTED: polypyrimidine tract-binding prot...    174   1e-46    
ref|XP_007109280.1|  PREDICTED: polypyrimidine tract-binding prot...    173   1e-46    
ref|XP_009968096.1|  PREDICTED: polypyrimidine tract-binding prot...    173   1e-46    
ref|XP_010713913.1|  PREDICTED: polypyrimidine tract-binding prot...    173   1e-46    
ref|XP_009488434.1|  PREDICTED: polypyrimidine tract-binding prot...    173   1e-46    
ref|XP_009082184.1|  PREDICTED: polypyrimidine tract-binding prot...    173   1e-46    
ref|XP_009082182.1|  PREDICTED: polypyrimidine tract-binding prot...    173   1e-46    
ref|XP_009968095.1|  PREDICTED: polypyrimidine tract-binding prot...    172   1e-46    
ref|XP_003292087.1|  hypothetical protein DICPUDRAFT_82723              175   1e-46    
ref|XP_004378583.1|  PREDICTED: polypyrimidine tract-binding prot...    174   1e-46    
ref|XP_004378582.1|  PREDICTED: polypyrimidine tract-binding prot...    174   1e-46    
ref|XP_009503000.1|  PREDICTED: polypyrimidine tract-binding prot...    172   1e-46    
ref|XP_010948731.1|  PREDICTED: polypyrimidine tract-binding prot...    173   1e-46    
ref|XP_009684270.1|  PREDICTED: polypyrimidine tract-binding prot...    173   1e-46    
ref|XP_007485070.1|  PREDICTED: polypyrimidine tract-binding prot...    174   1e-46    
ref|XP_009684271.1|  PREDICTED: polypyrimidine tract-binding prot...    173   1e-46    
ref|XP_009645796.1|  PREDICTED: polypyrimidine tract-binding prot...    172   1e-46    
ref|XP_004263108.1|  PREDICTED: polypyrimidine tract-binding prot...    173   1e-46    
ref|XP_005866728.1|  PREDICTED: polypyrimidine tract-binding prot...    174   2e-46    
ref|XP_005866729.1|  PREDICTED: polypyrimidine tract-binding prot...    174   2e-46    
ref|XP_012032206.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_007485071.1|  PREDICTED: polypyrimidine tract-binding prot...    174   2e-46    
ref|XP_009488433.1|  PREDICTED: polypyrimidine tract-binding prot...    172   2e-46    
gb|EFB21565.1|  hypothetical protein PANDA_015565                       172   2e-46    
ref|XP_010158854.1|  PREDICTED: polypyrimidine tract-binding prot...    172   2e-46    
ref|XP_004936634.1|  PREDICTED: polypyrimidine tract-binding prot...    172   2e-46    
ref|XP_010158850.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_010158851.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_005018787.1|  PREDICTED: polypyrimidine tract-binding prot...    172   2e-46    
ref|XP_009968094.1|  PREDICTED: polypyrimidine tract-binding prot...    172   2e-46    
ref|XP_009332037.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_010858800.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_009905235.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_012032213.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_004614696.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
gb|KGL84729.1|  Polypyrimidine tract-binding protein 2                  173   2e-46    
ref|XP_009578940.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_009082181.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_006114192.1|  PREDICTED: polypyrimidine tract-binding prot...    172   2e-46    
ref|XP_005866727.1|  PREDICTED: polypyrimidine tract-binding prot...    174   2e-46    
ref|XP_010973660.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_009905236.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_009082180.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_009883063.1|  PREDICTED: polypyrimidine tract-binding prot...    172   2e-46    
ref|XP_009488429.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_010158853.1|  PREDICTED: polypyrimidine tract-binding prot...    172   2e-46    
ref|XP_009968092.1|  PREDICTED: polypyrimidine tract-binding prot...    172   2e-46    
ref|XP_009645788.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_009968093.1|  PREDICTED: polypyrimidine tract-binding prot...    172   2e-46    
ref|XP_009645795.1|  PREDICTED: polypyrimidine tract-binding prot...    172   2e-46    
ref|XP_007662364.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_009578939.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_009488431.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_007485069.1|  PREDICTED: polypyrimidine tract-binding prot...    174   2e-46    
ref|XP_009905237.1|  PREDICTED: polypyrimidine tract-binding prot...    172   2e-46    
ref|XP_010158852.1|  PREDICTED: polypyrimidine tract-binding prot...    172   2e-46    
ref|XP_009916897.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_004635751.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_007427282.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_008300237.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_011570949.1|  PREDICTED: polypyrimidine tract-binding prot...    172   2e-46    
ref|XP_009883062.1|  PREDICTED: polypyrimidine tract-binding prot...    172   2e-46    
ref|XP_009578938.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_009082179.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_008489095.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_008275503.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_009968091.1|  PREDICTED: polypyrimidine tract-binding prot...    172   2e-46    
ref|XP_009684268.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    
ref|XP_004699299.1|  PREDICTED: polypyrimidine tract-binding prot...    173   2e-46    



>ref|XP_010665155.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X2 [Vitis vinifera]
Length=256

 Score =   427 bits (1098),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 201/218 (92%), Positives = 213/218 (98%), Gaps = 0/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA NA+QF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAANAMQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YTNVQPSIRGRNVY+QFSSHQELTT+DQN Q RGDEPNRILLVTIHH+LYPITVEVLHQV
Sbjct  61   YTNVQPSIRGRNVYVQFSSHQELTTVDQNAQGRGDEPNRILLVTIHHLLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q+ QSAV+ARN+LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKIVTFQKSAGFQALIQYQSRQSAVAARNSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNN+RSRDFTNP+LPSEQKG+SSQ GYGDAGGMY+
Sbjct  181  QVNYNNERSRDFTNPSLPSEQKGRSSQSGYGDAGGMYA  218



>ref|XP_010665151.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Vitis vinifera]
 ref|XP_010665152.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Vitis vinifera]
 ref|XP_010665153.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Vitis vinifera]
 emb|CBI18226.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   428 bits (1100),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 201/218 (92%), Positives = 213/218 (98%), Gaps = 0/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA NA+QF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAANAMQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YTNVQPSIRGRNVY+QFSSHQELTT+DQN Q RGDEPNRILLVTIHH+LYPITVEVLHQV
Sbjct  61   YTNVQPSIRGRNVYVQFSSHQELTTVDQNAQGRGDEPNRILLVTIHHLLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q+ QSAV+ARN+LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKIVTFQKSAGFQALIQYQSRQSAVAARNSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNN+RSRDFTNP+LPSEQKG+SSQ GYGDAGGMY+
Sbjct  181  QVNYNNERSRDFTNPSLPSEQKGRSSQSGYGDAGGMYA  218



>ref|XP_009597471.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Nicotiana tomentosiformis]
 ref|XP_009597472.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Nicotiana tomentosiformis]
 ref|XP_009597473.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Nicotiana tomentosiformis]
Length=441

 Score =   422 bits (1085),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 205/218 (94%), Positives = 210/218 (96%), Gaps = 3/218 (1%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MT+PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAV ALQF
Sbjct  1    MTDPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVKALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YTNVQPSIRGRNVY+QFSSHQELTTMDQNTQ RGDEPNRILLVTIHHMLYPITV+VLHQV
Sbjct  61   YTNVQPSIRGRNVYVQFSSHQELTTMDQNTQGRGDEPNRILLVTIHHMLYPITVDVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQFQ  QSAVSARN+LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKIVTFQKSAGFQALIQFQLQQSAVSARNSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNN+RSRDFTNPNLPSEQKGKSSQ GYGD   MYS
Sbjct  181  QVNYNNERSRDFTNPNLPSEQKGKSSQQGYGD---MYS  215



>emb|CDP17953.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   421 bits (1082),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 203/217 (94%), Positives = 208/217 (96%), Gaps = 0/217 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YTNVQPSIRGRNVY+QFSSHQELTTMDQNTQ RGDEPNRILLVTIH MLYPITVEVLHQV
Sbjct  61   YTNVQPSIRGRNVYVQFSSHQELTTMDQNTQGRGDEPNRILLVTIHQMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q  QSAVSARNALQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKIVTFQKSAGFQALIQYQLQQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            QVNYNN+RSRDFTNP+LPSEQKG+SS  GYGD G  Y
Sbjct  181  QVNYNNERSRDFTNPSLPSEQKGRSSHPGYGDVGVGY  217



>ref|XP_009768478.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Nicotiana sylvestris]
Length=585

 Score =   424 bits (1091),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 205/218 (94%), Positives = 210/218 (96%), Gaps = 3/218 (1%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MT+PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAV ALQF
Sbjct  1    MTDPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVKALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YTNVQPSIRGRNVY+QFSSHQELTTMDQNTQ RGDEPNRILLVTIHHMLYPITV+VLHQV
Sbjct  61   YTNVQPSIRGRNVYVQFSSHQELTTMDQNTQGRGDEPNRILLVTIHHMLYPITVDVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQFQ  QSAVSARN+LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKIVTFQKSAGFQALIQFQLQQSAVSARNSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNN+RSRDFTNPNLPSEQKGKSSQ GYGD   MYS
Sbjct  181  QVNYNNERSRDFTNPNLPSEQKGKSSQQGYGD---MYS  215



>ref|XP_007151988.1| hypothetical protein PHAVU_004G092400g [Phaseolus vulgaris]
 gb|ESW23982.1| hypothetical protein PHAVU_004G092400g [Phaseolus vulgaris]
Length=439

 Score =   419 bits (1078),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 199/218 (91%), Positives = 211/218 (97%), Gaps = 1/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+PSAVNALQF
Sbjct  1    MAEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIPSAVNALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y+NVQPSIRGRNVY+QFSSHQELTTMDQN Q+R DEPNRILLVT+HHMLYPIT +VLHQV
Sbjct  61   YSNVQPSIRGRNVYVQFSSHQELTTMDQN-QAREDEPNRILLVTVHHMLYPITADVLHQV  119

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q+ QSAV+AR+ LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  120  FSPHGFVEKIVTFQKSAGFQALIQYQSRQSAVAARSTLQGRNIYDGCCQLDIQFSNLDEL  179

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNNDRSRDFTNPNLP+EQKG+SSQ GYGDAGGMYS
Sbjct  180  QVNYNNDRSRDFTNPNLPTEQKGRSSQPGYGDAGGMYS  217



>ref|XP_009621582.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Nicotiana tomentosiformis]
Length=443

 Score =   419 bits (1078),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 201/218 (92%), Positives = 212/218 (97%), Gaps = 1/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIH+RNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF
Sbjct  1    MTEPSKVIHIRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y+NVQPSIRGRNVY+QFSSHQELTTMDQN+Q RGDEPNRILLVTIHH+LYPITVEVLHQV
Sbjct  61   YSNVQPSIRGRNVYVQFSSHQELTTMDQNSQGRGDEPNRILLVTIHHVLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHG VEKIVTFQKSAGFQALIQ+Q  Q+AVSARN+LQGRN+YDGCCQLD+QFSNLDEL
Sbjct  121  FSPHGVVEKIVTFQKSAGFQALIQYQLPQNAVSARNSLQGRNVYDGCCQLDVQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNN+RSRDFTNPNLPSEQKGKS Q GYGDAGGMYS
Sbjct  181  QVNYNNERSRDFTNPNLPSEQKGKSPQ-GYGDAGGMYS  217



>gb|KCW69168.1| hypothetical protein EUGRSUZ_F02695 [Eucalyptus grandis]
Length=334

 Score =   415 bits (1067),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 195/218 (89%), Positives = 210/218 (96%), Gaps = 0/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+PSA+NALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIPSAINALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y NVQPSIRGRNVY+QFSSHQELTT+DQN Q+RGDEPNRILLVTIHHMLYPITVEVL QV
Sbjct  61   YANVQPSIRGRNVYVQFSSHQELTTVDQNAQARGDEPNRILLVTIHHMLYPITVEVLQQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSP+GFVEKIVTFQKSAGFQALIQ+Q+ Q A++AR +LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPYGFVEKIVTFQKSAGFQALIQYQSRQCAIAARTSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNN+RSRDFTNPNLPSEQKG+SSQ GYGDAG +Y+
Sbjct  181  QVNYNNERSRDFTNPNLPSEQKGRSSQPGYGDAGSIYA  218



>gb|KCW69167.1| hypothetical protein EUGRSUZ_F02695 [Eucalyptus grandis]
Length=353

 Score =   415 bits (1067),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 195/218 (89%), Positives = 210/218 (96%), Gaps = 0/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+PSA+NALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIPSAINALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y NVQPSIRGRNVY+QFSSHQELTT+DQN Q+RGDEPNRILLVTIHHMLYPITVEVL QV
Sbjct  61   YANVQPSIRGRNVYVQFSSHQELTTVDQNAQARGDEPNRILLVTIHHMLYPITVEVLQQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSP+GFVEKIVTFQKSAGFQALIQ+Q+ Q A++AR +LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPYGFVEKIVTFQKSAGFQALIQYQSRQCAIAARTSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNN+RSRDFTNPNLPSEQKG+SSQ GYGDAG +Y+
Sbjct  181  QVNYNNERSRDFTNPNLPSEQKGRSSQPGYGDAGSIYA  218



>ref|XP_009765394.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Nicotiana sylvestris]
Length=443

 Score =   418 bits (1074),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 202/218 (93%), Positives = 211/218 (97%), Gaps = 1/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQ VPSAVNALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQGVPSAVNALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y+NVQPSIRGRNVY+QFSSHQELTTMDQN+Q RGDEPNRILLVTIHH+LYPITVEVLHQV
Sbjct  61   YSNVQPSIRGRNVYVQFSSHQELTTMDQNSQGRGDEPNRILLVTIHHVLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHG VEKIVTFQKSAGFQALIQ+Q  Q+AVSARN+LQGRNIYDGCCQLD+QFSNLDEL
Sbjct  121  FSPHGIVEKIVTFQKSAGFQALIQYQLPQNAVSARNSLQGRNIYDGCCQLDVQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNN+RSRDFTNPNLPSEQKGKS Q GYGDAGGMYS
Sbjct  181  QVNYNNERSRDFTNPNLPSEQKGKSPQ-GYGDAGGMYS  217



>ref|XP_006473079.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Citrus sinensis]
 gb|KDO83775.1| hypothetical protein CISIN_1g013267mg [Citrus sinensis]
Length=446

 Score =   418 bits (1074),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 197/218 (90%), Positives = 209/218 (96%), Gaps = 0/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YTNVQP+IRGRNVY+QFSSHQELTTM+QN Q RGDEPNRILLVTIHHMLYPITVEVLHQV
Sbjct  61   YTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q   SAV AR++LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNN+RSRDFTNPNLP+EQKG+ SQ GY +AGGMY+
Sbjct  181  QVNYNNERSRDFTNPNLPAEQKGRPSQSGYSEAGGMYA  218



>ref|XP_008463064.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Cucumis 
melo]
Length=444

 Score =   418 bits (1074),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 198/218 (91%), Positives = 207/218 (95%), Gaps = 0/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQDVPSAVNALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALMQMQDVPSAVNALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            + N+QPSIRGRNVY+QFSSHQELTT DQN Q RGDEPNRILLVTIHHMLYPITVEVLHQV
Sbjct  61   FANLQPSIRGRNVYVQFSSHQELTTADQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            F PHGFVEKIVTFQKSAGFQALIQ+QT Q AVSAR ALQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FFPHGFVEKIVTFQKSAGFQALIQYQTRQCAVSARTALQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNN+RSRDFTNP+LPSE KG+SSQ GYGD GGMY+
Sbjct  181  QVNYNNERSRDFTNPSLPSEPKGRSSQPGYGDTGGMYA  218



>ref|XP_007019550.1| Polypyrimidine tract-binding protein 3 [Theobroma cacao]
 gb|EOY16775.1| Polypyrimidine tract-binding protein 3 [Theobroma cacao]
Length=718

 Score =   427 bits (1097),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 200/221 (90%), Positives = 211/221 (95%), Gaps = 1/221 (0%)
 Frame = +1

Query  124  LKMTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNAL  303
            L+M EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+PSA+NAL
Sbjct  267  LQMAEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIPSAINAL  326

Query  304  QFYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLH  483
            QFYTNVQP+IRGRNVY+QFSSHQELTTMDQ  Q RGDEPNRILLVTIHHMLYPITVEVLH
Sbjct  327  QFYTNVQPTIRGRNVYVQFSSHQELTTMDQTAQGRGDEPNRILLVTIHHMLYPITVEVLH  386

Query  484  QVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLD  663
            QVFSPHGFVEKIVTFQKSAGFQALIQ+Q  QSAVSAR +LQGRNIYDGCCQLDIQFSNLD
Sbjct  387  QVFSPHGFVEKIVTFQKSAGFQALIQYQLRQSAVSARTSLQGRNIYDGCCQLDIQFSNLD  446

Query  664  ELQVNYNNDRSRDFTNPNLPSEQKGKSSQ-HGYGDAGGMYS  783
            ELQV+YNNDRSRDFTNPNLP+EQKG+SSQ  GYGD GGMY+
Sbjct  447  ELQVHYNNDRSRDFTNPNLPTEQKGRSSQPTGYGDVGGMYA  487



>ref|XP_006434490.1| hypothetical protein CICLE_v10001148mg [Citrus clementina]
 ref|XP_006434491.1| hypothetical protein CICLE_v10001148mg [Citrus clementina]
 gb|ESR47730.1| hypothetical protein CICLE_v10001148mg [Citrus clementina]
 gb|ESR47731.1| hypothetical protein CICLE_v10001148mg [Citrus clementina]
Length=446

 Score =   417 bits (1073),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 197/218 (90%), Positives = 209/218 (96%), Gaps = 0/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YTNVQP+IRGRNVY+QFSSHQELTTM+QN Q RGDEPNRILLVTIHHMLYPITVEVLHQV
Sbjct  61   YTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q   SAV AR++LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNN+RSRDFTNPNLP+EQKG+ SQ GY +AGGMY+
Sbjct  181  QVNYNNERSRDFTNPNLPAEQKGRPSQSGYSEAGGMYA  218



>ref|XP_003518587.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Glycine max]
Length=439

 Score =   417 bits (1071),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 198/218 (91%), Positives = 210/218 (96%), Gaps = 1/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+PSAVNALQF
Sbjct  1    MAEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIPSAVNALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y NVQPSIRGRNVY+QFSSHQELTTMDQN Q+R DEPNRILLVT+HHMLYPIT +VLHQV
Sbjct  61   YANVQPSIRGRNVYVQFSSHQELTTMDQN-QAREDEPNRILLVTVHHMLYPITADVLHQV  119

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q+ QSAV+AR+ LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  120  FSPHGFVEKIVTFQKSAGFQALIQYQSRQSAVTARSTLQGRNIYDGCCQLDIQFSNLDEL  179

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNNDRSRDFTNPNLP+EQKG+SSQ GYGDAGGM+S
Sbjct  180  QVNYNNDRSRDFTNPNLPTEQKGRSSQPGYGDAGGMHS  217



>ref|XP_003548101.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Glycine max]
 ref|XP_006599485.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Glycine max]
 gb|KHN41293.1| Polypyrimidine tract-binding protein like 3 [Glycine soja]
Length=439

 Score =   416 bits (1070),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 198/218 (91%), Positives = 209/218 (96%), Gaps = 1/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+PSAVNALQF
Sbjct  1    MAEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIPSAVNALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y NVQPSIRGRNVY+QFSSHQELTTMDQN Q+R DEPNRILLVT+HHMLYPIT +VLHQV
Sbjct  61   YANVQPSIRGRNVYVQFSSHQELTTMDQN-QAREDEPNRILLVTVHHMLYPITADVLHQV  119

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q+ QSAV+AR+ LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  120  FSPHGFVEKIVTFQKSAGFQALIQYQSRQSAVTARSTLQGRNIYDGCCQLDIQFSNLDEL  179

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNNDRSRDFTNPNLP+EQKG+SSQ GYGDA GMYS
Sbjct  180  QVNYNNDRSRDFTNPNLPTEQKGRSSQPGYGDAAGMYS  217



>ref|XP_011078771.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Sesamum 
indicum]
 ref|XP_011078772.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Sesamum 
indicum]
 ref|XP_011078773.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Sesamum 
indicum]
 ref|XP_011078774.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Sesamum 
indicum]
Length=437

 Score =   416 bits (1069),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 199/218 (91%), Positives = 210/218 (96%), Gaps = 1/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+ SAV+ALQF
Sbjct  1    MAEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIASAVSALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YTNVQPSIRGRNVY+QFSSHQELT MDQN Q+RGDEPNRILLVTIHHMLYPITVEVLHQV
Sbjct  61   YTNVQPSIRGRNVYVQFSSHQELTIMDQNAQARGDEPNRILLVTIHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q +QSA+SARN+LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKIVTFQKSAGFQALIQYQLHQSAISARNSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNN+RSRDFTNP+LPSEQKGKSSQ GYGD  GMY+
Sbjct  181  QVNYNNERSRDFTNPSLPSEQKGKSSQPGYGDT-GMYA  217



>ref|XP_010062097.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Eucalyptus 
grandis]
 ref|XP_010062098.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Eucalyptus 
grandis]
 ref|XP_010062099.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Eucalyptus 
grandis]
 ref|XP_010062100.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Eucalyptus 
grandis]
 gb|KCW69166.1| hypothetical protein EUGRSUZ_F02695 [Eucalyptus grandis]
Length=444

 Score =   416 bits (1070),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 195/218 (89%), Positives = 210/218 (96%), Gaps = 0/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+PSA+NALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIPSAINALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y NVQPSIRGRNVY+QFSSHQELTT+DQN Q+RGDEPNRILLVTIHHMLYPITVEVL QV
Sbjct  61   YANVQPSIRGRNVYVQFSSHQELTTVDQNAQARGDEPNRILLVTIHHMLYPITVEVLQQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSP+GFVEKIVTFQKSAGFQALIQ+Q+ Q A++AR +LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPYGFVEKIVTFQKSAGFQALIQYQSRQCAIAARTSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNN+RSRDFTNPNLPSEQKG+SSQ GYGDAG +Y+
Sbjct  181  QVNYNNERSRDFTNPNLPSEQKGRSSQPGYGDAGSIYA  218



>ref|XP_011656467.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Cucumis 
sativus]
Length=444

 Score =   416 bits (1070),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 198/217 (91%), Positives = 206/217 (95%), Gaps = 0/217 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQDVPSAVNALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALMQMQDVPSAVNALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            + N+QPSIRGRNVY+QFSSHQELTT DQN Q RGDEPNRILLVTIHHMLYPITVEVLHQV
Sbjct  61   FANLQPSIRGRNVYVQFSSHQELTTADQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            F PHGFVEKIVTFQKSAGFQALIQ+QT Q AVSAR ALQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FFPHGFVEKIVTFQKSAGFQALIQYQTRQCAVSARTALQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            QVNYNN+RSRDFTNP+LPSE KG+SSQ GYGD GGMY
Sbjct  181  QVNYNNERSRDFTNPSLPSEPKGRSSQPGYGDTGGMY  217



>gb|KHN00751.1| Polypyrimidine tract-binding protein like 3 [Glycine soja]
Length=439

 Score =   415 bits (1067),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 197/218 (90%), Positives = 210/218 (96%), Gaps = 1/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALL+MQD+PSAVNALQF
Sbjct  1    MAEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLRMQDIPSAVNALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y NVQPSIRGRNVY+QFSSHQELTTMDQN Q+R DEPNRILLVT+HHMLYPIT +VLHQV
Sbjct  61   YANVQPSIRGRNVYVQFSSHQELTTMDQN-QAREDEPNRILLVTVHHMLYPITADVLHQV  119

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q+ QSAV+AR+ LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  120  FSPHGFVEKIVTFQKSAGFQALIQYQSRQSAVTARSTLQGRNIYDGCCQLDIQFSNLDEL  179

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNNDRSRDFTNPNLP+EQKG+SSQ GYGDAGGM+S
Sbjct  180  QVNYNNDRSRDFTNPNLPTEQKGRSSQPGYGDAGGMHS  217



>ref|XP_002302167.2| polypyrimidine tract-binding family protein [Populus trichocarpa]
 gb|EEE81440.2| polypyrimidine tract-binding family protein [Populus trichocarpa]
Length=436

 Score =   414 bits (1064),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 197/215 (92%), Positives = 205/215 (95%), Gaps = 0/215 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQ 
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQL  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YTN+QP+IRGRNVY+QFSSHQELTTMDQNTQ RGDEPNRILLVTIHHMLYPITVEVLHQV
Sbjct  61   YTNIQPTIRGRNVYVQFSSHQELTTMDQNTQGRGDEPNRILLVTIHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q+ Q AV AR +LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKIVTFQKSAGFQALIQYQSRQCAVQARTSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGG  774
            QVNYNNDRSRDFTNPNLPSEQKG+SSQ  YGD  G
Sbjct  181  QVNYNNDRSRDFTNPNLPSEQKGRSSQPAYGDVVG  215



>ref|NP_001274797.1| polypyrimidine tract-binding protein homolog 3-like [Solanum 
tuberosum]
 gb|AEG89703.1| polypyrimidine tract-binding protein 1 [Solanum tuberosum]
Length=441

 Score =   414 bits (1065),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 198/218 (91%), Positives = 209/218 (96%), Gaps = 3/218 (1%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M++PSKV+HVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAV ALQF
Sbjct  1    MSDPSKVVHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVKALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y+NVQPSIRGRNVY+QFSSHQELTTMDQN Q RGDEPNRILLVTIHHMLYPITV+VLHQV
Sbjct  61   YSNVQPSIRGRNVYVQFSSHQELTTMDQNAQGRGDEPNRILLVTIHHMLYPITVDVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q  QS+VSARN+LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKIVTFQKSAGFQALIQYQVQQSSVSARNSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNN+RSRD+TNPNLPSEQKGKSSQ GYGD   MYS
Sbjct  181  QVNYNNERSRDYTNPNLPSEQKGKSSQQGYGD---MYS  215



>ref|XP_011042880.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X2 [Populus euphratica]
Length=435

 Score =   414 bits (1064),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 197/215 (92%), Positives = 205/215 (95%), Gaps = 0/215 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQ 
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQL  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YTN+QP+IRGRNVY+QFSSHQELTTMDQNTQ RGDEPNRILLVTIHHMLYPITVEVLHQV
Sbjct  61   YTNIQPTIRGRNVYVQFSSHQELTTMDQNTQGRGDEPNRILLVTIHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q+ Q AV AR +LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKIVTFQKSAGFQALIQYQSRQCAVQARTSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGG  774
            QVNYNNDRSRDFTNPNLPSEQKG+SSQ  YGD  G
Sbjct  181  QVNYNNDRSRDFTNPNLPSEQKGRSSQPAYGDVVG  215



>ref|XP_009336734.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009341177.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X2 [Pyrus x bretschneideri]
Length=438

 Score =   414 bits (1064),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 195/217 (90%), Positives = 206/217 (95%), Gaps = 0/217 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQD  +AV+ALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDTAAAVSALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y NVQP+IRGRNVY+QFSSHQELTTM QN Q RGDEPNRILLVT+HHMLYPITVEVLHQV
Sbjct  61   YANVQPAIRGRNVYVQFSSHQELTTMYQNAQGRGDEPNRILLVTVHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            F PHGFVEKIVTFQKSAGFQALIQ+Q+ QSAV+AR ALQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FVPHGFVEKIVTFQKSAGFQALIQYQSRQSAVAARTALQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            QVNYNN+RSRDFTNPNLPSEQKG+S Q GYGDAGGMY
Sbjct  181  QVNYNNERSRDFTNPNLPSEQKGRSPQSGYGDAGGMY  217



>ref|XP_004252004.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Solanum 
lycopersicum]
Length=441

 Score =   414 bits (1064),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 199/218 (91%), Positives = 208/218 (95%), Gaps = 3/218 (1%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M++PSKV+HVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAV ALQF
Sbjct  1    MSDPSKVVHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVKALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y NVQPSIRGRNVY+QFSSHQELTTMDQN Q RGDEPNRILLVTIHHMLYPITV+VLHQV
Sbjct  61   YLNVQPSIRGRNVYVQFSSHQELTTMDQNVQGRGDEPNRILLVTIHHMLYPITVDVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q  QS+VSARN+LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKIVTFQKSAGFQALIQYQVQQSSVSARNSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNN+RSRDFTNPNLPSEQKGKSSQ GYGD   MYS
Sbjct  181  QVNYNNERSRDFTNPNLPSEQKGKSSQQGYGD---MYS  215



>ref|XP_009336732.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009336733.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009341174.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009341175.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009341176.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009341178.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Pyrus x bretschneideri]
Length=444

 Score =   414 bits (1064),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 195/217 (90%), Positives = 206/217 (95%), Gaps = 0/217 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQD  +AV+ALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDTAAAVSALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y NVQP+IRGRNVY+QFSSHQELTTM QN Q RGDEPNRILLVT+HHMLYPITVEVLHQV
Sbjct  61   YANVQPAIRGRNVYVQFSSHQELTTMYQNAQGRGDEPNRILLVTVHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            F PHGFVEKIVTFQKSAGFQALIQ+Q+ QSAV+AR ALQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FVPHGFVEKIVTFQKSAGFQALIQYQSRQSAVAARTALQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            QVNYNN+RSRDFTNPNLPSEQKG+S Q GYGDAGGMY
Sbjct  181  QVNYNNERSRDFTNPNLPSEQKGRSPQSGYGDAGGMY  217



>ref|XP_012080721.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X3 [Jatropha curcas]
Length=436

 Score =   414 bits (1063),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 198/213 (93%), Positives = 206/213 (97%), Gaps = 1/213 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YTNVQP+IRGRNVY+QFSSHQELTTMDQN+Q RGDEPNRILLVTIHHMLYPITVEVLHQV
Sbjct  61   YTNVQPAIRGRNVYVQFSSHQELTTMDQNSQGRGDEPNRILLVTIHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q  QSAV+AR +LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKIVTFQKSAGFQALIQYQLRQSAVAARTSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQK-GKSSQHGYGD  765
            QVNYNNDRSRDFTNPNLPSEQK G+SSQ GY D
Sbjct  181  QVNYNNDRSRDFTNPNLPSEQKGGRSSQAGYSD  213



>gb|ACI43571.1| RBP50 [Cucurbita maxima]
Length=445

 Score =   414 bits (1063),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 207/219 (95%), Gaps = 1/219 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQDVPSAVNALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDVPSAVNALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            + NVQPSIRGRNVY+QFSSHQELTT DQN Q RGDEPNRILLVTIHHMLYPITVEVLHQV
Sbjct  61   FANVQPSIRGRNVYVQFSSHQELTTADQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            F PHGFVEKIVTFQKSAGFQALIQ+QT Q A+SAR ALQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FFPHGFVEKIVTFQKSAGFQALIQYQTRQCAISARTALQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQH-GYGDAGGMYS  783
            QVNYNN+RSRDFTNP+LPSE KG+ SQ  GYGDAGGMY+
Sbjct  181  QVNYNNERSRDFTNPSLPSEPKGRPSQQPGYGDAGGMYA  219



>ref|XP_008369222.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Malus domestica]
Length=467

 Score =   414 bits (1065),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 195/217 (90%), Positives = 206/217 (95%), Gaps = 0/217 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQD  +AV+ALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDTAAAVSALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y NVQP+IRGRNVY+QFSSHQELTTM QN Q RGDEPNRILLVT+HHMLYPITVEVLHQV
Sbjct  61   YANVQPAIRGRNVYVQFSSHQELTTMYQNAQGRGDEPNRILLVTVHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            F PHGFVEKIVTFQKSAGFQALIQ+Q+ QSAV+AR ALQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FFPHGFVEKIVTFQKSAGFQALIQYQSRQSAVAARTALQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            QVNYNN+RSRDFTNPNLPSEQKG+S Q GYGDAGGMY
Sbjct  181  QVNYNNERSRDFTNPNLPSEQKGRSPQSGYGDAGGMY  217



>ref|XP_012080720.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X2 [Jatropha curcas]
Length=443

 Score =   413 bits (1062),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 198/213 (93%), Positives = 206/213 (97%), Gaps = 1/213 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YTNVQP+IRGRNVY+QFSSHQELTTMDQN+Q RGDEPNRILLVTIHHMLYPITVEVLHQV
Sbjct  61   YTNVQPAIRGRNVYVQFSSHQELTTMDQNSQGRGDEPNRILLVTIHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q  QSAV+AR +LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKIVTFQKSAGFQALIQYQLRQSAVAARTSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQK-GKSSQHGYGD  765
            QVNYNNDRSRDFTNPNLPSEQK G+SSQ GY D
Sbjct  181  QVNYNNDRSRDFTNPNLPSEQKGGRSSQAGYSD  213



>ref|XP_008237510.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X2 [Prunus mume]
Length=438

 Score =   413 bits (1062),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 196/218 (90%), Positives = 207/218 (95%), Gaps = 0/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQD P+AV+ALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDTPAAVSALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y NVQP+IRGRNVY+QFSSHQELTTM QN Q RGDEPNRILLVTIHHMLYPITVEVLHQV
Sbjct  61   YGNVQPAIRGRNVYVQFSSHQELTTMYQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            F PHGFVEKIVTFQKSAGFQALIQ+Q+ QSAV+AR ALQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FFPHGFVEKIVTFQKSAGFQALIQYQSRQSAVAARTALQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNN+RSRDFTNPNLPSEQKG+S Q GYGDAGG+Y 
Sbjct  181  QVNYNNERSRDFTNPNLPSEQKGRSPQPGYGDAGGVYG  218



>ref|XP_007201036.1| hypothetical protein PRUPE_ppa005775mg [Prunus persica]
 ref|XP_008237509.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Prunus mume]
 gb|EMJ02235.1| hypothetical protein PRUPE_ppa005775mg [Prunus persica]
Length=444

 Score =   413 bits (1062),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 196/218 (90%), Positives = 207/218 (95%), Gaps = 0/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQD P+AV+ALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDTPAAVSALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y NVQP+IRGRNVY+QFSSHQELTTM QN Q RGDEPNRILLVTIHHMLYPITVEVLHQV
Sbjct  61   YGNVQPAIRGRNVYVQFSSHQELTTMYQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            F PHGFVEKIVTFQKSAGFQALIQ+Q+ QSAV+AR ALQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FFPHGFVEKIVTFQKSAGFQALIQYQSRQSAVAARTALQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNN+RSRDFTNPNLPSEQKG+S Q GYGDAGG+Y 
Sbjct  181  QVNYNNERSRDFTNPNLPSEQKGRSPQPGYGDAGGVYG  218



>gb|EYU20662.1| hypothetical protein MIMGU_mgv1a006642mg [Erythranthe guttata]
Length=437

 Score =   411 bits (1056),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 195/218 (89%), Positives = 210/218 (96%), Gaps = 1/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIHVRNVGHEI+ENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+ SAVNALQF
Sbjct  1    MAEPSKVIHVRNVGHEIAENDLLQLFQPFGVITKLVMLRAKNQALLQMQDITSAVNALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y+NVQPSIRGRNVY+QFSSHQELT +DQN+Q+RGDEPNR+LLVT+HHMLYPITVEVLHQV
Sbjct  61   YSNVQPSIRGRNVYVQFSSHQELTVIDQNSQARGDEPNRVLLVTVHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q  QSA+ ARN+LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKIVTFQKSAGFQALIQYQLQQSAILARNSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNN+RSRDFTNP+LPSEQKGKSSQ GYGDA GMY+
Sbjct  181  QVNYNNERSRDFTNPSLPSEQKGKSSQPGYGDA-GMYA  217



>ref|XP_006386305.1| hypothetical protein POPTR_0002s06660g [Populus trichocarpa]
 gb|ERP64102.1| hypothetical protein POPTR_0002s06660g [Populus trichocarpa]
Length=437

 Score =   411 bits (1056),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 197/216 (91%), Positives = 205/216 (95%), Gaps = 1/216 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQ 
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQL  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YTN+QP+IRGRNVY+QFSSHQELTTMDQNTQ RGDEPNRILLVTIHHMLYPITVEVLHQV
Sbjct  61   YTNIQPTIRGRNVYVQFSSHQELTTMDQNTQGRGDEPNRILLVTIHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q+ Q AV AR +LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKIVTFQKSAGFQALIQYQSRQCAVQARTSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQH-GYGDAGG  774
            QVNYNNDRSRDFTNPNLPSEQKG+SSQ   YGD  G
Sbjct  181  QVNYNNDRSRDFTNPNLPSEQKGRSSQQPAYGDVVG  216



>ref|XP_007143560.1| hypothetical protein PHAVU_007G081900g [Phaseolus vulgaris]
 gb|ESW15554.1| hypothetical protein PHAVU_007G081900g [Phaseolus vulgaris]
Length=443

 Score =   410 bits (1055),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 196/218 (90%), Positives = 208/218 (95%), Gaps = 1/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKV+HVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF
Sbjct  1    MTEPSKVVHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y N+QPSIRGRNVY+QFSSHQELTTMDQ +Q RGDEPNRILLVT+HHMLYPITV+VL QV
Sbjct  61   YANIQPSIRGRNVYVQFSSHQELTTMDQ-SQGRGDEPNRILLVTVHHMLYPITVDVLFQV  119

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHG VEKIVTFQKSAGFQALIQFQ+ QSAV+AR+ LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  120  FSPHGTVEKIVTFQKSAGFQALIQFQSRQSAVNARSTLQGRNIYDGCCQLDIQFSNLDEL  179

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNNDRSRDFTNPNLP+EQKG+ SQ GYGDAG MY+
Sbjct  180  QVNYNNDRSRDFTNPNLPTEQKGRPSQPGYGDAGNMYA  217



>ref|XP_011042879.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Populus euphratica]
Length=436

 Score =   410 bits (1053),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 197/216 (91%), Positives = 205/216 (95%), Gaps = 1/216 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQ 
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQL  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YTN+QP+IRGRNVY+QFSSHQELTTMDQNTQ RGDEPNRILLVTIHHMLYPITVEVLHQV
Sbjct  61   YTNIQPTIRGRNVYVQFSSHQELTTMDQNTQGRGDEPNRILLVTIHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q+ Q AV AR +LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKIVTFQKSAGFQALIQYQSRQCAVQARTSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQH-GYGDAGG  774
            QVNYNNDRSRDFTNPNLPSEQKG+SSQ   YGD  G
Sbjct  181  QVNYNNDRSRDFTNPNLPSEQKGRSSQQPAYGDVVG  216



>ref|XP_006434492.1| hypothetical protein CICLE_v10001148mg [Citrus clementina]
 gb|ESR47732.1| hypothetical protein CICLE_v10001148mg [Citrus clementina]
Length=437

 Score =   410 bits (1053),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 194/214 (91%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YTNVQP+IRGRNVY+QFSSHQELTTM+QN Q RGDEPNRILLVTIHHMLYPITVEVLHQV
Sbjct  61   YTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q   SAV AR++LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAG  771
            QVNYNN+RSRDFTNPNLP+EQKG+ SQ GY +AG
Sbjct  181  QVNYNNERSRDFTNPNLPAEQKGRPSQSGYSEAG  214



>gb|KJB28976.1| hypothetical protein B456_005G078200 [Gossypium raimondii]
 gb|KJB28977.1| hypothetical protein B456_005G078200 [Gossypium raimondii]
Length=438

 Score =   410 bits (1053),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 207/215 (96%), Gaps = 1/215 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+PSA+NA+QF
Sbjct  1    MAEASKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIPSAINAMQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YTNVQP+IRGRNVY+QFSSHQELTTMDQN Q RGDEPNRILLVTIHHMLYPITVEVLHQV
Sbjct  61   YTNVQPTIRGRNVYVQFSSHQELTTMDQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q  Q+A+SAR +LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKIVTFQKSAGFQALIQYQGRQNAISARTSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQH-GYGDAG  771
            QV+YNN+RSRDFTNPNLP+EQKG+SSQH GYGDAG
Sbjct  181  QVHYNNERSRDFTNPNLPTEQKGRSSQHPGYGDAG  215



>ref|XP_006473080.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Citrus sinensis]
 gb|KDO83776.1| hypothetical protein CISIN_1g013267mg [Citrus sinensis]
Length=437

 Score =   410 bits (1053),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 194/214 (91%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YTNVQP+IRGRNVY+QFSSHQELTTM+QN Q RGDEPNRILLVTIHHMLYPITVEVLHQV
Sbjct  61   YTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q   SAV AR++LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAG  771
            QVNYNN+RSRDFTNPNLP+EQKG+ SQ GY +AG
Sbjct  181  QVNYNNERSRDFTNPNLPAEQKGRPSQSGYSEAG  214



>gb|KHG00384.1| hypothetical protein F383_17340 [Gossypium arboreum]
Length=445

 Score =   410 bits (1054),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 207/215 (96%), Gaps = 1/215 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+PSA+NA+QF
Sbjct  1    MAEASKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIPSAINAMQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YTNVQP+IRGRNVY+QFSSHQELTTMDQN Q RGDEPNRILLVTIHHMLYPITVEVLHQV
Sbjct  61   YTNVQPTIRGRNVYVQFSSHQELTTMDQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q  Q+A+SAR +LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKIVTFQKSAGFQALIQYQGRQNAISARTSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQH-GYGDAG  771
            QV+YNN+RSRDFTNPNLP+EQKG+SSQH GYGDAG
Sbjct  181  QVHYNNERSRDFTNPNLPTEQKGRSSQHPGYGDAG  215



>ref|XP_012080719.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Jatropha curcas]
Length=444

 Score =   410 bits (1053),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 197/214 (92%), Positives = 204/214 (95%), Gaps = 2/214 (1%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YTNVQP+IRGRNVY+QFSSHQELTTMDQN+Q RGDEPNRILLVTIHHMLYPITVEVLHQV
Sbjct  61   YTNVQPAIRGRNVYVQFSSHQELTTMDQNSQGRGDEPNRILLVTIHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q  QSAV+AR +LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKIVTFQKSAGFQALIQYQLRQSAVAARTSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKG--KSSQHGYGD  765
            QVNYNNDRSRDFTNPNLPSEQKG   S Q GY D
Sbjct  181  QVNYNNDRSRDFTNPNLPSEQKGGRSSQQAGYSD  214



>ref|XP_003536416.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Glycine max]
 gb|KHN17024.1| Polypyrimidine tract-binding protein like 3 [Glycine soja]
Length=443

 Score =   409 bits (1052),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 195/218 (89%), Positives = 209/218 (96%), Gaps = 1/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQDVPSAVNALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDVPSAVNALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y NVQPSIRGRNVY+QFSSHQELTTMDQ +Q RGDEPNRILLVT+HHMLYP+TV+VL+QV
Sbjct  61   YANVQPSIRGRNVYVQFSSHQELTTMDQ-SQGRGDEPNRILLVTVHHMLYPMTVDVLYQV  119

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHG VEKIVTFQKSAGFQALIQ+Q+ QSAV+AR+ LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  120  FSPHGSVEKIVTFQKSAGFQALIQYQSRQSAVAARSTLQGRNIYDGCCQLDIQFSNLDEL  179

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNNDRSRDFTNPNLP+EQKG+ SQ GYGDAG MY+
Sbjct  180  QVNYNNDRSRDFTNPNLPTEQKGRPSQPGYGDAGNMYA  217



>gb|KCW71107.1| hypothetical protein EUGRSUZ_F04205 [Eucalyptus grandis]
Length=319

 Score =   404 bits (1039),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 192/218 (88%), Positives = 209/218 (96%), Gaps = 1/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M E SKVIH+RNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NA+Q 
Sbjct  1    MAEASKVIHIRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINAMQV  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y+NVQP+IRGRNVY+QFSSHQELTT+DQNTQ RGDEPNRI+LVTIHHMLYPITVEVLHQV
Sbjct  61   YSNVQPTIRGRNVYVQFSSHQELTTVDQNTQGRGDEPNRIVLVTIHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSP+GFVEKIVTFQKSAGFQALIQ+Q+ QSAVSA  ALQGRNIYDGCCQLDIQ+SNLDEL
Sbjct  121  FSPYGFVEKIVTFQKSAGFQALIQYQSRQSAVSAITALQGRNIYDGCCQLDIQYSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQH-GYGDAGGMY  780
            QVN+NN+RSRDFTNPNLP+EQ+G+SSQ  GYGDAGGMY
Sbjct  181  QVNFNNERSRDFTNPNLPAEQRGRSSQQAGYGDAGGMY  218



>ref|NP_001242751.1| uncharacterized protein LOC100819672 [Glycine max]
 gb|ACU20184.1| unknown [Glycine max]
Length=431

 Score =   407 bits (1047),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 194/218 (89%), Positives = 209/218 (96%), Gaps = 1/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQDVPSAVNALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDVPSAVNALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y NVQPSIRGRNVY+QFSSHQELTTM+Q +Q RGDEPNRILLVT+HHMLYP+TV+VL+QV
Sbjct  61   YANVQPSIRGRNVYVQFSSHQELTTMEQ-SQGRGDEPNRILLVTVHHMLYPMTVDVLYQV  119

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHG VEKIVTFQKSAGFQALIQ+Q+ QSAV+AR+ LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  120  FSPHGSVEKIVTFQKSAGFQALIQYQSRQSAVAARSTLQGRNIYDGCCQLDIQFSNLDEL  179

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNNDRSRDFTNPNLP+EQKG+ SQ GYGDAG MY+
Sbjct  180  QVNYNNDRSRDFTNPNLPTEQKGRPSQPGYGDAGNMYA  217



>ref|XP_006605400.1| PREDICTED: uncharacterized protein LOC100819672 isoform X1 [Glycine 
max]
 ref|XP_006605401.1| PREDICTED: uncharacterized protein LOC100819672 isoform X2 [Glycine 
max]
 ref|XP_006605402.1| PREDICTED: uncharacterized protein LOC100819672 isoform X3 [Glycine 
max]
Length=443

 Score =   408 bits (1048),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 194/218 (89%), Positives = 209/218 (96%), Gaps = 1/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQDVPSAVNALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDVPSAVNALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y NVQPSIRGRNVY+QFSSHQELTTM+Q +Q RGDEPNRILLVT+HHMLYP+TV+VL+QV
Sbjct  61   YANVQPSIRGRNVYVQFSSHQELTTMEQ-SQGRGDEPNRILLVTVHHMLYPMTVDVLYQV  119

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHG VEKIVTFQKSAGFQALIQ+Q+ QSAV+AR+ LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  120  FSPHGSVEKIVTFQKSAGFQALIQYQSRQSAVAARSTLQGRNIYDGCCQLDIQFSNLDEL  179

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNNDRSRDFTNPNLP+EQKG+ SQ GYGDAG MY+
Sbjct  180  QVNYNNDRSRDFTNPNLPTEQKGRPSQPGYGDAGNMYA  217



>ref|XP_010260994.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Nelumbo nucifera]
Length=447

 Score =   408 bits (1048),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 197/222 (89%), Positives = 208/222 (94%), Gaps = 4/222 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIH+RNVGHEISENDLLQL QPFGV+TKLVMLRAKNQALLQM DV SAVNAL +
Sbjct  1    MTEPSKVIHIRNVGHEISENDLLQLVQPFGVVTKLVMLRAKNQALLQMHDVASAVNALHY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR-GDE---PNRILLVTIHHMLYPITVEV  477
            YTNVQPS+RGRNVYIQFSSHQELTTMDQN Q R GD+   PNRILLVTIHH+LYPITVEV
Sbjct  61   YTNVQPSVRGRNVYIQFSSHQELTTMDQNAQGRKGDQDTQPNRILLVTIHHLLYPITVEV  120

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            LHQVFSPHGFVEKIVTFQKSAGFQALIQ+Q+ QSAVSAR ALQGRNIYDGCCQLDIQFSN
Sbjct  121  LHQVFSPHGFVEKIVTFQKSAGFQALIQYQSRQSAVSARTALQGRNIYDGCCQLDIQFSN  180

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            L ELQVNYNN+RSRDFTNP+LPSEQKG+SSQ GYGDAGGMYS
Sbjct  181  LSELQVNYNNERSRDFTNPSLPSEQKGRSSQSGYGDAGGMYS  222



>gb|KHN46405.1| Polypyrimidine tract-binding protein like 3 [Glycine soja]
Length=443

 Score =   408 bits (1048),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 194/218 (89%), Positives = 209/218 (96%), Gaps = 1/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQDVPSAVNALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDVPSAVNALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y NVQPSIRGRNVY+QFSSHQELTTM+Q +Q RGDEPNRILLVT+HHMLYP+TV+VL+QV
Sbjct  61   YANVQPSIRGRNVYVQFSSHQELTTMEQ-SQGRGDEPNRILLVTVHHMLYPMTVDVLYQV  119

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHG VEKIVTFQKSAGFQALIQ+Q+ QSAV+AR+ LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  120  FSPHGSVEKIVTFQKSAGFQALIQYQSRQSAVAARSTLQGRNIYDGCCQLDIQFSNLDEL  179

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            QVNYNNDRSRDFTNPNLP+EQKG+ SQ GYGDAG MY+
Sbjct  180  QVNYNNDRSRDFTNPNLPTEQKGRPSQPGYGDAGNMYA  217



>ref|XP_010063840.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Eucalyptus grandis]
 ref|XP_010063841.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Eucalyptus grandis]
 gb|KCW71106.1| hypothetical protein EUGRSUZ_F04205 [Eucalyptus grandis]
Length=445

 Score =   407 bits (1047),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 192/218 (88%), Positives = 209/218 (96%), Gaps = 1/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M E SKVIH+RNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NA+Q 
Sbjct  1    MAEASKVIHIRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINAMQV  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y+NVQP+IRGRNVY+QFSSHQELTT+DQNTQ RGDEPNRI+LVTIHHMLYPITVEVLHQV
Sbjct  61   YSNVQPTIRGRNVYVQFSSHQELTTVDQNTQGRGDEPNRIVLVTIHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSP+GFVEKIVTFQKSAGFQALIQ+Q+ QSAVSA  ALQGRNIYDGCCQLDIQ+SNLDEL
Sbjct  121  FSPYGFVEKIVTFQKSAGFQALIQYQSRQSAVSAITALQGRNIYDGCCQLDIQYSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQH-GYGDAGGMY  780
            QVN+NN+RSRDFTNPNLP+EQ+G+SSQ  GYGDAGGMY
Sbjct  181  QVNFNNERSRDFTNPNLPAEQRGRSSQQAGYGDAGGMY  218



>ref|XP_004290497.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Fragaria 
vesca subsp. vesca]
Length=445

 Score =   407 bits (1046),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 194/219 (89%), Positives = 206/219 (94%), Gaps = 1/219 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQD  +AV+ALQF
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDTAAAVSALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y NVQP++RGRNVY+QFSSHQELTTM QN Q RGDEPNRILLVT+HHMLYPITVEVLHQV
Sbjct  61   YANVQPAVRGRNVYVQFSSHQELTTMYQNAQGRGDEPNRILLVTVHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            F PHGFVEKIVTFQKSAGFQALIQ+Q+ QSAV+AR ALQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FFPHGFVEKIVTFQKSAGFQALIQYQSRQSAVAARTALQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDA-GGMYS  783
            QVNYNN+RSRDFTNPNLPSEQKG+S Q GYGDA GGMY 
Sbjct  181  QVNYNNERSRDFTNPNLPSEQKGRSPQPGYGDAGGGMYG  219



>ref|XP_011044257.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X4 [Populus euphratica]
Length=435

 Score =   405 bits (1042),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 192/215 (89%), Positives = 205/215 (95%), Gaps = 0/215 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQ+
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YT+VQP+IRGRNVY+QFSSHQELTTMDQNTQ RG+EPNRILL+TIHHM YPITV+VLHQV
Sbjct  61   YTDVQPTIRGRNVYVQFSSHQELTTMDQNTQGRGEEPNRILLITIHHMQYPITVDVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEK+VTFQKSAGFQALIQ+Q+ QSAV AR +LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKMVTFQKSAGFQALIQYQSRQSAVQARTSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGG  774
            QVNYNND SRDFTNPNLPSEQK +SSQ  YGDA G
Sbjct  181  QVNYNNDSSRDFTNPNLPSEQKARSSQPSYGDAVG  215



>ref|XP_010246265.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Nelumbo nucifera]
Length=447

 Score =   405 bits (1041),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 193/222 (87%), Positives = 208/222 (94%), Gaps = 4/222 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIH+RNVGHEISENDLLQL QPFGV+TKLVMLRAKNQALLQM DV SAVNALQ+
Sbjct  1    MTEPSKVIHIRNVGHEISENDLLQLVQPFGVVTKLVMLRAKNQALLQMHDVASAVNALQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE----PNRILLVTIHHMLYPITVEV  477
            YTN+QPS+RGRNVYIQFSSHQELTTMDQN Q R  +    PNRILLVTIHHMLYPITVEV
Sbjct  61   YTNIQPSVRGRNVYIQFSSHQELTTMDQNAQGRKTDQDTQPNRILLVTIHHMLYPITVEV  120

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            LHQVFSPHGFVEKIVTFQKSAGFQAL+Q+Q+ Q+AVSAR+ALQGRNIYDGCCQLDIQFSN
Sbjct  121  LHQVFSPHGFVEKIVTFQKSAGFQALVQYQSRQNAVSARSALQGRNIYDGCCQLDIQFSN  180

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            L ELQVNYNN+RSRDFTNP+LPSEQKG+SSQ GYGDAGGMY+
Sbjct  181  LSELQVNYNNERSRDFTNPSLPSEQKGRSSQPGYGDAGGMYA  222



>ref|XP_006351367.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Solanum tuberosum]
Length=444

 Score =   405 bits (1040),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/217 (88%), Positives = 206/217 (95%), Gaps = 0/217 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVG EISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+ +AVNA+QF
Sbjct  1    MTEPSKVIHVRNVGQEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIAAAVNAMQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y+NVQPSIRGR+VY+QFSSHQELTT+DQN Q RGDEPNRILLV+IHH+LYPITVEVLHQV
Sbjct  61   YSNVQPSIRGRSVYVQFSSHQELTTVDQNAQGRGDEPNRILLVSIHHVLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHG VEKIVTFQKSAGFQALIQ++  Q+A+SARN+LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGIVEKIVTFQKSAGFQALIQYELTQTAISARNSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            QV+YNN+RSRDFTNPNLPSE KGKS Q GYGDAG MY
Sbjct  181  QVSYNNERSRDFTNPNLPSEPKGKSPQQGYGDAGAMY  217



>ref|XP_011044256.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X3 [Populus euphratica]
Length=435

 Score =   404 bits (1037),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 191/215 (89%), Positives = 204/215 (95%), Gaps = 0/215 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQ+
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YT+VQP+IRGRNVY+QFSSHQELTTMDQNTQ RG+EPNRILL+TIHHM YPITV+VLHQV
Sbjct  61   YTDVQPTIRGRNVYVQFSSHQELTTMDQNTQGRGEEPNRILLITIHHMQYPITVDVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEK+VTFQKSAGFQALIQ+Q+ QSAV AR +LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKMVTFQKSAGFQALIQYQSRQSAVQARTSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGG  774
            QVNYNND SRDFTNPNLPSEQK +SSQ  YGD  G
Sbjct  181  QVNYNNDSSRDFTNPNLPSEQKARSSQPSYGDVVG  215



>ref|XP_010260993.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Nelumbo nucifera]
Length=448

 Score =   404 bits (1038),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 197/223 (88%), Positives = 208/223 (93%), Gaps = 5/223 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIH+RNVGHEISENDLLQL QPFGV+TKLVMLRAKNQALLQM DV SAVNAL +
Sbjct  1    MTEPSKVIHIRNVGHEISENDLLQLVQPFGVVTKLVMLRAKNQALLQMHDVASAVNALHY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR-GDE---PNRILLVTIHHMLYPITVEV  477
            YTNVQPS+RGRNVYIQFSSHQELTTMDQN Q R GD+   PNRILLVTIHH+LYPITVEV
Sbjct  61   YTNVQPSVRGRNVYIQFSSHQELTTMDQNAQGRKGDQDTQPNRILLVTIHHLLYPITVEV  120

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            LHQVFSPHGFVEKIVTFQKSAGFQALIQ+Q+ QSAVSAR ALQGRNIYDGCCQLDIQFSN
Sbjct  121  LHQVFSPHGFVEKIVTFQKSAGFQALIQYQSRQSAVSARTALQGRNIYDGCCQLDIQFSN  180

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH-GYGDAGGMYS  783
            L ELQVNYNN+RSRDFTNP+LPSEQKG+SSQ  GYGDAGGMYS
Sbjct  181  LSELQVNYNNERSRDFTNPSLPSEQKGRSSQQSGYGDAGGMYS  223



>gb|AEG89704.1| polypyrimidine tract-binding protein 6 [Solanum tuberosum]
Length=444

 Score =   403 bits (1035),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 189/217 (87%), Positives = 205/217 (94%), Gaps = 0/217 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVG EISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+ +AVNA+QF
Sbjct  1    MTEPSKVIHVRNVGQEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIAAAVNAMQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y+NVQPSIRGR+VY+QFSSHQELTT+DQN Q RGDEPNRILLV+IHH+LYPITVEVLHQV
Sbjct  61   YSNVQPSIRGRSVYVQFSSHQELTTVDQNAQGRGDEPNRILLVSIHHVLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHG VEKIVTFQKSAGFQALIQ++  Q+A+SARN+LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGIVEKIVTFQKSAGFQALIQYELTQTAISARNSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            QV+YNN+R RDFTNPNLPSE KGKS Q GYGDAG MY
Sbjct  181  QVSYNNERPRDFTNPNLPSEPKGKSPQQGYGDAGAMY  217



>ref|XP_008384421.1| PREDICTED: LOW QUALITY PROTEIN: polypyrimidine tract-binding 
protein homolog 3-like [Malus domestica]
Length=428

 Score =   401 bits (1031),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 189/217 (87%), Positives = 204/217 (94%), Gaps = 0/217 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPS VIHVRNVGHEISENDLL+LFQPFGVITKLVMLRAKNQAL+QMQD  +AV+ALQF
Sbjct  1    MTEPSNVIHVRNVGHEISENDLLRLFQPFGVITKLVMLRAKNQALIQMQDTTAAVSALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y NVQP++RGRNVY+QFSSHQELTTM QN Q RG+EPN+ILLVTIHHMLYPITVEVLHQV
Sbjct  61   YANVQPALRGRNVYVQFSSHQELTTMYQNAQGRGNEPNQILLVTIHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQ SAGFQALIQ+Q+ QSA++AR ALQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKIVTFQMSAGFQALIQYQSRQSAIAARTALQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            QVNYNN+RSRDFTNPNLPSEQ G+S Q GYGDAGGMY
Sbjct  181  QVNYNNERSRDFTNPNLPSEQIGRSPQPGYGDAGGMY  217



>ref|XP_011044254.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X2 [Populus euphratica]
Length=436

 Score =   401 bits (1031),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 192/216 (89%), Positives = 205/216 (95%), Gaps = 1/216 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQ+
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YT+VQP+IRGRNVY+QFSSHQELTTMDQNTQ RG+EPNRILL+TIHHM YPITV+VLHQV
Sbjct  61   YTDVQPTIRGRNVYVQFSSHQELTTMDQNTQGRGEEPNRILLITIHHMQYPITVDVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEK+VTFQKSAGFQALIQ+Q+ QSAV AR +LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKMVTFQKSAGFQALIQYQSRQSAVQARTSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQH-GYGDAGG  774
            QVNYNND SRDFTNPNLPSEQK +SSQ   YGDA G
Sbjct  181  QVNYNNDSSRDFTNPNLPSEQKARSSQQPSYGDAVG  216



>ref|XP_011044253.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Populus euphratica]
 ref|XP_011044258.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Populus euphratica]
Length=436

 Score =   399 bits (1026),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 191/216 (88%), Positives = 204/216 (94%), Gaps = 1/216 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQ+
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YT+VQP+IRGRNVY+QFSSHQELTTMDQNTQ RG+EPNRILL+TIHHM YPITV+VLHQV
Sbjct  61   YTDVQPTIRGRNVYVQFSSHQELTTMDQNTQGRGEEPNRILLITIHHMQYPITVDVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEK+VTFQKSAGFQALIQ+Q+ QSAV AR +LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKMVTFQKSAGFQALIQYQSRQSAVQARTSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQH-GYGDAGG  774
            QVNYNND SRDFTNPNLPSEQK +SSQ   YGD  G
Sbjct  181  QVNYNNDSSRDFTNPNLPSEQKARSSQQPSYGDVVG  216



>ref|XP_004249306.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Solanum lycopersicum]
 ref|XP_010312158.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Solanum lycopersicum]
Length=444

 Score =   400 bits (1027),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 187/217 (86%), Positives = 206/217 (95%), Gaps = 0/217 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVG EISENDLLQLFQPFGVITKLVMLRAKNQALLQMQ++ +AVNA+QF
Sbjct  1    MTEPSKVIHVRNVGQEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQEIGAAVNAMQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y+NVQPSIRGR+VY+QFSSHQELTT+DQN Q RGDEPNRILLV+IHH+LYPITVEVLHQV
Sbjct  61   YSNVQPSIRGRSVYVQFSSHQELTTVDQNAQGRGDEPNRILLVSIHHVLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHG +EKIVTFQKSAGFQALIQ++  Q+A+SARN+LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGIIEKIVTFQKSAGFQALIQYELTQTAISARNSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            QV+YNN+RSRDFTNPNLPSE KGKS Q GYGDAG +Y
Sbjct  181  QVSYNNERSRDFTNPNLPSEPKGKSPQQGYGDAGALY  217



>emb|CBI21552.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   396 bits (1018),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 193/222 (87%), Positives = 207/222 (93%), Gaps = 4/222 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVG EISENDLLQL  PFGV+TKLVMLRAKNQALLQMQDV SAV+ALQ+
Sbjct  1    MTEPSKVIHVRNVGPEISENDLLQLVHPFGVVTKLVMLRAKNQALLQMQDVASAVSALQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR-GDE---PNRILLVTIHHMLYPITVEV  477
            Y NVQPS+RGRNVY+QFSSHQELTTMDQN+Q R GD+   PNRILLVTIHH+LYPITVEV
Sbjct  61   YANVQPSVRGRNVYVQFSSHQELTTMDQNSQGRKGDQDAQPNRILLVTIHHLLYPITVEV  120

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            LHQVFSPHGFVEKIVTFQKSAGFQALIQ+Q+ QSAVSA NALQGRNIYDGCCQLDIQFSN
Sbjct  121  LHQVFSPHGFVEKIVTFQKSAGFQALIQYQSRQSAVSAINALQGRNIYDGCCQLDIQFSN  180

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            L ELQVNYNN+RSRDFTNP+LPSEQKG+SSQ GYGD GGMY+
Sbjct  181  LTELQVNYNNERSRDFTNPSLPSEQKGRSSQSGYGDGGGMYA  222



>ref|XP_002306709.2| hypothetical protein POPTR_0005s21660g, partial [Populus trichocarpa]
 gb|EEE93705.2| hypothetical protein POPTR_0005s21660g, partial [Populus trichocarpa]
Length=520

 Score =   401 bits (1031),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 204/214 (95%), Gaps = 1/214 (0%)
 Frame = +1

Query  127  KMTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQ  306
            KMTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQ
Sbjct  90   KMTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQ  149

Query  307  FYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQ  486
            +YT+VQP+IRGRNVYIQFSSHQELTTMDQNTQ RG+EPNRILL+TIHHM YPITV+VLHQ
Sbjct  150  YYTDVQPTIRGRNVYIQFSSHQELTTMDQNTQGRGEEPNRILLITIHHMQYPITVDVLHQ  209

Query  487  VFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDE  666
            VFSPHGFVEK+VTFQKSAGFQALIQ+Q+ QSAV AR +LQGRNIYDGCCQLDIQFSNLDE
Sbjct  210  VFSPHGFVEKMVTFQKSAGFQALIQYQSRQSAVQARTSLQGRNIYDGCCQLDIQFSNLDE  269

Query  667  LQVNYNNDRSRDFTNPNLPSEQKGKSSQH-GYGD  765
            LQVNYNND SRDFTNPNLPSEQK +SSQ   YGD
Sbjct  270  LQVNYNNDSSRDFTNPNLPSEQKARSSQQPSYGD  303



>ref|XP_002277938.2| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Vitis vinifera]
Length=448

 Score =   397 bits (1021),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 193/222 (87%), Positives = 207/222 (93%), Gaps = 4/222 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVG EISENDLLQL  PFGV+TKLVMLRAKNQALLQMQDV SAV+ALQ+
Sbjct  1    MTEPSKVIHVRNVGPEISENDLLQLVHPFGVVTKLVMLRAKNQALLQMQDVASAVSALQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR-GDE---PNRILLVTIHHMLYPITVEV  477
            Y NVQPS+RGRNVY+QFSSHQELTTMDQN+Q R GD+   PNRILLVTIHH+LYPITVEV
Sbjct  61   YANVQPSVRGRNVYVQFSSHQELTTMDQNSQGRKGDQDAQPNRILLVTIHHLLYPITVEV  120

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            LHQVFSPHGFVEKIVTFQKSAGFQALIQ+Q+ QSAVSA NALQGRNIYDGCCQLDIQFSN
Sbjct  121  LHQVFSPHGFVEKIVTFQKSAGFQALIQYQSRQSAVSAINALQGRNIYDGCCQLDIQFSN  180

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            L ELQVNYNN+RSRDFTNP+LPSEQKG+SSQ GYGD GGMY+
Sbjct  181  LTELQVNYNNERSRDFTNPSLPSEQKGRSSQSGYGDGGGMYA  222



>emb|CAN82466.1| hypothetical protein VITISV_002663 [Vitis vinifera]
Length=476

 Score =   398 bits (1022),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 193/222 (87%), Positives = 207/222 (93%), Gaps = 4/222 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVG EISENDLLQL  PFGV+TKLVMLRAKNQALLQMQDV SAV+ALQ+
Sbjct  1    MTEPSKVIHVRNVGPEISENDLLQLVHPFGVVTKLVMLRAKNQALLQMQDVASAVSALQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR-GDE---PNRILLVTIHHMLYPITVEV  477
            Y NVQPS+RGRNVY+QFSSHQELTTMDQN+Q R GD+   PNRILLVTIHH+LYPITVEV
Sbjct  61   YANVQPSVRGRNVYVQFSSHQELTTMDQNSQGRKGDQDAQPNRILLVTIHHLLYPITVEV  120

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            LHQVFSPHGFVEKIVTFQKSAGFQALIQ+Q+ QSAVSA NALQGRNIYDGCCQLDIQFSN
Sbjct  121  LHQVFSPHGFVEKIVTFQKSAGFQALIQYQSRQSAVSAINALQGRNIYDGCCQLDIQFSN  180

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            L ELQVNYNN+RSRDFTNP+LPSEQKG+SSQ GYGD GGMY+
Sbjct  181  LTELQVNYNNERSRDFTNPSLPSEQKGRSSQSGYGDGGGMYA  222



>ref|XP_003592082.1| Polypyrimidine tract-binding protein-like protein [Medicago truncatula]
 gb|AES62333.1| polypyrimidine tract-binding-like protein [Medicago truncatula]
 gb|AFK34374.1| unknown [Medicago truncatula]
Length=443

 Score =   396 bits (1017),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 189/217 (87%), Positives = 204/217 (94%), Gaps = 1/217 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQDVPSAV+AL F
Sbjct  1    MAEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDVPSAVSALHF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y N QPSIRGRNVY+QFSSHQELTT+DQ +Q RGDEPNRILLVTIHH+LYPITV+VL+QV
Sbjct  61   YGNTQPSIRGRNVYVQFSSHQELTTIDQ-SQGRGDEPNRILLVTIHHVLYPITVDVLYQV  119

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHG VEKIVTFQKSAGFQALIQ+Q+ QS+++AR ALQGRNIYDGCCQLDIQFSNLDEL
Sbjct  120  FSPHGSVEKIVTFQKSAGFQALIQYQSQQSSITARTALQGRNIYDGCCQLDIQFSNLDEL  179

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            QVNYNNDRSRDFTNPNLP+EQKG+  Q GYGDAG MY
Sbjct  180  QVNYNNDRSRDFTNPNLPTEQKGRPPQLGYGDAGNMY  216



>ref|XP_010681101.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Beta vulgaris subsp. vulgaris]
Length=443

 Score =   395 bits (1014),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 186/217 (86%), Positives = 202/217 (93%), Gaps = 0/217 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M+E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQDVPSAVN LQ+
Sbjct  1    MSEASKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALVQMQDVPSAVNILQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YTN QP+IRGRNVYIQFSSHQELTTMDQN+  RGDEPNRILLVTIH ++YPITV+VLHQV
Sbjct  61   YTNTQPTIRGRNVYIQFSSHQELTTMDQNSHGRGDEPNRILLVTIHQLVYPITVDVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHG VEKIVTFQKSAGFQALIQ+Q+  SAV+ARN LQGRNIYDGCCQLDIQ+SNLDEL
Sbjct  121  FSPHGLVEKIVTFQKSAGFQALIQYQSRHSAVTARNLLQGRNIYDGCCQLDIQYSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            QVNYNN+R+RDFTN +LPSE KG+SSQ GY D GGMY
Sbjct  181  QVNYNNERTRDFTNSSLPSEPKGRSSQPGYADGGGMY  217



>ref|XP_010912014.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Elaeis guineensis]
Length=453

 Score =   395 bits (1014),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 188/222 (85%), Positives = 207/222 (93%), Gaps = 4/222 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIH+RNVGHEISENDLLQL QPFG + KLVMLRAKNQALLQM D+PSAVN LQ+
Sbjct  1    MTEPSKVIHIRNVGHEISENDLLQLVQPFGPVNKLVMLRAKNQALLQMHDLPSAVNVLQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR-GDE---PNRILLVTIHHMLYPITVEV  477
            Y+NVQPS+RGRNVYIQFSSHQELTT DQN+Q R GD+   PNRILLVTIHHMLYPITVEV
Sbjct  61   YSNVQPSVRGRNVYIQFSSHQELTTADQNSQGRRGDQDSQPNRILLVTIHHMLYPITVEV  120

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            LHQVFSPHGFVEKIVTFQKSAGFQALIQ+Q+ QSA+ AR ALQGRNIYDGCCQLDIQFSN
Sbjct  121  LHQVFSPHGFVEKIVTFQKSAGFQALIQYQSRQSALQARTALQGRNIYDGCCQLDIQFSN  180

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            L+ELQVNYNN+RSRDFTNP+LP+EQ+G+SSQ GYGDAGG+Y+
Sbjct  181  LNELQVNYNNERSRDFTNPSLPTEQRGRSSQSGYGDAGGLYA  222



>ref|XP_010912015.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Elaeis guineensis]
Length=446

 Score =   394 bits (1013),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 188/222 (85%), Positives = 207/222 (93%), Gaps = 4/222 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIH+RNVGHEISENDLLQL QPFG + KLVMLRAKNQALLQM D+PSAVN LQ+
Sbjct  1    MTEPSKVIHIRNVGHEISENDLLQLVQPFGPVNKLVMLRAKNQALLQMHDLPSAVNVLQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR-GDE---PNRILLVTIHHMLYPITVEV  477
            Y+NVQPS+RGRNVYIQFSSHQELTT DQN+Q R GD+   PNRILLVTIHHMLYPITVEV
Sbjct  61   YSNVQPSVRGRNVYIQFSSHQELTTADQNSQGRRGDQDSQPNRILLVTIHHMLYPITVEV  120

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            LHQVFSPHGFVEKIVTFQKSAGFQALIQ+Q+ QSA+ AR ALQGRNIYDGCCQLDIQFSN
Sbjct  121  LHQVFSPHGFVEKIVTFQKSAGFQALIQYQSRQSALQARTALQGRNIYDGCCQLDIQFSN  180

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            L+ELQVNYNN+RSRDFTNP+LP+EQ+G+SSQ GYGDAGG+Y+
Sbjct  181  LNELQVNYNNERSRDFTNPSLPTEQRGRSSQSGYGDAGGLYA  222



>ref|XP_010927400.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010927401.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010927402.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Elaeis guineensis]
Length=446

 Score =   394 bits (1012),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/222 (85%), Positives = 207/222 (93%), Gaps = 4/222 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIH+RNVGHEISENDLLQL QPFG + KLVMLRAKNQAL+QM D+PSAVN LQ+
Sbjct  1    MTEPSKVIHIRNVGHEISENDLLQLVQPFGPVNKLVMLRAKNQALIQMHDLPSAVNVLQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR-GDE---PNRILLVTIHHMLYPITVEV  477
            YTNVQPS+RGRNVYIQFSSHQELTT DQN+Q R GD+   PNRILLVTIHHMLYPITVEV
Sbjct  61   YTNVQPSVRGRNVYIQFSSHQELTTADQNSQGRKGDQDSQPNRILLVTIHHMLYPITVEV  120

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            LHQVFSPHGFVEKIVTFQKSAGFQALIQ+Q+ QSAV AR+ LQGRNIYDGCCQLDIQFSN
Sbjct  121  LHQVFSPHGFVEKIVTFQKSAGFQALIQYQSRQSAVQARSTLQGRNIYDGCCQLDIQFSN  180

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            L+ELQVNYNN+RSRDFTNP+LP+EQ+G+SSQ GYGDAGG+Y+
Sbjct  181  LNELQVNYNNERSRDFTNPSLPTEQRGRSSQTGYGDAGGLYT  222



>ref|XP_006395995.1| hypothetical protein EUTSA_v10004261mg [Eutrema salsugineum]
 ref|XP_006395996.1| hypothetical protein EUTSA_v10004261mg [Eutrema salsugineum]
 gb|ESQ33281.1| hypothetical protein EUTSA_v10004261mg [Eutrema salsugineum]
 gb|ESQ33282.1| hypothetical protein EUTSA_v10004261mg [Eutrema salsugineum]
Length=432

 Score =   392 bits (1008),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 188/217 (87%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDV SAV+ALQF
Sbjct  1    MAESSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVSSAVSALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            +TNVQP+IRGRNVYIQFSSHQELTT++QN   R DEPNRILLVTIHHMLYPITV+VLHQV
Sbjct  61   FTNVQPTIRGRNVYIQFSSHQELTTIEQNIHGREDEPNRILLVTIHHMLYPITVDVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSP+GFVEK+VTFQKSAGFQALIQ+Q  Q A SAR ALQGRNIYDGCCQLDIQFSNL+EL
Sbjct  121  FSPYGFVEKLVTFQKSAGFQALIQYQAQQCAASARTALQGRNIYDGCCQLDIQFSNLEEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            QVNYNNDRSRD+TNPNLPSEQKG+SS  GYGD G  Y
Sbjct  181  QVNYNNDRSRDYTNPNLPSEQKGRSSHPGYGDVGVAY  217



>ref|XP_009385102.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Musa acuminata subsp. malaccensis]
Length=447

 Score =   393 bits (1009),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 187/222 (84%), Positives = 208/222 (94%), Gaps = 4/222 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIH+RNVGHEISENDLLQL QPFGV+TKLVMLRAKNQALLQM D+ SAVN LQ+
Sbjct  1    MTEPSKVIHIRNVGHEISENDLLQLVQPFGVVTKLVMLRAKNQALLQMHDLTSAVNVLQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR-GDE---PNRILLVTIHHMLYPITVEV  477
            YT+VQPS+RGRNVYIQFSSHQELTT DQN+Q R GD+   PNRILLVTIHHMLYPITVEV
Sbjct  61   YTSVQPSVRGRNVYIQFSSHQELTTADQNSQGRKGDQDSQPNRILLVTIHHMLYPITVEV  120

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            LHQVFSP+GFVEKIVTFQKSAGFQALIQ+Q+ QSA+ AR++LQGRNIYDGCCQLDIQFSN
Sbjct  121  LHQVFSPYGFVEKIVTFQKSAGFQALIQYQSRQSALQARSSLQGRNIYDGCCQLDIQFSN  180

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            L+ELQVNYNN+RSRDFTNP+LP+EQ+GKSSQH YGDAG +Y+
Sbjct  181  LNELQVNYNNERSRDFTNPSLPTEQRGKSSQHSYGDAGSLYA  222



>ref|XP_008785843.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008785844.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Phoenix dactylifera]
Length=446

 Score =   392 bits (1008),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 187/222 (84%), Positives = 206/222 (93%), Gaps = 4/222 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIH+RNVGHEISENDLLQL QPFG + KLVMLRAKNQALLQM D+PSAVN LQ+
Sbjct  1    MTEPSKVIHIRNVGHEISENDLLQLVQPFGPVNKLVMLRAKNQALLQMHDLPSAVNVLQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR-GDE---PNRILLVTIHHMLYPITVEV  477
            Y+NVQPS+RGRNVYIQFSSHQELTT DQN+Q R GD+   PNRILLVTIHHMLYPITVEV
Sbjct  61   YSNVQPSVRGRNVYIQFSSHQELTTADQNSQGRRGDQDSQPNRILLVTIHHMLYPITVEV  120

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            LHQVFSPHGFVEKIVTFQKSAGFQALIQ+Q+ QSA+ A  ALQGRNIYDGCCQLDIQFSN
Sbjct  121  LHQVFSPHGFVEKIVTFQKSAGFQALIQYQSRQSALQASTALQGRNIYDGCCQLDIQFSN  180

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            L+ELQVNYNN+RSRDFTNP+LP+EQ+G+SSQ GYGDAGG+Y+
Sbjct  181  LNELQVNYNNERSRDFTNPSLPTEQRGRSSQSGYGDAGGLYA  222



>ref|XP_002893943.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70202.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=432

 Score =   391 bits (1004),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 185/217 (85%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDV SA++ALQF
Sbjct  1    MAESSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVSSAISALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            +TNVQP+IRGRNVY+QFSSHQELTT++QN   R DEPNRILLVTIHHMLYPITV+VLHQV
Sbjct  61   FTNVQPTIRGRNVYVQFSSHQELTTIEQNIHGREDEPNRILLVTIHHMLYPITVDVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSP+GFVEK+VTFQKSAGFQALIQ+Q  Q A SAR ALQGRNIYDGCCQLDIQFSNL+EL
Sbjct  121  FSPYGFVEKLVTFQKSAGFQALIQYQVQQCAASARTALQGRNIYDGCCQLDIQFSNLEEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            QVNYNNDRSRD+TNPNLP+EQKG+SS  GYGD G  Y
Sbjct  181  QVNYNNDRSRDYTNPNLPAEQKGRSSHPGYGDVGVAY  217



>ref|XP_010527313.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Tarenaya hassleriana]
Length=449

 Score =   390 bits (1003),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 186/217 (86%), Positives = 201/217 (93%), Gaps = 0/217 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQM+DV +AVNALQF
Sbjct  18   MAEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMEDVSAAVNALQF  77

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YTNVQPSIRGRNVYIQFSSHQELTT++Q T  RGDEPNRILLVTIHHMLYPITV+VLHQV
Sbjct  78   YTNVQPSIRGRNVYIQFSSHQELTTVEQTTHGRGDEPNRILLVTIHHMLYPITVDVLHQV  137

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSP+GFVEKIVTFQKSAGFQAL+Q+Q+ Q +VSAR +LQGRNIYDGCCQLDIQFSNL+EL
Sbjct  138  FSPYGFVEKIVTFQKSAGFQALVQYQSQQFSVSARTSLQGRNIYDGCCQLDIQFSNLEEL  197

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            QVNYNN+RSRD+TNP LP EQKG+SS   YGD G  Y
Sbjct  198  QVNYNNERSRDYTNPTLPPEQKGRSSHPAYGDVGVAY  234



>ref|XP_010461394.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Camelina 
sativa]
Length=433

 Score =   390 bits (1001),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 201/218 (92%), Gaps = 1/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAV+ALQF
Sbjct  1    MAESSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVSALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            +TNVQP+IRGRNVY+QFSSHQELTT++QN   R DEPNRILLVTIHHMLYPITV+VLHQV
Sbjct  61   FTNVQPTIRGRNVYVQFSSHQELTTIEQNIHGREDEPNRILLVTIHHMLYPITVDVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSP+GFVEK+VTFQKSAGFQALIQ+Q  Q A SAR ALQGRNIYDGCCQLDIQFSNL+EL
Sbjct  121  FSPYGFVEKLVTFQKSAGFQALIQYQVQQCAASARTALQGRNIYDGCCQLDIQFSNLEEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQ-HGYGDAGGMY  780
            QVNYNNDRSRD+TNPNLP+EQKG+SS   GYGD G  Y
Sbjct  181  QVNYNNDRSRDYTNPNLPAEQKGRSSHPGGYGDVGVAY  218



>ref|XP_010479003.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X2 [Camelina sativa]
Length=433

 Score =   390 bits (1001),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 201/218 (92%), Gaps = 1/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAV+ALQF
Sbjct  1    MAESSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVSALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            +TNVQP+IRGRNVY+QFSSHQELTT++QN   R DEPNRILLVTIHHMLYPITV+VLHQV
Sbjct  61   FTNVQPTIRGRNVYVQFSSHQELTTIEQNIHGREDEPNRILLVTIHHMLYPITVDVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSP+GFVEK+VTFQKSAGFQALIQ+Q  Q A SAR ALQGRNIYDGCCQLDIQFSNL+EL
Sbjct  121  FSPYGFVEKLVTFQKSAGFQALIQYQVQQCAASARTALQGRNIYDGCCQLDIQFSNLEEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQ-HGYGDAGGMY  780
            QVNYNNDRSRD+TNPNLP+EQKG+SS   GYGD G  Y
Sbjct  181  QVNYNNDRSRDYTNPNLPAEQKGRSSHPGGYGDVGVAY  218



>ref|XP_010479002.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Camelina sativa]
Length=433

 Score =   390 bits (1001),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 201/218 (92%), Gaps = 1/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAV+ALQF
Sbjct  1    MAESSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVSALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            +TNVQP+IRGRNVY+QFSSHQELTT++QN   R DEPNRILLVTIHHMLYPITV+VLHQV
Sbjct  61   FTNVQPTIRGRNVYVQFSSHQELTTIEQNIHGREDEPNRILLVTIHHMLYPITVDVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSP+GFVEK+VTFQKSAGFQALIQ+Q  Q A SAR ALQGRNIYDGCCQLDIQFSNL+EL
Sbjct  121  FSPYGFVEKLVTFQKSAGFQALIQYQVQQCAASARTALQGRNIYDGCCQLDIQFSNLEEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQ-HGYGDAGGMY  780
            QVNYNNDRSRD+TNPNLP+EQKG+SS   GYGD G  Y
Sbjct  181  QVNYNNDRSRDYTNPNLPAEQKGRSSHPGGYGDVGVAY  218



>ref|XP_010500100.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Camelina sativa]
 ref|XP_010500101.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Camelina sativa]
Length=433

 Score =   390 bits (1001),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 201/218 (92%), Gaps = 1/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAV+ALQF
Sbjct  1    MAESSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVSALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            +TNVQP+IRGRNVY+QFSSHQELTT++QN   R DEPNRILLVTIHHMLYPITV+VLHQV
Sbjct  61   FTNVQPTIRGRNVYVQFSSHQELTTIEQNIHGREDEPNRILLVTIHHMLYPITVDVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSP+GFVEK+VTFQKSAGFQALIQ+Q  Q A SAR ALQGRNIYDGCCQLDIQFSNL+EL
Sbjct  121  FSPYGFVEKLVTFQKSAGFQALIQYQVQQCAASARTALQGRNIYDGCCQLDIQFSNLEEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQ-HGYGDAGGMY  780
            QVNYNNDRSRD+TNPNLP+EQKG+SS   GYGD G  Y
Sbjct  181  QVNYNNDRSRDYTNPNLPAEQKGRSSHPGGYGDVGVAY  218



>ref|XP_004496454.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X3 [Cicer arietinum]
Length=444

 Score =   390 bits (1001),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 187/217 (86%), Positives = 201/217 (93%), Gaps = 1/217 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISE DL  LFQ FG ITKLVMLRAKNQAL+QMQDVPSA++ALQF
Sbjct  1    MTEPSKVIHVRNVGHEISEKDLFLLFQRFGAITKLVMLRAKNQALIQMQDVPSAISALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y N QPSIRGRNVY+QFSSHQELTT+DQ +Q RGDEPNRILLVTIHH+LYPITV+VL+QV
Sbjct  61   YANTQPSIRGRNVYVQFSSHQELTTVDQ-SQGRGDEPNRILLVTIHHVLYPITVDVLYQV  119

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHG VEKIVTFQKSAGFQALIQ+ + QSAV+AR ALQGRNIYDGCCQLDIQFSNLDEL
Sbjct  120  FSPHGSVEKIVTFQKSAGFQALIQYPSQQSAVAARTALQGRNIYDGCCQLDIQFSNLDEL  179

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            QVNYNNDRSRDFTNPNLP+EQKG+ SQ GYGDAG MY
Sbjct  180  QVNYNNDRSRDFTNPNLPTEQKGRPSQLGYGDAGNMY  216



>ref|NP_175010.2| polypyrimidine tract-binding protein 3 [Arabidopsis thaliana]
 ref|NP_001077672.1| polypyrimidine tract-binding protein 3 [Arabidopsis thaliana]
 sp|Q6ICX4.1|PTBP3_ARATH RecName: Full=Polypyrimidine tract-binding protein homolog 3 
[Arabidopsis thaliana]
 gb|AAT44975.1| At1g43190 [Arabidopsis thaliana]
 gb|AAT70479.1| At1g43190 [Arabidopsis thaliana]
 dbj|BAF00629.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE31961.1| polypyrimidine tract-binding protein 3 [Arabidopsis thaliana]
 gb|AEE31962.1| polypyrimidine tract-binding protein 3 [Arabidopsis thaliana]
Length=432

 Score =   389 bits (998),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/217 (85%), Positives = 199/217 (92%), Gaps = 0/217 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M E SKV+HVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDV SAV+ALQF
Sbjct  1    MAESSKVVHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVSSAVSALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            +TNVQP+IRGRNVY+QFSSHQELTT++QN   R DEPNRILLVTIHHMLYPITV+VLHQV
Sbjct  61   FTNVQPTIRGRNVYVQFSSHQELTTIEQNIHGREDEPNRILLVTIHHMLYPITVDVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSP+GFVEK+VTFQKSAGFQALIQ+Q  Q A SAR ALQGRNIYDGCCQLDIQFSNL+EL
Sbjct  121  FSPYGFVEKLVTFQKSAGFQALIQYQVQQCAASARTALQGRNIYDGCCQLDIQFSNLEEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            QVNYNNDRSRD+TNPNLP+EQKG+SS   YGD G  Y
Sbjct  181  QVNYNNDRSRDYTNPNLPAEQKGRSSHPCYGDTGVAY  217



>ref|XP_004496452.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Cicer arietinum]
 ref|XP_004496453.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Cicer arietinum]
Length=476

 Score =   390 bits (1001),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 187/217 (86%), Positives = 201/217 (93%), Gaps = 1/217 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISE DL  LFQ FG ITKLVMLRAKNQAL+QMQDVPSA++ALQF
Sbjct  1    MTEPSKVIHVRNVGHEISEKDLFLLFQRFGAITKLVMLRAKNQALIQMQDVPSAISALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y N QPSIRGRNVY+QFSSHQELTT+DQ +Q RGDEPNRILLVTIHH+LYPITV+VL+QV
Sbjct  61   YANTQPSIRGRNVYVQFSSHQELTTVDQ-SQGRGDEPNRILLVTIHHVLYPITVDVLYQV  119

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHG VEKIVTFQKSAGFQALIQ+ + QSAV+AR ALQGRNIYDGCCQLDIQFSNLDEL
Sbjct  120  FSPHGSVEKIVTFQKSAGFQALIQYPSQQSAVAARTALQGRNIYDGCCQLDIQFSNLDEL  179

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            QVNYNNDRSRDFTNPNLP+EQKG+ SQ GYGDAG MY
Sbjct  180  QVNYNNDRSRDFTNPNLPTEQKGRPSQLGYGDAGNMY  216



>ref|XP_008793925.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Phoenix dactylifera]
 ref|XP_008793926.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Phoenix dactylifera]
Length=446

 Score =   388 bits (997),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 183/222 (82%), Positives = 205/222 (92%), Gaps = 4/222 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIH+RNVGHEISENDLLQL QPFG ++KLV+LRAKNQAL+QM D+PSAVN LQ+
Sbjct  1    MTEPSKVIHIRNVGHEISENDLLQLVQPFGPVSKLVILRAKNQALIQMHDLPSAVNVLQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE----PNRILLVTIHHMLYPITVEV  477
            YTNVQPS+RGRNVYIQFSSHQELTT DQ +Q R  +    PNRILLVTIHHMLYPITVEV
Sbjct  61   YTNVQPSVRGRNVYIQFSSHQELTTADQTSQGRKSDQDSQPNRILLVTIHHMLYPITVEV  120

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            LHQVFSPHGFVEKIVTFQKSAGFQALIQ+Q+ QSA+ AR+ LQGRNIYDGCCQLDIQFSN
Sbjct  121  LHQVFSPHGFVEKIVTFQKSAGFQALIQYQSRQSAMQARSTLQGRNIYDGCCQLDIQFSN  180

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            L+ELQVNYNN+RSRDFTNP+LP+EQ+G+SSQ GYGDAGG+Y+
Sbjct  181  LNELQVNYNNERSRDFTNPSLPTEQRGRSSQPGYGDAGGLYA  222



>ref|XP_009393413.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009393414.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009393415.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Musa acuminata subsp. malaccensis]
Length=447

 Score =   388 bits (997),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 182/222 (82%), Positives = 207/222 (93%), Gaps = 4/222 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPS+VIH+RNVGHEISENDLLQL QPFGV+TKLVMLRAKNQALLQM D+ S++N LQ+
Sbjct  1    MTEPSRVIHIRNVGHEISENDLLQLVQPFGVVTKLVMLRAKNQALLQMHDLSSSINVLQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR-GDE---PNRILLVTIHHMLYPITVEV  477
            YTNVQPS+RGRNVYIQFSSHQELTT DQN+Q R GD+   PNRILLVTIHHMLYPITVEV
Sbjct  61   YTNVQPSVRGRNVYIQFSSHQELTTADQNSQGRKGDQDSQPNRILLVTIHHMLYPITVEV  120

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            LHQVFSP+GFVEKIVTFQKSAGFQ+LIQ+Q+ QSA+ AR++LQGRNIYDGCCQLDIQFSN
Sbjct  121  LHQVFSPYGFVEKIVTFQKSAGFQSLIQYQSQQSAMQARSSLQGRNIYDGCCQLDIQFSN  180

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            L ELQVNYNN+RSRDFTNP+LP+EQ+G++SQHGYGD G +Y+
Sbjct  181  LSELQVNYNNERSRDFTNPSLPTEQRGRTSQHGYGDTGSLYA  222



>ref|XP_010527312.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   387 bits (995),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 202/218 (93%), Gaps = 1/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQM+DV +AVNALQF
Sbjct  18   MAEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMEDVSAAVNALQF  77

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YTNVQPSIRGRNVYIQFSSHQELTT++Q T  RGDEPNRILLVTIHHMLYPITV+VLHQV
Sbjct  78   YTNVQPSIRGRNVYIQFSSHQELTTVEQTTHGRGDEPNRILLVTIHHMLYPITVDVLHQV  137

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSP+GFVEKIVTFQKSAGFQAL+Q+Q+ Q +VSAR +LQGRNIYDGCCQLDIQFSNL+EL
Sbjct  138  FSPYGFVEKIVTFQKSAGFQALVQYQSQQFSVSARTSLQGRNIYDGCCQLDIQFSNLEEL  197

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSS-QHGYGDAGGMY  780
            QVNYNN+RSRD+TNP LP EQKG+SS Q  YGD G  Y
Sbjct  198  QVNYNNERSRDYTNPTLPPEQKGRSSHQPAYGDVGVAY  235



>ref|XP_010533404.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X3 [Tarenaya hassleriana]
Length=433

 Score =   386 bits (992),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 185/218 (85%), Positives = 200/218 (92%), Gaps = 1/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M+EPSKVIHVRNVGHEISENDLLQLFQPFG +TKLVMLRAKNQALLQMQDV +AVNALQF
Sbjct  1    MSEPSKVIHVRNVGHEISENDLLQLFQPFGAVTKLVMLRAKNQALLQMQDVSAAVNALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQ-SRGDEPNRILLVTIHHMLYPITVEVLHQ  486
            YTNVQPSIRGRNVYIQFSSHQELTTM+QNT   R DEPNRILLVTIHHMLYPITV+VLHQ
Sbjct  61   YTNVQPSIRGRNVYIQFSSHQELTTMEQNTHHGRVDEPNRILLVTIHHMLYPITVDVLHQ  120

Query  487  VFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDE  666
            VFSP+GFVEKIVTFQKSAGFQAL+Q+Q  Q A SAR +LQ RNIYDGCCQLDIQFSNL+E
Sbjct  121  VFSPYGFVEKIVTFQKSAGFQALVQYQLQQCAASARTSLQARNIYDGCCQLDIQFSNLEE  180

Query  667  LQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            LQVNYNN+RSRD+TNPNLP++QKG+SS   YGD G  Y
Sbjct  181  LQVNYNNERSRDYTNPNLPNDQKGRSSHPAYGDVGVAY  218



>emb|CDY36013.1| BnaA08g04480D [Brassica napus]
Length=432

 Score =   385 bits (990),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 184/217 (85%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDV SA+ ALQF
Sbjct  1    MAESSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVSSAITALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            +TNVQP+IRGRNVYIQFSSHQELTT +QN   R DEPNRILLVT+HHMLYPITV+VLHQV
Sbjct  61   FTNVQPTIRGRNVYIQFSSHQELTTAEQNIHGREDEPNRILLVTVHHMLYPITVDVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSP+GFVEKIVTFQKSAGFQALIQ+Q    A SAR +LQGRNIYDGCCQLDIQFSNL+EL
Sbjct  121  FSPYGFVEKIVTFQKSAGFQALIQYQAQPCAASARTSLQGRNIYDGCCQLDIQFSNLEEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            QVNYNNDRSRD+TNPNLPSEQKG+    GYGDAG  Y
Sbjct  181  QVNYNNDRSRDYTNPNLPSEQKGRLPHPGYGDAGVAY  217



>ref|XP_010533402.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Tarenaya hassleriana]
Length=435

 Score =   385 bits (990),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 185/218 (85%), Positives = 200/218 (92%), Gaps = 1/218 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M+EPSKVIHVRNVGHEISENDLLQLFQPFG +TKLVMLRAKNQALLQMQDV +AVNALQF
Sbjct  1    MSEPSKVIHVRNVGHEISENDLLQLFQPFGAVTKLVMLRAKNQALLQMQDVSAAVNALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQ-SRGDEPNRILLVTIHHMLYPITVEVLHQ  486
            YTNVQPSIRGRNVYIQFSSHQELTTM+QNT   R DEPNRILLVTIHHMLYPITV+VLHQ
Sbjct  61   YTNVQPSIRGRNVYIQFSSHQELTTMEQNTHHGRVDEPNRILLVTIHHMLYPITVDVLHQ  120

Query  487  VFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDE  666
            VFSP+GFVEKIVTFQKSAGFQAL+Q+Q  Q A SAR +LQ RNIYDGCCQLDIQFSNL+E
Sbjct  121  VFSPYGFVEKIVTFQKSAGFQALVQYQLQQCAASARTSLQARNIYDGCCQLDIQFSNLEE  180

Query  667  LQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            LQVNYNN+RSRD+TNPNLP++QKG+SS   YGD G  Y
Sbjct  181  LQVNYNNERSRDYTNPNLPNDQKGRSSHPAYGDVGVAY  218



>emb|CDY47859.1| BnaCnng15550D [Brassica napus]
Length=454

 Score =   385 bits (989),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 184/217 (85%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDV SA+ ALQF
Sbjct  1    MAESSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVSSAITALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            +TNVQP+IRGRNVYIQFSSHQELTT +QN   R DEPNRILLVT+HHMLYPITV+VLHQV
Sbjct  61   FTNVQPTIRGRNVYIQFSSHQELTTAEQNIHGREDEPNRILLVTVHHMLYPITVDVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSP+GFVEKIVTFQKSAGFQALIQ+Q    A SAR +LQGRNIYDGCCQLDIQFSNL+EL
Sbjct  121  FSPYGFVEKIVTFQKSAGFQALIQYQAQPCAASARTSLQGRNIYDGCCQLDIQFSNLEEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            QVNYNNDRSRD+TNPNLPSEQKG+    GYGDAG  Y
Sbjct  181  QVNYNNDRSRDYTNPNLPSEQKGRLPHPGYGDAGVAY  217



>ref|XP_003619162.1| Polypyrimidine tract-binding protein-like protein [Medicago truncatula]
Length=354

 Score =   381 bits (978),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 182/214 (85%), Positives = 199/214 (93%), Gaps = 1/214 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M E SKVIHVRNVGHEISENDLLQLFQPFGV+TKLVMLRAKNQAL+QMQDV SA +A+QF
Sbjct  1    MAEQSKVIHVRNVGHEISENDLLQLFQPFGVVTKLVMLRAKNQALVQMQDVASADSAIQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y N QPSIRGRNVY+QFSSH+ELTTMDQN Q R DEPNRILLVT+H +LYP+TV+VL QV
Sbjct  61   YINSQPSIRGRNVYVQFSSHRELTTMDQN-QGREDEPNRILLVTVHQVLYPMTVDVLQQV  119

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ++T QSAV+AR ALQGRN+YDGCCQLDIQFSNLDEL
Sbjct  120  FSPHGFVEKIVTFQKSAGFQALIQYETRQSAVTARGALQGRNVYDGCCQLDIQFSNLDEL  179

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAG  771
            QVNYNNDRSRDFTNPNLP++QKG+ SQ GYGDAG
Sbjct  180  QVNYNNDRSRDFTNPNLPTDQKGRPSQAGYGDAG  213



>ref|XP_010533403.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X2 [Tarenaya hassleriana]
Length=434

 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 201/219 (92%), Gaps = 2/219 (1%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M+EPSKVIHVRNVGHEISENDLLQLFQPFG +TKLVMLRAKNQALLQMQDV +AVNALQF
Sbjct  1    MSEPSKVIHVRNVGHEISENDLLQLFQPFGAVTKLVMLRAKNQALLQMQDVSAAVNALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQ-SRGDEPNRILLVTIHHMLYPITVEVLHQ  486
            YTNVQPSIRGRNVYIQFSSHQELTTM+QNT   R DEPNRILLVTIHHMLYPITV+VLHQ
Sbjct  61   YTNVQPSIRGRNVYIQFSSHQELTTMEQNTHHGRVDEPNRILLVTIHHMLYPITVDVLHQ  120

Query  487  VFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDE  666
            VFSP+GFVEKIVTFQKSAGFQAL+Q+Q  Q A SAR +LQ RNIYDGCCQLDIQFSNL+E
Sbjct  121  VFSPYGFVEKIVTFQKSAGFQALVQYQLQQCAASARTSLQARNIYDGCCQLDIQFSNLEE  180

Query  667  LQVNYNNDRSRDFTNPNLPSEQKGKSS-QHGYGDAGGMY  780
            LQVNYNN+RSRD+TNPNLP++QKG+SS Q  YGD G  Y
Sbjct  181  LQVNYNNERSRDYTNPNLPNDQKGRSSHQPAYGDVGVAY  219



>ref|XP_010533405.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X4 [Tarenaya hassleriana]
Length=443

 Score =   383 bits (983),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 201/219 (92%), Gaps = 2/219 (1%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M+EPSKVIHVRNVGHEISENDLLQLFQPFG +TKLVMLRAKNQALLQMQDV +AVNALQF
Sbjct  8    MSEPSKVIHVRNVGHEISENDLLQLFQPFGAVTKLVMLRAKNQALLQMQDVSAAVNALQF  67

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQ-SRGDEPNRILLVTIHHMLYPITVEVLHQ  486
            YTNVQPSIRGRNVYIQFSSHQELTTM+QNT   R DEPNRILLVTIHHMLYPITV+VLHQ
Sbjct  68   YTNVQPSIRGRNVYIQFSSHQELTTMEQNTHHGRVDEPNRILLVTIHHMLYPITVDVLHQ  127

Query  487  VFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDE  666
            VFSP+GFVEKIVTFQKSAGFQAL+Q+Q  Q A SAR +LQ RNIYDGCCQLDIQFSNL+E
Sbjct  128  VFSPYGFVEKIVTFQKSAGFQALVQYQLQQCAASARTSLQARNIYDGCCQLDIQFSNLEE  187

Query  667  LQVNYNNDRSRDFTNPNLPSEQKGKSS-QHGYGDAGGMY  780
            LQVNYNN+RSRD+TNPNLP++QKG+SS Q  YGD G  Y
Sbjct  188  LQVNYNNERSRDYTNPNLPNDQKGRSSHQPAYGDVGVAY  226



>ref|XP_010533406.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X5 [Tarenaya hassleriana]
Length=436

 Score =   382 bits (982),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 201/219 (92%), Gaps = 2/219 (1%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M+EPSKVIHVRNVGHEISENDLLQLFQPFG +TKLVMLRAKNQALLQMQDV +AVNALQF
Sbjct  1    MSEPSKVIHVRNVGHEISENDLLQLFQPFGAVTKLVMLRAKNQALLQMQDVSAAVNALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQ-SRGDEPNRILLVTIHHMLYPITVEVLHQ  486
            YTNVQPSIRGRNVYIQFSSHQELTTM+QNT   R DEPNRILLVTIHHMLYPITV+VLHQ
Sbjct  61   YTNVQPSIRGRNVYIQFSSHQELTTMEQNTHHGRVDEPNRILLVTIHHMLYPITVDVLHQ  120

Query  487  VFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDE  666
            VFSP+GFVEKIVTFQKSAGFQAL+Q+Q  Q A SAR +LQ RNIYDGCCQLDIQFSNL+E
Sbjct  121  VFSPYGFVEKIVTFQKSAGFQALVQYQLQQCAASARTSLQARNIYDGCCQLDIQFSNLEE  180

Query  667  LQVNYNNDRSRDFTNPNLPSEQKGKSS-QHGYGDAGGMY  780
            LQVNYNN+RSRD+TNPNLP++QKG+SS Q  YGD G  Y
Sbjct  181  LQVNYNNERSRDYTNPNLPNDQKGRSSHQPAYGDVGVAY  219



>gb|KGN45884.1| hypothetical protein Csa_6G017000 [Cucumis sativus]
Length=459

 Score =   382 bits (982),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 185/219 (84%), Positives = 194/219 (89%), Gaps = 13/219 (6%)
 Frame = +1

Query  124  LKMTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNAL  303
             +MTEPSK             NDLLQLFQPFGVITKLVMLRAKNQAL+QMQDVPSAVNAL
Sbjct  27   FRMTEPSK-------------NDLLQLFQPFGVITKLVMLRAKNQALMQMQDVPSAVNAL  73

Query  304  QFYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLH  483
            QF+ N+QPSIRGRNVY+QFSSHQELTT DQN Q RGDEPNRILLVTIHHMLYPITVEVLH
Sbjct  74   QFFANLQPSIRGRNVYVQFSSHQELTTADQNAQGRGDEPNRILLVTIHHMLYPITVEVLH  133

Query  484  QVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLD  663
            QVF PHGFVEKIVTFQKSAGFQALIQ+QT Q AVSAR ALQGRNIYDGCCQLDIQFSNLD
Sbjct  134  QVFFPHGFVEKIVTFQKSAGFQALIQYQTRQCAVSARTALQGRNIYDGCCQLDIQFSNLD  193

Query  664  ELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            ELQVNYNN+RSRDFTNP+LPSE KG+SSQ GYGD GGMY
Sbjct  194  ELQVNYNNERSRDFTNPSLPSEPKGRSSQPGYGDTGGMY  232



>ref|XP_009107488.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Brassica 
rapa]
Length=432

 Score =   380 bits (977),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 183/217 (84%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDV SA+ ALQF
Sbjct  1    MAESSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVSSAITALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            +TNVQP+IRGRNVYIQFSSHQELTT +QN   R DEPNRILLVT+HHMLYPITV+VLHQV
Sbjct  61   FTNVQPTIRGRNVYIQFSSHQELTTAEQNIHGREDEPNRILLVTVHHMLYPITVDVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSP+GFVEKIVTFQKSAGFQALIQ+Q    A SAR +LQGRNIYDG CQLDIQFSNL+EL
Sbjct  121  FSPYGFVEKIVTFQKSAGFQALIQYQAQPCAASARTSLQGRNIYDGGCQLDIQFSNLEEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            QVNYNNDRSRD+TNPNLPSEQKG+    GYGDAG  Y
Sbjct  181  QVNYNNDRSRDYTNPNLPSEQKGRLPHPGYGDAGVAY  217



>ref|NP_001266083.1| polypyrimidine tract-binding protein homolog 3-like [Cicer arietinum]
 emb|CAD70621.1| polypyrimidine track-binding protein homologue [Cicer arietinum]
Length=442

 Score =   380 bits (977),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 179/214 (84%), Positives = 198/214 (93%), Gaps = 1/214 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIHVRNVGHEISENDLLQLFQ FGVITKLVMLR KNQALLQM+D+PSA++ALQF
Sbjct  1    MAEPSKVIHVRNVGHEISENDLLQLFQTFGVITKLVMLRTKNQALLQMEDIPSAISALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y N QPSIRGRNVY+QFSSH+ELTTMDQ +Q R DEPNRILLVT+H M YPITV+VL QV
Sbjct  61   YANAQPSIRGRNVYVQFSSHKELTTMDQ-SQGRDDEPNRILLVTVHQMQYPITVDVLQQV  119

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHG+VEKIVTFQKSAGFQALIQ+++ QSAV+AR++LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  120  FSPHGYVEKIVTFQKSAGFQALIQYESRQSAVTARSSLQGRNIYDGCCQLDIQFSNLDEL  179

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAG  771
            QVNYNNDRSRD+TNPNLP+EQKG+ S  GYGD G
Sbjct  180  QVNYNNDRSRDYTNPNLPTEQKGRPSHSGYGDTG  213



>gb|EPS74228.1| hypothetical protein M569_00523 [Genlisea aurea]
Length=437

 Score =   380 bits (975),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 181/221 (82%), Positives = 199/221 (90%), Gaps = 6/221 (3%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIH+RNVGHEI E+DL+QLFQPFGV++KL+MLRAKNQALLQMQD+PSAVNA+Q+
Sbjct  1    MAEPSKVIHLRNVGHEIIESDLIQLFQPFGVVSKLMMLRAKNQALLQMQDIPSAVNAMQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y NVQP IRGRNVY+QFSSHQEL  MDQ +Q+R DEPNRILLVTIHHMLYPITVEVLHQV
Sbjct  61   YANVQPIIRGRNVYVQFSSHQELMVMDQASQARVDEPNRILLVTIHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q ++SAVSAR+AL  RNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKIVTFQKSAGFQALIQYQYHESAVSARDALHRRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQ------HGYGDAGG  774
            QVN NN+RSRDFTNP+LPSE KGKSSQ      HGY   GG
Sbjct  181  QVNCNNERSRDFTNPSLPSEHKGKSSQSYSDDVHGYSQTGG  221



>gb|AES75380.2| polypyrimidine tract-binding-like protein [Medicago truncatula]
Length=443

 Score =   380 bits (976),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 182/214 (85%), Positives = 199/214 (93%), Gaps = 1/214 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M E SKVIHVRNVGHEISENDLLQLFQPFGV+TKLVMLRAKNQAL+QMQDV SA +A+QF
Sbjct  1    MAEQSKVIHVRNVGHEISENDLLQLFQPFGVVTKLVMLRAKNQALVQMQDVASADSAIQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y N QPSIRGRNVY+QFSSH+ELTTMDQN Q R DEPNRILLVT+H +LYP+TV+VL QV
Sbjct  61   YINSQPSIRGRNVYVQFSSHRELTTMDQN-QGREDEPNRILLVTVHQVLYPMTVDVLQQV  119

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ++T QSAV+AR ALQGRN+YDGCCQLDIQFSNLDEL
Sbjct  120  FSPHGFVEKIVTFQKSAGFQALIQYETRQSAVTARGALQGRNVYDGCCQLDIQFSNLDEL  179

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAG  771
            QVNYNNDRSRDFTNPNLP++QKG+ SQ GYGDAG
Sbjct  180  QVNYNNDRSRDFTNPNLPTDQKGRPSQAGYGDAG  213



>ref|XP_006303776.1| hypothetical protein CARUB_v10012016mg [Capsella rubella]
 gb|EOA36674.1| hypothetical protein CARUB_v10012016mg [Capsella rubella]
Length=420

 Score =   379 bits (973),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDV SAV+ALQF
Sbjct  1    MAESSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVSSAVSALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            +TNVQP+IRGRNVY+QFSSHQELTT++QN   R DEPNRILLVTIHHMLYPITV+VLHQV
Sbjct  61   FTNVQPTIRGRNVYVQFSSHQELTTIEQNIHGREDEPNRILLVTIHHMLYPITVDVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSP+GFVEK+VTFQKSAGFQALIQ+Q  Q A SAR ALQGRNIYDGCCQLDIQFSNL+EL
Sbjct  121  FSPYGFVEKLVTFQKSAGFQALIQYQVQQYAASARTALQGRNIYDGCCQLDIQFSNLEEL  180

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSS  747
            QVNYNNDRSRD+TNPNLP+EQKG+SS
Sbjct  181  QVNYNNDRSRDYTNPNLPAEQKGRSS  206



>ref|NP_001077673.1| polypyrimidine tract-binding protein 3 [Arabidopsis thaliana]
 gb|AEE31963.1| polypyrimidine tract-binding protein 3 [Arabidopsis thaliana]
Length=430

 Score =   378 bits (971),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 182/217 (84%), Positives = 197/217 (91%), Gaps = 2/217 (1%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M E SKV+HVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDV SAV+ALQF
Sbjct  1    MAESSKVVHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVSSAVSALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            +TNVQP+IR  NVY+QFSSHQELTT++QN   R DEPNRILLVTIHHMLYPITV+VLHQV
Sbjct  61   FTNVQPTIR--NVYVQFSSHQELTTIEQNIHGREDEPNRILLVTIHHMLYPITVDVLHQV  118

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSP+GFVEK+VTFQKSAGFQALIQ+Q  Q A SAR ALQGRNIYDGCCQLDIQFSNL+EL
Sbjct  119  FSPYGFVEKLVTFQKSAGFQALIQYQVQQCAASARTALQGRNIYDGCCQLDIQFSNLEEL  178

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            QVNYNNDRSRD+TNPNLP+EQKG+SS   YGD G  Y
Sbjct  179  QVNYNNDRSRDYTNPNLPAEQKGRSSHPCYGDTGVAY  215



>gb|ERN15979.1| hypothetical protein AMTR_s00175p00061780 [Amborella trichopoda]
Length=493

 Score =   380 bits (975),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 186/230 (81%), Positives = 203/230 (88%), Gaps = 8/230 (3%)
 Frame = +1

Query  118  RPLKMTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVN  297
            R  KMTEPSKVIHVRNVGHEISENDLLQL QPFGV+ K VMLRAKNQALLQM D+PSAVN
Sbjct  28   RFTKMTEPSKVIHVRNVGHEISENDLLQLVQPFGVVDKRVMLRAKNQALLQMHDIPSAVN  87

Query  298  ALQFYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGD-----EPNRILLVTIHHMLYP  462
            ALQ+YTNVQPS+RGRNVY+QFSSHQELTT DQN Q   D     +PNRILLVTIHH+LYP
Sbjct  88   ALQYYTNVQPSVRGRNVYMQFSSHQELTTPDQNGQGSKDGDQDSQPNRILLVTIHHLLYP  147

Query  463  ITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLD  642
            ITVEVLHQVFSPHGFVEKIVTFQK+AGFQALIQ+Q  QSAV ARN LQGRNIYDGCCQLD
Sbjct  148  ITVEVLHQVFSPHGFVEKIVTFQKAAGFQALIQYQACQSAVQARNTLQGRNIYDGCCQLD  207

Query  643  IQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH---GYGDAGGMYS  783
            IQFSNL ELQV++NN+RSRDFTNP+LP+EQKG+ SQ    GYGD+GG+Y 
Sbjct  208  IQFSNLPELQVHFNNERSRDFTNPSLPNEQKGRPSQGALPGYGDSGGLYG  257



>ref|XP_010106865.1| Polypyrimidine tract-binding protein-3-like protein [Morus notabilis]
 gb|EXC12325.1| Polypyrimidine tract-binding protein-3-like protein [Morus notabilis]
Length=483

 Score =   379 bits (973),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = +1

Query  187  NDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTNVQPSIRGRNVYIQFSS  366
            NDLLQLFQPFGVITKLVMLRAKNQAL+QMQD+P AVNALQFY NVQP+IRGRNVY+QFSS
Sbjct  53   NDLLQLFQPFGVITKLVMLRAKNQALIQMQDIPPAVNALQFYANVQPAIRGRNVYVQFSS  112

Query  367  HQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGF  546
            HQELTTMDQN Q RGDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGF
Sbjct  113  HQELTTMDQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGF  172

Query  547  QALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            QALIQ+Q+ QSAV+AR  LQGRNIYDGCCQLDIQFSNLDELQVNYNN+RSRDFTNPNLPS
Sbjct  173  QALIQYQSRQSAVAARTTLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLPS  232

Query  727  EQKGKSSQH-GYGDAGGMY  780
            EQKG+SSQ  GYGDAG MY
Sbjct  233  EQKGRSSQQSGYGDAGSMY  251



>ref|XP_009411926.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=445

 Score =   377 bits (969),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 180/220 (82%), Positives = 203/220 (92%), Gaps = 2/220 (1%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIH+RNVGHEISENDLLQL QPFGV+TKLVMLRAKNQALLQM D+ SAVN LQ+
Sbjct  1    MAEPSKVIHIRNVGHEISENDLLQLVQPFGVVTKLVMLRAKNQALLQMHDLNSAVNVLQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQ-NTQSRGD-EPNRILLVTIHHMLYPITVEVLH  483
            YT+VQPS+RGRNVYIQFSSHQELTT D    +S  D +PNRILLVTIHHMLYPITVEVLH
Sbjct  61   YTSVQPSVRGRNVYIQFSSHQELTTTDSPGWKSDQDSQPNRILLVTIHHMLYPITVEVLH  120

Query  484  QVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLD  663
            QVFSP+G+VEKIVTFQKSAGFQALIQ+Q+ QSAV A+++LQGRNIYDGCCQLDIQFSNL+
Sbjct  121  QVFSPYGYVEKIVTFQKSAGFQALIQYQSRQSAVQAKSSLQGRNIYDGCCQLDIQFSNLN  180

Query  664  ELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            ELQVNYNN+RSRDFTNP+LP+EQ+G+SSQ GYGDAG +Y+
Sbjct  181  ELQVNYNNERSRDFTNPSLPTEQRGRSSQPGYGDAGSLYA  220



>ref|XP_011627104.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X2 [Amborella trichopoda]
Length=452

 Score =   377 bits (969),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 184/226 (81%), Positives = 201/226 (89%), Gaps = 8/226 (4%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQL QPFGV+ K VMLRAKNQALLQM D+PSAVNALQ+
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLVQPFGVVDKRVMLRAKNQALLQMHDIPSAVNALQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGD-----EPNRILLVTIHHMLYPITVE  474
            YTNVQPS+RGRNVY+QFSSHQELTT DQN Q   D     +PNRILLVTIHH+LYPITVE
Sbjct  61   YTNVQPSVRGRNVYMQFSSHQELTTPDQNGQGSKDGDQDSQPNRILLVTIHHLLYPITVE  120

Query  475  VLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFS  654
            VLHQVFSPHGFVEKIVTFQK+AGFQALIQ+Q  QSAV ARN LQGRNIYDGCCQLDIQFS
Sbjct  121  VLHQVFSPHGFVEKIVTFQKAAGFQALIQYQACQSAVQARNTLQGRNIYDGCCQLDIQFS  180

Query  655  NLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH---GYGDAGGMYS  783
            NL ELQV++NN+RSRDFTNP+LP+EQKG+ SQ    GYGD+GG+Y 
Sbjct  181  NLPELQVHFNNERSRDFTNPSLPNEQKGRPSQGALPGYGDSGGLYG  226



>ref|XP_011627103.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Amborella trichopoda]
Length=462

 Score =   377 bits (969),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 184/226 (81%), Positives = 201/226 (89%), Gaps = 8/226 (4%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQL QPFGV+ K VMLRAKNQALLQM D+PSAVNALQ+
Sbjct  1    MTEPSKVIHVRNVGHEISENDLLQLVQPFGVVDKRVMLRAKNQALLQMHDIPSAVNALQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGD-----EPNRILLVTIHHMLYPITVE  474
            YTNVQPS+RGRNVY+QFSSHQELTT DQN Q   D     +PNRILLVTIHH+LYPITVE
Sbjct  61   YTNVQPSVRGRNVYMQFSSHQELTTPDQNGQGSKDGDQDSQPNRILLVTIHHLLYPITVE  120

Query  475  VLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFS  654
            VLHQVFSPHGFVEKIVTFQK+AGFQALIQ+Q  QSAV ARN LQGRNIYDGCCQLDIQFS
Sbjct  121  VLHQVFSPHGFVEKIVTFQKAAGFQALIQYQACQSAVQARNTLQGRNIYDGCCQLDIQFS  180

Query  655  NLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH---GYGDAGGMYS  783
            NL ELQV++NN+RSRDFTNP+LP+EQKG+ SQ    GYGD+GG+Y 
Sbjct  181  NLPELQVHFNNERSRDFTNPSLPNEQKGRPSQGALPGYGDSGGLYG  226



>ref|XP_002524303.1| polypyrimidine tract binding protein, putative [Ricinus communis]
 gb|EEF38043.1| polypyrimidine tract binding protein, putative [Ricinus communis]
Length=437

 Score =   375 bits (962),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 195/219 (89%), Gaps = 3/219 (1%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+PSA+NALQF
Sbjct  1    MAEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIPSAINALQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHML--YPITVEVLH  483
            Y NVQP+IRGRNVY+QFSSHQELTTMDQN+Q R DEP  +L V          I VEVLH
Sbjct  61   YGNVQPTIRGRNVYVQFSSHQELTTMDQNSQGRADEP-FVLAVRFKSNFDGINIIVEVLH  119

Query  484  QVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLD  663
            QVFSPHGFVEKIVTFQKSAGFQALIQ+Q  QSAV+AR ALQGRNIYDGCCQLDIQFSNLD
Sbjct  120  QVFSPHGFVEKIVTFQKSAGFQALIQYQLRQSAVAARTALQGRNIYDGCCQLDIQFSNLD  179

Query  664  ELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            ELQVNYNNDRSRDFTNP+LP+EQKG+SSQ GYGDAG  Y
Sbjct  180  ELQVNYNNDRSRDFTNPHLPAEQKGRSSQAGYGDAGVAY  218



>gb|KHG00385.1| hypothetical protein F383_17340 [Gossypium arboreum]
Length=439

 Score =   363 bits (931),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 171/189 (90%), Positives = 182/189 (96%), Gaps = 0/189 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+PSA+NA+QF
Sbjct  1    MAEASKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIPSAINAMQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YTNVQP+IRGRNVY+QFSSHQELTTMDQN Q RGDEPNRILLVTIHHMLYPITVEVLHQV
Sbjct  61   YTNVQPTIRGRNVYVQFSSHQELTTMDQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQV  120

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q  Q+A+SAR +LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  121  FSPHGFVEKIVTFQKSAGFQALIQYQGRQNAISARTSLQGRNIYDGCCQLDIQFSNLDEL  180

Query  670  QVNYNNDRS  696
            QV+YNN+RS
Sbjct  181  QVHYNNERS  189



>ref|XP_010927403.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Elaeis guineensis]
Length=432

 Score =   358 bits (920),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 175/222 (79%), Positives = 193/222 (87%), Gaps = 18/222 (8%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIH+RNVGHEISENDLLQL QPFG + KLVMLRAKNQAL+QM D+PSAVN LQ+
Sbjct  1    MTEPSKVIHIRNVGHEISENDLLQLVQPFGPVNKLVMLRAKNQALIQMHDLPSAVNVLQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR-GD---EPNRILLVTIHHMLYPITVEV  477
            YTNVQPS+RGRNVYIQFSSHQELTT DQN+Q R GD   +PNRILLVTIHHMLYPITVEV
Sbjct  61   YTNVQPSVRGRNVYIQFSSHQELTTADQNSQGRKGDQDSQPNRILLVTIHHMLYPITVEV  120

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            LHQVFSPHGFVEKIVTFQKSAGFQALIQ+Q+ QSAV AR+ LQGRNIYDGCCQLDIQF  
Sbjct  121  LHQVFSPHGFVEKIVTFQKSAGFQALIQYQSRQSAVQARSTLQGRNIYDGCCQLDIQF--  178

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
                        S+DFTNP+LP+EQ+G+SSQ GYGDAGG+Y+
Sbjct  179  ------------SKDFTNPSLPTEQRGRSSQTGYGDAGGLYT  208



>ref|XP_011622853.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X3 [Amborella trichopoda]
Length=453

 Score =   358 bits (918),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 175/226 (77%), Positives = 198/226 (88%), Gaps = 9/226 (4%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIH+RNVGHEISE+DL QL QPFG + K+VMLRAKNQALLQM DV SAVNALQ+
Sbjct  1    MVEPSKVIHIRNVGHEISEHDLHQLVQPFGAVMKVVMLRAKNQALLQMHDVASAVNALQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR--GDE---PNRILLVTIHHMLYPITVE  474
            YT VQPSIRGRNVYIQFSSHQELTT DQN Q R  GD+    NRILLVT+HH+LYPITVE
Sbjct  61   YTTVQPSIRGRNVYIQFSSHQELTTADQNGQGRNNGDQDSQTNRILLVTVHHLLYPITVE  120

Query  475  VLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFS  654
            VLHQVFSP+G+VEKIVTFQK+AGFQALIQ++  QSAV AR ALQGRNIYDGCCQLD+QFS
Sbjct  121  VLHQVFSPYGYVEKIVTFQKAAGFQALIQYEAFQSAVQARTALQGRNIYDGCCQLDVQFS  180

Query  655  NLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH----GYGDAGGMY  780
            NL ELQV++NN+RSRDFTNP+LP++QKG+SSQ     GY D+GG+Y
Sbjct  181  NLTELQVHFNNERSRDFTNPSLPADQKGRSSQGAMQPGYNDSGGLY  226



>ref|XP_006842980.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Amborella trichopoda]
 ref|XP_011622849.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Amborella trichopoda]
 ref|XP_011622850.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X1 [Amborella trichopoda]
 gb|ERN04655.1| hypothetical protein AMTR_s00076p00078090 [Amborella trichopoda]
Length=463

 Score =   358 bits (919),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 175/227 (77%), Positives = 198/227 (87%), Gaps = 9/227 (4%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIH+RNVGHEISE+DL QL QPFG + K+VMLRAKNQALLQM DV SAVNALQ+
Sbjct  1    MVEPSKVIHIRNVGHEISEHDLHQLVQPFGAVMKVVMLRAKNQALLQMHDVASAVNALQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR--GDE---PNRILLVTIHHMLYPITVE  474
            YT VQPSIRGRNVYIQFSSHQELTT DQN Q R  GD+    NRILLVT+HH+LYPITVE
Sbjct  61   YTTVQPSIRGRNVYIQFSSHQELTTADQNGQGRNNGDQDSQTNRILLVTVHHLLYPITVE  120

Query  475  VLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFS  654
            VLHQVFSP+G+VEKIVTFQK+AGFQALIQ++  QSAV AR ALQGRNIYDGCCQLD+QFS
Sbjct  121  VLHQVFSPYGYVEKIVTFQKAAGFQALIQYEAFQSAVQARTALQGRNIYDGCCQLDVQFS  180

Query  655  NLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH----GYGDAGGMYS  783
            NL ELQV++NN+RSRDFTNP+LP++QKG+SSQ     GY D+GG+Y 
Sbjct  181  NLTELQVHFNNERSRDFTNPSLPADQKGRSSQGAMQPGYNDSGGLYG  227



>ref|XP_011622852.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 
X2 [Amborella trichopoda]
Length=462

 Score =   358 bits (919),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 175/226 (77%), Positives = 198/226 (88%), Gaps = 8/226 (4%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIH+RNVGHEISE+DL QL QPFG + K+VMLRAKNQALLQM DV SAVNALQ+
Sbjct  1    MVEPSKVIHIRNVGHEISEHDLHQLVQPFGAVMKVVMLRAKNQALLQMHDVASAVNALQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR--GDE---PNRILLVTIHHMLYPITVE  474
            YT VQPSIRGRNVYIQFSSHQELTT DQN Q R  GD+    NRILLVT+HH+LYPITVE
Sbjct  61   YTTVQPSIRGRNVYIQFSSHQELTTADQNGQGRNNGDQDSQTNRILLVTVHHLLYPITVE  120

Query  475  VLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFS  654
            VLHQVFSP+G+VEKIVTFQK+AGFQALIQ++  QSAV AR ALQGRNIYDGCCQLD+QFS
Sbjct  121  VLHQVFSPYGYVEKIVTFQKAAGFQALIQYEAFQSAVQARTALQGRNIYDGCCQLDVQFS  180

Query  655  NLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH---GYGDAGGMYS  783
            NL ELQV++NN+RSRDFTNP+LP++QKG+SSQ    GY D+GG+Y 
Sbjct  181  NLTELQVHFNNERSRDFTNPSLPADQKGRSSQGAMPGYNDSGGLYG  226



>ref|XP_010680298.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010680300.1| PREDICTED: polypyrimidine tract-binding protein homolog 3 [Beta 
vulgaris subsp. vulgaris]
Length=445

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 197/220 (90%), Gaps = 4/220 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M+E SKVIHVRNVGHEI+ENDLLQL QPFG +TKLVMLR KNQALLQMQDV +A+N + +
Sbjct  1    MSETSKVIHVRNVGHEITENDLLQLVQPFGSVTKLVMLRTKNQALLQMQDVATAINLVDY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGD---EPNRILLVTIHHMLYPITVEVL  480
            YTNVQP++RGRNVY+QFSSHQELTT DQ    + D   +PNRILLV+IHH++YP+TV+VL
Sbjct  61   YTNVQPNVRGRNVYMQFSSHQELTT-DQTQGRKSDTDGQPNRILLVSIHHVIYPMTVDVL  119

Query  481  HQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNL  660
            +QVFSP+GFVEK+VTFQKSAG+QAL+Q+QT QSA SA +AL GRNIYDGCCQLD+Q+SNL
Sbjct  120  NQVFSPYGFVEKVVTFQKSAGYQALVQYQTRQSAASAMSALHGRNIYDGCCQLDVQYSNL  179

Query  661  DELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
             ELQVN NNDRSRDFTNPNLPSEQ+G+SSQ GYGDAGG++
Sbjct  180  TELQVNSNNDRSRDFTNPNLPSEQRGRSSQSGYGDAGGLF  219



>ref|XP_009411927.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=422

 Score =   352 bits (902),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 187/204 (92%), Gaps = 2/204 (1%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIH+RNVGHEISENDLLQL QPFGV+TKLVMLRAKNQALLQM D+ SAVN LQ+
Sbjct  1    MAEPSKVIHIRNVGHEISENDLLQLVQPFGVVTKLVMLRAKNQALLQMHDLNSAVNVLQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQN--TQSRGDEPNRILLVTIHHMLYPITVEVLH  483
            YT+VQPS+RGRNVYIQFSSHQELTT D       +  +PNRILLVTIHHMLYPITVEVLH
Sbjct  61   YTSVQPSVRGRNVYIQFSSHQELTTTDSPGWKSDQDSQPNRILLVTIHHMLYPITVEVLH  120

Query  484  QVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLD  663
            QVFSP+G+VEKIVTFQKSAGFQALIQ+Q+ QSAV A+++LQGRNIYDGCCQLDIQFSNL+
Sbjct  121  QVFSPYGYVEKIVTFQKSAGFQALIQYQSRQSAVQAKSSLQGRNIYDGCCQLDIQFSNLN  180

Query  664  ELQVNYNNDRSRDFTNPNLPSEQK  735
            ELQVNYNN+RSRDFTNP+LP+EQ+
Sbjct  181  ELQVNYNNERSRDFTNPSLPTEQR  204



>gb|AFW81821.1| hypothetical protein ZEAMMB73_476847 [Zea mays]
Length=339

 Score =   348 bits (894),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 197/223 (88%), Gaps = 5/223 (2%)
 Frame = +1

Query  127  KMTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQ  306
            +M+EPSKVIH+RNVGHEI+E+DLLQL QPFG+++K+VMLRAKNQALLQM+D+ ++V+ALQ
Sbjct  85   RMSEPSKVIHIRNVGHEIAESDLLQLLQPFGMVSKIVMLRAKNQALLQMEDLHASVSALQ  144

Query  307  FYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR----GDEPNRILLVTIHHMLYPITVE  474
            +YT+VQPSIRGRNVY+QFSSHQELTT DQ++  R    G EPNRILLVTIHHM+YPITVE
Sbjct  145  YYTSVQPSIRGRNVYMQFSSHQELTT-DQSSHGRNSDQGSEPNRILLVTIHHMIYPITVE  203

Query  475  VLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFS  654
            +LHQVF  +GFVEKIVTFQKSAGFQALIQ+ + Q AV A  +L GRNIYDGCCQLDIQ+S
Sbjct  204  ILHQVFKAYGFVEKIVTFQKSAGFQALIQYHSRQEAVEAFGSLHGRNIYDGCCQLDIQYS  263

Query  655  NLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            NL ELQV+YNNDRSRDFTNP+LP+EQ+ ++SQ GY D   +Y+
Sbjct  264  NLSELQVHYNNDRSRDFTNPSLPTEQRPRASQQGYLDPANLYA  306



>emb|CBH32581.1| RNA recognition domain containing protein [Triticum aestivum]
Length=277

 Score =   345 bits (885),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 191/215 (89%), Gaps = 4/215 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPS+VIH+RNVGHEISE DLLQ+ QPFG + KLVMLR KNQAL+QM+D+ ++++A+Q+
Sbjct  1    MAEPSRVIHIRNVGHEISETDLLQVVQPFGAVAKLVMLRTKNQALVQMEDLSASISAIQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRG---DEPNRILLVTIHHMLYPITVEVL  480
            YT +QPS+RGRNVY+Q+SSHQELTT DQ++  R    DEPNRILLVT+HHMLYP+TVEVL
Sbjct  61   YTTIQPSVRGRNVYLQYSSHQELTT-DQSSHGRNPDQDEPNRILLVTVHHMLYPMTVEVL  119

Query  481  HQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNL  660
            HQVFSP+GFVEKIVTFQK+AGFQALIQFQ+ QSA+ A  AL GRNIYDGCCQLDIQ+SNL
Sbjct  120  HQVFSPYGFVEKIVTFQKTAGFQALIQFQSRQSAIQAAGALHGRNIYDGCCQLDIQYSNL  179

Query  661  DELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGD  765
             ELQV+YNNDRSRDFTNP+LP+EQ+ +SSQ GY D
Sbjct  180  SELQVHYNNDRSRDFTNPSLPTEQRPRSSQLGYND  214



>gb|KJB28978.1| hypothetical protein B456_005G078200 [Gossypium raimondii]
Length=415

 Score =   349 bits (895),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 171/215 (80%), Positives = 184/215 (86%), Gaps = 24/215 (11%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M E SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQD+PSA+NA+QF
Sbjct  1    MAEASKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDIPSAINAMQF  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            YTNVQP+IRGRNVY+QFSSHQELTTMDQN Q RGDE                       V
Sbjct  61   YTNVQPTIRGRNVYVQFSSHQELTTMDQNAQGRGDE-----------------------V  97

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FSPHGFVEKIVTFQKSAGFQALIQ+Q  Q+A+SAR +LQGRNIYDGCCQLDIQFSNLDEL
Sbjct  98   FSPHGFVEKIVTFQKSAGFQALIQYQGRQNAISARTSLQGRNIYDGCCQLDIQFSNLDEL  157

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQH-GYGDAG  771
            QV+YNN+RSRDFTNPNLP+EQKG+SSQH GYGDAG
Sbjct  158  QVHYNNERSRDFTNPNLPTEQKGRSSQHPGYGDAG  192



>ref|NP_001169470.1| uncharacterized protein LOC100383343 [Zea mays]
 gb|ACN33854.1| unknown [Zea mays]
Length=444

 Score =   349 bits (895),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 163/222 (73%), Positives = 196/222 (88%), Gaps = 5/222 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M+EPSKVIH+RNVGHEI+E+DLLQL QPFG+++K+VMLRAKNQALLQM+D+ ++V+ALQ+
Sbjct  1    MSEPSKVIHIRNVGHEIAESDLLQLLQPFGMVSKIVMLRAKNQALLQMEDLHASVSALQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR----GDEPNRILLVTIHHMLYPITVEV  477
            YT+VQPSIRGRNVY+QFSSHQELTT DQ++  R    G EPNRILLVTIHHM+YPITVE+
Sbjct  61   YTSVQPSIRGRNVYMQFSSHQELTT-DQSSHGRNSDQGSEPNRILLVTIHHMIYPITVEI  119

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            LHQVF  +GFVEKIVTFQKSAGFQALIQ+ + Q AV A  +L GRNIYDGCCQLDIQ+SN
Sbjct  120  LHQVFKAYGFVEKIVTFQKSAGFQALIQYHSRQEAVEAFGSLHGRNIYDGCCQLDIQYSN  179

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            L ELQV+YNNDRSRDFTNP+LP+EQ+ ++SQ GY D   +Y+
Sbjct  180  LSELQVHYNNDRSRDFTNPSLPTEQRPRASQQGYLDPANLYA  221



>gb|AFW68313.1| hypothetical protein ZEAMMB73_143783 [Zea mays]
Length=251

 Score =   342 bits (877),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 164/224 (73%), Positives = 194/224 (87%), Gaps = 7/224 (3%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQA--LLQMQDVPSAVNAL  303
            M+EPSKVIH+RNVGHEI+E+DLLQL QPFGV++K+VMLRAKNQA  LLQM+D+ ++V+AL
Sbjct  1    MSEPSKVIHIRNVGHEIAESDLLQLLQPFGVVSKIVMLRAKNQAQTLLQMEDIHASVSAL  60

Query  304  QFYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGD----EPNRILLVTIHHMLYPITV  471
            Q+YT+VQPSIRGRNVY+QFSSHQELTT DQ++  R      EPNRILLVTIHHM+YPITV
Sbjct  61   QYYTSVQPSIRGRNVYMQFSSHQELTT-DQSSHGRNSDQESEPNRILLVTIHHMIYPITV  119

Query  472  EVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQF  651
            EVLHQVF  +GFVEKIVTFQKSAGFQALIQF + Q AV A  +L GRNIYDGCCQLDIQ+
Sbjct  120  EVLHQVFKAYGFVEKIVTFQKSAGFQALIQFHSRQEAVEAFGSLHGRNIYDGCCQLDIQY  179

Query  652  SNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            SNL ELQV+YNNDRSRDFTNP+LP+EQ+ ++SQ  Y D   +Y+
Sbjct  180  SNLSELQVHYNNDRSRDFTNPSLPTEQRPRASQQAYPDPANLYA  223



>ref|NP_001055652.1| Os05g0437300 [Oryza sativa Japonica Group]
 dbj|BAF17566.1| Os05g0437300 [Oryza sativa Japonica Group]
 dbj|BAG95704.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79291.1| hypothetical protein OsI_20097 [Oryza sativa Indica Group]
 gb|EEE63848.1| hypothetical protein OsJ_18672 [Oryza sativa Japonica Group]
Length=444

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/222 (74%), Positives = 194/222 (87%), Gaps = 5/222 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIH+RNVGHEI+E DLLQL QPFG ++K+VMLRAKNQALLQMQD+ ++V+ALQ+
Sbjct  1    MAEPSKVIHIRNVGHEIAEADLLQLLQPFGNVSKIVMLRAKNQALLQMQDLHNSVSALQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGD----EPNRILLVTIHHMLYPITVEV  477
            Y+ VQPS+RGRNVY+QFSSHQELTT DQN+  R      EPNRILLVTIHHM+YPITVEV
Sbjct  61   YSTVQPSVRGRNVYMQFSSHQELTT-DQNSHGRNSDQESEPNRILLVTIHHMMYPITVEV  119

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            LHQVF  +G+VEKIVTFQKSAGFQALIQ+Q+ Q A+ A  AL GRNIYDGCCQLDIQ+SN
Sbjct  120  LHQVFKAYGYVEKIVTFQKSAGFQALIQYQSLQEAMDAFGALHGRNIYDGCCQLDIQYSN  179

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            L ELQV+YNNDRSRDFTNP+LP+EQ+ ++SQ GY D GG+Y+
Sbjct  180  LSELQVHYNNDRSRDFTNPSLPTEQRPRASQQGYPDPGGLYA  221



>ref|XP_009621583.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Nicotiana tomentosiformis]
Length=407

 Score =   347 bits (891),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 176/182 (97%), Gaps = 1/182 (1%)
 Frame = +1

Query  238  MLRAKNQALLQMQDVPSAVNALQFYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  417
            MLRAKNQALLQMQDVPSAVNALQFY+NVQPSIRGRNVY+QFSSHQELTTMDQN+Q RGDE
Sbjct  1    MLRAKNQALLQMQDVPSAVNALQFYSNVQPSIRGRNVYVQFSSHQELTTMDQNSQGRGDE  60

Query  418  PNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARN  597
            PNRILLVTIHH+LYPITVEVLHQVFSPHG VEKIVTFQKSAGFQALIQ+Q  Q+AVSARN
Sbjct  61   PNRILLVTIHHVLYPITVEVLHQVFSPHGVVEKIVTFQKSAGFQALIQYQLPQNAVSARN  120

Query  598  ALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGM  777
            +LQGRN+YDGCCQLD+QFSNLDELQVNYNN+RSRDFTNPNLPSEQKGKS Q GYGDAGGM
Sbjct  121  SLQGRNVYDGCCQLDVQFSNLDELQVNYNNERSRDFTNPNLPSEQKGKSPQ-GYGDAGGM  179

Query  778  YS  783
            YS
Sbjct  180  YS  181



>ref|XP_002441164.1| hypothetical protein SORBIDRAFT_09g021560 [Sorghum bicolor]
 gb|EES19594.1| hypothetical protein SORBIDRAFT_09g021560 [Sorghum bicolor]
Length=444

 Score =   348 bits (892),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/222 (74%), Positives = 194/222 (87%), Gaps = 5/222 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M+EPSKVIH+RNVGHEI+E+DLLQL QPFGV++K+VMLRAKNQALLQM+D+ ++V+ALQ+
Sbjct  1    MSEPSKVIHIRNVGHEIAESDLLQLLQPFGVVSKIVMLRAKNQALLQMEDIHASVSALQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGD----EPNRILLVTIHHMLYPITVEV  477
            YT+VQPSIRGRNVY+QFSSHQELTT DQ++  R      EPNRILLVTIHHM+YPITVEV
Sbjct  61   YTSVQPSIRGRNVYMQFSSHQELTT-DQSSHGRNSDQESEPNRILLVTIHHMIYPITVEV  119

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            LHQVF  +GFVEKIVTFQKSAGFQALIQF + Q AV A  +L GRNIYDGCCQLDIQ+SN
Sbjct  120  LHQVFKAYGFVEKIVTFQKSAGFQALIQFHSRQEAVEAFGSLHGRNIYDGCCQLDIQYSN  179

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            L ELQV+YNNDRSRDFTNP+LP+EQ+ ++ Q GY D   +Y+
Sbjct  180  LSELQVHYNNDRSRDFTNPSLPTEQRPRAPQQGYPDPANLYA  221



>ref|XP_004961956.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Setaria italica]
 ref|XP_004961957.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Setaria italica]
Length=444

 Score =   347 bits (891),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 162/222 (73%), Positives = 194/222 (87%), Gaps = 5/222 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIH+RNVGHEI+E+DLLQL QPFG+++K+VMLRAKNQALLQM+D+ ++V ALQ+
Sbjct  1    MAEPSKVIHIRNVGHEIAESDLLQLLQPFGLVSKIVMLRAKNQALLQMEDIHASVTALQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGD----EPNRILLVTIHHMLYPITVEV  477
            Y++VQPS+RGRNVY+QFSSHQELTT DQ++  R      EPNRILLVTIHHM+YPITVEV
Sbjct  61   YSSVQPSVRGRNVYMQFSSHQELTT-DQSSHGRNSDQESEPNRILLVTIHHMIYPITVEV  119

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            LHQVF  +GFVEKIVTFQKSAGFQALIQ+ + Q AV A  +L GRNIYDGCCQLDIQ+SN
Sbjct  120  LHQVFKAYGFVEKIVTFQKSAGFQALIQYHSRQEAVEAFGSLHGRNIYDGCCQLDIQYSN  179

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            L ELQV+YNNDRSRDFTNP+LP+EQ+ ++SQ GY D  G+Y+
Sbjct  180  LSELQVHYNNDRSRDFTNPSLPTEQRPRTSQQGYPDPAGLYA  221



>ref|XP_003568375.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Brachypodium distachyon]
Length=444

 Score =   347 bits (890),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 164/222 (74%), Positives = 191/222 (86%), Gaps = 5/222 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M E SKVIH+RNVGHEI+E DLLQL QPFG ++K+VMLRAKNQALLQMQD+ S+V+ALQ+
Sbjct  1    MAEASKVIHIRNVGHEIAEADLLQLLQPFGAVSKIVMLRAKNQALLQMQDIHSSVSALQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGD----EPNRILLVTIHHMLYPITVEV  477
            YT VQPS+RGRN+Y+QFSSHQELTT DQ++  R      EPNRILL TIHHM+YPITVEV
Sbjct  61   YTTVQPSVRGRNIYMQFSSHQELTT-DQSSHGRNSDQDSEPNRILLATIHHMIYPITVEV  119

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            LHQVF  +G+VEKIVTF KSAGFQALIQ+Q+ Q AV A  AL GRNIYDGCCQLDIQ+SN
Sbjct  120  LHQVFKAYGYVEKIVTFNKSAGFQALIQYQSRQEAVEAFGALHGRNIYDGCCQLDIQYSN  179

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            L ELQV+YNNDRSRDFTNP+LP+EQ+ +SSQ GY D GG+Y+
Sbjct  180  LSELQVHYNNDRSRDFTNPSLPTEQRPRSSQQGYPDPGGLYA  221



>ref|XP_008655270.1| PREDICTED: uncharacterized protein LOC100383343 isoform X1 [Zea 
mays]
 gb|AFW81820.1| hypothetical protein ZEAMMB73_476847 [Zea mays]
Length=529

 Score =   350 bits (897),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 197/223 (88%), Gaps = 5/223 (2%)
 Frame = +1

Query  127  KMTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQ  306
            +M+EPSKVIH+RNVGHEI+E+DLLQL QPFG+++K+VMLRAKNQALLQM+D+ ++V+ALQ
Sbjct  85   RMSEPSKVIHIRNVGHEIAESDLLQLLQPFGMVSKIVMLRAKNQALLQMEDLHASVSALQ  144

Query  307  FYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR----GDEPNRILLVTIHHMLYPITVE  474
            +YT+VQPSIRGRNVY+QFSSHQELTT DQ++  R    G EPNRILLVTIHHM+YPITVE
Sbjct  145  YYTSVQPSIRGRNVYMQFSSHQELTT-DQSSHGRNSDQGSEPNRILLVTIHHMIYPITVE  203

Query  475  VLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFS  654
            +LHQVF  +GFVEKIVTFQKSAGFQALIQ+ + Q AV A  +L GRNIYDGCCQLDIQ+S
Sbjct  204  ILHQVFKAYGFVEKIVTFQKSAGFQALIQYHSRQEAVEAFGSLHGRNIYDGCCQLDIQYS  263

Query  655  NLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            NL ELQV+YNNDRSRDFTNP+LP+EQ+ ++SQ GY D   +Y+
Sbjct  264  NLSELQVHYNNDRSRDFTNPSLPTEQRPRASQQGYLDPANLYA  306



>ref|XP_008644687.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Zea mays]
 ref|XP_008648140.1| PREDICTED: uncharacterized protein LOC100383701 isoform X2 [Zea 
mays]
 gb|AFW68315.1| hypothetical protein ZEAMMB73_143783 [Zea mays]
 gb|AFW78164.1| hypothetical protein ZEAMMB73_011466 [Zea mays]
Length=444

 Score =   347 bits (889),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 163/222 (73%), Positives = 193/222 (87%), Gaps = 5/222 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M+EPSKVIH+RNVGHEI+E+DLLQL QPFGV++K+VMLRAKNQ LLQM+D+ ++V+ALQ+
Sbjct  1    MSEPSKVIHIRNVGHEIAESDLLQLLQPFGVVSKIVMLRAKNQTLLQMEDIHASVSALQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGD----EPNRILLVTIHHMLYPITVEV  477
            YT+VQPSIRGRNVY+QFSSHQELTT DQ++  R      EPNRILLVTIHHM+YPITVEV
Sbjct  61   YTSVQPSIRGRNVYMQFSSHQELTT-DQSSHGRNSDQESEPNRILLVTIHHMIYPITVEV  119

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            LHQVF  +GFVEKIVTFQKSAGFQALIQF + Q AV A  +L GRNIYDGCCQLDIQ+SN
Sbjct  120  LHQVFKAYGFVEKIVTFQKSAGFQALIQFHSRQEAVEAFGSLHGRNIYDGCCQLDIQYSN  179

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            L ELQV+YNNDRSRDFTNP+LP+EQ+ ++SQ  Y D   +Y+
Sbjct  180  LSELQVHYNNDRSRDFTNPSLPTEQRPRASQQAYPDPANLYA  221



>ref|XP_006654460.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Oryza brachyantha]
Length=444

 Score =   347 bits (889),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 165/222 (74%), Positives = 192/222 (86%), Gaps = 5/222 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIH+RNVGHEI+E DLLQL QPFG + K+VMLRAKNQALLQMQD+ ++V+ALQ+
Sbjct  1    MAEPSKVIHIRNVGHEIAEADLLQLLQPFGNVAKIVMLRAKNQALLQMQDLHNSVSALQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGD----EPNRILLVTIHHMLYPITVEV  477
            Y+ VQPS+RGRNVY+QFSSHQELTT DQ++  R      EPNRILLVTIHHM+YPITVEV
Sbjct  61   YSAVQPSVRGRNVYMQFSSHQELTT-DQSSHGRNSDQESEPNRILLVTIHHMMYPITVEV  119

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            LHQVF  +G+VEKIVTFQKSAGFQALIQ+Q+ Q AV A  AL GRNIYDGCCQLDIQ+SN
Sbjct  120  LHQVFKAYGYVEKIVTFQKSAGFQALIQYQSLQEAVEAFGALHGRNIYDGCCQLDIQYSN  179

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            L ELQV+YNNDRSRDFTNP+LP+EQ+ + SQ GY D GG+Y+
Sbjct  180  LSELQVHYNNDRSRDFTNPSLPTEQRPRGSQQGYPDPGGLYA  221



>emb|CBH32582.1| RNA recognition domain containing protein,expressed [Triticum 
aestivum]
 emb|CDM85150.1| unnamed protein product [Triticum aestivum]
Length=439

 Score =   347 bits (889),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 191/215 (89%), Gaps = 4/215 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPS+VIH+RNVGHEISE DLLQ+ QPFG + KLVMLR KNQAL+QM+D+ ++++A+Q+
Sbjct  1    MAEPSRVIHIRNVGHEISETDLLQVVQPFGAVAKLVMLRTKNQALVQMEDLSASISAIQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRG---DEPNRILLVTIHHMLYPITVEVL  480
            YT +QPS+RGRNVY+Q+SSHQELTT DQ++  R    DEPNRILLVT+HHMLYP+TVEVL
Sbjct  61   YTTIQPSVRGRNVYLQYSSHQELTT-DQSSHGRNPDQDEPNRILLVTVHHMLYPMTVEVL  119

Query  481  HQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNL  660
            HQVFSP+GFVEKIVTFQK+AGFQALIQFQ+ QSA+ A  AL GRNIYDGCCQLDIQ+SNL
Sbjct  120  HQVFSPYGFVEKIVTFQKTAGFQALIQFQSRQSAIQAAGALHGRNIYDGCCQLDIQYSNL  179

Query  661  DELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGD  765
             ELQV+YNNDRSRDFTNP+LP+EQ+ +SSQ GY D
Sbjct  180  SELQVHYNNDRSRDFTNPSLPTEQRPRSSQLGYND  214



>gb|EEC71864.1| hypothetical protein OsI_04570 [Oryza sativa Indica Group]
Length=443

 Score =   346 bits (888),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 161/220 (73%), Positives = 191/220 (87%), Gaps = 4/220 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIH+RNVGHEISE++LLQ+ QPFG + KLVMLRAKNQAL+QM+D+ SAVN +Q+
Sbjct  1    MAEPSKVIHIRNVGHEISESELLQVVQPFGTVAKLVMLRAKNQALVQMEDLASAVNVIQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRG---DEPNRILLVTIHHMLYPITVEVL  480
            Y  +QPS+RGRNVY+Q+SSHQELTT DQ++  R    +EPNRILLVTIHHMLYPIT+EVL
Sbjct  61   YNTIQPSVRGRNVYLQYSSHQELTT-DQSSHGRNPDQEEPNRILLVTIHHMLYPITIEVL  119

Query  481  HQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNL  660
            HQVFSP+GFVEKIVTFQKSAGFQ LIQ+Q+ QSA+ A  AL GRNIYDGCCQLDIQ+SNL
Sbjct  120  HQVFSPYGFVEKIVTFQKSAGFQTLIQYQSRQSAIQAYGALHGRNIYDGCCQLDIQYSNL  179

Query  661  DELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
             ELQV+YNNDRSRDFTNP+LP+EQ+ +SSQ  Y D   ++
Sbjct  180  SELQVHYNNDRSRDFTNPSLPTEQRSRSSQPSYNDPSSLF  219



>gb|AFW78165.1| hypothetical protein ZEAMMB73_011466 [Zea mays]
Length=444

 Score =   346 bits (888),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 163/222 (73%), Positives = 193/222 (87%), Gaps = 5/222 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M+EPSKVIH+RNVGHEI+E+DLLQL QPFGV++K+VMLRAKNQ LLQM+D+ ++V+ALQ+
Sbjct  1    MSEPSKVIHIRNVGHEIAESDLLQLLQPFGVVSKIVMLRAKNQTLLQMEDIHASVSALQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGD----EPNRILLVTIHHMLYPITVEV  477
            YT+VQPSIRGRNVY+QFSSHQELTT DQ++  R      EPNRILLVTIHHM+YPITVEV
Sbjct  61   YTSVQPSIRGRNVYMQFSSHQELTT-DQSSHGRNSDQESEPNRILLVTIHHMIYPITVEV  119

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            LHQVF  +GFVEKIVTFQKSAGFQALIQF + Q AV A  +L GRNIYDGCCQLDIQ+SN
Sbjct  120  LHQVFKAYGFVEKIVTFQKSAGFQALIQFHSRQEAVEAFGSLHGRNIYDGCCQLDIQYSN  179

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            L ELQV+YNNDRSRDFTNP+LP+EQ+ ++SQ  Y D   +Y+
Sbjct  180  LSELQVHYNNDRSRDFTNPSLPTEQRPRASQQAYPDPANLYA  221



>ref|XP_003564696.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Brachypodium distachyon]
Length=443

 Score =   345 bits (885),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/220 (73%), Positives = 195/220 (89%), Gaps = 4/220 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M +PS+VIH+RNVGHEISE+DLLQ+ QPFG + KLVMLRAKNQAL+QM+D+ ++V+A+Q+
Sbjct  1    MGDPSRVIHIRNVGHEISESDLLQVVQPFGTVAKLVMLRAKNQALVQMEDLAASVSAIQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRG---DEPNRILLVTIHHMLYPITVEVL  480
            YT +QPS+RGRNVY+Q+SSHQELTT DQ++  R    DEPNRILLVT+HHMLYP+TVEVL
Sbjct  61   YTTIQPSVRGRNVYLQYSSHQELTT-DQSSHGRNPDQDEPNRILLVTVHHMLYPMTVEVL  119

Query  481  HQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNL  660
            HQVFSP+GFVEKIVTFQK+AGFQALIQ+Q+ QSA+ A  AL GRNIYDGCCQLDIQ+SNL
Sbjct  120  HQVFSPYGFVEKIVTFQKTAGFQALIQYQSRQSAIQACGALHGRNIYDGCCQLDIQYSNL  179

Query  661  DELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
             ELQV+YNNDRSRDFTNP+LP+EQ+ +SSQ GY D   ++
Sbjct  180  SELQVHYNNDRSRDFTNPSLPTEQRQRSSQPGYNDPSVLF  219



>gb|EMT30091.1| Polypyrimidine tract-binding protein-3-like protein [Aegilops 
tauschii]
Length=506

 Score =   347 bits (890),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 192/216 (89%), Gaps = 4/216 (2%)
 Frame = +1

Query  127  KMTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQ  306
            +M EPS+VIH+RNVGHEISE DLLQ+ QPFG + KLVMLR KNQAL+QM+D+ ++++A+Q
Sbjct  30   RMAEPSRVIHIRNVGHEISETDLLQVVQPFGAVAKLVMLRTKNQALVQMEDLSASISAIQ  89

Query  307  FYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRG---DEPNRILLVTIHHMLYPITVEV  477
            +YT +QPS+RGRNVY+Q+SSHQELTT DQ++  R    DEPNRILLVT+HHMLYP+TVEV
Sbjct  90   YYTTIQPSVRGRNVYLQYSSHQELTT-DQSSHGRNPDQDEPNRILLVTVHHMLYPMTVEV  148

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            LHQVFSP+GFVEKIVTFQK+AGFQALIQFQ+ QSA+ A  AL GRNIYDGCCQLDIQ+SN
Sbjct  149  LHQVFSPYGFVEKIVTFQKTAGFQALIQFQSRQSAIQAAGALHGRNIYDGCCQLDIQYSN  208

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGD  765
            L ELQV+YNNDRSRDFTNP+LP+EQ+ +SSQ GY D
Sbjct  209  LSELQVHYNNDRSRDFTNPSLPTEQRPRSSQLGYND  244



>ref|XP_006665040.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Oryza brachyantha]
Length=443

 Score =   344 bits (883),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 161/220 (73%), Positives = 191/220 (87%), Gaps = 4/220 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIH+RNVGHEISE++LLQ+ QPFG + KLVMLRAKNQAL+QM+D+ SAVN +Q+
Sbjct  1    MGEPSKVIHIRNVGHEISESELLQVVQPFGTVAKLVMLRAKNQALVQMEDLASAVNVIQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRG---DEPNRILLVTIHHMLYPITVEVL  480
            Y  +QPS+RGRN+Y+QFSSHQELTT DQ++  R    +EPNRILLVTIHHMLYPIT+EVL
Sbjct  61   YNTIQPSVRGRNIYLQFSSHQELTT-DQSSHGRNPDQEEPNRILLVTIHHMLYPITIEVL  119

Query  481  HQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNL  660
            HQVFSP+GFVEKIVTFQKSAGFQALIQ+Q+  SA+ A  AL GRNIYDGCCQLDIQ+SNL
Sbjct  120  HQVFSPYGFVEKIVTFQKSAGFQALIQYQSRPSAIQAYGALHGRNIYDGCCQLDIQYSNL  179

Query  661  DELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
             ELQV+YNNDRSRDFTNP+LP+EQ+ +SSQ  Y D   ++
Sbjct  180  SELQVHYNNDRSRDFTNPSLPTEQRPRSSQPSYNDPSSLF  219



>gb|EMS55211.1| Polypyrimidine tract-binding protein-like protein 3 [Triticum 
urartu]
Length=528

 Score =   347 bits (889),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 191/215 (89%), Gaps = 4/215 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPS+VIH+RNVGHEISE DLLQ+ QPFG + KLVMLR KNQAL+QM+D+ ++++A+Q+
Sbjct  1    MAEPSRVIHIRNVGHEISETDLLQVVQPFGAVAKLVMLRTKNQALVQMEDLSASISAIQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRG---DEPNRILLVTIHHMLYPITVEVL  480
            YT +QPS+RGRNVY+Q+SSHQELTT DQ++  R    DEPNRILLVT+HHMLYP+TVEVL
Sbjct  61   YTTIQPSVRGRNVYLQYSSHQELTT-DQSSHGRNPDQDEPNRILLVTVHHMLYPMTVEVL  119

Query  481  HQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNL  660
            HQVFSP+GFVEKIVTFQK+AGFQALIQFQ+ QSA+ A  AL GRNIYDGCCQLDIQ+SNL
Sbjct  120  HQVFSPYGFVEKIVTFQKTAGFQALIQFQSRQSAIQAAGALHGRNIYDGCCQLDIQYSNL  179

Query  661  DELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGD  765
             ELQV+YNNDRSRDFTNP+LP+EQ+ +SSQ GY D
Sbjct  180  SELQVHYNNDRSRDFTNPSLPTEQRPRSSQLGYND  214



>ref|XP_010232611.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Brachypodium distachyon]
Length=470

 Score =   344 bits (883),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/220 (73%), Positives = 195/220 (89%), Gaps = 4/220 (2%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M +PS+VIH+RNVGHEISE+DLLQ+ QPFG + KLVMLRAKNQAL+QM+D+ ++V+A+Q+
Sbjct  1    MGDPSRVIHIRNVGHEISESDLLQVVQPFGTVAKLVMLRAKNQALVQMEDLAASVSAIQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRG---DEPNRILLVTIHHMLYPITVEVL  480
            YT +QPS+RGRNVY+Q+SSHQELTT DQ++  R    DEPNRILLVT+HHMLYP+TVEVL
Sbjct  61   YTTIQPSVRGRNVYLQYSSHQELTT-DQSSHGRNPDQDEPNRILLVTVHHMLYPMTVEVL  119

Query  481  HQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNL  660
            HQVFSP+GFVEKIVTFQK+AGFQALIQ+Q+ QSA+ A  AL GRNIYDGCCQLDIQ+SNL
Sbjct  120  HQVFSPYGFVEKIVTFQKTAGFQALIQYQSRQSAIQACGALHGRNIYDGCCQLDIQYSNL  179

Query  661  DELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
             ELQV+YNNDRSRDFTNP+LP+EQ+ +SSQ GY D   ++
Sbjct  180  SELQVHYNNDRSRDFTNPSLPTEQRQRSSQPGYNDPSVLF  219



>gb|KEH25911.1| polypyrimidine tract-binding-like protein [Medicago truncatula]
Length=336

 Score =   338 bits (868),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 189/217 (87%), Gaps = 8/217 (4%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIHVRNVG EI+ENDLL LFQPFGVITKL++LRAKNQ      ++PSA+ A++F
Sbjct  1    MAEPSKVIHVRNVGPEIAENDLLLLFQPFGVITKLMVLRAKNQ------NIPSAIRAVEF  54

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQV  489
            Y N QPSIRGRN+Y+QFSSH+ +T+ +Q +Q R DEPNRILLVTIH +LYP+TV+VL QV
Sbjct  55   YANAQPSIRGRNLYVQFSSHRVITSANQ-SQGREDEPNRILLVTIHQVLYPMTVDVLQQV  113

Query  490  FSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDEL  669
            FS HG VEKIVTFQKSAGFQALIQ++T Q AV+AR ALQGRN+YDGCCQLDIQFSNLDEL
Sbjct  114  FSRHGCVEKIVTFQKSAGFQALIQYETRQGAVTARGALQGRNVYDGCCQLDIQFSNLDEL  173

Query  670  QVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            QVNYNND SRDFTNPNLP+EQKG+SSQ G GDA GMY
Sbjct  174  QVNYNNDWSRDFTNPNLPTEQKGQSSQSGSGDA-GMY  209



>ref|XP_006654459.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Oryza brachyantha]
Length=445

 Score =   342 bits (877),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 165/223 (74%), Positives = 192/223 (86%), Gaps = 6/223 (3%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIH+RNVGHEI+E DLLQL QPFG + K+VMLRAKNQALLQMQD+ ++V+ALQ+
Sbjct  1    MAEPSKVIHIRNVGHEIAEADLLQLLQPFGNVAKIVMLRAKNQALLQMQDLHNSVSALQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGD----EPNRILLVTIHHMLYPITVEV  477
            Y+ VQPS+RGRNVY+QFSSHQELTT DQ++  R      EPNRILLVTIHHM+YPITVEV
Sbjct  61   YSAVQPSVRGRNVYMQFSSHQELTT-DQSSHGRNSDQESEPNRILLVTIHHMMYPITVEV  119

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            LHQVF  +G+VEKIVTFQKSAGFQALIQ+Q+ Q AV A  AL GRNIYDGCCQLDIQ+SN
Sbjct  120  LHQVFKAYGYVEKIVTFQKSAGFQALIQYQSLQEAVEAFGALHGRNIYDGCCQLDIQYSN  179

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSS-QHGYGDAGGMYS  783
            L ELQV+YNNDRSRDFTNP+LP+EQ+ + S Q GY D GG+Y+
Sbjct  180  LSELQVHYNNDRSRDFTNPSLPTEQRPRGSQQQGYPDPGGLYA  222



>ref|XP_008644686.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X1 [Zea mays]
 ref|XP_008648139.1| PREDICTED: uncharacterized protein LOC100383701 isoform X1 [Zea 
mays]
 gb|AFW68314.1| hypothetical protein ZEAMMB73_143783 [Zea mays]
Length=445

 Score =   342 bits (877),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 193/223 (87%), Gaps = 6/223 (3%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M+EPSKVIH+RNVGHEI+E+DLLQL QPFGV++K+VMLRAKNQ LLQM+D+ ++V+ALQ+
Sbjct  1    MSEPSKVIHIRNVGHEIAESDLLQLLQPFGVVSKIVMLRAKNQTLLQMEDIHASVSALQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGD----EPNRILLVTIHHMLYPITVEV  477
            YT+VQPSIRGRNVY+QFSSHQELTT DQ++  R      EPNRILLVTIHHM+YPITVEV
Sbjct  61   YTSVQPSIRGRNVYMQFSSHQELTT-DQSSHGRNSDQESEPNRILLVTIHHMIYPITVEV  119

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            LHQVF  +GFVEKIVTFQKSAGFQALIQF + Q AV A  +L GRNIYDGCCQLDIQ+SN
Sbjct  120  LHQVFKAYGFVEKIVTFQKSAGFQALIQFHSRQEAVEAFGSLHGRNIYDGCCQLDIQYSN  179

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSS-QHGYGDAGGMYS  783
            L ELQV+YNNDRSRDFTNP+LP+EQ+ ++S Q  Y D   +Y+
Sbjct  180  LSELQVHYNNDRSRDFTNPSLPTEQRPRASQQQAYPDPANLYA  222



>gb|ADE76165.1| unknown [Picea sitchensis]
Length=461

 Score =   341 bits (875),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/222 (74%), Positives = 188/222 (85%), Gaps = 6/222 (3%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTE SKV+H+RNVG EISENDLLQL Q FG +TKLVMLRAKNQAL+QM D+PSA+  L  
Sbjct  1    MTEASKVLHIRNVGAEISENDLLQLVQRFGTVTKLVMLRAKNQALMQMNDIPSAITVLDH  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR--GD---EPNRILLVTIHHMLYPITVE  474
            Y+ VQPSIRGRNVYIQFSSHQELTT +Q+ Q+R  GD   +PNRILLVTIHH+LYPITVE
Sbjct  61   YSTVQPSIRGRNVYIQFSSHQELTTTEQSGQARRNGDQDSQPNRILLVTIHHLLYPITVE  120

Query  475  VLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFS  654
            VLHQVFSPHGFVEKIV FQKS G QA +Q+ + Q+A+ A N LQGRNIYDGCCQLDIQFS
Sbjct  121  VLHQVFSPHGFVEKIVIFQKS-GLQAFVQYSSRQNAIQASNTLQGRNIYDGCCQLDIQFS  179

Query  655  NLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            NL ELQVNYNN+R+RDFTNP+LPSEQK +     +G+AGGMY
Sbjct  180  NLPELQVNYNNERTRDFTNPSLPSEQKHRLPAQSFGEAGGMY  221



>gb|AIZ74340.1| polypyrimidine tract-binding protein [Pinus massoniana]
Length=465

 Score =   340 bits (873),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 167/222 (75%), Positives = 190/222 (86%), Gaps = 7/222 (3%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTE SKV+H+RNVG EISENDLLQL Q FG +TKLVMLRAKNQAL+QM D+PSA++ L  
Sbjct  1    MTEASKVLHIRNVGAEISENDLLQLVQRFGTVTKLVMLRAKNQALMQMHDIPSAISVLDH  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR--GD---EPNRILLVTIHHMLYPITVE  474
            Y+ VQPSIRGRNVYIQFSSHQELTT +Q+ Q+R  GD   +PNRILLVTIHH+LYPITVE
Sbjct  61   YSTVQPSIRGRNVYIQFSSHQELTT-EQSGQARRNGDQDSQPNRILLVTIHHLLYPITVE  119

Query  475  VLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFS  654
            VLHQVFSPHGFVEKIV FQKS G QA +Q+ + Q+AV ARN LQGRNIYDGCCQLDIQFS
Sbjct  120  VLHQVFSPHGFVEKIVIFQKS-GLQAFVQYSSRQNAVQARNTLQGRNIYDGCCQLDIQFS  178

Query  655  NLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            NL ELQVNYNN+R+RDFTNP+LPSEQK +     +G+AGGMY
Sbjct  179  NLTELQVNYNNERTRDFTNPSLPSEQKHRLPAQSFGEAGGMY  220



>gb|KDP30748.1| hypothetical protein JCGZ_15177 [Jatropha curcas]
Length=434

 Score =   335 bits (859),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 173/194 (89%), Gaps = 15/194 (8%)
 Frame = +1

Query  187  NDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTNVQPSIRGRNVYIQFSS  366
            NDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA+NALQFYTNVQP+IRGRNVY+QFSS
Sbjct  25   NDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQFYTNVQPAIRGRNVYVQFSS  84

Query  367  HQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGF  546
            HQELTTMDQN+Q RGDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGF
Sbjct  85   HQELTTMDQNSQGRGDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGF  144

Query  547  QALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            QALIQ+Q  QSAV+AR +LQGRNIYDGCCQLDIQF              S+DFTNPNLPS
Sbjct  145  QALIQYQLRQSAVAARTSLQGRNIYDGCCQLDIQF--------------SKDFTNPNLPS  190

Query  727  EQK-GKSSQHGYGD  765
            EQK G+SSQ GY D
Sbjct  191  EQKGGRSSQAGYSD  204



>ref|NP_001044916.1| Os01g0867800 [Oryza sativa Japonica Group]
 dbj|BAF06830.1| Os01g0867800 [Oryza sativa Japonica Group]
 dbj|BAG91238.1| unnamed protein product [Oryza sativa Japonica Group]
Length=439

 Score =   335 bits (858),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/220 (72%), Positives = 187/220 (85%), Gaps = 8/220 (4%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIH+RNVGHEISE++LLQ+ QPFG + KLVMLRAKNQ    M+D+ SAVN +Q+
Sbjct  1    MAEPSKVIHIRNVGHEISESELLQVVQPFGTVAKLVMLRAKNQ----MEDLASAVNVIQY  56

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRG---DEPNRILLVTIHHMLYPITVEVL  480
            Y  +QPS+RGRNVY+Q+SSHQELTT DQ++  R    +EPNRILLVTIHHMLYPIT+EVL
Sbjct  57   YNTIQPSVRGRNVYLQYSSHQELTT-DQSSHGRNPDQEEPNRILLVTIHHMLYPITIEVL  115

Query  481  HQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNL  660
            HQVFSP+GFVEKIVTFQKSAGFQ LIQ+Q+ QSA+ A  AL GRNIYDGCCQLDIQ+SNL
Sbjct  116  HQVFSPYGFVEKIVTFQKSAGFQTLIQYQSRQSAIQAYGALHGRNIYDGCCQLDIQYSNL  175

Query  661  DELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
             ELQV+YNNDRSRDFTNP+LP+EQ+ +SSQ  Y D   ++
Sbjct  176  SELQVHYNNDRSRDFTNPSLPTEQRSRSSQPSYNDPSSLF  215



>ref|XP_003632518.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
isoform X2 [Vitis vinifera]
Length=412

 Score =   333 bits (854),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 174/186 (94%), Gaps = 4/186 (2%)
 Frame = +1

Query  238  MLRAKNQALLQMQDVPSAVNALQFYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR-GD  414
            MLRAKNQALLQMQDV SAV+ALQ+Y NVQPS+RGRNVY+QFSSHQELTTMDQN+Q R GD
Sbjct  1    MLRAKNQALLQMQDVASAVSALQYYANVQPSVRGRNVYVQFSSHQELTTMDQNSQGRKGD  60

Query  415  E---PNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAV  585
            +   PNRILLVTIHH+LYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQ+Q+ QSAV
Sbjct  61   QDAQPNRILLVTIHHLLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQSRQSAV  120

Query  586  SARNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGD  765
            SA NALQGRNIYDGCCQLDIQFSNL ELQVNYNN+RSRDFTNP+LPSEQKG+SSQ GYGD
Sbjct  121  SAINALQGRNIYDGCCQLDIQFSNLTELQVNYNNERSRDFTNPSLPSEQKGRSSQSGYGD  180

Query  766  AGGMYS  783
             GGMY+
Sbjct  181  GGGMYA  186



>gb|ADE75620.1| unknown [Picea sitchensis]
Length=471

 Score =   330 bits (846),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 162/227 (71%), Positives = 191/227 (84%), Gaps = 10/227 (4%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKV+H+RNVGHEISENDLL L Q FG++TKLVMLRAKNQALLQM  V +A++ALQ+
Sbjct  1    MAEPSKVLHIRNVGHEISENDLLNLVQQFGLVTKLVMLRAKNQALLQMHHVSAAIDALQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR--GDE---PNRILLVTIHHMLYPITVE  474
            Y+ VQPS+RGRNVYIQFSSHQELTT++  T +R  GD+   PNRILLVTIHH+L+PITVE
Sbjct  61   YSTVQPSVRGRNVYIQFSSHQELTTVEHPTHARQSGDQDSQPNRILLVTIHHLLFPITVE  120

Query  475  VLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFS  654
            VLHQVFSP GFVEKIVTFQKSAG QALIQ+ + Q+AV A+N LQGRNIYDGCCQLDIQFS
Sbjct  121  VLHQVFSPCGFVEKIVTFQKSAGLQALIQYTSQQNAVQAKNNLQGRNIYDGCCQLDIQFS  180

Query  655  NLDELQVNYNNDRSRDFTNPNLPSEQKGK-----SSQHGYGDAGGMY  780
            NL+ LQV+Y N+RSRDFTNP+LPSEQK +     ++   +G  G +Y
Sbjct  181  NLNGLQVHYINERSRDFTNPSLPSEQKDRIPAQANAMSAFGGTGSIY  227



>ref|XP_003592083.1| Polypyrimidine tract-binding protein-like protein [Medicago truncatula]
Length=407

 Score =   325 bits (832),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = +1

Query  238  MLRAKNQALLQMQDVPSAVNALQFYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  417
            MLRAKNQAL+QMQDVPSAV+AL FY N QPSIRGRNVY+QFSSHQELTT+DQ +Q RGDE
Sbjct  1    MLRAKNQALIQMQDVPSAVSALHFYGNTQPSIRGRNVYVQFSSHQELTTIDQ-SQGRGDE  59

Query  418  PNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARN  597
            PNRILLVTIHH+LYPITV+VL+QVFSPHG VEKIVTFQKSAGFQALIQ+Q+ QS+++AR 
Sbjct  60   PNRILLVTIHHVLYPITVDVLYQVFSPHGSVEKIVTFQKSAGFQALIQYQSQQSSITART  119

Query  598  ALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGM  777
            ALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLP+EQKG+  Q GYGDAG M
Sbjct  120  ALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPTEQKGRPPQLGYGDAGNM  179

Query  778  Y  780
            Y
Sbjct  180  Y  180



>ref|XP_001761356.1| predicted protein [Physcomitrella patens]
 gb|EDQ73745.1| predicted protein [Physcomitrella patens]
Length=441

 Score =   322 bits (824),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 177/207 (86%), Gaps = 6/207 (3%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKV+H+RNVG E++E+DLLQL Q FGV+ K+VMLRAKNQALLQMQDVPSA+N +Q+
Sbjct  1    MTEPSKVLHIRNVGPEVAESDLLQLAQSFGVVQKVVMLRAKNQALLQMQDVPSAINVMQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE------PNRILLVTIHHMLYPITV  471
            YT VQPS+RGRNVY+QFSSH+ELTT DQN Q+R         PNRILL+TIH+ LYPITV
Sbjct  61   YTTVQPSVRGRNVYMQFSSHKELTTPDQNGQTRRLPAEQELLPNRILLITIHNPLYPITV  120

Query  472  EVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQF  651
            +VLHQVFSPHGFVEKIVTF KSAG QAL+Q+ +  SAV AR  LQGRNIYDGCC LDIQ+
Sbjct  121  DVLHQVFSPHGFVEKIVTFTKSAGLQALLQYASQPSAVQARTTLQGRNIYDGCCTLDIQY  180

Query  652  SNLDELQVNYNNDRSRDFTNPNLPSEQ  732
            SNL ELQVNYNN+R+RDFTN  LPSEQ
Sbjct  181  SNLQELQVNYNNERTRDFTNAALPSEQ  207



>ref|XP_003619163.1| Polypyrimidine tract-binding protein-like protein [Medicago truncatula]
Length=318

 Score =   314 bits (804),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 165/178 (93%), Gaps = 1/178 (1%)
 Frame = +1

Query  238  MLRAKNQALLQMQDVPSAVNALQFYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  417
            MLRAKNQAL+QMQDV SA +A+QFY N QPSIRGRNVY+QFSSH+ELTTMDQN Q R DE
Sbjct  1    MLRAKNQALVQMQDVASADSAIQFYINSQPSIRGRNVYVQFSSHRELTTMDQN-QGREDE  59

Query  418  PNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARN  597
            PNRILLVT+H +LYP+TV+VL QVFSPHGFVEKIVTFQKSAGFQALIQ++T QSAV+AR 
Sbjct  60   PNRILLVTVHQVLYPMTVDVLQQVFSPHGFVEKIVTFQKSAGFQALIQYETRQSAVTARG  119

Query  598  ALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAG  771
            ALQGRN+YDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLP++QKG+ SQ GYGDAG
Sbjct  120  ALQGRNVYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPTDQKGRPSQAGYGDAG  177



>ref|XP_002973098.1| hypothetical protein SELMODRAFT_173175 [Selaginella moellendorffii]
 ref|XP_002976769.1| hypothetical protein SELMODRAFT_105564 [Selaginella moellendorffii]
 gb|EFJ22438.1| hypothetical protein SELMODRAFT_105564 [Selaginella moellendorffii]
 gb|EFJ25472.1| hypothetical protein SELMODRAFT_173175 [Selaginella moellendorffii]
Length=436

 Score =   318 bits (814),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 180/206 (87%), Gaps = 6/206 (3%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKV+HVRNVG EI+E+DLL L QPFG ++K+V+LR KNQALLQMQDV +A++A+Q+
Sbjct  1    MTEPSKVLHVRNVGQEITESDLLGLVQPFGSVSKMVLLRTKNQALLQMQDVNAAISAMQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSR---GDE---PNRILLVTIHHMLYPITV  471
            YT+VQPS+RGRNVYIQFSSHQELTT DQ TQ R   GD+   PNRILLVTIHH LYPITV
Sbjct  61   YTSVQPSVRGRNVYIQFSSHQELTTSDQATQPRRPAGDQDQQPNRILLVTIHHPLYPITV  120

Query  472  EVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQF  651
            +VLHQVF+PHG VEKIVTFQKSAG QALIQ+   QSAV A++ LQGRNIYDGCC LDIQF
Sbjct  121  DVLHQVFNPHGHVEKIVTFQKSAGLQALIQYNNQQSAVYAKSLLQGRNIYDGCCTLDIQF  180

Query  652  SNLDELQVNYNNDRSRDFTNPNLPSE  729
            SNL ELQVN+NN+R+RD+TN +LP+E
Sbjct  181  SNLQELQVNFNNERTRDYTNSSLPNE  206



>ref|XP_001759167.1| predicted protein [Physcomitrella patens]
 gb|EDQ75851.1| predicted protein [Physcomitrella patens]
Length=410

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 157/207 (76%), Gaps = 29/207 (14%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKV+H+RNVG EI+E                       QALLQMQD+PSA+N +Q+
Sbjct  1    MTEPSKVLHIRNVGPEIAE-----------------------QALLQMQDIPSAINLMQY  37

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE------PNRILLVTIHHMLYPITV  471
            YT VQPS+RGRNVY+QFSSH ELTT DQ+ Q+R         PNRILL+TIH+ LYPITV
Sbjct  38   YTTVQPSVRGRNVYMQFSSHPELTTPDQSGQTRRLPAEQELLPNRILLITIHNPLYPITV  97

Query  472  EVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQF  651
            +VLHQVFSPHGFVEKIVTF KSAG QAL+Q+ +  SAV AR+ LQGRNIYDGCC LDIQ+
Sbjct  98   DVLHQVFSPHGFVEKIVTFTKSAGLQALLQYASQSSAVQARSTLQGRNIYDGCCTLDIQY  157

Query  652  SNLDELQVNYNNDRSRDFTNPNLPSEQ  732
            SNL ELQVNYNN+R+RDFTN  LPSEQ
Sbjct  158  SNLQELQVNYNNERTRDFTNAALPSEQ  184



>ref|NP_001169809.1| uncharacterized protein LOC100383701 [Zea mays]
 gb|ACN34969.1| unknown [Zea mays]
Length=397

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 148/175 (85%), Gaps = 5/175 (3%)
 Frame = +1

Query  271  MQDVPSAVNALQFYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGD----EPNRILLV  438
            M+D+ ++V+ALQ+YT+VQPSIRGRNVY+QFSSHQELTT DQ++  R      EPNRILLV
Sbjct  1    MEDIHASVSALQYYTSVQPSIRGRNVYMQFSSHQELTT-DQSSHGRNSDQESEPNRILLV  59

Query  439  TIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNI  618
            TIHHM+YPITVEVLHQVF  +GFVEKIVTFQKSAGFQALIQF + Q AV A  +L GRNI
Sbjct  60   TIHHMIYPITVEVLHQVFKAYGFVEKIVTFQKSAGFQALIQFHSRQEAVEAFGSLHGRNI  119

Query  619  YDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
            YDGCCQLDIQ+SNL ELQV+YNNDRSRDFTNP+LP+EQ+ ++SQ  Y D   +Y+
Sbjct  120  YDGCCQLDIQYSNLSELQVHYNNDRSRDFTNPSLPTEQRPRASQQAYPDPANLYA  174



>gb|EMS57308.1| Polypyrimidine tract-binding protein-like protein 3 [Triticum 
urartu]
Length=323

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 139/166 (84%), Gaps = 6/166 (4%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIH+RNVGHEI+E DLLQL QPFG ++KLVMLR KNQALLQMQD+ S+V+ALQ+
Sbjct  1    MAEPSKVIHIRNVGHEITEADLLQLLQPFGSVSKLVMLRGKNQALLQMQDIHSSVSALQY  60

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRG----DEPNRILLVTIHHMLYPITVEV  477
            Y+ VQPS+RGR+VY+QFSSHQELTT DQ++ SR      EPNRILL T+HH+LYPITVE+
Sbjct  61   YSGVQPSVRGRHVYMQFSSHQELTT-DQSSHSRNSDQESEPNRILLATVHHVLYPITVEI  119

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQ-GR  612
            LHQVF  +G+VEKIV FQKSAGFQALIQ+Q+   AV A  AL  GR
Sbjct  120  LHQVFKAYGYVEKIVKFQKSAGFQALIQYQSRHEAVEALAALHTGR  165



>gb|AAV59307.1| putative polypyrimidine track-binding protein [Oryza sativa Japonica 
Group]
Length=389

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 133/164 (81%), Gaps = 13/164 (8%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            M EPSKVIH+RNVGHEI+E DLLQL QPFG ++K+        ALLQMQD+ ++V+ALQ+
Sbjct  1    MAEPSKVIHIRNVGHEIAEADLLQLLQPFGNVSKI--------ALLQMQDLHNSVSALQY  52

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGD----EPNRILLVTIHHMLYPITVEV  477
            Y+ VQPS+RGRNVY+QFSSHQELTT DQN+  R      EPNRILLVTIHHM+YPITVEV
Sbjct  53   YSTVQPSVRGRNVYMQFSSHQELTT-DQNSHGRNSDQESEPNRILLVTIHHMMYPITVEV  111

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQG  609
            LHQVF  +G+VEKIVTFQKSAGFQALIQ+Q+ Q A+ A  AL G
Sbjct  112  LHQVFKAYGYVEKIVTFQKSAGFQALIQYQSLQEAMDAFGALHG  155



>ref|XP_006386304.1| hypothetical protein POPTR_0002s06660g [Populus trichocarpa]
 gb|ERP64101.1| hypothetical protein POPTR_0002s06660g [Populus trichocarpa]
Length=330

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = +1

Query  451  MLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGC  630
            MLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQ+Q+ Q AV AR +LQGRNIYDGC
Sbjct  1    MLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQSRQCAVQARTSLQGRNIYDGC  60

Query  631  CQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH-GYGDAGG  774
            CQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKG+SSQ   YGD  G
Sbjct  61   CQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGRSSQQPAYGDVVG  109



>gb|EFA84392.1| RNA-binding region RNP-1 domain-containing protein [Polysphondylium 
pallidum PN500]
Length=468

 Score =   203 bits (516),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 148/209 (71%), Gaps = 6/209 (3%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PSKV+H+RN+  + +E++++ L  PFG +  +++L+ K+Q  +QM D+ SA   +QFYT 
Sbjct  47   PSKVVHLRNLPIDCTEHEIMALASPFGQVEHILILKGKSQGFIQMADLTSATAFIQFYTT  106

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQVFSP  498
            +Q SIR +N ++Q+S+ +E+T+      S  + PN ILLVTI +++YP+T++VL+Q+FS 
Sbjct  107  IQGSIRSKNFFVQYSNREEITSY-----SSVETPNNILLVTISNIIYPVTIDVLYQLFSK  161

Query  499  HGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDELQVN  678
            +G V KI+ F KS  FQ+LIQ  T  SA++A+  L G+NIY+GCC L IQ+S+L+ L++ 
Sbjct  162  YGSVLKILIFSKSGNFQSLIQLHTTDSAINAKRELDGQNIYNGCCTLKIQYSSLNNLRIK  221

Query  679  YNNDRSRDFTNPN-LPSEQKGKSSQHGYG  762
            YNND+SRDFTNP  LP      S+  G+G
Sbjct  222  YNNDKSRDFTNPTLLPGTTSLLSNPIGFG  250



>ref|XP_004368076.1| hnRNPL/PTB/hephaestus splicing factor subfamily protein [Acanthamoeba 
castellanii str. Neff]
 gb|ELR25321.1| hnRNPL/PTB/hephaestus splicing factor subfamily protein [Acanthamoeba 
castellanii str. Neff]
Length=575

 Score =   199 bits (507),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 140/212 (66%), Gaps = 9/212 (4%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS V+HVRN+  + +E +L+ +  PFG + K+++L+ K Q  +QMQDV SA   +Q Y+ 
Sbjct  116  PSSVLHVRNLPMDCTEQELVTIACPFGRVEKVLLLKGKTQGFVQMQDVQSASALVQCYSQ  175

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQVFSP  498
             Q +IRG+ VY Q+S HQ + T   + QS     N ILLVT+ +++YP+T+++LHQVFS 
Sbjct  176  AQVNIRGKPVYFQYSQHQAVNTATGDEQS-----NHILLVTVTNLVYPVTIDILHQVFSK  230

Query  499  HGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDELQVN  678
            +G + KIV F K  GFQALIQ      A +A+ AL G+NIY GCC L IQ+SNL  L V 
Sbjct  231  YGAIHKIVIFSKK-GFQALIQMGDKNQAQAAKQALDGQNIYSGCCTLRIQYSNLPSLNVK  289

Query  679  YNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGG  774
            YNND+SRDFTN NLPS   G ++    G  GG
Sbjct  290  YNNDKSRDFTNNNLPS---GDAAGPAVGQFGG  318



>dbj|GAM28251.1| hypothetical protein SAMD00019534_114270 [Acytostelium subglobosum 
LB1]
Length=592

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 149/215 (69%), Gaps = 5/215 (2%)
 Frame = +1

Query  118  RPLKMTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVN  297
            R   ++ PSKV+H+RN+  + +E +++ L  PFG +  +++L+ K QA +QM ++ +A  
Sbjct  28   RNTPLSAPSKVVHLRNLPMDCTEPEIIALASPFGHVEHILILKGKGQAFIQMAELNNASA  87

Query  298  ALQFYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEV  477
             +QFY+N+Q  IR ++ ++QFS+  E+T+      S  + PN ILL TI ++LYP+T+++
Sbjct  88   FVQFYSNIQGVIRTKDFFVQFSTRDEITS-----HSSIETPNNILLTTITNILYPVTIDM  142

Query  478  LHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSN  657
            L+Q+FS +G + KI+ F K   FQ+LIQ  T ++A++A+  L+G+NIY+GCC L IQ+S+
Sbjct  143  LYQLFSKYGSILKILIFSKQGNFQSLIQLSTTEAAIAAKRDLEGQNIYNGCCNLKIQYSS  202

Query  658  LDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYG  762
            L  L++ YNND+SRDFTNP+LP      S+  G+G
Sbjct  203  LTSLRIKYNNDKSRDFTNPSLPVGNALISNPIGFG  237



>ref|XP_008560050.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X4 
[Microplitis demolitor]
Length=581

 Score =   197 bits (502),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/218 (44%), Positives = 142/218 (65%), Gaps = 21/218 (10%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+  E+SE++++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  73   KPSRVIHIRNIASEVSESEIINLGMPFGRVTNVLVLKGKNQAFLEMADENAATTMVGYYA  132

Query  316  NVQPSIRGRNVYIQFSSHQELTT------------------MDQNTQSRGDE---PNRIL  432
            +   ++RGR VY+Q+S+H+EL T                    QN QS G+    PN +L
Sbjct  133  SSGAALRGRAVYVQYSNHRELKTDQAHSNANSNTQVALQVAQGQNIQSPGETQGGPNTVL  192

Query  433  LVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGR  612
             V I HM+YPI++++L+Q+F+  G V KIVTF K++ FQALIQ+    +A +A+  L G+
Sbjct  193  RVIIEHMIYPISLDILYQIFTRFGKVLKIVTFTKNSTFQALIQYSDTIAAQNAKATLDGQ  252

Query  613  NIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            NIY+ CC L I FS +  L V YNND+SRD+TNP LP+
Sbjct  253  NIYNSCCTLRIDFSKMQSLNVKYNNDKSRDYTNPTLPT  290



>ref|XP_011310459.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X4 
[Fopius arisanus]
Length=581

 Score =   197 bits (500),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/218 (44%), Positives = 141/218 (65%), Gaps = 21/218 (10%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PSKVIH+RN+  ++ E++++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  72   KPSKVIHIRNISSDVVESEIIHLGMPFGRVTNVLVLKGKNQAFLEMADENAATTMVGYYA  131

Query  316  NVQPSIRGRNVYIQFSSHQELTT------------------MDQNTQSRGDE---PNRIL  432
                S+RGR VY+Q+S+H+EL T                    Q  QS+GD    PN +L
Sbjct  132  ASGASLRGRAVYVQYSNHRELKTDQAHSNANTNTQVALQVAQGQAVQSQGDTQGGPNTVL  191

Query  433  LVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGR  612
             V + HM+YPI++++L+Q+F+  G V KIVTF K++ FQALIQ+    SA +A+ +L G+
Sbjct  192  RVIVEHMIYPISLDILYQIFTRFGKVLKIVTFTKNSTFQALIQYSDTMSAQTAKLSLDGQ  251

Query  613  NIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            NIY+ CC L I FS +  L V YNND+SRD+TNP LP+
Sbjct  252  NIYNSCCTLRIDFSKMQSLNVKYNNDKSRDYTNPTLPT  289



>dbj|GAM25404.1| hypothetical protein SAMD00019534_085790 [Acytostelium subglobosum 
LB1]
Length=445

 Score =   192 bits (487),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 137/193 (71%), Gaps = 4/193 (2%)
 Frame = +1

Query  142  SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTNV  321
            SKVIH+RN+  + +END++ L  PFG I   ++++ KNQ  +QM D+ ++   +Q+Y ++
Sbjct  31   SKVIHLRNLPSDCTENDIIALASPFGHIEHALLIKGKNQGFIQMADLAASSAFVQYYGSI  90

Query  322  QPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQVFSPH  501
            Q +IR ++ ++QFS+ +EL +   +  +    PN+I+L+TI +++YP+T+EVLHQ+FS +
Sbjct  91   QGNIRSKDFFVQFSNREELKSCSSSIAT----PNKIMLITITNVMYPVTIEVLHQLFSKY  146

Query  502  GFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDELQVNY  681
            G V KI+ F KS  FQ LIQ QT ++A++A+  L G ++Y+G C L +QFS+L  L + Y
Sbjct  147  GEVSKILIFAKSGNFQTLIQMQTEEAAIAAKKELDGHSLYNGSCTLKLQFSSLTNLSIKY  206

Query  682  NNDRSRDFTNPNL  720
            NND+SRD+TNP L
Sbjct  207  NNDKSRDYTNPAL  219



>ref|XP_008345274.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like 
[Malus domestica]
Length=111

 Score =   181 bits (459),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +1

Query  130  MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQF  309
            MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQAL+QMQD  +AV+ALQF
Sbjct  12   MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALIQMQDTAAAVSALQF  71

Query  310  YTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE  417
            Y NVQP+IRGRNVY+QFSSHQELTTM QN Q RGDE
Sbjct  72   YANVQPAIRGRNVYVQFSSHQELTTMYQNAQGRGDE  107



>ref|XP_008560051.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X5 
[Microplitis demolitor]
Length=537

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/232 (41%), Positives = 142/232 (61%), Gaps = 35/232 (15%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+  E+SE++++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  15   KPSRVIHIRNIASEVSESEIINLGMPFGRVTNVLVLKGKNQAFLEMADENAATTMVGYYA  74

Query  316  NVQPSIRGRNVYIQFSSHQELTT--------------------------------MDQNT  399
            +   ++RGR VY+Q+S+H+EL T                                  QN 
Sbjct  75   SSGAALRGRAVYVQYSNHRELKTDQAHSNAVSSLATNTIVNKLNNSNTQVALQVAQGQNI  134

Query  400  QSRGDE---PNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQT  570
            QS G+    PN +L V I HM+YPI++++L+Q+F+  G V KIVTF K++ FQALIQ+  
Sbjct  135  QSPGETQGGPNTVLRVIIEHMIYPISLDILYQIFTRFGKVLKIVTFTKNSTFQALIQYSD  194

Query  571  NQSAVSARNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
              +A +A+  L G+NIY+ CC L I FS +  L V YNND+SRD+TNP LP+
Sbjct  195  TIAAQNAKATLDGQNIYNSCCTLRIDFSKMQSLNVKYNNDKSRDYTNPTLPT  246



>ref|XP_011175574.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X2 
[Solenopsis invicta]
Length=589

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/217 (43%), Positives = 141/217 (65%), Gaps = 20/217 (9%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+ +E++E +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  87   KPSRVIHIRNIPNEVTEAEIIHLGLPFGRVTNVLVLKGKNQAFLEMADENAAATMVTYYA  146

Query  316  NVQPSIRGRNVYIQFSSHQELTT----------------MDQNTQSRGDE----PNRILL  435
            +    +RGR VY+QFS+H+EL T                  QN  S   E    PN +L 
Sbjct  147  SGVAQLRGRAVYVQFSNHRELKTDQTHSNNANSNNQVAIAGQNQVSGAGETQGGPNTVLR  206

Query  436  VTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRN  615
            V + H+LYPIT+++L+Q+F+  G V KIVTF K++ FQALIQ+    SA +A+ +L G+N
Sbjct  207  VIVEHLLYPITLDILYQIFTRFGKVLKIVTFTKNSSFQALIQYADMLSAQTAKFSLDGQN  266

Query  616  IYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            +Y+ CC L I +S +  L V YNND+SRD+TNPNLP+
Sbjct  267  VYNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPNLPT  303



>ref|XP_008560049.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X3 
[Microplitis demolitor]
Length=587

 Score =   192 bits (488),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/232 (41%), Positives = 142/232 (61%), Gaps = 35/232 (15%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+  E+SE++++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  65   KPSRVIHIRNIASEVSESEIINLGMPFGRVTNVLVLKGKNQAFLEMADENAATTMVGYYA  124

Query  316  NVQPSIRGRNVYIQFSSHQELTT--------------------------------MDQNT  399
            +   ++RGR VY+Q+S+H+EL T                                  QN 
Sbjct  125  SSGAALRGRAVYVQYSNHRELKTDQAHSNAVSSLATNTIVNKLNNSNTQVALQVAQGQNI  184

Query  400  QSRGDE---PNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQT  570
            QS G+    PN +L V I HM+YPI++++L+Q+F+  G V KIVTF K++ FQALIQ+  
Sbjct  185  QSPGETQGGPNTVLRVIIEHMIYPISLDILYQIFTRFGKVLKIVTFTKNSTFQALIQYSD  244

Query  571  NQSAVSARNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
              +A +A+  L G+NIY+ CC L I FS +  L V YNND+SRD+TNP LP+
Sbjct  245  TIAAQNAKATLDGQNIYNSCCTLRIDFSKMQSLNVKYNNDKSRDYTNPTLPT  296



>ref|XP_008560046.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X1 
[Microplitis demolitor]
 ref|XP_008560047.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X1 
[Microplitis demolitor]
Length=595

 Score =   192 bits (488),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/232 (41%), Positives = 142/232 (61%), Gaps = 35/232 (15%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+  E+SE++++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  73   KPSRVIHIRNIASEVSESEIINLGMPFGRVTNVLVLKGKNQAFLEMADENAATTMVGYYA  132

Query  316  NVQPSIRGRNVYIQFSSHQELTT--------------------------------MDQNT  399
            +   ++RGR VY+Q+S+H+EL T                                  QN 
Sbjct  133  SSGAALRGRAVYVQYSNHRELKTDQAHSNAVSSLATNTIVNKLNNSNTQVALQVAQGQNI  192

Query  400  QSRGDE---PNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQT  570
            QS G+    PN +L V I HM+YPI++++L+Q+F+  G V KIVTF K++ FQALIQ+  
Sbjct  193  QSPGETQGGPNTVLRVIIEHMIYPISLDILYQIFTRFGKVLKIVTFTKNSTFQALIQYSD  252

Query  571  NQSAVSARNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
              +A +A+  L G+NIY+ CC L I FS +  L V YNND+SRD+TNP LP+
Sbjct  253  TIAAQNAKATLDGQNIYNSCCTLRIDFSKMQSLNVKYNNDKSRDYTNPTLPT  304



>ref|XP_008560048.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X2 
[Microplitis demolitor]
Length=591

 Score =   192 bits (488),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/232 (41%), Positives = 142/232 (61%), Gaps = 35/232 (15%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+  E+SE++++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  73   KPSRVIHIRNIASEVSESEIINLGMPFGRVTNVLVLKGKNQAFLEMADENAATTMVGYYA  132

Query  316  NVQPSIRGRNVYIQFSSHQELTT--------------------------------MDQNT  399
            +   ++RGR VY+Q+S+H+EL T                                  QN 
Sbjct  133  SSGAALRGRAVYVQYSNHRELKTDQAHSNAVSSLATNTIVNKLNNSNTQVALQVAQGQNI  192

Query  400  QSRGDE---PNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQT  570
            QS G+    PN +L V I HM+YPI++++L+Q+F+  G V KIVTF K++ FQALIQ+  
Sbjct  193  QSPGETQGGPNTVLRVIIEHMIYPISLDILYQIFTRFGKVLKIVTFTKNSTFQALIQYSD  252

Query  571  NQSAVSARNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
              +A +A+  L G+NIY+ CC L I FS +  L V YNND+SRD+TNP LP+
Sbjct  253  TIAAQNAKATLDGQNIYNSCCTLRIDFSKMQSLNVKYNNDKSRDYTNPTLPT  304



>ref|XP_004354746.1| RNA-binding region RNP-1 domain-containing protein [Dictyostelium 
fasciculatum]
 gb|EGG16362.1| RNA-binding region RNP-1 domain-containing protein [Dictyostelium 
fasciculatum]
Length=656

 Score =   192 bits (489),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 93/218 (43%), Positives = 150/218 (69%), Gaps = 10/218 (5%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PSKVIH+RN+  + +E++++ +  PFG +  +++L+ K+Q  +Q  ++ SA + +QFYT
Sbjct  246  QPSKVIHLRNLPIDCTEHEIMAIAAPFGQVDHILILKGKSQGFIQFLELTSASSFIQFYT  305

Query  316  NVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPNRILLVTIHHMLYPITVEVLHQVFS  495
             +Q  IR +N ++Q+S+ +E+T+      S  + PN ILLVTI +++YP+T+EVL+Q+F 
Sbjct  306  TIQGCIRAKNFFVQYSNREEITST-----SAVETPNNILLVTISNIVYPVTIEVLYQLFG  360

Query  496  PHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQLDIQFSNLDELQV  675
             +G V KI+ F KS  FQ+L+Q  + +SA+ A+  L G++IY GCC + IQ+S+L  L++
Sbjct  361  KYGSVLKILIFSKSGNFQSLVQLHSLESAIQAKRELDGQSIYSGCCTMKIQYSSLSNLRI  420

Query  676  NYNNDRSRDFTNPNLPSEQKGKSSQHGYGD--AGGMYS  783
             YNND+SRDFTNP L S   G  S  G+G+  AG + S
Sbjct  421  KYNNDKSRDFTNPTLMS---GIPSTIGFGNNSAGQLMS  455



>gb|ELU04990.1| hypothetical protein CAPTEDRAFT_200421 [Capitella teleta]
Length=524

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 134/209 (64%), Gaps = 12/209 (6%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PSKV+H R V  + +E +++QL  PFG +T LV+ + KNQA L+M DV SA   +  Y 
Sbjct  30   KPSKVLHFRGVPADATEGEVVQLGLPFGHMTNLVLAKKKNQAWLEMVDVQSAQAVVSCYH  89

Query  316  NVQPSIRGRNVYIQFSSHQELTT------------MDQNTQSRGDEPNRILLVTIHHMLY  459
            +  P IRGR VY+QFS++  L T              Q   +  D+P  +L V + +MLY
Sbjct  90   DRPPQIRGRTVYVQFSNYDILKTEASQQGAQAALQAAQQLMTNVDDPKTVLRVIVENMLY  149

Query  460  PITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGCCQL  639
            P+T++VL  +FS +G V KIVTF K+  FQALIQF    +A +A+ +L G+NIY+GCC L
Sbjct  150  PVTIDVLKSIFSRYGQVLKIVTFSKNNTFQALIQFSDQIAAQTAKVSLHGQNIYNGCCTL  209

Query  640  DIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
             I FS L  L V YNND+SRD+TNPNLPS
Sbjct  210  RIDFSKLQALNVKYNNDKSRDYTNPNLPS  238



>gb|KFM66418.1| Polypyrimidine tract-binding protein 2, partial [Stegodyphus 
mimosarum]
Length=501

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 136/217 (63%), Gaps = 20/217 (9%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+V+H+RNV  + +E D++ L   FG +T +++L+ KNQA L+M D  SA + + +Y 
Sbjct  62   KPSRVVHIRNVSSDATETDIIHLGIAFGRVTNVLLLKGKNQAFLEMSDEASATSMVNYYA  121

Query  316  NV-QPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE-------------------PNRILL  435
            N   P +RGRNVY+QFS+H+EL T   +                          PN +L 
Sbjct  122  NSGAPYVRGRNVYVQFSNHKELKTDSSHATGNASTQAALQAAQALVNQSDTQGGPNTVLR  181

Query  436  VTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRN  615
            V + + +YP+T+E+L+Q+FS  G V KIVTF K+  FQALIQ+    +A +A+ +L G+N
Sbjct  182  VIVDNQIYPVTLEILYQIFSRVGRVLKIVTFSKNGTFQALIQYPDVITAQAAKLSLDGQN  241

Query  616  IYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            IY+ CC L +++S L  L V YNND+SRDFTNP LP+
Sbjct  242  IYNSCCTLRVEYSKLSNLNVKYNNDKSRDFTNPTLPT  278



>ref|XP_001842351.1| polypyrimidine tract binding protein [Culex quinquefasciatus]
 gb|EDS42784.1| polypyrimidine tract binding protein [Culex quinquefasciatus]
Length=535

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 102/250 (41%), Positives = 144/250 (58%), Gaps = 38/250 (15%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+V+H+RN+ +E SE D++ L  PFG +T +++L+ KNQA L+M D  +A + +  +T
Sbjct  20   KPSRVVHIRNIPNESSEVDVMHLGVPFGRVTNVLVLKGKNQAFLEMADESAATSMVTMFT  79

Query  316  NVQPSIRGRNVYIQFSSHQELTTMDQN------TQSRGDEP-------------------  420
               P +RGR VY+QFS+H+EL T DQN      TQS    P                   
Sbjct  80   ATPPIVRGRTVYVQFSNHRELKT-DQNHTATDLTQSPTGSPLPLALDHANTNSTTAGTGA  138

Query  421  ---------NRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTN  573
                     N +L V +  +LYP+++++L+Q+F   G V KIVTF K+  FQALIQ+   
Sbjct  139  NVGGNAGGPNTVLRVIVESLLYPVSLDILYQIFQRFGKVLKIVTFTKNNSFQALIQYPDA  198

Query  574  QSAVSARNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
             +A  A+  L G+NIY+GCC L I  S L  L V YNND+SRD+TNP LPS + G     
Sbjct  199  TTAQHAKQTLDGQNIYNGCCTLRIDNSKLTSLNVKYNNDKSRDYTNPTLPSGEPGSDV--  256

Query  754  GYGDAGGMYS  783
                AGG+ S
Sbjct  257  -IASAGGLVS  265



>ref|XP_001636058.1| predicted protein [Nematostella vectensis]
 gb|EDO43995.1| predicted protein, partial [Nematostella vectensis]
Length=470

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/238 (41%), Positives = 145/238 (61%), Gaps = 27/238 (11%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PSKV+H+RNV  E ++ +++ L  P+G +T ++ML+ KNQA L+M+   +A+  +  Y+ 
Sbjct  1    PSKVLHLRNVAAEATDAEIIALGIPYGRVTNVLMLKGKNQAFLEMKTKENAMALMNSYSY  60

Query  319  VQPSIRGRNVYIQFSSHQELTT-----------------------MDQNTQSRGDEPNR-  426
            + PSIRGR +YIQ+S+HQELTT                       +       G+ P+  
Sbjct  61   IPPSIRGRQIYIQYSNHQELTTNESQHSPGVRGLSSSHLGAGIGSLTSGLGIAGELPSVN  120

Query  427  --ILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNA  600
              IL + + +MLYPIT+EVL+Q+F+ +G V KIV F ++  FQAL+QF  +  A +A+ +
Sbjct  121  GCILRIIVENMLYPITIEVLNQIFTKYGTVLKIVIFTRNNQFQALVQFSQSTEARAAKCS  180

Query  601  LQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS-EQKGKSSQHGYGDAG  771
            L G+NIY+GCC L I +S L  L V YNND++RD+T P+LPS E     S  G+   G
Sbjct  181  LDGQNIYNGCCTLRIDYSKLKTLSVKYNNDKTRDYTRPDLPSGESTPDPSALGFAGLG  238



>ref|XP_011645100.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X3 
[Pogonomyrmex barbatus]
Length=611

 Score =   189 bits (481),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 91/217 (42%), Positives = 142/217 (65%), Gaps = 20/217 (9%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+ +E++E +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  109  KPSRVIHIRNIPNEVTEAEIIHLGLPFGRVTNVLVLKGKNQAFLEMADENAAATMVTYYA  168

Query  316  NVQPSIRGRNVYIQFSSHQELTT----------------MDQNTQSRGDE----PNRILL  435
            +    +RGR VY+QFS+H+EL T                  QN  +   E    PN +L 
Sbjct  169  SGVAQLRGRAVYVQFSNHRELKTDQTHSNNANSNNQVAIAGQNQVTGAGETQGGPNTVLR  228

Query  436  VTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRN  615
            V + H++YPIT+++L+Q+F+  G V KIVTF K++ +QALIQ+    SA +A+ +L G+N
Sbjct  229  VVVEHLVYPITLDILYQIFTRFGKVLKIVTFTKNSCYQALIQYADMLSAQTAKFSLDGQN  288

Query  616  IYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            +Y+ CC L I++S +  L V YNND+SRD+TNPNLP+
Sbjct  289  VYNSCCTLRIEYSKMQNLNVKYNNDKSRDYTNPNLPT  325



>ref|XP_008401682.1| PREDICTED: polypyrimidine tract-binding protein 1-like, partial 
[Poecilia reticulata]
Length=423

 Score =   186 bits (472),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 136/221 (62%), Gaps = 16/221 (7%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+VIH+R +  +I+E +++ L  PFG +T L+ML+AKNQA L+M    +A N + +Y+ 
Sbjct  23   PSRVIHIRKLPSDITEAEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQNMVGYYST  82

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRG----------------DEPNRILLVTIHH  450
            + P IR + VY+QFS+H+EL T +   Q R                   P+ +L V + +
Sbjct  83   MMPVIRHQPVYLQFSNHKELKTDNSPNQERAQAALRALSSSHVDTLMTAPSTVLRVVVEN  142

Query  451  MLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGC  630
            +LYP+T++ L Q+FS  G V +I+ F K+  FQAL+QF    SA +A+  L G+NIY+GC
Sbjct  143  LLYPVTLDALCQIFSKFGTVLRIIIFTKNNQFQALLQFSDGSSAQAAKLTLDGQNIYNGC  202

Query  631  CQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
            C L I FS L  L V YNN++SRDFT P+LPS       +H
Sbjct  203  CTLRISFSKLTSLNVKYNNEKSRDFTRPDLPSGDSQPGLEH  243



>dbj|BAO03403.1| polypyrimidine tract binding protein 1b splicing isoform [Oryzias 
latipes]
Length=360

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 138/223 (62%), Gaps = 18/223 (8%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+V+H+R +  +I+E +++ L  PFG +T L+ML+AKNQA L+M    +A N + +Y+ 
Sbjct  53   PSRVLHIRKLPIDITETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQNMVGYYST  112

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE------------------PNRILLVTI  444
            V P IR + V++QFS+H+EL T +   Q R                     P+ +L V +
Sbjct  113  VMPIIRQQPVFVQFSNHKELKTDNSPNQERAQAALRALSSSHVDTAALVVAPSSVLRVVV  172

Query  445  HHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYD  624
             ++LYP++++ L Q+FS  G V +I+ F K+  FQAL+Q+    SA +A+ +L G+NIY+
Sbjct  173  ENLLYPVSLDALCQIFSKFGTVLRIIVFTKNNQFQALLQYAEGASAQAAKVSLDGQNIYN  232

Query  625  GCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
            GCC L I FS L  L V YNND+SRDFT P+LPS     + +H
Sbjct  233  GCCTLRISFSKLTTLNVKYNNDKSRDFTRPDLPSGDGQPTMEH  275



>ref|XP_001848742.1| polypyrimidine tract binding protein [Culex quinquefasciatus]
 gb|EDS28948.1| polypyrimidine tract binding protein [Culex quinquefasciatus]
Length=572

 Score =   189 bits (479),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 102/251 (41%), Positives = 145/251 (58%), Gaps = 38/251 (15%)
 Frame = +1

Query  133  TEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFY  312
            ++PS+V+H+RN+ +E SE D++ L  PFG +T +++L+ KNQA L+M D  +A + +  +
Sbjct  20   SKPSRVVHIRNIPNESSEVDVMHLGVPFGRVTNVLVLKGKNQAFLEMADESAATSMVTMF  79

Query  313  TNVQPSIRGRNVYIQFSSHQELTTMDQN------TQSRGDEP------------------  420
            T   P +RGR VY+QFS+H+EL T DQN      TQS    P                  
Sbjct  80   TATPPIVRGRTVYVQFSNHRELKT-DQNHTATDLTQSPTGSPLPLALDHANTNSTTAGTG  138

Query  421  ----------NRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQT  570
                      N +L V +  +LYP+++++L+Q+F   G V KIVTF K+  FQALIQ+  
Sbjct  139  ANVGGNAGGPNTVLRVIVESLLYPVSLDILYQIFQRFGKVLKIVTFTKNNSFQALIQYPD  198

Query  571  NQSAVSARNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQ  750
              +A  A+  L G+NIY+GCC L I  S L  L V YNND+SRD+TNP LPS + G    
Sbjct  199  ATTAQHAKQTLDGQNIYNGCCTLRIDNSKLTSLNVKYNNDKSRDYTNPTLPSGEPGSDV-  257

Query  751  HGYGDAGGMYS  783
                 AGG+ S
Sbjct  258  --IASAGGLVS  266



>ref|XP_012139258.1| PREDICTED: polypyrimidine tract-binding protein 2 isoform X6 
[Megachile rotundata]
Length=553

 Score =   188 bits (478),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 143/218 (66%), Gaps = 21/218 (10%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  46   KPSRVIHIRNIPNEVSEGEIIHLGVPFGRVTNVLVLKGKNQAFLEMADENAAATIVSYYA  105

Query  316  NVQPSIRGRNVYIQFSSHQELTT------------------MDQNTQSRGDE---PNRIL  432
            +    +RGR VY+QFS+H+EL T                   +Q  Q++ +    PN +L
Sbjct  106  SCIAQLRGRPVYVQFSNHRELKTDQTHANNANSNNQVALPGQNQVAQTQAETQGGPNTVL  165

Query  433  LVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGR  612
             V +  M+YPI+++VL+Q+F+  G V KIVTF K++ FQALIQ+    SA +A+ +L+G+
Sbjct  166  RVIVEQMVYPISLDVLYQIFTRFGKVLKIVTFTKNSTFQALIQYADMLSAQTAKLSLEGQ  225

Query  613  NIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            NIY+ CC L I +S +  L V YNND+SRD+TNP+LP+
Sbjct  226  NIYNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPSLPT  263



>ref|XP_012139257.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X5 
[Megachile rotundata]
Length=571

 Score =   188 bits (478),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 143/218 (66%), Gaps = 21/218 (10%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  64   KPSRVIHIRNIPNEVSEGEIIHLGVPFGRVTNVLVLKGKNQAFLEMADENAAATIVSYYA  123

Query  316  NVQPSIRGRNVYIQFSSHQELTT------------------MDQNTQSRGDE---PNRIL  432
            +    +RGR VY+QFS+H+EL T                   +Q  Q++ +    PN +L
Sbjct  124  SCIAQLRGRPVYVQFSNHRELKTDQTHANNANSNNQVALPGQNQVAQTQAETQGGPNTVL  183

Query  433  LVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGR  612
             V +  M+YPI+++VL+Q+F+  G V KIVTF K++ FQALIQ+    SA +A+ +L+G+
Sbjct  184  RVIVEQMVYPISLDVLYQIFTRFGKVLKIVTFTKNSTFQALIQYADMLSAQTAKLSLEGQ  243

Query  613  NIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            NIY+ CC L I +S +  L V YNND+SRD+TNP+LP+
Sbjct  244  NIYNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPSLPT  281



>ref|XP_012139256.1| PREDICTED: polypyrimidine tract-binding protein 2 isoform X4 
[Megachile rotundata]
Length=579

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 143/218 (66%), Gaps = 21/218 (10%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  72   KPSRVIHIRNIPNEVSEGEIIHLGVPFGRVTNVLVLKGKNQAFLEMADENAAATIVSYYA  131

Query  316  NVQPSIRGRNVYIQFSSHQELTT------------------MDQNTQSRGDE---PNRIL  432
            +    +RGR VY+QFS+H+EL T                   +Q  Q++ +    PN +L
Sbjct  132  SCIAQLRGRPVYVQFSNHRELKTDQTHANNANSNNQVALPGQNQVAQTQAETQGGPNTVL  191

Query  433  LVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGR  612
             V +  M+YPI+++VL+Q+F+  G V KIVTF K++ FQALIQ+    SA +A+ +L+G+
Sbjct  192  RVIVEQMVYPISLDVLYQIFTRFGKVLKIVTFTKNSTFQALIQYADMLSAQTAKLSLEGQ  251

Query  613  NIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            NIY+ CC L I +S +  L V YNND+SRD+TNP+LP+
Sbjct  252  NIYNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPSLPT  289



>ref|XP_012139255.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X3 
[Megachile rotundata]
Length=592

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 143/218 (66%), Gaps = 21/218 (10%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  90   KPSRVIHIRNIPNEVSEGEIIHLGVPFGRVTNVLVLKGKNQAFLEMADENAAATIVSYYA  149

Query  316  NVQPSIRGRNVYIQFSSHQELTT------------------MDQNTQSRGDE---PNRIL  432
            +    +RGR VY+QFS+H+EL T                   +Q  Q++ +    PN +L
Sbjct  150  SCIAQLRGRPVYVQFSNHRELKTDQTHANNANSNNQVALPGQNQVAQTQAETQGGPNTVL  209

Query  433  LVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGR  612
             V +  M+YPI+++VL+Q+F+  G V KIVTF K++ FQALIQ+    SA +A+ +L+G+
Sbjct  210  RVIVEQMVYPISLDVLYQIFTRFGKVLKIVTFTKNSTFQALIQYADMLSAQTAKLSLEGQ  269

Query  613  NIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            NIY+ CC L I +S +  L V YNND+SRD+TNP+LP+
Sbjct  270  NIYNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPSLPT  307



>ref|XP_012139254.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X2 
[Megachile rotundata]
Length=596

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 143/218 (66%), Gaps = 21/218 (10%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  90   KPSRVIHIRNIPNEVSEGEIIHLGVPFGRVTNVLVLKGKNQAFLEMADENAAATIVSYYA  149

Query  316  NVQPSIRGRNVYIQFSSHQELTT------------------MDQNTQSRGDE---PNRIL  432
            +    +RGR VY+QFS+H+EL T                   +Q  Q++ +    PN +L
Sbjct  150  SCIAQLRGRPVYVQFSNHRELKTDQTHANNANSNNQVALPGQNQVAQTQAETQGGPNTVL  209

Query  433  LVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGR  612
             V +  M+YPI+++VL+Q+F+  G V KIVTF K++ FQALIQ+    SA +A+ +L+G+
Sbjct  210  RVIVEQMVYPISLDVLYQIFTRFGKVLKIVTFTKNSTFQALIQYADMLSAQTAKLSLEGQ  269

Query  613  NIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            NIY+ CC L I +S +  L V YNND+SRD+TNP+LP+
Sbjct  270  NIYNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPSLPT  307



>ref|XP_012139253.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X1 
[Megachile rotundata]
Length=597

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 143/218 (66%), Gaps = 21/218 (10%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  90   KPSRVIHIRNIPNEVSEGEIIHLGVPFGRVTNVLVLKGKNQAFLEMADENAAATIVSYYA  149

Query  316  NVQPSIRGRNVYIQFSSHQELTT------------------MDQNTQSRGDE---PNRIL  432
            +    +RGR VY+QFS+H+EL T                   +Q  Q++ +    PN +L
Sbjct  150  SCIAQLRGRPVYVQFSNHRELKTDQTHANNANSNNQVALPGQNQVAQTQAETQGGPNTVL  209

Query  433  LVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGR  612
             V +  M+YPI+++VL+Q+F+  G V KIVTF K++ FQALIQ+    SA +A+ +L+G+
Sbjct  210  RVIVEQMVYPISLDVLYQIFTRFGKVLKIVTFTKNSTFQALIQYADMLSAQTAKLSLEGQ  269

Query  613  NIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            NIY+ CC L I +S +  L V YNND+SRD+TNP+LP+
Sbjct  270  NIYNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPSLPT  307



>ref|XP_010753398.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X3 [Larimichthys crocea]
Length=508

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/221 (41%), Positives = 139/221 (63%), Gaps = 16/221 (7%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+VIH+R + ++I+E +++ L  PFG +T L+ML+AKNQA L+M    +A N + +Y+ 
Sbjct  23   PSRVIHIRKLPNDIAETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQNMVSYYST  82

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE----------------PNRILLVTIHH  450
            V P IR   VY+QFS+H+EL T +   Q R                   P+ +L V + +
Sbjct  83   VMPIIRHHPVYVQFSNHKELKTDNSPNQERAQAALRALSTSHVDTTVAAPSSVLRVVVEN  142

Query  451  MLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGC  630
            ++YP++++ L Q+FS  G V +I+ F K++ FQAL+Q+    SA +A+ +L G+NIY+GC
Sbjct  143  LVYPVSLDALCQIFSKFGTVLRIIVFTKNSQFQALLQYPDGASAQAAKLSLDGQNIYNGC  202

Query  631  CQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
            C L I FS L  L V YNN++SRDFT P+LPS     + +H
Sbjct  203  CTLRISFSKLTSLNVKYNNEKSRDFTRPDLPSGDSQPAMEH  243



>ref|XP_010753397.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X2 [Larimichthys crocea]
Length=532

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/221 (41%), Positives = 139/221 (63%), Gaps = 16/221 (7%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+VIH+R + ++I+E +++ L  PFG +T L+ML+AKNQA L+M    +A N + +Y+ 
Sbjct  53   PSRVIHIRKLPNDIAETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQNMVSYYST  112

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE----------------PNRILLVTIHH  450
            V P IR   VY+QFS+H+EL T +   Q R                   P+ +L V + +
Sbjct  113  VMPIIRHHPVYVQFSNHKELKTDNSPNQERAQAALRALSTSHVDTTVAAPSSVLRVVVEN  172

Query  451  MLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGC  630
            ++YP++++ L Q+FS  G V +I+ F K++ FQAL+Q+    SA +A+ +L G+NIY+GC
Sbjct  173  LVYPVSLDALCQIFSKFGTVLRIIVFTKNSQFQALLQYPDGASAQAAKLSLDGQNIYNGC  232

Query  631  CQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
            C L I FS L  L V YNN++SRDFT P+LPS     + +H
Sbjct  233  CTLRISFSKLTSLNVKYNNEKSRDFTRPDLPSGDSQPAMEH  273



>ref|XP_010753396.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X1 [Larimichthys crocea]
Length=538

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/221 (41%), Positives = 139/221 (63%), Gaps = 16/221 (7%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+VIH+R + ++I+E +++ L  PFG +T L+ML+AKNQA L+M    +A N + +Y+ 
Sbjct  53   PSRVIHIRKLPNDIAETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQNMVSYYST  112

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE----------------PNRILLVTIHH  450
            V P IR   VY+QFS+H+EL T +   Q R                   P+ +L V + +
Sbjct  113  VMPIIRHHPVYVQFSNHKELKTDNSPNQERAQAALRALSTSHVDTTVAAPSSVLRVVVEN  172

Query  451  MLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGC  630
            ++YP++++ L Q+FS  G V +I+ F K++ FQAL+Q+    SA +A+ +L G+NIY+GC
Sbjct  173  LVYPVSLDALCQIFSKFGTVLRIIVFTKNSQFQALLQYPDGASAQAAKLSLDGQNIYNGC  232

Query  631  CQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
            C L I FS L  L V YNN++SRDFT P+LPS     + +H
Sbjct  233  CTLRISFSKLTSLNVKYNNEKSRDFTRPDLPSGDSQPAMEH  273



>ref|XP_007569508.1| PREDICTED: LOW QUALITY PROTEIN: polypyrimidine tract-binding 
protein 1-like [Poecilia formosa]
Length=560

 Score =   186 bits (472),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 137/221 (62%), Gaps = 16/221 (7%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+VIH+R +  +I+E +++ L  PFG +T L+ML+AKNQA L+M    +A N + +Y+ 
Sbjct  73   PSRVIHIRKLPSDITEAEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQNMVGYYST  132

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE----------------PNRILLVTIHH  450
            + P IR + VY+QFS+H+EL T +   Q R                   P+ +L V + +
Sbjct  133  MMPVIRHQPVYLQFSNHKELKTDNSPNQERAQAALRALSSSHVDTLMAAPSTVLRVVVEN  192

Query  451  MLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGC  630
            +LYP+T++ L Q+FS  G V +I+ F K+  FQAL+QF    SA +A+  L G+NIY+GC
Sbjct  193  LLYPVTLDALCQIFSKFGTVLRIIIFTKNNQFQALLQFSDGSSAQAAKLTLDGQNIYNGC  252

Query  631  CQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
            C L I FS L  L V YNN++SRDFT P+LPS     + +H
Sbjct  253  CTLRISFSKLTSLNVKYNNEKSRDFTRPDLPSGDSQPTLEH  293



>ref|XP_008212882.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X9 
[Nasonia vitripennis]
Length=562

 Score =   185 bits (470),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 139/226 (62%), Gaps = 29/226 (13%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  SA   + +  
Sbjct  46   KPSRVIHIRNIPNEVSEGEIIHLGMPFGRVTNVLVLKGKNQAFLEMADEGSAATMVTYCA  105

Query  316  NVQPSIRGRNVYIQFSSHQELTT-----------------MDQNT--------QSRGDE-  417
            +    +RGR VY+QFS+H+EL T                    NT        Q +G E 
Sbjct  106  SCPAQLRGRAVYVQFSNHRELKTDQGHNNAVGSPTNAIANTSNNTSVQAAGQGQVQGSET  165

Query  418  ---PNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVS  588
               PN +L V + H +YPI+++VL+Q+F+ +G V KIVTF K+  FQALIQ+    SA +
Sbjct  166  QGGPNTVLRVIVEHQIYPISLDVLYQIFTRYGKVLKIVTFTKNGTFQALIQYADMLSAQT  225

Query  589  ARNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            A+  L G+NIY+ CC L I +S +  L V YNND+SRD+TNP LP+
Sbjct  226  AKFNLDGQNIYNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPTLPT  271



>ref|XP_008212881.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X8 
[Nasonia vitripennis]
Length=566

 Score =   186 bits (471),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 139/226 (62%), Gaps = 29/226 (13%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  SA   + +  
Sbjct  72   KPSRVIHIRNIPNEVSEGEIIHLGMPFGRVTNVLVLKGKNQAFLEMADEGSAATMVTYCA  131

Query  316  NVQPSIRGRNVYIQFSSHQELTT-----------------MDQNT--------QSRGDE-  417
            +    +RGR VY+QFS+H+EL T                    NT        Q +G E 
Sbjct  132  SCPAQLRGRAVYVQFSNHRELKTDQGHNNAVGSPTNAIANTSNNTSVQAAGQGQVQGSET  191

Query  418  ---PNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVS  588
               PN +L V + H +YPI+++VL+Q+F+ +G V KIVTF K+  FQALIQ+    SA +
Sbjct  192  QGGPNTVLRVIVEHQIYPISLDVLYQIFTRYGKVLKIVTFTKNGTFQALIQYADMLSAQT  251

Query  589  ARNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            A+  L G+NIY+ CC L I +S +  L V YNND+SRD+TNP LP+
Sbjct  252  AKFNLDGQNIYNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPTLPT  297



>ref|XP_008212880.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X7 
[Nasonia vitripennis]
Length=567

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 139/226 (62%), Gaps = 29/226 (13%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  SA   + +  
Sbjct  72   KPSRVIHIRNIPNEVSEGEIIHLGMPFGRVTNVLVLKGKNQAFLEMADEGSAATMVTYCA  131

Query  316  NVQPSIRGRNVYIQFSSHQELTT-----------------MDQNT--------QSRGDE-  417
            +    +RGR VY+QFS+H+EL T                    NT        Q +G E 
Sbjct  132  SCPAQLRGRAVYVQFSNHRELKTDQGHNNAVGSPTNAIANTSNNTSVQAAGQGQVQGSET  191

Query  418  ---PNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVS  588
               PN +L V + H +YPI+++VL+Q+F+ +G V KIVTF K+  FQALIQ+    SA +
Sbjct  192  QGGPNTVLRVIVEHQIYPISLDVLYQIFTRYGKVLKIVTFTKNGTFQALIQYADMLSAQT  251

Query  589  ARNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            A+  L G+NIY+ CC L I +S +  L V YNND+SRD+TNP LP+
Sbjct  252  AKFNLDGQNIYNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPTLPT  297



>ref|XP_008283570.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X4 [Stegastes partitus]
Length=508

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/221 (41%), Positives = 139/221 (63%), Gaps = 16/221 (7%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+VIH+R + ++I+E +++ L  PFG +T L+ML+AKNQA L+M    +A + + +Y+ 
Sbjct  23   PSRVIHIRKLPNDITETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQSMVSYYST  82

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRG----------------DEPNRILLVTIHH  450
            V P IR   VY+QFS+H+EL T +   Q R                   P+ +L V + +
Sbjct  83   VMPIIRHHPVYVQFSNHKELKTDNSPNQERAQAALRALSTSHVDTTVPAPSTVLRVVVEN  142

Query  451  MLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGC  630
            ++YP+T++ L Q+FS  G V +I+ F K++ FQAL+Q+    SA +A+ +L G+NIY+GC
Sbjct  143  LVYPVTLDALCQIFSKFGTVLRIIVFTKNSQFQALLQYPDGASAQAAKLSLDGQNIYNGC  202

Query  631  CQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
            C L I FS L  L V YNN++SRDFT P+LP+     + +H
Sbjct  203  CTLRISFSKLTSLNVKYNNEKSRDFTRPDLPTGDNQPAMEH  243



>ref|XP_008212884.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X11 
[Nasonia vitripennis]
Length=543

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 139/226 (62%), Gaps = 29/226 (13%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  SA   + +  
Sbjct  27   KPSRVIHIRNIPNEVSEGEIIHLGMPFGRVTNVLVLKGKNQAFLEMADEGSAATMVTYCA  86

Query  316  NVQPSIRGRNVYIQFSSHQELTT-----------------MDQNT--------QSRGDE-  417
            +    +RGR VY+QFS+H+EL T                    NT        Q +G E 
Sbjct  87   SCPAQLRGRAVYVQFSNHRELKTDQGHNNAVGSPTNAIANTSNNTSVQAAGQGQVQGSET  146

Query  418  ---PNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVS  588
               PN +L V + H +YPI+++VL+Q+F+ +G V KIVTF K+  FQALIQ+    SA +
Sbjct  147  QGGPNTVLRVIVEHQIYPISLDVLYQIFTRYGKVLKIVTFTKNGTFQALIQYADMLSAQT  206

Query  589  ARNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            A+  L G+NIY+ CC L I +S +  L V YNND+SRD+TNP LP+
Sbjct  207  AKFNLDGQNIYNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPTLPT  252



>ref|XP_008212883.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X10 
[Nasonia vitripennis]
Length=562

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 139/226 (62%), Gaps = 29/226 (13%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  SA   + +  
Sbjct  72   KPSRVIHIRNIPNEVSEGEIIHLGMPFGRVTNVLVLKGKNQAFLEMADEGSAATMVTYCA  131

Query  316  NVQPSIRGRNVYIQFSSHQELTT-----------------MDQNT--------QSRGDE-  417
            +    +RGR VY+QFS+H+EL T                    NT        Q +G E 
Sbjct  132  SCPAQLRGRAVYVQFSNHRELKTDQGHNNAVGSPTNAIANTSNNTSVQAAGQGQVQGSET  191

Query  418  ---PNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVS  588
               PN +L V + H +YPI+++VL+Q+F+ +G V KIVTF K+  FQALIQ+    SA +
Sbjct  192  QGGPNTVLRVIVEHQIYPISLDVLYQIFTRYGKVLKIVTFTKNGTFQALIQYADMLSAQT  251

Query  589  ARNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            A+  L G+NIY+ CC L I +S +  L V YNND+SRD+TNP LP+
Sbjct  252  AKFNLDGQNIYNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPTLPT  297



>ref|XP_008212875.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X5 
[Nasonia vitripennis]
 ref|XP_008212876.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X5 
[Nasonia vitripennis]
 ref|XP_008212877.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X5 
[Nasonia vitripennis]
 ref|XP_008212878.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X5 
[Nasonia vitripennis]
Length=572

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 139/226 (62%), Gaps = 29/226 (13%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  SA   + +  
Sbjct  56   KPSRVIHIRNIPNEVSEGEIIHLGMPFGRVTNVLVLKGKNQAFLEMADEGSAATMVTYCA  115

Query  316  NVQPSIRGRNVYIQFSSHQELTT-----------------MDQNT--------QSRGDE-  417
            +    +RGR VY+QFS+H+EL T                    NT        Q +G E 
Sbjct  116  SCPAQLRGRAVYVQFSNHRELKTDQGHNNAVGSPTNAIANTSNNTSVQAAGQGQVQGSET  175

Query  418  ---PNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVS  588
               PN +L V + H +YPI+++VL+Q+F+ +G V KIVTF K+  FQALIQ+    SA +
Sbjct  176  QGGPNTVLRVIVEHQIYPISLDVLYQIFTRYGKVLKIVTFTKNGTFQALIQYADMLSAQT  235

Query  589  ARNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            A+  L G+NIY+ CC L I +S +  L V YNND+SRD+TNP LP+
Sbjct  236  AKFNLDGQNIYNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPTLPT  281



>ref|XP_008212879.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X6 
[Nasonia vitripennis]
Length=568

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 139/226 (62%), Gaps = 29/226 (13%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  SA   + +  
Sbjct  52   KPSRVIHIRNIPNEVSEGEIIHLGMPFGRVTNVLVLKGKNQAFLEMADEGSAATMVTYCA  111

Query  316  NVQPSIRGRNVYIQFSSHQELTT-----------------MDQNT--------QSRGDE-  417
            +    +RGR VY+QFS+H+EL T                    NT        Q +G E 
Sbjct  112  SCPAQLRGRAVYVQFSNHRELKTDQGHNNAVGSPTNAIANTSNNTSVQAAGQGQVQGSET  171

Query  418  ---PNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVS  588
               PN +L V + H +YPI+++VL+Q+F+ +G V KIVTF K+  FQALIQ+    SA +
Sbjct  172  QGGPNTVLRVIVEHQIYPISLDVLYQIFTRYGKVLKIVTFTKNGTFQALIQYADMLSAQT  231

Query  589  ARNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            A+  L G+NIY+ CC L I +S +  L V YNND+SRD+TNP LP+
Sbjct  232  AKFNLDGQNIYNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPTLPT  277



>ref|XP_007075804.1| PREDICTED: polypyrimidine tract-binding protein 1-like, partial 
[Panthera tigris altaica]
Length=351

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/225 (40%), Positives = 137/225 (61%), Gaps = 30/225 (13%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+VIH+R +  +++E +++ L  PFG +T L+ML+ KNQA ++M    +A   + +YT+
Sbjct  59   PSRVIHIRKLPSDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTS  118

Query  319  VQPSIRGRNVYIQFSSHQELTT-------------------MDQNTQSRGDEPNR-----  426
            V P +RG+ +YIQFS+H+EL T                     + ++ RG  P R     
Sbjct  119  VTPVLRGQPIYIQFSNHKELKTDSSPNQAVRCRAWGAVGWTWGERSRWRG-APGRNSXXM  177

Query  427  -----ILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSA  591
                 +L + + ++ YP+T++VLHQ+FS  G V KI+TF K+  FQAL+Q+    SA  A
Sbjct  178  AGQSPVLRIIVENLFYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHA  237

Query  592  RNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            + +L G+NIY+ CC L I FS L  L V YNND+SRD+T P+LPS
Sbjct  238  KLSLDGQNIYNACCPLRIDFSKLTSLNVKYNNDKSRDYTRPDLPS  282



>ref|XP_006610361.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X9 [Apis dorsata]
Length=553

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 140/216 (65%), Gaps = 21/216 (10%)
 Frame = +1

Query  142  SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTNV  321
            S+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y + 
Sbjct  48   SRVIHIRNIPNEVSEGEIIHLGIPFGRVTNVLVLKGKNQAFLEMADENAAATMVNYYASC  107

Query  322  QPSIRGRNVYIQFSSHQELTT------------------MDQNTQSRGDE---PNRILLV  438
               +RGR VY+QFS+H+EL T                   +Q  Q++ +    PN +L V
Sbjct  108  MAQLRGRAVYVQFSNHRELKTDQTHTNNANSNNQVALPGQNQVAQTQAETQGGPNTVLRV  167

Query  439  TIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNI  618
             +  M+YPI+++VL+Q+F+  G V KIVTF K+  FQALIQ+    SA +A+ +L+G+NI
Sbjct  168  IVEQMVYPISLDVLYQIFTRFGKVLKIVTFTKNNTFQALIQYADMLSAQTAKLSLEGQNI  227

Query  619  YDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            Y+ CC L I +S +  L V YNND+SRD+TNP+LP+
Sbjct  228  YNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPSLPT  263



>ref|XP_001603240.2| PREDICTED: polypyrimidine tract-binding protein 1 isoform X2 
[Nasonia vitripennis]
Length=587

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 139/226 (62%), Gaps = 29/226 (13%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  SA   + +  
Sbjct  72   KPSRVIHIRNIPNEVSEGEIIHLGMPFGRVTNVLVLKGKNQAFLEMADEGSAATMVTYCA  131

Query  316  NVQPSIRGRNVYIQFSSHQELTT-----------------MDQNT--------QSRGDE-  417
            +    +RGR VY+QFS+H+EL T                    NT        Q +G E 
Sbjct  132  SCPAQLRGRAVYVQFSNHRELKTDQGHNNAVGSPTNAIANTSNNTSVQAAGQGQVQGSET  191

Query  418  ---PNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVS  588
               PN +L V + H +YPI+++VL+Q+F+ +G V KIVTF K+  FQALIQ+    SA +
Sbjct  192  QGGPNTVLRVIVEHQIYPISLDVLYQIFTRYGKVLKIVTFTKNGTFQALIQYADMLSAQT  251

Query  589  ARNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            A+  L G+NIY+ CC L I +S +  L V YNND+SRD+TNP LP+
Sbjct  252  AKFNLDGQNIYNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPTLPT  297



>ref|XP_008212870.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X1 
[Nasonia vitripennis]
Length=588

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 139/226 (62%), Gaps = 29/226 (13%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  SA   + +  
Sbjct  72   KPSRVIHIRNIPNEVSEGEIIHLGMPFGRVTNVLVLKGKNQAFLEMADEGSAATMVTYCA  131

Query  316  NVQPSIRGRNVYIQFSSHQELTT-----------------MDQNT--------QSRGDE-  417
            +    +RGR VY+QFS+H+EL T                    NT        Q +G E 
Sbjct  132  SCPAQLRGRAVYVQFSNHRELKTDQGHNNAVGSPTNAIANTSNNTSVQAAGQGQVQGSET  191

Query  418  ---PNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVS  588
               PN +L V + H +YPI+++VL+Q+F+ +G V KIVTF K+  FQALIQ+    SA +
Sbjct  192  QGGPNTVLRVIVEHQIYPISLDVLYQIFTRYGKVLKIVTFTKNGTFQALIQYADMLSAQT  251

Query  589  ARNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            A+  L G+NIY+ CC L I +S +  L V YNND+SRD+TNP LP+
Sbjct  252  AKFNLDGQNIYNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPTLPT  297



>ref|XP_008212874.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X4 
[Nasonia vitripennis]
Length=583

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 139/226 (62%), Gaps = 29/226 (13%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  SA   + +  
Sbjct  72   KPSRVIHIRNIPNEVSEGEIIHLGMPFGRVTNVLVLKGKNQAFLEMADEGSAATMVTYCA  131

Query  316  NVQPSIRGRNVYIQFSSHQELTT-----------------MDQNT--------QSRGDE-  417
            +    +RGR VY+QFS+H+EL T                    NT        Q +G E 
Sbjct  132  SCPAQLRGRAVYVQFSNHRELKTDQGHNNAVGSPTNAIANTSNNTSVQAAGQGQVQGSET  191

Query  418  ---PNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVS  588
               PN +L V + H +YPI+++VL+Q+F+ +G V KIVTF K+  FQALIQ+    SA +
Sbjct  192  QGGPNTVLRVIVEHQIYPISLDVLYQIFTRYGKVLKIVTFTKNGTFQALIQYADMLSAQT  251

Query  589  ARNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            A+  L G+NIY+ CC L I +S +  L V YNND+SRD+TNP LP+
Sbjct  252  AKFNLDGQNIYNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPTLPT  297



>ref|XP_006610363.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X11 [Apis dorsata]
 ref|XP_006610364.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X12 [Apis dorsata]
Length=534

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 140/216 (65%), Gaps = 21/216 (10%)
 Frame = +1

Query  142  SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTNV  321
            S+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y + 
Sbjct  29   SRVIHIRNIPNEVSEGEIIHLGIPFGRVTNVLVLKGKNQAFLEMADENAAATMVNYYASC  88

Query  322  QPSIRGRNVYIQFSSHQELTT------------------MDQNTQSRGDE---PNRILLV  438
               +RGR VY+QFS+H+EL T                   +Q  Q++ +    PN +L V
Sbjct  89   MAQLRGRAVYVQFSNHRELKTDQTHTNNANSNNQVALPGQNQVAQTQAETQGGPNTVLRV  148

Query  439  TIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNI  618
             +  M+YPI+++VL+Q+F+  G V KIVTF K+  FQALIQ+    SA +A+ +L+G+NI
Sbjct  149  IVEQMVYPISLDVLYQIFTRFGKVLKIVTFTKNNTFQALIQYADMLSAQTAKLSLEGQNI  208

Query  619  YDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            Y+ CC L I +S +  L V YNND+SRD+TNP+LP+
Sbjct  209  YNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPSLPT  244



>ref|XP_006610365.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X13 [Apis dorsata]
 ref|XP_006610366.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X14 [Apis dorsata]
 ref|XP_006610367.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X15 [Apis dorsata]
 ref|XP_006610368.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X16 [Apis dorsata]
 ref|XP_006610369.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X17 [Apis dorsata]
 ref|XP_006610370.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X18 [Apis dorsata]
Length=554

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 140/216 (65%), Gaps = 21/216 (10%)
 Frame = +1

Query  142  SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTNV  321
            S+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y + 
Sbjct  49   SRVIHIRNIPNEVSEGEIIHLGIPFGRVTNVLVLKGKNQAFLEMADENAAATMVNYYASC  108

Query  322  QPSIRGRNVYIQFSSHQELTT------------------MDQNTQSRGDE---PNRILLV  438
               +RGR VY+QFS+H+EL T                   +Q  Q++ +    PN +L V
Sbjct  109  MAQLRGRAVYVQFSNHRELKTDQTHTNNANSNNQVALPGQNQVAQTQAETQGGPNTVLRV  168

Query  439  TIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNI  618
             +  M+YPI+++VL+Q+F+  G V KIVTF K+  FQALIQ+    SA +A+ +L+G+NI
Sbjct  169  IVEQMVYPISLDVLYQIFTRFGKVLKIVTFTKNNTFQALIQYADMLSAQTAKLSLEGQNI  228

Query  619  YDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            Y+ CC L I +S +  L V YNND+SRD+TNP+LP+
Sbjct  229  YNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPSLPT  264



>ref|XP_006610362.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X10 [Apis dorsata]
Length=549

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 140/216 (65%), Gaps = 21/216 (10%)
 Frame = +1

Query  142  SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTNV  321
            S+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y + 
Sbjct  44   SRVIHIRNIPNEVSEGEIIHLGIPFGRVTNVLVLKGKNQAFLEMADENAAATMVNYYASC  103

Query  322  QPSIRGRNVYIQFSSHQELTT------------------MDQNTQSRGDE---PNRILLV  438
               +RGR VY+QFS+H+EL T                   +Q  Q++ +    PN +L V
Sbjct  104  MAQLRGRAVYVQFSNHRELKTDQTHTNNANSNNQVALPGQNQVAQTQAETQGGPNTVLRV  163

Query  439  TIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNI  618
             +  M+YPI+++VL+Q+F+  G V KIVTF K+  FQALIQ+    SA +A+ +L+G+NI
Sbjct  164  IVEQMVYPISLDVLYQIFTRFGKVLKIVTFTKNNTFQALIQYADMLSAQTAKLSLEGQNI  223

Query  619  YDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            Y+ CC L I +S +  L V YNND+SRD+TNP+LP+
Sbjct  224  YNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPSLPT  259



>ref|XP_006610359.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X7 [Apis dorsata]
Length=571

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 140/216 (65%), Gaps = 21/216 (10%)
 Frame = +1

Query  142  SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTNV  321
            S+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y + 
Sbjct  66   SRVIHIRNIPNEVSEGEIIHLGIPFGRVTNVLVLKGKNQAFLEMADENAAATMVNYYASC  125

Query  322  QPSIRGRNVYIQFSSHQELTT------------------MDQNTQSRGDE---PNRILLV  438
               +RGR VY+QFS+H+EL T                   +Q  Q++ +    PN +L V
Sbjct  126  MAQLRGRAVYVQFSNHRELKTDQTHTNNANSNNQVALPGQNQVAQTQAETQGGPNTVLRV  185

Query  439  TIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNI  618
             +  M+YPI+++VL+Q+F+  G V KIVTF K+  FQALIQ+    SA +A+ +L+G+NI
Sbjct  186  IVEQMVYPISLDVLYQIFTRFGKVLKIVTFTKNNTFQALIQYADMLSAQTAKLSLEGQNI  245

Query  619  YDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            Y+ CC L I +S +  L V YNND+SRD+TNP+LP+
Sbjct  246  YNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPSLPT  281



>ref|XP_008283569.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X3 [Stegastes partitus]
Length=537

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/221 (41%), Positives = 139/221 (63%), Gaps = 16/221 (7%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+VIH+R + ++I+E +++ L  PFG +T L+ML+AKNQA L+M    +A + + +Y+ 
Sbjct  52   PSRVIHIRKLPNDITETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQSMVSYYST  111

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRG----------------DEPNRILLVTIHH  450
            V P IR   VY+QFS+H+EL T +   Q R                   P+ +L V + +
Sbjct  112  VMPIIRHHPVYVQFSNHKELKTDNSPNQERAQAALRALSTSHVDTTVPAPSTVLRVVVEN  171

Query  451  MLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGC  630
            ++YP+T++ L Q+FS  G V +I+ F K++ FQAL+Q+    SA +A+ +L G+NIY+GC
Sbjct  172  LVYPVTLDALCQIFSKFGTVLRIIVFTKNSQFQALLQYPDGASAQAAKLSLDGQNIYNGC  231

Query  631  CQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
            C L I FS L  L V YNN++SRDFT P+LP+     + +H
Sbjct  232  CTLRISFSKLTSLNVKYNNEKSRDFTRPDLPTGDNQPAMEH  272



>ref|XP_006610360.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X8 [Apis dorsata]
Length=563

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 140/216 (65%), Gaps = 21/216 (10%)
 Frame = +1

Query  142  SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTNV  321
            S+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y + 
Sbjct  58   SRVIHIRNIPNEVSEGEIIHLGIPFGRVTNVLVLKGKNQAFLEMADENAAATMVNYYASC  117

Query  322  QPSIRGRNVYIQFSSHQELTT------------------MDQNTQSRGDE---PNRILLV  438
               +RGR VY+QFS+H+EL T                   +Q  Q++ +    PN +L V
Sbjct  118  MAQLRGRAVYVQFSNHRELKTDQTHTNNANSNNQVALPGQNQVAQTQAETQGGPNTVLRV  177

Query  439  TIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNI  618
             +  M+YPI+++VL+Q+F+  G V KIVTF K+  FQALIQ+    SA +A+ +L+G+NI
Sbjct  178  IVEQMVYPISLDVLYQIFTRFGKVLKIVTFTKNNTFQALIQYADMLSAQTAKLSLEGQNI  237

Query  619  YDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            Y+ CC L I +S +  L V YNND+SRD+TNP+LP+
Sbjct  238  YNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPSLPT  273



>ref|XP_008283568.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X2 [Stegastes partitus]
Length=538

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/221 (41%), Positives = 139/221 (63%), Gaps = 16/221 (7%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+VIH+R + ++I+E +++ L  PFG +T L+ML+AKNQA L+M    +A + + +Y+ 
Sbjct  53   PSRVIHIRKLPNDITETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQSMVSYYST  112

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRG----------------DEPNRILLVTIHH  450
            V P IR   VY+QFS+H+EL T +   Q R                   P+ +L V + +
Sbjct  113  VMPIIRHHPVYVQFSNHKELKTDNSPNQERAQAALRALSTSHVDTTVPAPSTVLRVVVEN  172

Query  451  MLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGC  630
            ++YP+T++ L Q+FS  G V +I+ F K++ FQAL+Q+    SA +A+ +L G+NIY+GC
Sbjct  173  LVYPVTLDALCQIFSKFGTVLRIIVFTKNSQFQALLQYPDGASAQAAKLSLDGQNIYNGC  232

Query  631  CQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
            C L I FS L  L V YNN++SRDFT P+LP+     + +H
Sbjct  233  CTLRISFSKLTSLNVKYNNEKSRDFTRPDLPTGDNQPAMEH  273



>ref|XP_008212871.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X3 
[Nasonia vitripennis]
 ref|XP_008212873.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X3 
[Nasonia vitripennis]
Length=585

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 139/226 (62%), Gaps = 29/226 (13%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  SA   + +  
Sbjct  69   KPSRVIHIRNIPNEVSEGEIIHLGMPFGRVTNVLVLKGKNQAFLEMADEGSAATMVTYCA  128

Query  316  NVQPSIRGRNVYIQFSSHQELTT-----------------MDQNT--------QSRGDE-  417
            +    +RGR VY+QFS+H+EL T                    NT        Q +G E 
Sbjct  129  SCPAQLRGRAVYVQFSNHRELKTDQGHNNAVGSPTNAIANTSNNTSVQAAGQGQVQGSET  188

Query  418  ---PNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVS  588
               PN +L V + H +YPI+++VL+Q+F+ +G V KIVTF K+  FQALIQ+    SA +
Sbjct  189  QGGPNTVLRVIVEHQIYPISLDVLYQIFTRYGKVLKIVTFTKNGTFQALIQYADMLSAQT  248

Query  589  ARNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            A+  L G+NIY+ CC L I +S +  L V YNND+SRD+TNP LP+
Sbjct  249  AKFNLDGQNIYNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPTLPT  294



>ref|XP_003401618.1| PREDICTED: polypyrimidine tract-binding protein 2-like [Bombus 
terrestris]
Length=578

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 140/216 (65%), Gaps = 21/216 (10%)
 Frame = +1

Query  142  SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTNV  321
            S+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y + 
Sbjct  74   SRVIHIRNIPNEVSEGEIIHLGVPFGRVTNVLVLKGKNQAFLEMADENAAATMVNYYASC  133

Query  322  QPSIRGRNVYIQFSSHQELTT------------------MDQNTQSRGDE---PNRILLV  438
               +RGR VY+QFS+H+EL T                   +Q  Q++ +    PN +L V
Sbjct  134  MAQLRGRAVYVQFSNHRELKTDQTHTNNANSNSQVTLPGQNQVAQTQAETQGGPNTVLRV  193

Query  439  TIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNI  618
             +  M+YPI+++VL+Q+F+  G V KIVTF K+  FQALIQ+    SA +A+ +L+G+NI
Sbjct  194  IVEQMVYPISLDVLYQIFTRFGKVLKIVTFTKNNTFQALIQYADMLSAQTAKLSLEGQNI  253

Query  619  YDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            Y+ CC L I +S +  L V YNND+SRD+TNP+LP+
Sbjct  254  YNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPSLPT  289



>ref|XP_005470623.1| PREDICTED: polypyrimidine tract-binding protein 3 [Oreochromis 
niloticus]
Length=499

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 140/242 (58%), Gaps = 31/242 (13%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+V+H+R +  ++SE ++L L  PFG ++KL+ L+ KNQA L+M    +AV  + +YT+
Sbjct  25   PSRVLHLRQLPPDVSEQEVLSLALPFGRVSKLITLKTKNQAFLEMASEEAAVTMVNYYTS  84

Query  319  VQPSIRGRNVYIQFSSHQELTT------------------------MDQNTQSRGDEPNR  426
              PSIR + VYIQ+S+H+EL T                        M    + RG  P +
Sbjct  85   ATPSIRSQPVYIQYSTHRELKTDNMTSQRAQAALQAINAGAVHSGNMTSGGEGRGIAPGQ  144

Query  427  --ILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNA  600
              +L + + ++ YP+T+EVL Q+FS  G V KI+TF ++  FQAL+QF     A  A+  
Sbjct  145  SPVLRIIVENLFYPVTLEVLQQIFSKFGSVLKIITFTRNNQFQALLQFSDTVHAQHAKAT  204

Query  601  LQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHG-----YGD  765
            L G+NIY+GCC L I FS L  L V YNND+SRDFT  +LPS +   ++  G     YG 
Sbjct  205  LDGQNIYNGCCTLRIDFSKLSALNVKYNNDKSRDFTRADLPSGELEPTAAFGVALPPYGA  264

Query  766  AG  771
            A 
Sbjct  265  AA  266



>ref|XP_003693343.1| PREDICTED: polypyrimidine tract-binding protein 2-like [Apis 
florea]
Length=578

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 140/216 (65%), Gaps = 21/216 (10%)
 Frame = +1

Query  142  SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTNV  321
            S+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y + 
Sbjct  74   SRVIHIRNIPNEVSEGEIIHLGIPFGRVTNVLVLKGKNQAFLEMADENAAATMVNYYASC  133

Query  322  QPSIRGRNVYIQFSSHQELTT------------------MDQNTQSRGDE---PNRILLV  438
               +RGR VY+QFS+H+EL T                   +Q  Q++ +    PN +L V
Sbjct  134  MAQLRGRAVYVQFSNHRELKTDQTHTNNANSNNQVAIPGQNQVAQTQAETQGGPNTVLRV  193

Query  439  TIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNI  618
             +  M+YPI+++VL+Q+F+  G V KIVTF K+  FQALIQ+    SA +A+ +L+G+NI
Sbjct  194  IVEQMVYPISLDVLYQIFTRFGKVLKIVTFTKNNTFQALIQYADMLSAQTAKLSLEGQNI  253

Query  619  YDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            Y+ CC L I +S +  L V YNND+SRD+TNP+LP+
Sbjct  254  YNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPSLPT  289



>ref|XP_003491847.1| PREDICTED: polypyrimidine tract-binding protein 2-like [Bombus 
impatiens]
Length=578

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 140/216 (65%), Gaps = 21/216 (10%)
 Frame = +1

Query  142  SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTNV  321
            S+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y + 
Sbjct  74   SRVIHIRNIPNEVSEGEIIHLGVPFGRVTNVLVLKGKNQAFLEMADENAAATMVNYYASC  133

Query  322  QPSIRGRNVYIQFSSHQELTT------------------MDQNTQSRGDE---PNRILLV  438
               +RGR VY+QFS+H+EL T                   +Q  Q++ +    PN +L V
Sbjct  134  MAQLRGRAVYVQFSNHRELKTDQTHTNNANSNNQVALPGQNQVAQTQAETQGGPNTVLRV  193

Query  439  TIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNI  618
             +  M+YPI+++VL+Q+F+  G V KIVTF K+  FQALIQ+    SA +A+ +L+G+NI
Sbjct  194  IVEQMVYPISLDVLYQIFTRFGKVLKIVTFTKNNTFQALIQYADMLSAQTAKLSLEGQNI  253

Query  619  YDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            Y+ CC L I +S +  L V YNND+SRD+TNP+LP+
Sbjct  254  YNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPSLPT  289



>ref|XP_006610358.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X6 [Apis dorsata]
Length=579

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 140/216 (65%), Gaps = 21/216 (10%)
 Frame = +1

Query  142  SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTNV  321
            S+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y + 
Sbjct  74   SRVIHIRNIPNEVSEGEIIHLGIPFGRVTNVLVLKGKNQAFLEMADENAAATMVNYYASC  133

Query  322  QPSIRGRNVYIQFSSHQELTT------------------MDQNTQSRGDE---PNRILLV  438
               +RGR VY+QFS+H+EL T                   +Q  Q++ +    PN +L V
Sbjct  134  MAQLRGRAVYVQFSNHRELKTDQTHTNNANSNNQVALPGQNQVAQTQAETQGGPNTVLRV  193

Query  439  TIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNI  618
             +  M+YPI+++VL+Q+F+  G V KIVTF K+  FQALIQ+    SA +A+ +L+G+NI
Sbjct  194  IVEQMVYPISLDVLYQIFTRFGKVLKIVTFTKNNTFQALIQYADMLSAQTAKLSLEGQNI  253

Query  619  YDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            Y+ CC L I +S +  L V YNND+SRD+TNP+LP+
Sbjct  254  YNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPSLPT  289



>ref|XP_008283567.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X1 [Stegastes partitus]
Length=582

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/221 (41%), Positives = 139/221 (63%), Gaps = 16/221 (7%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+VIH+R + ++I+E +++ L  PFG +T L+ML+AKNQA L+M    +A + + +Y+ 
Sbjct  97   PSRVIHIRKLPNDITETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQSMVSYYST  156

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRG----------------DEPNRILLVTIHH  450
            V P IR   VY+QFS+H+EL T +   Q R                   P+ +L V + +
Sbjct  157  VMPIIRHHPVYVQFSNHKELKTDNSPNQERAQAALRALSTSHVDTTVPAPSTVLRVVVEN  216

Query  451  MLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGC  630
            ++YP+T++ L Q+FS  G V +I+ F K++ FQAL+Q+    SA +A+ +L G+NIY+GC
Sbjct  217  LVYPVTLDALCQIFSKFGTVLRIIVFTKNSQFQALLQYPDGASAQAAKLSLDGQNIYNGC  276

Query  631  CQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
            C L I FS L  L V YNN++SRDFT P+LP+     + +H
Sbjct  277  CTLRISFSKLTSLNVKYNNEKSRDFTRPDLPTGDNQPAMEH  317



>ref|XP_011472629.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X4 [Oryzias latipes]
Length=509

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 138/223 (62%), Gaps = 18/223 (8%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+V+H+R +  +I+E +++ L  PFG +T L+ML+AKNQA L+M    +A N + +Y+ 
Sbjct  23   PSRVLHIRKLPIDITETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQNMVGYYST  82

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE------------------PNRILLVTI  444
            V P IR + V++QFS+H+EL T +   Q R                     P+ +L V +
Sbjct  83   VMPIIRQQPVFVQFSNHKELKTDNSPNQERAQAALRALSSSHVDTAALVVAPSSVLRVVV  142

Query  445  HHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYD  624
             ++LYP++++ L Q+FS  G V +I+ F K+  FQAL+Q+    SA +A+ +L G+NIY+
Sbjct  143  ENLLYPVSLDALCQIFSKFGTVLRIIVFTKNNQFQALLQYAEGASAQAAKVSLDGQNIYN  202

Query  625  GCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
            GCC L I FS L  L V YNND+SRDFT P+LPS     + +H
Sbjct  203  GCCTLRISFSKLTTLNVKYNNDKSRDFTRPDLPSGDGQPTMEH  245



>ref|XP_008183515.1| PREDICTED: polypyrimidine tract-binding protein 2 isoform X4 
[Acyrthosiphon pisum]
Length=632

 Score =   185 bits (469),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 139/216 (64%), Gaps = 21/216 (10%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+ +E++E +++ L  PFG +T +++L+ KNQA L+M D  SA   + ++T
Sbjct  79   KPSRVIHIRNIPNEVTEAEVIHLGIPFGKVTNVLVLKGKNQAFLEMADETSASAMVTYFT  138

Query  316  NVQPSIRGRNVYIQFSSHQELTTMDQN-----------------TQSRGD---EPNRILL  435
                 +RGR V+IQFS+H+EL T DQ                     + D    PN +L 
Sbjct  139  TCTAQLRGRAVFIQFSNHKELKT-DQTHSNANASAQAALQAAQALAGQSDVQGGPNTVLR  197

Query  436  VTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRN  615
            V + HM++PI+++VL+++FS +G V KIVTF K+  FQ LIQ+    +A SA+ +L G+N
Sbjct  198  VIVEHMVFPISLDVLYEIFSRYGKVLKIVTFTKNNSFQVLIQYPDVVTAQSAKLSLDGQN  257

Query  616  IYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLP  723
            IY  CC+L I++S L  L V YNND+SRD+TNP LP
Sbjct  258  IYTSCCKLRIEYSKLSSLNVKYNNDKSRDYTNPTLP  293



>ref|XP_006610356.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X4 [Apis dorsata]
Length=629

 Score =   184 bits (468),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 140/216 (65%), Gaps = 21/216 (10%)
 Frame = +1

Query  142  SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTNV  321
            S+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y + 
Sbjct  124  SRVIHIRNIPNEVSEGEIIHLGIPFGRVTNVLVLKGKNQAFLEMADENAAATMVNYYASC  183

Query  322  QPSIRGRNVYIQFSSHQELTT------------------MDQNTQSRGDE---PNRILLV  438
               +RGR VY+QFS+H+EL T                   +Q  Q++ +    PN +L V
Sbjct  184  MAQLRGRAVYVQFSNHRELKTDQTHTNNANSNNQVALPGQNQVAQTQAETQGGPNTVLRV  243

Query  439  TIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNI  618
             +  M+YPI+++VL+Q+F+  G V KIVTF K+  FQALIQ+    SA +A+ +L+G+NI
Sbjct  244  IVEQMVYPISLDVLYQIFTRFGKVLKIVTFTKNNTFQALIQYADMLSAQTAKLSLEGQNI  303

Query  619  YDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            Y+ CC L I +S +  L V YNND+SRD+TNP+LP+
Sbjct  304  YNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPSLPT  339



>ref|XP_006610357.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X5 [Apis dorsata]
Length=623

 Score =   184 bits (468),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 140/216 (65%), Gaps = 21/216 (10%)
 Frame = +1

Query  142  SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTNV  321
            S+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y + 
Sbjct  118  SRVIHIRNIPNEVSEGEIIHLGIPFGRVTNVLVLKGKNQAFLEMADENAAATMVNYYASC  177

Query  322  QPSIRGRNVYIQFSSHQELTT------------------MDQNTQSRGDE---PNRILLV  438
               +RGR VY+QFS+H+EL T                   +Q  Q++ +    PN +L V
Sbjct  178  MAQLRGRAVYVQFSNHRELKTDQTHTNNANSNNQVALPGQNQVAQTQAETQGGPNTVLRV  237

Query  439  TIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNI  618
             +  M+YPI+++VL+Q+F+  G V KIVTF K+  FQALIQ+    SA +A+ +L+G+NI
Sbjct  238  IVEQMVYPISLDVLYQIFTRFGKVLKIVTFTKNNTFQALIQYADMLSAQTAKLSLEGQNI  297

Query  619  YDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            Y+ CC L I +S +  L V YNND+SRD+TNP+LP+
Sbjct  298  YNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPSLPT  333



>gb|ELV09317.1| Polypyrimidine tract-binding protein 1, partial [Tupaia chinensis]
Length=522

 Score =   183 bits (464),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/213 (42%), Positives = 135/213 (63%), Gaps = 17/213 (8%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+VIH+R +  +++E +++ L  PFG +T L+ML+ KNQA ++M    +A   + +YT+
Sbjct  45   PSRVIHIRKLPSDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNAEEAANTMVNYYTS  104

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGD-----------------EPNRILLVTIH  447
            V P +RG+ +YIQFS+H+EL T     Q+ G+                   + +L V + 
Sbjct  105  VTPVLRGQPIYIQFSNHKELKTDSSPNQASGNLALAASAAAMDAGMAMAGQSPVLRVIVE  164

Query  448  HMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDG  627
            ++ YP+T++VLHQ+FS  G V KI+TF K+  FQAL+Q+    SA  A+ +L G+NIY+ 
Sbjct  165  NLFYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNA  224

Query  628  CCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            CC L I FS L  L V YNND+SRD+T P+LPS
Sbjct  225  CCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPS  257



>ref|XP_006610353.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X1 [Apis dorsata]
Length=639

 Score =   184 bits (468),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 140/216 (65%), Gaps = 21/216 (10%)
 Frame = +1

Query  142  SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTNV  321
            S+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y + 
Sbjct  134  SRVIHIRNIPNEVSEGEIIHLGIPFGRVTNVLVLKGKNQAFLEMADENAAATMVNYYASC  193

Query  322  QPSIRGRNVYIQFSSHQELTT------------------MDQNTQSRGDE---PNRILLV  438
               +RGR VY+QFS+H+EL T                   +Q  Q++ +    PN +L V
Sbjct  194  MAQLRGRAVYVQFSNHRELKTDQTHTNNANSNNQVALPGQNQVAQTQAETQGGPNTVLRV  253

Query  439  TIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNI  618
             +  M+YPI+++VL+Q+F+  G V KIVTF K+  FQALIQ+    SA +A+ +L+G+NI
Sbjct  254  IVEQMVYPISLDVLYQIFTRFGKVLKIVTFTKNNTFQALIQYADMLSAQTAKLSLEGQNI  313

Query  619  YDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            Y+ CC L I +S +  L V YNND+SRD+TNP+LP+
Sbjct  314  YNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPSLPT  349



>ref|XP_006610354.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X2 [Apis dorsata]
Length=638

 Score =   184 bits (468),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 140/216 (65%), Gaps = 21/216 (10%)
 Frame = +1

Query  142  SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTNV  321
            S+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y + 
Sbjct  134  SRVIHIRNIPNEVSEGEIIHLGIPFGRVTNVLVLKGKNQAFLEMADENAAATMVNYYASC  193

Query  322  QPSIRGRNVYIQFSSHQELTT------------------MDQNTQSRGDE---PNRILLV  438
               +RGR VY+QFS+H+EL T                   +Q  Q++ +    PN +L V
Sbjct  194  MAQLRGRAVYVQFSNHRELKTDQTHTNNANSNNQVALPGQNQVAQTQAETQGGPNTVLRV  253

Query  439  TIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNI  618
             +  M+YPI+++VL+Q+F+  G V KIVTF K+  FQALIQ+    SA +A+ +L+G+NI
Sbjct  254  IVEQMVYPISLDVLYQIFTRFGKVLKIVTFTKNNTFQALIQYADMLSAQTAKLSLEGQNI  313

Query  619  YDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            Y+ CC L I +S +  L V YNND+SRD+TNP+LP+
Sbjct  314  YNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPSLPT  349



>ref|XP_006610355.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X3 [Apis dorsata]
Length=634

 Score =   184 bits (468),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 140/216 (65%), Gaps = 21/216 (10%)
 Frame = +1

Query  142  SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTNV  321
            S+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y + 
Sbjct  134  SRVIHIRNIPNEVSEGEIIHLGIPFGRVTNVLVLKGKNQAFLEMADENAAATMVNYYASC  193

Query  322  QPSIRGRNVYIQFSSHQELTT------------------MDQNTQSRGDE---PNRILLV  438
               +RGR VY+QFS+H+EL T                   +Q  Q++ +    PN +L V
Sbjct  194  MAQLRGRAVYVQFSNHRELKTDQTHTNNANSNNQVALPGQNQVAQTQAETQGGPNTVLRV  253

Query  439  TIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNI  618
             +  M+YPI+++VL+Q+F+  G V KIVTF K+  FQALIQ+    SA +A+ +L+G+NI
Sbjct  254  IVEQMVYPISLDVLYQIFTRFGKVLKIVTFTKNNTFQALIQYADMLSAQTAKLSLEGQNI  313

Query  619  YDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            Y+ CC L I +S +  L V YNND+SRD+TNP+LP+
Sbjct  314  YNSCCTLRIDYSKMQNLNVKYNNDKSRDYTNPSLPT  349



>ref|XP_006815130.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X2 [Saccoglossus kowalevskii]
Length=566

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 92/220 (42%), Positives = 140/220 (64%), Gaps = 25/220 (11%)
 Frame = +1

Query  142  SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTNV  321
            S+V+H+RNV  + +E++++ L  PFG +T +++L+ K+QA L+M++  +A   + +Y++V
Sbjct  76   SRVVHIRNVVADATESEIIALGVPFGRVTNILLLKGKSQAFLEMENETAATTMVNYYSHV  135

Query  322  QPSIRGRNVYIQFSSHQELTTMDQNT------------------QSRGDEP-------NR  426
              +IRGR VY+QFS+H+EL T +                     Q+ G  P       N 
Sbjct  136  TANIRGRPVYVQFSNHKELKTENAPAQQTAAAQAALAAAQSLMPQTLGVHPGDTLGGQNT  195

Query  427  ILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQ  606
            +L V + +MLYP+TV++LHQ+FS  G V KI+TF K+  FQALIQF    SA +++ +L 
Sbjct  196  VLRVIVENMLYPVTVDILHQIFSKFGAVLKIITFNKNNTFQALIQFADAVSAQASKLSLD  255

Query  607  GRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            G+NIY+ CC L I +S L  L V YNND+SRD+T P+LPS
Sbjct  256  GQNIYNACCTLRIDYSKLTTLNVKYNNDKSRDYTRPDLPS  295



>ref|XP_011472630.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X5 [Oryzias latipes]
Length=533

 Score =   183 bits (464),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 138/223 (62%), Gaps = 18/223 (8%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+V+H+R +  +I+E +++ L  PFG +T L+ML+AKNQA L+M    +A N + +Y+ 
Sbjct  53   PSRVLHIRKLPIDITETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQNMVGYYST  112

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE------------------PNRILLVTI  444
            V P IR + V++QFS+H+EL T +   Q R                     P+ +L V +
Sbjct  113  VMPIIRQQPVFVQFSNHKELKTDNSPNQERAQAALRALSSSHVDTAALVVAPSSVLRVVV  172

Query  445  HHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYD  624
             ++LYP++++ L Q+FS  G V +I+ F K+  FQAL+Q+    SA +A+ +L G+NIY+
Sbjct  173  ENLLYPVSLDALCQIFSKFGTVLRIIVFTKNNQFQALLQYAEGASAQAAKVSLDGQNIYN  232

Query  625  GCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
            GCC L I FS L  L V YNND+SRDFT P+LPS     + +H
Sbjct  233  GCCTLRISFSKLTTLNVKYNNDKSRDFTRPDLPSGDGQPTMEH  275



>ref|XP_011472627.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X2 [Oryzias latipes]
 dbj|BAO03404.1| polypyrimidine tract binding protein 1b [Oryzias latipes]
Length=539

 Score =   183 bits (464),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 138/223 (62%), Gaps = 18/223 (8%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+V+H+R +  +I+E +++ L  PFG +T L+ML+AKNQA L+M    +A N + +Y+ 
Sbjct  53   PSRVLHIRKLPIDITETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQNMVGYYST  112

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE------------------PNRILLVTI  444
            V P IR + V++QFS+H+EL T +   Q R                     P+ +L V +
Sbjct  113  VMPIIRQQPVFVQFSNHKELKTDNSPNQERAQAALRALSSSHVDTAALVVAPSSVLRVVV  172

Query  445  HHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYD  624
             ++LYP++++ L Q+FS  G V +I+ F K+  FQAL+Q+    SA +A+ +L G+NIY+
Sbjct  173  ENLLYPVSLDALCQIFSKFGTVLRIIVFTKNNQFQALLQYAEGASAQAAKVSLDGQNIYN  232

Query  625  GCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
            GCC L I FS L  L V YNND+SRDFT P+LPS     + +H
Sbjct  233  GCCTLRISFSKLTTLNVKYNNDKSRDFTRPDLPSGDGQPTMEH  275



>ref|XP_011472628.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X3 [Oryzias latipes]
Length=557

 Score =   183 bits (465),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 138/223 (62%), Gaps = 18/223 (8%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+V+H+R +  +I+E +++ L  PFG +T L+ML+AKNQA L+M    +A N + +Y+ 
Sbjct  77   PSRVLHIRKLPIDITETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQNMVGYYST  136

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE------------------PNRILLVTI  444
            V P IR + V++QFS+H+EL T +   Q R                     P+ +L V +
Sbjct  137  VMPIIRQQPVFVQFSNHKELKTDNSPNQERAQAALRALSSSHVDTAALVVAPSSVLRVVV  196

Query  445  HHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYD  624
             ++LYP++++ L Q+FS  G V +I+ F K+  FQAL+Q+    SA +A+ +L G+NIY+
Sbjct  197  ENLLYPVSLDALCQIFSKFGTVLRIIVFTKNNQFQALLQYAEGASAQAAKVSLDGQNIYN  256

Query  625  GCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
            GCC L I FS L  L V YNND+SRDFT P+LPS     + +H
Sbjct  257  GCCTLRISFSKLTTLNVKYNNDKSRDFTRPDLPSGDGQPTMEH  299



>ref|XP_006815129.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X1 [Saccoglossus kowalevskii]
Length=581

 Score =   184 bits (466),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/220 (42%), Positives = 140/220 (64%), Gaps = 25/220 (11%)
 Frame = +1

Query  142  SKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTNV  321
            S+V+H+RNV  + +E++++ L  PFG +T +++L+ K+QA L+M++  +A   + +Y++V
Sbjct  68   SRVVHIRNVVADATESEIIALGVPFGRVTNILLLKGKSQAFLEMENETAATTMVNYYSHV  127

Query  322  QPSIRGRNVYIQFSSHQELTTMDQNT------------------QSRGDEP-------NR  426
              +IRGR VY+QFS+H+EL T +                     Q+ G  P       N 
Sbjct  128  TANIRGRPVYVQFSNHKELKTENAPAQQTAAAQAALAAAQSLMPQTLGVHPGDTLGGQNT  187

Query  427  ILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQ  606
            +L V + +MLYP+TV++LHQ+FS  G V KI+TF K+  FQALIQF    SA +++ +L 
Sbjct  188  VLRVIVENMLYPVTVDILHQIFSKFGAVLKIITFNKNNTFQALIQFADAVSAQASKLSLD  247

Query  607  GRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            G+NIY+ CC L I +S L  L V YNND+SRD+T P+LPS
Sbjct  248  GQNIYNACCTLRIDYSKLTTLNVKYNNDKSRDYTRPDLPS  287



>ref|XP_011472626.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X1 [Oryzias latipes]
Length=563

 Score =   183 bits (464),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 138/223 (62%), Gaps = 18/223 (8%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+V+H+R +  +I+E +++ L  PFG +T L+ML+AKNQA L+M    +A N + +Y+ 
Sbjct  77   PSRVLHIRKLPIDITETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQNMVGYYST  136

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE------------------PNRILLVTI  444
            V P IR + V++QFS+H+EL T +   Q R                     P+ +L V +
Sbjct  137  VMPIIRQQPVFVQFSNHKELKTDNSPNQERAQAALRALSSSHVDTAALVVAPSSVLRVVV  196

Query  445  HHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYD  624
             ++LYP++++ L Q+FS  G V +I+ F K+  FQAL+Q+    SA +A+ +L G+NIY+
Sbjct  197  ENLLYPVSLDALCQIFSKFGTVLRIIVFTKNNQFQALLQYAEGASAQAAKVSLDGQNIYN  256

Query  625  GCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
            GCC L I FS L  L V YNND+SRDFT P+LPS     + +H
Sbjct  257  GCCTLRISFSKLTTLNVKYNNDKSRDFTRPDLPSGDGQPTMEH  299



>ref|XP_011495872.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X4 
[Ceratosolen solmsi marchali]
Length=562

 Score =   183 bits (464),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 89/226 (39%), Positives = 137/226 (61%), Gaps = 29/226 (13%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  72   KPSRVIHIRNIPNEVSEGEIVHLGIPFGRVTNVLVLKGKNQAFLEMADEGAAATMVTYYA  131

Query  316  NVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE--------------------------  417
            +    +R R VY+QFS+H+EL T   +  + G                            
Sbjct  132  SCPAQLRARAVYVQFSNHRELKTDQAHNNAVGSPTNAIANTSNNANVQASNQGPVQGSDT  191

Query  418  ---PNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVS  588
               PN +L V + HM+YPI++++L+Q+F+ +G V KIVTF K+  FQALIQ+    SA +
Sbjct  192  QGGPNTVLRVIVEHMIYPISLDILYQIFTRYGKVLKIVTFTKNNSFQALIQYTDMLSAQT  251

Query  589  ARNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            A+  L G+NIY+ CC L I +S +  L V +NND+SRD+TNP LP+
Sbjct  252  AKFNLDGQNIYNSCCTLRIDYSKMQNLNVKFNNDKSRDYTNPTLPT  297



>ref|XP_010865898.1| PREDICTED: polypyrimidine tract-binding protein 2-like, partial 
[Esox lucius]
Length=324

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 93/225 (41%), Positives = 135/225 (60%), Gaps = 27/225 (12%)
 Frame = +1

Query  133  TEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFY  312
            + PS+V+H+R +  E+SE +++ L  PFG +T ++ML+ KNQA L++    +AV  + +Y
Sbjct  3    SPPSRVLHIRKLPSEVSETEVIALGLPFGKVTNILMLKGKNQAFLELSTEEAAVTMVNYY  62

Query  313  TNVQPSIRGRNVYIQFSSHQELTT---MDQNTQS---------RGDEPNR----------  426
            T V P +R   V+IQFS+H+EL T   ++Q  Q+          G  PN           
Sbjct  63   TAVIPQVRNVPVFIQFSNHKELKTDSALNQRAQAVLQAVSAVQEGGSPNSDTTALDSVLA  122

Query  427  -----ILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSA  591
                 +L + I +M YP+T++VL Q+FS  G V KI+TF K+  FQAL+QF    +A  A
Sbjct  123  QAPSPVLRIIIDNMFYPVTLDVLQQIFSKFGTVMKIITFTKNNQFQALLQFSEPVNAQQA  182

Query  592  RNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            R +L G+NIY+ CC L I FS L  L V YNND+SRD+T P LP+
Sbjct  183  RLSLDGQNIYNSCCTLRIDFSKLVNLNVKYNNDKSRDYTRPELPA  227



>ref|XP_011495870.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X2 
[Ceratosolen solmsi marchali]
Length=583

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/226 (39%), Positives = 137/226 (61%), Gaps = 29/226 (13%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  72   KPSRVIHIRNIPNEVSEGEIVHLGIPFGRVTNVLVLKGKNQAFLEMADEGAAATMVTYYA  131

Query  316  NVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE--------------------------  417
            +    +R R VY+QFS+H+EL T   +  + G                            
Sbjct  132  SCPAQLRARAVYVQFSNHRELKTDQAHNNAVGSPTNAIANTSNNANVQASNQGPVQGSDT  191

Query  418  ---PNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVS  588
               PN +L V + HM+YPI++++L+Q+F+ +G V KIVTF K+  FQALIQ+    SA +
Sbjct  192  QGGPNTVLRVIVEHMIYPISLDILYQIFTRYGKVLKIVTFTKNNSFQALIQYTDMLSAQT  251

Query  589  ARNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            A+  L G+NIY+ CC L I +S +  L V +NND+SRD+TNP LP+
Sbjct  252  AKFNLDGQNIYNSCCTLRIDYSKMQNLNVKFNNDKSRDYTNPTLPT  297



>ref|XP_011495869.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X1 
[Ceratosolen solmsi marchali]
Length=587

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/226 (39%), Positives = 137/226 (61%), Gaps = 29/226 (13%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  72   KPSRVIHIRNIPNEVSEGEIVHLGIPFGRVTNVLVLKGKNQAFLEMADEGAAATMVTYYA  131

Query  316  NVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE--------------------------  417
            +    +R R VY+QFS+H+EL T   +  + G                            
Sbjct  132  SCPAQLRARAVYVQFSNHRELKTDQAHNNAVGSPTNAIANTSNNANVQASNQGPVQGSDT  191

Query  418  ---PNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVS  588
               PN +L V + HM+YPI++++L+Q+F+ +G V KIVTF K+  FQALIQ+    SA +
Sbjct  192  QGGPNTVLRVIVEHMIYPISLDILYQIFTRYGKVLKIVTFTKNNSFQALIQYTDMLSAQT  251

Query  589  ARNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            A+  L G+NIY+ CC L I +S +  L V +NND+SRD+TNP LP+
Sbjct  252  AKFNLDGQNIYNSCCTLRIDYSKMQNLNVKFNNDKSRDYTNPTLPT  297



>ref|XP_006803670.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X3 [Neolamprologus brichardi]
Length=508

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/221 (41%), Positives = 137/221 (62%), Gaps = 16/221 (7%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+VIH+R +  +I+E +++ L  PFG +T L+ML+AKNQA L+M    +A N + +Y+ 
Sbjct  23   PSRVIHIRKLPSDITEAEVISLGVPFGDVTNLLMLKAKNQAFLEMNSEEAAQNLVGYYST  82

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE----------------PNRILLVTIHH  450
            + P IR   VY+QFS+H+EL T +   Q R                   P+ +L V + +
Sbjct  83   MVPIIRHHPVYVQFSNHKELKTDNSPNQERAQAALRALSSSHVDTAAVAPSTVLRVVVEN  142

Query  451  MLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGC  630
            ++YP+T++ L Q+FS  G V +I+ F K+  FQAL+Q+    SA +A+ +L G+NIY+GC
Sbjct  143  LIYPVTLDALCQIFSKFGTVLRIIIFTKNNQFQALLQYPDGASAQAAKLSLDGQNIYNGC  202

Query  631  CQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
            C L I FS L  L V YNN++SRDFT P+LP+     + +H
Sbjct  203  CTLRISFSKLTSLNVKYNNEKSRDFTRPDLPTGDSQPTMEH  243



>ref|XP_011495871.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X3 
[Ceratosolen solmsi marchali]
Length=583

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/226 (39%), Positives = 137/226 (61%), Gaps = 29/226 (13%)
 Frame = +1

Query  136  EPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYT  315
            +PS+VIH+RN+ +E+SE +++ L  PFG +T +++L+ KNQA L+M D  +A   + +Y 
Sbjct  68   KPSRVIHIRNIPNEVSEGEIVHLGIPFGRVTNVLVLKGKNQAFLEMADEGAAATMVTYYA  127

Query  316  NVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE--------------------------  417
            +    +R R VY+QFS+H+EL T   +  + G                            
Sbjct  128  SCPAQLRARAVYVQFSNHRELKTDQAHNNAVGSPTNAIANTSNNANVQASNQGPVQGSDT  187

Query  418  ---PNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVS  588
               PN +L V + HM+YPI++++L+Q+F+ +G V KIVTF K+  FQALIQ+    SA +
Sbjct  188  QGGPNTVLRVIVEHMIYPISLDILYQIFTRYGKVLKIVTFTKNNSFQALIQYTDMLSAQT  247

Query  589  ARNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            A+  L G+NIY+ CC L I +S +  L V +NND+SRD+TNP LP+
Sbjct  248  AKFNLDGQNIYNSCCTLRIDYSKMQNLNVKFNNDKSRDYTNPTLPT  293



>ref|XP_006803669.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X2 [Neolamprologus brichardi]
Length=532

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/221 (41%), Positives = 137/221 (62%), Gaps = 16/221 (7%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+VIH+R +  +I+E +++ L  PFG +T L+ML+AKNQA L+M    +A N + +Y+ 
Sbjct  53   PSRVIHIRKLPSDITEAEVISLGVPFGDVTNLLMLKAKNQAFLEMNSEEAAQNLVGYYST  112

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE----------------PNRILLVTIHH  450
            + P IR   VY+QFS+H+EL T +   Q R                   P+ +L V + +
Sbjct  113  MVPIIRHHPVYVQFSNHKELKTDNSPNQERAQAALRALSSSHVDTAAVAPSTVLRVVVEN  172

Query  451  MLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGC  630
            ++YP+T++ L Q+FS  G V +I+ F K+  FQAL+Q+    SA +A+ +L G+NIY+GC
Sbjct  173  LIYPVTLDALCQIFSKFGTVLRIIIFTKNNQFQALLQYPDGASAQAAKLSLDGQNIYNGC  232

Query  631  CQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
            C L I FS L  L V YNN++SRDFT P+LP+     + +H
Sbjct  233  CTLRISFSKLTSLNVKYNNEKSRDFTRPDLPTGDSQPTMEH  273



>ref|XP_005475708.1| PREDICTED: polypyrimidine tract-binding protein 1-like [Oreochromis 
niloticus]
Length=533

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/221 (41%), Positives = 137/221 (62%), Gaps = 16/221 (7%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+VIH+R +  +I+E +++ L  PFG +T L+ML+AKNQA L+M    +A N + +Y+ 
Sbjct  53   PSRVIHIRKLPSDITEAEVISLGVPFGDVTNLLMLKAKNQAFLEMNSEEAAQNLVGYYST  112

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE----------------PNRILLVTIHH  450
            + P IR   VY+QFS+H+EL T +   Q R                   P+ +L V + +
Sbjct  113  MVPIIRHHPVYVQFSNHKELKTDNSPNQERAQAALRALSSSHVDTAAVAPSTVLRVVVEN  172

Query  451  MLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGC  630
            ++YP+T++ L Q+FS  G V +I+ F K+  FQAL+Q+    SA +A+ +L G+NIY+GC
Sbjct  173  LIYPVTLDALCQIFSKFGTVLRIIIFTKNNQFQALLQYSDGASAQAAKLSLDGQNIYNGC  232

Query  631  CQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
            C L I FS L  L V YNN++SRDFT P+LP+     + +H
Sbjct  233  CTLRISFSKLTSLNVKYNNEKSRDFTRPDLPTGDGQPTMEH  273



>ref|XP_006803668.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X1 [Neolamprologus brichardi]
Length=538

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/221 (41%), Positives = 137/221 (62%), Gaps = 16/221 (7%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+VIH+R +  +I+E +++ L  PFG +T L+ML+AKNQA L+M    +A N + +Y+ 
Sbjct  53   PSRVIHIRKLPSDITEAEVISLGVPFGDVTNLLMLKAKNQAFLEMNSEEAAQNLVGYYST  112

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE----------------PNRILLVTIHH  450
            + P IR   VY+QFS+H+EL T +   Q R                   P+ +L V + +
Sbjct  113  MVPIIRHHPVYVQFSNHKELKTDNSPNQERAQAALRALSSSHVDTAAVAPSTVLRVVVEN  172

Query  451  MLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGC  630
            ++YP+T++ L Q+FS  G V +I+ F K+  FQAL+Q+    SA +A+ +L G+NIY+GC
Sbjct  173  LIYPVTLDALCQIFSKFGTVLRIIIFTKNNQFQALLQYPDGASAQAAKLSLDGQNIYNGC  232

Query  631  CQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
            C L I FS L  L V YNN++SRDFT P+LP+     + +H
Sbjct  233  CTLRISFSKLTSLNVKYNNEKSRDFTRPDLPTGDSQPTMEH  273



>ref|XP_004569390.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X1 [Maylandia zebra]
Length=537

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/221 (41%), Positives = 137/221 (62%), Gaps = 16/221 (7%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+VIH+R +  +I+E +++ L  PFG +T L+ML+AKNQA L+M    +A N + +Y+ 
Sbjct  53   PSRVIHIRKLPSDITEAEVISLGVPFGDVTNLLMLKAKNQAFLEMNSEEAAQNLVGYYST  112

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE----------------PNRILLVTIHH  450
            + P IR   VY+QFS+H+EL T +   Q R                   P+ +L V + +
Sbjct  113  MVPIIRHHPVYVQFSNHKELKTDNSPNQERAQAALRALSSSHVDTAAVAPSTVLRVVVEN  172

Query  451  MLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGC  630
            ++YP+T++ L Q+FS  G V +I+ F K+  FQAL+Q+    SA +A+ +L G+NIY+GC
Sbjct  173  LIYPVTLDALCQIFSKFGTVLRIIIFTKNNQFQALLQYPDGASAQAAKLSLDGQNIYNGC  232

Query  631  CQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
            C L I FS L  L V YNN++SRDFT P+LP+     + +H
Sbjct  233  CTLRISFSKLTSLNVKYNNEKSRDFTRPDLPTGDGQPTMEH  273



>ref|XP_009304155.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X2 
[Danio rerio]
Length=518

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/230 (40%), Positives = 138/230 (60%), Gaps = 25/230 (11%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+VIHVR + ++I+E +++ L  PFG +T L+ML+ KNQA L+M    +A   + +Y++
Sbjct  23   PSRVIHVRKLPNDINEAEVIALGLPFGKVTNLLMLKGKNQAFLEMNSEEAAQTMVTYYSS  82

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE-------------------------PN  423
            V P IR   +++Q+S+H+EL T +   Q R                            P+
Sbjct  83   VTPVIRNHPIFMQYSNHKELKTDNSPNQVRAQAALQAVNAVQTGSLTLGGVDPSGMTGPS  142

Query  424  RILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNAL  603
             +L V + ++ YP+T++VLHQ+FS  G V K++TF K+  FQAL+QF    +A  A+ AL
Sbjct  143  PVLRVIVENLFYPVTLDVLHQIFSKFGTVLKVITFTKNNQFQALLQFTDGLTAQHAKLAL  202

Query  604  QGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
             G+NIY+GCC L I FS L  L V YNND+SRD+T P+LP+     + +H
Sbjct  203  DGQNIYNGCCTLRISFSKLTSLNVKYNNDKSRDYTRPDLPTGDSQPALEH  252



>ref|XP_004561995.1| PREDICTED: polypyrimidine tract-binding protein 3-like [Maylandia 
zebra]
Length=491

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/242 (40%), Positives = 140/242 (58%), Gaps = 31/242 (13%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+V+H+R +  ++SE ++L L  PFG +++L+ L+ KNQA L+M    +AV  + +YT+
Sbjct  25   PSRVLHLRQLPPDVSEQEVLSLALPFGRVSQLITLKTKNQAFLEMASEEAAVTMVNYYTS  84

Query  319  VQPSIRGRNVYIQFSSHQELTT------------------------MDQNTQSRGDEPNR  426
              PSIR + VYIQ+S+H+EL T                        M    + RG  P +
Sbjct  85   ATPSIRSQPVYIQYSTHRELKTDNMTNQRAQATLQAMNAGAVHSGNMASGGEGRGIAPGQ  144

Query  427  --ILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNA  600
              +L + + ++ YP+T+EVL Q+FS  G V KI+TF ++  FQAL+QF     A  A+  
Sbjct  145  SPVLRIIVENLFYPVTLEVLQQIFSKFGSVLKIITFTRNNQFQALLQFSDTVHAQHAKAT  204

Query  601  LQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHG-----YGD  765
            L G+NIY+GCC L I FS L  L V YNND+SRDFT  +LPS +   ++  G     YG 
Sbjct  205  LDGQNIYNGCCTLRIDFSKLSVLNVKYNNDKSRDFTRADLPSGELEPAATFGVALPPYGA  264

Query  766  AG  771
            A 
Sbjct  265  AA  266



>ref|XP_005947655.1| PREDICTED: polypyrimidine tract-binding protein 3-like isoform 
X2 [Haplochromis burtoni]
 ref|XP_006782217.1| PREDICTED: polypyrimidine tract-binding protein 3-like [Neolamprologus 
brichardi]
Length=499

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/242 (40%), Positives = 140/242 (58%), Gaps = 31/242 (13%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+V+H+R +  ++SE ++L L  PFG +++L+ L+ KNQA L+M    +AV  + +YT+
Sbjct  25   PSRVLHLRQLPPDVSEQEVLSLALPFGRVSQLITLKTKNQAFLEMASEEAAVTMVNYYTS  84

Query  319  VQPSIRGRNVYIQFSSHQELTT------------------------MDQNTQSRGDEPNR  426
              PSIR + VYIQ+S+H+EL T                        M    + RG  P +
Sbjct  85   ATPSIRSQPVYIQYSTHRELKTDNMTNQRAQATLQAMNAGAVHSGNMASGGEGRGIAPGQ  144

Query  427  --ILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNA  600
              +L + + ++ YP+T+EVL Q+FS  G V KI+TF ++  FQAL+QF     A  A+  
Sbjct  145  SPVLRIIVENLFYPVTLEVLQQIFSKFGSVLKIITFTRNNQFQALLQFSDTVHAQHAKAT  204

Query  601  LQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHG-----YGD  765
            L G+NIY+GCC L I FS L  L V YNND+SRDFT  +LPS +   ++  G     YG 
Sbjct  205  LDGQNIYNGCCTLRIDFSKLSVLNVKYNNDKSRDFTRADLPSGELEPAATFGVALPPYGA  264

Query  766  AG  771
            A 
Sbjct  265  AA  266



>ref|XP_004569391.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 
X2 [Maylandia zebra]
Length=536

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/221 (41%), Positives = 137/221 (62%), Gaps = 16/221 (7%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+VIH+R +  +I+E +++ L  PFG +T L+ML+AKNQA L+M    +A N + +Y+ 
Sbjct  52   PSRVIHIRKLPSDITEAEVISLGVPFGDVTNLLMLKAKNQAFLEMNSEEAAQNLVGYYST  111

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE----------------PNRILLVTIHH  450
            + P IR   VY+QFS+H+EL T +   Q R                   P+ +L V + +
Sbjct  112  MVPIIRHHPVYVQFSNHKELKTDNSPNQERAQAALRALSSSHVDTAAVAPSTVLRVVVEN  171

Query  451  MLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNIYDGC  630
            ++YP+T++ L Q+FS  G V +I+ F K+  FQAL+Q+    SA +A+ +L G+NIY+GC
Sbjct  172  LIYPVTLDALCQIFSKFGTVLRIIIFTKNNQFQALLQYPDGASAQAAKLSLDGQNIYNGC  231

Query  631  CQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
            C L I FS L  L V YNN++SRDFT P+LP+     + +H
Sbjct  232  CTLRISFSKLTSLNVKYNNEKSRDFTRPDLPTGDGQPTMEH  272



>ref|XP_005155995.1| PREDICTED: polypyrimidine tract-binding protein 1 isoform X1 
[Danio rerio]
Length=547

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/230 (40%), Positives = 138/230 (60%), Gaps = 25/230 (11%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+VIHVR + ++I+E +++ L  PFG +T L+ML+ KNQA L+M    +A   + +Y++
Sbjct  52   PSRVIHVRKLPNDINEAEVIALGLPFGKVTNLLMLKGKNQAFLEMNSEEAAQTMVTYYSS  111

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE-------------------------PN  423
            V P IR   +++Q+S+H+EL T +   Q R                            P+
Sbjct  112  VTPVIRNHPIFMQYSNHKELKTDNSPNQVRAQAALQAVNAVQTGSLTLGGVDPSGMTGPS  171

Query  424  RILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNAL  603
             +L V + ++ YP+T++VLHQ+FS  G V K++TF K+  FQAL+QF    +A  A+ AL
Sbjct  172  PVLRVIVENLFYPVTLDVLHQIFSKFGTVLKVITFTKNNQFQALLQFTDGLTAQHAKLAL  231

Query  604  QGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
             G+NIY+GCC L I FS L  L V YNND+SRD+T P+LP+     + +H
Sbjct  232  DGQNIYNGCCTLRISFSKLTSLNVKYNNDKSRDYTRPDLPTGDSQPALEH  281



>ref|XP_005748480.1| PREDICTED: polypyrimidine tract-binding protein 3-like [Pundamilia 
nyererei]
Length=499

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/242 (40%), Positives = 140/242 (58%), Gaps = 31/242 (13%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+V+H+R +  ++SE ++L L  PFG +++L+ L+ KNQA L+M    +AV  + +YT+
Sbjct  25   PSRVLHLRQLPPDVSEQEVLSLALPFGRVSQLITLKTKNQAFLEMASEEAAVTMVNYYTS  84

Query  319  VQPSIRGRNVYIQFSSHQELTT------------------------MDQNTQSRGDEPNR  426
              PSIR + VYIQ+S+H+EL T                        M    + RG  P +
Sbjct  85   ATPSIRSQPVYIQYSTHRELKTDNMTNQRAQATLQAMNAGAVHSGNMASGGEGRGIAPGQ  144

Query  427  --ILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNA  600
              +L + + ++ YP+T+EVL Q+FS  G V KI+TF ++  FQAL+QF     A  A+  
Sbjct  145  SPVLRIIVENLFYPVTLEVLQQIFSKFGSVLKIITFTRNNQFQALLQFSDTVHAQHAKAT  204

Query  601  LQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHG-----YGD  765
            L G+NIY+GCC L I FS L  L V YNND+SRDFT  +LPS +   ++  G     YG 
Sbjct  205  LDGQNIYNGCCTLRIDFSKLSVLNVKYNNDKSRDFTRADLPSGELEPAATFGVALPPYGA  264

Query  766  AG  771
            A 
Sbjct  265  AA  266



>gb|KFZ65284.1| Polypyrimidine tract-binding protein 2, partial [Podiceps cristatus]
Length=269

 Score =   174 bits (442),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/225 (39%), Positives = 135/225 (60%), Gaps = 31/225 (14%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+V+H+R +  E++E +++ L  PFG +T ++ML+ KNQA L++    +A+  + +Y+ 
Sbjct  23   PSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSA  82

Query  319  VQPSIRGRNVYIQFSSHQEL-----------------------------TTMDQNTQSRG  411
            V P +R + +YIQ+S+H+EL                             TT+ ++  +  
Sbjct  83   VTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAVQATNAPISGTTVSESAVTPA  142

Query  412  DEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSA  591
              P  +L + I +M YP+T++VLHQ+FS  G V KI+TF K+  FQAL+QF    +A  A
Sbjct  143  QSP--VLRIIIDNMYYPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQFGDPVNAQQA  200

Query  592  RNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            + AL G+NIY+ CC L I FS L  L V YNND+SRD+T P+LPS
Sbjct  201  KLALDGQNIYNACCTLRIDFSKLVNLNVKYNNDKSRDYTRPDLPS  245



>ref|NP_001116126.1| polypyrimidine tract-binding protein 1 [Danio rerio]
Length=564

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/230 (40%), Positives = 138/230 (60%), Gaps = 25/230 (11%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+VIHVR + ++I+E +++ L  PFG +T L+ML+ KNQA L+M    +A   + +Y++
Sbjct  69   PSRVIHVRKLPNDINEAEVIALGLPFGKVTNLLMLKGKNQAFLEMNSEEAAQTMVTYYSS  128

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE-------------------------PN  423
            V P IR   +++Q+S+H+EL T +   Q R                            P+
Sbjct  129  VTPVIRNHPIFMQYSNHKELKTDNSPNQVRAQAALQAVNAVQTGSLTLGGVDPSGMTGPS  188

Query  424  RILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNAL  603
             +L V + ++ YP+T++VLHQ+FS  G V K++TF K+  FQAL+QF    +A  A+ AL
Sbjct  189  PVLRVIVENLFYPVTLDVLHQIFSKFGTVLKVITFTKNNQFQALLQFTDGLTAQHAKLAL  248

Query  604  QGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
             G+NIY+GCC L I FS L  L V YNND+SRD+T P+LP+     + +H
Sbjct  249  DGQNIYNGCCTLRISFSKLTSLNVKYNNDKSRDYTRPDLPTGDSQPALEH  298



>ref|XP_005462343.1| PREDICTED: polypyrimidine tract-binding protein 2-like isoform 
X3 [Oreochromis niloticus]
Length=380

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 94/216 (44%), Positives = 130/216 (60%), Gaps = 20/216 (9%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+VIH+R + +E SE +++ L  PFG +T ++ L+ KNQA L+M    +AV  + +Y+ 
Sbjct  51   PSRVIHIRKLPNEASEAEVIALGLPFGKVTNILTLKGKNQAFLEMGTEEAAVTMVNYYSK  110

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQN------------TQSRGDEPNRILL--------V  438
            V P IR   V+IQ+S+H+EL T   N             QS G E   +L         +
Sbjct  111  VTPLIRNIQVFIQYSNHKELKTDAANQRTQAVLQAVSAAQSPGSEVQEVLAAVSSPVLRI  170

Query  439  TIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNI  618
             I +M YP+T++VL Q+FS  G V KI+TF K+  FQAL+QF    SA  A+ AL G+NI
Sbjct  171  IIDNMFYPVTLDVLQQIFSKFGTVMKIITFTKNNQFQALLQFSDPVSAQQAKLALDGQNI  230

Query  619  YDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            Y+ CC L I FS L  L V YNND+SRD+T P LP+
Sbjct  231  YNSCCTLRIDFSKLVNLNVKYNNDKSRDYTRPELPA  266



>ref|XP_009019582.1| hypothetical protein HELRODRAFT_94426 [Helobdella robusta]
 gb|ESO02174.1| hypothetical protein HELRODRAFT_94426 [Helobdella robusta]
Length=546

 Score =   181 bits (458),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/243 (42%), Positives = 154/243 (63%), Gaps = 27/243 (11%)
 Frame = +1

Query  118  RPLKM----TEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVP  285
            + LKM     +PS+V+H+R V +++S+ +++QL   FG I+ LV+ + KNQAL++M D+ 
Sbjct  26   KKLKMEVNVNKPSRVVHLRGVPNDVSDVEIVQLALSFGRISNLVVSKKKNQALVEMMDIA  85

Query  286  SAVNALQFYTNVQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDEPN-------------R  426
            +A   +Q+Y    PSIR R V++QFS++++L T  +NT+ + D  N              
Sbjct  86   AAQAMVQYYGEHPPSIRKRVVHVQFSTYEKLKT--ENTRFQDDMSNLTDQLVLGMDENRT  143

Query  427  ILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQ  606
            +L V I +MLYP+TV++L  +FS +G V +IVT+ K+  FQALI++    SA S   AL 
Sbjct  144  VLRVIIDNMLYPVTVDILKLIFSKYGQVLRIVTYNKNNSFQALIEYADGISAKSGLTALN  203

Query  607  GRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS-------EQKG-KSSQHGYG  762
            G+NIY+GCC L I +S+L+ LQV YNN+++ D+T+PNLPS       EQ G   + HG G
Sbjct  204  GQNIYNGCCTLRIDYSHLETLQVKYNNEKTYDYTDPNLPSGPMASVGEQMGILDTPHGDG  263

Query  763  DAG  771
              G
Sbjct  264  ILG  266



>gb|AAH91854.1| Ptbp1b protein [Danio rerio]
Length=586

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/230 (40%), Positives = 138/230 (60%), Gaps = 25/230 (11%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+VIHVR + ++I+E +++ L  PFG +T L+ML+ KNQA L+M    +A   + +Y++
Sbjct  91   PSRVIHVRKLPNDINEAEVIALGLPFGKVTNLLMLKGKNQAFLEMNSEEAAQTMVTYYSS  150

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE-------------------------PN  423
            V P IR   +++Q+S+H+EL T +   Q R                            P+
Sbjct  151  VTPVIRNHPIFMQYSNHKELKTDNSPNQVRAQAALQAVNAVQTGSLTLGGVDPSGMTGPS  210

Query  424  RILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNAL  603
             +L V + ++ YP+T++VLHQ+FS  G V K++TF K+  FQAL+QF    +A  A+ AL
Sbjct  211  PVLRVIVENLFYPVTLDVLHQIFSKFGTVLKVITFTKNNQFQALLQFTDGLTAQHAKLAL  270

Query  604  QGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH  753
             G+NIY+GCC L I FS L  L V YNND+SRD+T P+LP+     + +H
Sbjct  271  DGQNIYNGCCTLRISFSKLTSLNVKYNNDKSRDYTRPDLPTGDSQPALEH  320



>ref|XP_005947654.1| PREDICTED: polypyrimidine tract-binding protein 3-like isoform 
X1 [Haplochromis burtoni]
Length=582

 Score =   181 bits (458),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 96/242 (40%), Positives = 140/242 (58%), Gaps = 31/242 (13%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+V+H+R +  ++SE ++L L  PFG +++L+ L+ KNQA L+M    +AV  + +YT+
Sbjct  108  PSRVLHLRQLPPDVSEQEVLSLALPFGRVSQLITLKTKNQAFLEMASEEAAVTMVNYYTS  167

Query  319  VQPSIRGRNVYIQFSSHQELTT------------------------MDQNTQSRGDEPNR  426
              PSIR + VYIQ+S+H+EL T                        M    + RG  P +
Sbjct  168  ATPSIRSQPVYIQYSTHRELKTDNMTNQRAQATLQAMNAGAVHSGNMASGGEGRGIAPGQ  227

Query  427  --ILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNA  600
              +L + + ++ YP+T+EVL Q+FS  G V KI+TF ++  FQAL+QF     A  A+  
Sbjct  228  SPVLRIIVENLFYPVTLEVLQQIFSKFGSVLKIITFTRNNQFQALLQFSDTVHAQHAKAT  287

Query  601  LQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHG-----YGD  765
            L G+NIY+GCC L I FS L  L V YNND+SRDFT  +LPS +   ++  G     YG 
Sbjct  288  LDGQNIYNGCCTLRIDFSKLSVLNVKYNNDKSRDFTRADLPSGELEPAATFGVALPPYGA  347

Query  766  AG  771
            A 
Sbjct  348  AA  349



>ref|XP_005808441.1| PREDICTED: polypyrimidine tract-binding protein 1-like [Xiphophorus 
maculatus]
Length=496

 Score =   179 bits (455),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 97/245 (40%), Positives = 143/245 (58%), Gaps = 30/245 (12%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+VIH+R +  +I+E +++ L  PFG +T L+ML+AKNQA L+M    +A N + +Y+ 
Sbjct  23   PSRVIHIRKLPSDITEAEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQNMVGYYST  82

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQ---------------------SRGD----EPN  423
            + P IR + VY+QFS+H+EL T +   Q                     S  D     P+
Sbjct  83   MMPVIRHQPVYLQFSNHKELKTDNSPNQEVTPALSPVCWAQAALRALSSSHVDTLMAAPS  142

Query  424  RILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNAL  603
             +L V + ++LYP+T++ L Q+FS  G V +I+ F K+  FQAL+QF    SA +A+  L
Sbjct  143  TVLRVVVENLLYPVTLDALCQIFSKFGTVLRIIIFTKNNQFQALLQFSDGSSAQAAKLTL  202

Query  604  QGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQH-----GYGDA  768
             G+NIY+GCC L I FS L  L V YNN++SRDFT P+LPS     + +H      +G  
Sbjct  203  DGQNIYNGCCTLRISFSKLTSLNVKYNNEKSRDFTRPDLPSGDSQPALEHPAMAAAFGKD  262

Query  769  GGMYS  783
            G + S
Sbjct  263  GPLSS  267



>ref|XP_007542687.1| PREDICTED: polypyrimidine tract-binding protein 3 isoform X3 
[Poecilia formosa]
Length=498

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/237 (39%), Positives = 136/237 (57%), Gaps = 23/237 (10%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS V+H+R +  + SE +++ L  PFG ++KL+ LR KNQA L+M    +AV  + +Y +
Sbjct  25   PSPVLHLRQLPADTSEQEVVDLALPFGRVSKLITLRTKNQAFLEMASEEAAVTMVNYYAS  84

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRG-----------------------DEPNRI  429
              P+IR + V+IQ+S+H+EL T +   Q R                          P+ +
Sbjct  85   APPTIRNQPVFIQYSTHRELKTDNLTNQQRALQAISTAAVHSGSLASSEGRGLIPAPSAV  144

Query  430  LLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQG  609
            L + + ++ YP+T+EVL Q+FS  G V KI+TF ++  FQAL+QF     A  A+ +L G
Sbjct  145  LRIIVENLFYPVTLEVLQQIFSKFGSVLKIITFTRNNQFQALLQFSDAVHAQHAKASLDG  204

Query  610  RNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMY  780
            +NIY+GCC L I FS L  L V YNND+SRDFT  +LPS +   +    +G A   Y
Sbjct  205  QNIYNGCCTLRIDFSKLSALNVKYNNDKSRDFTRADLPSGELDPAGAAAFGVALPPY  261



>ref|XP_004572121.1| PREDICTED: polypyrimidine tract-binding protein 2-like isoform 
X4 [Maylandia zebra]
Length=447

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/216 (44%), Positives = 130/216 (60%), Gaps = 20/216 (9%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+VIH+R + +E SE +++ L  PFG +T ++ L+ KNQA L+M    +AV  + +Y+ 
Sbjct  51   PSRVIHIRKLPNEASETEVIALGLPFGKVTNILTLKGKNQAFLEMGTEEAAVTMVNYYSK  110

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQN------------TQSRGDEPNRILL--------V  438
            V P IR   V+IQ+S+H+EL T   N             QS G E   +L         +
Sbjct  111  VTPLIRNIQVFIQYSNHKELKTDAANQRTQAVLQAVSAAQSPGSEVQEVLAAVSSPVLRI  170

Query  439  TIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNALQGRNI  618
             I +M YP+T++VL Q+FS  G V KI+TF K+  FQAL+QF    SA  A+ AL G+NI
Sbjct  171  IIDNMFYPVTLDVLQQIFSKFGTVMKIITFTKNNQFQALLQFSDPVSAQQAKLALDGQNI  230

Query  619  YDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            Y+ CC L I FS L  L V YNND+SRD+T P LP+
Sbjct  231  YNSCCTLRIDFSKLVNLNVKYNNDKSRDYTRPELPA  266



>gb|KFQ80980.1| Polypyrimidine tract-binding protein 2, partial [Phoenicopterus 
ruber ruber]
Length=290

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/225 (39%), Positives = 135/225 (60%), Gaps = 31/225 (14%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+V+H+R +  E++E +++ L  PFG +T ++ML+ KNQA L++    +A+  + +Y+ 
Sbjct  44   PSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSA  103

Query  319  VQPSIRGRNVYIQFSSHQEL-----------------------------TTMDQNTQSRG  411
            V P +R + +YIQ+S+H+EL                             TT+ ++  +  
Sbjct  104  VTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAVQATNAPISGTTVSESAVTPA  163

Query  412  DEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSA  591
              P  +L + I +M YP+T++VLHQ+FS  G V KI+TF K+  FQAL+Q+    +A  A
Sbjct  164  QSP--VLRIIIDNMYYPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQA  221

Query  592  RNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            + AL G+NIY+ CC L I FS L  L V YNND+SRD+T P+LPS
Sbjct  222  KLALDGQNIYNACCTLRIDFSKLVNLNVKYNNDKSRDYTRPDLPS  266



>ref|XP_007240255.1| PREDICTED: polypyrimidine tract-binding protein 1 [Astyanax mexicanus]
Length=566

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/240 (38%), Positives = 141/240 (59%), Gaps = 26/240 (11%)
 Frame = +1

Query  139  PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAVNALQFYTN  318
            PS+VIHVR +  +I+E +++ L  PFG +T L+ML+ KNQA L+M    +A   + +Y++
Sbjct  69   PSRVIHVRKLPSDINEAEVISLGLPFGKVTNLLMLKGKNQAFLEMNTEEAAQTMVSYYSS  128

Query  319  VQPSIRGRNVYIQFSSHQELTTMDQNTQSRGDE-------------------------PN  423
            V P IR   +++Q+S+H+EL T +   Q R                            P+
Sbjct  129  VTPVIRNHPIFMQYSNHKELKTDNSPNQVRAQAALQAVNAVQTGSMAIAGVDPSGVTGPS  188

Query  424  RILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSARNAL  603
             +L V + ++ YP+T++VLHQ+FS  G V K++TF K+  FQAL+QF    +A  A+ AL
Sbjct  189  PVLRVIVENLFYPVTLDVLHQIFSKFGTVLKVITFTKNNQFQALLQFADGLTAQHAKLAL  248

Query  604  QGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPSEQKGKSSQHGYGDAGGMYS  783
             G+NIY+ CC L I FS L  L V YNND+SRD+T P+LP+     + +H +  AG  ++
Sbjct  249  DGQNIYNACCTLRISFSKLTSLNVKYNNDKSRDYTRPDLPTGDSQPAIEH-HAMAGAAFA  307



>ref|XP_004572120.1| PREDICTED: polypyrimidine tract-binding protein 2-like isoform 
X3 [Maylandia zebra]
Length=461

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/225 (43%), Positives = 135/225 (60%), Gaps = 22/225 (10%)
 Frame = +1

Query  118  RPLKMTE--PSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSA  291
            + L++ E  PS+VIH+R + +E SE +++ L  PFG +T ++ L+ KNQA L+M    +A
Sbjct  42   KKLRVEEALPSRVIHIRKLPNEASETEVIALGLPFGKVTNILTLKGKNQAFLEMGTEEAA  101

Query  292  VNALQFYTNVQPSIRGRNVYIQFSSHQELTTMDQN------------TQSRGDEPNRILL  435
            V  + +Y+ V P IR   V+IQ+S+H+EL T   N             QS G E   +L 
Sbjct  102  VTMVNYYSKVTPLIRNIQVFIQYSNHKELKTDAANQRTQAVLQAVSAAQSPGSEVQEVLA  161

Query  436  --------VTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQFQTNQSAVSA  591
                    + I +M YP+T++VL Q+FS  G V KI+TF K+  FQAL+QF    SA  A
Sbjct  162  AVSSPVLRIIIDNMFYPVTLDVLQQIFSKFGTVMKIITFTKNNQFQALLQFSDPVSAQQA  221

Query  592  RNALQGRNIYDGCCQLDIQFSNLDELQVNYNNDRSRDFTNPNLPS  726
            + AL G+NIY+ CC L I FS L  L V YNND+SRD+T P LP+
Sbjct  222  KLALDGQNIYNSCCTLRIDFSKLVNLNVKYNNDKSRDYTRPELPA  266



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1572839714856