BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3535

Length=757
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009596634.1|  PREDICTED: polyol transporter 5-like               311   5e-99   Nicotiana tomentosiformis
ref|XP_009766648.1|  PREDICTED: polyol transporter 5-like               308   5e-98   Nicotiana sylvestris
ref|XP_008350306.1|  PREDICTED: putative polyol transporter 1           295   4e-96   
ref|XP_011092774.1|  PREDICTED: polyol transporter 5-like               298   3e-94   Sesamum indicum [beniseed]
gb|KHN39768.1|  Polyol transporter 5                                    298   5e-94   Glycine soja [wild soybean]
ref|XP_009345075.1|  PREDICTED: putative polyol transporter 1           298   5e-94   Pyrus x bretschneideri [bai li]
ref|XP_009800568.1|  PREDICTED: polyol transporter 5-like               297   8e-94   Nicotiana sylvestris
ref|XP_004507415.1|  PREDICTED: polyol transporter 5-like               296   2e-93   Cicer arietinum [garbanzo]
ref|XP_009611551.1|  PREDICTED: polyol transporter 5-like               296   3e-93   Nicotiana tomentosiformis
emb|CAP58706.1|  putative polyol transporter protein 1                  295   4e-93   Hevea brasiliensis [jebe]
ref|NP_001281033.1|  polyol transporter 5-like                          295   6e-93   Malus domestica [apple tree]
gb|ACB56939.1|  mannitol transporter                                    293   2e-92   Artemisia annua [sweet Annie]
gb|ABK29439.1|  sugar transport protein                                 293   2e-92   Coffea canephora [robusta coffee]
emb|CDO97075.1|  unnamed protein product                                293   3e-92   Coffea canephora [robusta coffee]
ref|XP_008387370.1|  PREDICTED: putative polyol transporter 1           293   4e-92   Malus domestica [apple tree]
gb|KEH30426.1|  polyol/monosaccharide transporter 1                     292   6e-92   Medicago truncatula
ref|XP_003541068.1|  PREDICTED: polyol transporter 5-like               292   6e-92   
ref|NP_001287655.1|  polyol transporter 5-like                          293   6e-92   Solanum lycopersicum
ref|XP_009344431.1|  PREDICTED: putative polyol transporter 1           292   8e-92   Pyrus x bretschneideri [bai li]
gb|AGG19155.1|  sorbitol transporter                                    292   8e-92   Pyrus pyrifolia [sha li]
ref|XP_009375627.1|  PREDICTED: putative polyol transporter 1           292   9e-92   Pyrus x bretschneideri [bai li]
ref|XP_004299107.1|  PREDICTED: polyol transporter 5-like               292   1e-91   Fragaria vesca subsp. vesca
ref|XP_008387369.1|  PREDICTED: putative polyol transporter 1 iso...    292   1e-91   
ref|XP_002519083.1|  sugar transporter, putative                        291   2e-91   Ricinus communis
gb|AFI61955.1|  polyol transporter                                      291   2e-91   Camellia sinensis [black tea]
ref|XP_006365518.1|  PREDICTED: polyol transporter 5-like               292   2e-91   Solanum tuberosum [potatoes]
ref|XP_009344433.1|  PREDICTED: putative polyol transporter 1           291   2e-91   Pyrus x bretschneideri [bai li]
ref|XP_012069681.1|  PREDICTED: putative polyol transporter 1           291   3e-91   Jatropha curcas
gb|ACC61047.1|  mannitol transporter                                    286   3e-91   Gossypium hirsutum [American cotton]
ref|XP_007200585.1|  hypothetical protein PRUPE_ppa007633mg             285   5e-91   
emb|CAJ29291.1|  putative polyol transporter protein 4                  289   7e-91   Lotus japonicus
emb|CAP58707.1|  putative polyol transported protein 2                  290   1e-90   Hevea brasiliensis [jebe]
ref|XP_012069657.1|  PREDICTED: putative polyol transporter 1           290   1e-90   Jatropha curcas
ref|XP_009375628.1|  PREDICTED: putative polyol transporter 1           289   1e-90   Pyrus x bretschneideri [bai li]
ref|XP_008393068.1|  PREDICTED: putative polyol transporter 1           289   2e-90   Malus domestica [apple tree]
gb|EPS69995.1|  sugar transport protein                                 288   2e-90   Genlisea aurea
gb|KHN25361.1|  Polyol transporter 5                                    288   3e-90   Glycine soja [wild soybean]
gb|KHG20989.1|  Polyol transporter 5 -like protein                      288   4e-90   Gossypium arboreum [tree cotton]
ref|XP_003539021.2|  PREDICTED: polyol transporter 5-like               280   6e-90   
gb|KJB32189.1|  hypothetical protein B456_005G228500                    286   2e-89   Gossypium raimondii
ref|XP_007131851.1|  hypothetical protein PHAVU_011G046700g             285   3e-89   Phaseolus vulgaris [French bean]
gb|KFK30307.1|  hypothetical protein AALP_AA7G244900                    284   8e-89   Arabis alpina [alpine rockcress]
gb|AAM44082.1|  putative sorbitol transporter                           285   9e-89   Prunus cerasus [pie cherry]
ref|XP_006406559.1|  hypothetical protein EUTSA_v10020495mg             284   1e-88   Eutrema salsugineum [saltwater cress]
ref|XP_007042744.1|  Polyol/monosaccharide transporter 5                283   2e-88   
ref|XP_008236795.1|  PREDICTED: polyol transporter 5-like               283   2e-88   Prunus mume [ume]
ref|XP_006423215.1|  hypothetical protein CICLE_v10028170mg             283   3e-88   Citrus clementina [clementine]
ref|XP_008795608.1|  PREDICTED: putative polyol transporter 1           283   3e-88   Phoenix dactylifera
ref|XP_004148857.1|  PREDICTED: polyol transporter 5-like               283   4e-88   Cucumis sativus [cucumbers]
gb|AAT06053.2|  sorbitol transporter                                    282   5e-88   Malus domestica [apple tree]
gb|AGY96955.1|  polyol transporter 1                                    282   8e-88   Vitis vinifera
ref|XP_007131850.1|  hypothetical protein PHAVU_011G046600g             281   1e-87   Phaseolus vulgaris [French bean]
ref|XP_003631630.1|  PREDICTED: polyol transporter 5                    281   1e-87   Vitis vinifera
ref|NP_001289249.1|  polyol transporter 5-like                          281   1e-87   Pyrus x bretschneideri [bai li]
gb|ACB86853.1|  mannitol transporter                                    281   1e-87   Citrus sinensis [apfelsine]
ref|XP_010065409.1|  PREDICTED: polyol transporter 5-like               281   2e-87   Eucalyptus grandis [rose gum]
ref|XP_006487182.1|  PREDICTED: polyol transporter 5-like               280   3e-87   Citrus sinensis [apfelsine]
ref|XP_004148312.2|  PREDICTED: polyol transporter 5-like               280   3e-87   Cucumis sativus [cucumbers]
ref|XP_009112300.1|  PREDICTED: polyol transporter 5                    280   4e-87   Brassica rapa
emb|CDX95491.1|  BnaC01g33830D                                          280   4e-87   
ref|NP_001236592.1|  sorbitol-like transporter                          280   4e-87   
ref|XP_010527590.1|  PREDICTED: polyol transporter 5-like               280   4e-87   Tarenaya hassleriana [spider flower]
emb|CDY61985.1|  BnaC03g73840D                                          279   1e-86   Brassica napus [oilseed rape]
ref|XP_010096202.1|  Polyol transporter 5                               279   1e-86   Morus notabilis
ref|XP_009135601.1|  PREDICTED: polyol transporter 5                    279   1e-86   Brassica rapa
ref|XP_010909852.1|  PREDICTED: putative polyol transporter 1           278   2e-86   Elaeis guineensis
emb|CDP10064.1|  unnamed protein product                                278   2e-86   Coffea canephora [robusta coffee]
ref|XP_002313809.1|  putative sorbitol transporter family protein       278   3e-86   Populus trichocarpa [western balsam poplar]
gb|AAY86779.1|  putative sugar transporter protein                      268   4e-86   Noccaea caerulescens
ref|XP_007135989.1|  hypothetical protein PHAVU_009G008900g             277   4e-86   Phaseolus vulgaris [French bean]
ref|XP_009345071.1|  PREDICTED: putative polyol transporter 1           277   5e-86   Pyrus x bretschneideri [bai li]
ref|XP_008361285.1|  PREDICTED: putative polyol transporter 1           277   6e-86   
ref|XP_011078883.1|  PREDICTED: polyol transporter 5-like isoform X1    277   7e-86   Sesamum indicum [beniseed]
ref|XP_009375822.1|  PREDICTED: putative polyol transporter 1           276   8e-86   Pyrus x bretschneideri [bai li]
ref|NP_001280902.1|  putative polyol transporter 1                      276   1e-85   Malus domestica [apple tree]
ref|XP_010065405.1|  PREDICTED: polyol transporter 5-like               276   1e-85   Eucalyptus grandis [rose gum]
ref|XP_011048787.1|  PREDICTED: polyol transporter 5-like               276   1e-85   Populus euphratica
gb|EMS55536.1|  Polyol transporter 5                                    275   2e-85   Triticum urartu
gb|KJB12315.1|  hypothetical protein B456_002G011400                    275   3e-85   Gossypium raimondii
emb|CAD58709.1|  polyol transporter                                     275   4e-85   Plantago major [cart-track plant]
ref|XP_004300990.1|  PREDICTED: polyol transporter 5-like               275   5e-85   Fragaria vesca subsp. vesca
ref|XP_008387377.1|  PREDICTED: putative polyol transporter 1           274   6e-85   
ref|XP_009121242.1|  PREDICTED: putative polyol transporter 1           265   6e-85   
gb|KCW55335.1|  hypothetical protein EUGRSUZ_I01255                     272   9e-85   Eucalyptus grandis [rose gum]
ref|XP_010690917.1|  PREDICTED: polyol transporter 5 isoform X2         274   1e-84   
ref|XP_009407915.1|  PREDICTED: putative polyol transporter 1           273   1e-84   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008345143.1|  PREDICTED: polyol transporter 5-like               273   1e-84   Malus domestica [apple tree]
ref|XP_008387376.1|  PREDICTED: putative polyol transporter 1           273   2e-84   
ref|XP_011088358.1|  PREDICTED: polyol transporter 5-like               273   2e-84   Sesamum indicum [beniseed]
gb|AEX55225.1|  sugar transporter                                       273   2e-84   Allium sativum
ref|XP_010690916.1|  PREDICTED: polyol transporter 5 isoform X1         273   2e-84   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006577924.1|  PREDICTED: polyol transporter 5-like               272   2e-84   Glycine max [soybeans]
ref|XP_006423216.1|  hypothetical protein CICLE_v10028174mg             273   3e-84   Citrus clementina [clementine]
ref|XP_008236860.1|  PREDICTED: putative polyol transporter 1           272   4e-84   Prunus mume [ume]
ref|XP_006487181.1|  PREDICTED: polyol transporter 5-like               272   4e-84   Citrus sinensis [apfelsine]
dbj|BAJ85302.1|  predicted protein                                      273   5e-84   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_012069670.1|  PREDICTED: polyol transporter 5-like               271   5e-84   Jatropha curcas
ref|XP_010028575.1|  PREDICTED: polyol transporter 5-like               272   5e-84   Eucalyptus grandis [rose gum]
ref|XP_006856084.1|  PREDICTED: polyol transporter 5                    271   6e-84   Amborella trichopoda
gb|AAO39267.1|AF482011_1  sorbitol transporter                          271   6e-84   Prunus cerasus [pie cherry]
ref|XP_006349557.1|  PREDICTED: polyol transporter 5-like               271   7e-84   Solanum tuberosum [potatoes]
ref|XP_009344435.1|  PREDICTED: putative polyol transporter 1           271   8e-84   Pyrus x bretschneideri [bai li]
dbj|BAM66295.1|  sorbitol transporter                                   269   1e-83   Pyrus pyrifolia [sha li]
ref|XP_009395604.1|  PREDICTED: putative polyol transporter 1           271   2e-83   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ85869.1|  unknown                                                 268   2e-83   Medicago truncatula
ref|XP_003603886.1|  Mannitol transporter                               270   2e-83   Medicago truncatula
ref|XP_010527594.1|  PREDICTED: polyol transporter 5-like isoform X4    270   2e-83   Tarenaya hassleriana [spider flower]
gb|AIU41385.1|  sorbitol transporter 1                                  270   2e-83   Prunus salicina [Japanese plum]
ref|XP_009602627.1|  PREDICTED: polyol transporter 5-like               270   2e-83   Nicotiana tomentosiformis
ref|XP_010527591.1|  PREDICTED: polyol transporter 5-like isoform X1    270   3e-83   Tarenaya hassleriana [spider flower]
ref|XP_007199793.1|  hypothetical protein PRUPE_ppa004456mg             270   3e-83   Prunus persica
ref|XP_009375629.1|  PREDICTED: polyol transporter 5-like               269   3e-83   Pyrus x bretschneideri [bai li]
gb|AGG19156.1|  sorbitol transporter                                    269   3e-83   Pyrus pyrifolia [sha li]
ref|XP_004500821.1|  PREDICTED: polyol transporter 5-like               270   3e-83   Cicer arietinum [garbanzo]
ref|XP_010527593.1|  PREDICTED: polyol transporter 5-like isoform X3    270   3e-83   Tarenaya hassleriana [spider flower]
ref|XP_009344434.1|  PREDICTED: polyol transporter 5-like               269   3e-83   Pyrus x bretschneideri [bai li]
ref|XP_008447049.1|  PREDICTED: polyol transporter 5                    269   4e-83   Cucumis melo [Oriental melon]
ref|XP_007199207.1|  hypothetical protein PRUPE_ppa021762mg             270   4e-83   Prunus persica
ref|XP_008387373.1|  PREDICTED: putative polyol transporter 1           270   4e-83   
emb|CBI32562.3|  unnamed protein product                                264   4e-83   Vitis vinifera
ref|XP_006349565.1|  PREDICTED: polyol transporter 5-like               269   4e-83   Solanum tuberosum [potatoes]
ref|XP_011078884.1|  PREDICTED: polyol transporter 5-like isoform X2    269   6e-83   Sesamum indicum [beniseed]
ref|XP_010468639.1|  PREDICTED: putative polyol transporter 2           268   7e-83   Camelina sativa [gold-of-pleasure]
gb|EMT15230.1|  Polyol transporter 5                                    269   8e-83   
ref|XP_010527592.1|  PREDICTED: polyol transporter 5-like isoform X2    269   8e-83   Tarenaya hassleriana [spider flower]
gb|AAL85876.2|AF480069_1  mannitol transporter                          269   8e-83   Apium graveolens Dulce Group [celery]
ref|XP_010516958.1|  PREDICTED: putative polyol transporter 2           268   9e-83   Camelina sativa [gold-of-pleasure]
ref|XP_008236796.1|  PREDICTED: polyol transporter 5-like               268   1e-82   Prunus mume [ume]
ref|NP_001281036.1|  polyol transporter 5-like                          267   1e-82   Malus domestica [apple tree]
ref|NP_188513.1|  polyol transporter 5                                  268   2e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006409469.1|  hypothetical protein EUTSA_v10023129mg             267   2e-82   Eutrema salsugineum [saltwater cress]
ref|XP_006299557.1|  hypothetical protein CARUB_v10015731mg             267   2e-82   Capsella rubella
ref|XP_011037561.1|  PREDICTED: polyol transporter 5                    268   2e-82   Populus euphratica
dbj|BAM66296.1|  sorbitol transporter                                   265   3e-82   Pyrus pyrifolia [sha li]
ref|XP_008236773.1|  PREDICTED: putative polyol transporter 1           267   3e-82   Prunus mume [ume]
ref|XP_010442448.1|  PREDICTED: putative polyol transporter 2           266   4e-82   Camelina sativa [gold-of-pleasure]
gb|KJB12316.1|  hypothetical protein B456_002G011500                    267   4e-82   Gossypium raimondii
ref|XP_002886203.1|  hypothetical protein ARALYDRAFT_343514             266   5e-82   Arabidopsis lyrata subsp. lyrata
ref|NP_179209.1|  polyol/monosaccharide transporter 1                   266   5e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002305419.2|  hypothetical protein POPTR_0004s15960g             266   6e-82   Populus trichocarpa [western balsam poplar]
ref|XP_009121227.1|  PREDICTED: putative polyol transporter 1           266   6e-82   Brassica rapa
ref|XP_009336961.1|  PREDICTED: putative polyol transporter 1           266   7e-82   Pyrus x bretschneideri [bai li]
emb|CAD58710.1|  polyol transporter                                     266   7e-82   Plantago major [cart-track plant]
gb|KHN25431.1|  Polyol transporter 5                                    266   7e-82   Glycine soja [wild soybean]
ref|XP_009345072.1|  PREDICTED: putative polyol transporter 1           266   9e-82   
ref|XP_002884156.1|  predicted protein                                  265   1e-81   Arabidopsis lyrata subsp. lyrata
ref|XP_010484928.1|  PREDICTED: putative polyol transporter 1           265   1e-81   Camelina sativa [gold-of-pleasure]
ref|XP_003540961.2|  PREDICTED: polyol transporter 5-like               266   1e-81   Glycine max [soybeans]
gb|KFK41272.1|  hypothetical protein AALP_AA2G108500                    263   1e-81   Arabis alpina [alpine rockcress]
ref|XP_006657888.1|  PREDICTED: polyol transporter 5-like               265   1e-81   Oryza brachyantha
tpg|DAA45950.1|  TPA: hypothetical protein ZEAMMB73_850316              265   2e-81   
ref|XP_010495901.1|  PREDICTED: putative polyol transporter 1           265   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_007200584.1|  hypothetical protein PRUPE_ppa007633mg             259   2e-81   
ref|XP_008775333.1|  PREDICTED: polyol transporter 5-like               265   2e-81   Phoenix dactylifera
ref|XP_010472919.1|  PREDICTED: putative polyol transporter 2           265   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_008795604.1|  PREDICTED: putative polyol transporter 1           265   2e-81   Phoenix dactylifera
ref|XP_010472942.1|  PREDICTED: putative polyol transporter 2           265   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_004983902.1|  PREDICTED: polyol transporter 5-like isoform X2    265   3e-81   
ref|XP_010442571.1|  PREDICTED: putative polyol transporter 2           265   3e-81   
gb|KFK40045.1|  hypothetical protein AALP_AA3G322700                    264   3e-81   Arabis alpina [alpine rockcress]
ref|XP_004983901.1|  PREDICTED: polyol transporter 5-like isoform X1    265   3e-81   Setaria italica
ref|XP_010507195.1|  PREDICTED: polyol transporter 5                    265   3e-81   Camelina sativa [gold-of-pleasure]
ref|XP_009396401.1|  PREDICTED: polyol transporter 5-like               264   4e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007201628.1|  hypothetical protein PRUPE_ppa021469mg             263   4e-81   
ref|XP_009121388.1|  PREDICTED: LOW QUALITY PROTEIN: putative pol...    264   4e-81   Brassica rapa
ref|XP_010435020.1|  PREDICTED: putative polyol transporter 2           264   5e-81   Camelina sativa [gold-of-pleasure]
emb|CDY46218.1|  BnaA07g03520D                                          264   5e-81   Brassica napus [oilseed rape]
ref|XP_008795606.1|  PREDICTED: polyol transporter 5-like isoform X1    264   5e-81   Phoenix dactylifera
ref|XP_006384498.1|  hypothetical protein POPTR_0004s15900g             263   7e-81   
ref|XP_010905473.1|  PREDICTED: putative polyol transporter 1           263   1e-80   
ref|NP_001281038.1|  polyol transporter 5-like                          262   1e-80   Malus domestica [apple tree]
ref|XP_003562817.1|  PREDICTED: polyol transporter 5-like               263   1e-80   Brachypodium distachyon [annual false brome]
ref|NP_179210.1|  polyol/monosaccharide transporter 2                   262   2e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009345073.1|  PREDICTED: polyol transporter 5-like               262   2e-80   Pyrus x bretschneideri [bai li]
ref|XP_007131852.1|  hypothetical protein PHAVU_011G046800g             263   2e-80   Phaseolus vulgaris [French bean]
ref|XP_002467638.1|  hypothetical protein SORBIDRAFT_01g031360          263   2e-80   Sorghum bicolor [broomcorn]
dbj|BAC83310.1|  putative sorbitol transporter                          262   2e-80   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ04480.1|  hypothetical protein OsI_26629                          262   2e-80   Oryza sativa Indica Group [Indian rice]
ref|XP_007200117.1|  hypothetical protein PRUPE_ppa018884mg             262   2e-80   Prunus persica
emb|CDY46217.1|  BnaA07g03530D                                          262   3e-80   Brassica napus [oilseed rape]
ref|XP_008791366.1|  PREDICTED: polyol transporter 5-like               261   3e-80   
ref|XP_010465998.1|  PREDICTED: polyol transporter 5-like               262   4e-80   Camelina sativa [gold-of-pleasure]
ref|XP_008653287.1|  PREDICTED: polyol transporter 5-like               261   4e-80   Zea mays [maize]
ref|XP_007200254.1|  hypothetical protein PRUPE_ppa015090mg             261   4e-80   Prunus persica
ref|XP_010445995.1|  PREDICTED: putative polyol transporter 2           261   5e-80   Camelina sativa [gold-of-pleasure]
ref|XP_007200033.1|  hypothetical protein PRUPE_ppa024323mg             261   6e-80   
emb|CDP17996.1|  unnamed protein product                                261   9e-80   Coffea canephora [robusta coffee]
ref|NP_001060108.1|  Os07g0582400                                       262   9e-80   
dbj|BAJ86526.1|  predicted protein                                      260   1e-79   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAO88964.1|  sorbitol transporter                                    259   1e-79   Malus domestica [apple tree]
gb|KCW55336.1|  hypothetical protein EUGRSUZ_I01255                     257   2e-79   Eucalyptus grandis [rose gum]
ref|XP_002460923.1|  hypothetical protein SORBIDRAFT_02g037570          259   2e-79   Sorghum bicolor [broomcorn]
gb|KEH30425.1|  polyol/monosaccharide transporter 1                     258   2e-79   Medicago truncatula
ref|XP_008668471.1|  PREDICTED: hypothetical protein isoform X1         260   2e-79   Zea mays [maize]
emb|CDP18000.1|  unnamed protein product                                259   2e-79   Coffea canephora [robusta coffee]
ref|XP_002885281.1|  ATPLT5                                             260   2e-79   Arabidopsis lyrata subsp. lyrata
gb|AAY88181.2|  mannitol transporter 1                                  258   2e-79   Olea europaea
ref|XP_003607077.1|  Sorbitol-like transporter                          259   3e-79   Medicago truncatula
ref|XP_008466921.1|  PREDICTED: putative polyol transporter 1           249   3e-79   Cucumis melo [Oriental melon]
ref|XP_003558585.1|  PREDICTED: putative polyol transporter 1           259   4e-79   Brachypodium distachyon [annual false brome]
ref|XP_010527168.1|  PREDICTED: putative polyol transporter 1           254   6e-79   Tarenaya hassleriana [spider flower]
ref|NP_001150711.1|  LOC100284344                                       259   7e-79   Zea mays [maize]
ref|XP_008245258.1|  PREDICTED: polyol transporter 5-like               258   8e-79   Prunus mume [ume]
ref|XP_008359575.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    258   9e-79   
ref|XP_009407903.1|  PREDICTED: polyol transporter 5-like               258   1e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008236797.1|  PREDICTED: putative polyol transporter 2           258   1e-78   Prunus mume [ume]
ref|NP_001049269.1|  Os03g0197100                                       258   1e-78   
ref|XP_010254895.1|  PREDICTED: polyol transporter 5-like               258   1e-78   Nelumbo nucifera [Indian lotus]
ref|XP_002463086.1|  hypothetical protein SORBIDRAFT_02g037590          257   1e-78   Sorghum bicolor [broomcorn]
ref|NP_001147446.1|  sorbitol transporter                               258   2e-78   Zea mays [maize]
ref|XP_007200667.1|  hypothetical protein PRUPE_ppa015294mg             258   2e-78   
gb|EMS50618.1|  Polyol transporter 5                                    251   2e-78   Triticum urartu
ref|XP_008795607.1|  PREDICTED: polyol transporter 5-like isoform X2    256   2e-78   Phoenix dactylifera
ref|XP_007042751.1|  Polyol/monosaccharide transporter 5, putative      257   3e-78   
ref|XP_009342010.1|  PREDICTED: putative polyol transporter 1           257   3e-78   Pyrus x bretschneideri [bai li]
ref|XP_008465477.1|  PREDICTED: polyol transporter 5-like               256   4e-78   Cucumis melo [Oriental melon]
ref|XP_009342008.1|  PREDICTED: putative polyol transporter 1           256   4e-78   Pyrus x bretschneideri [bai li]
ref|XP_009350912.1|  PREDICTED: putative polyol transporter 1           256   4e-78   Pyrus x bretschneideri [bai li]
ref|XP_004985338.1|  PREDICTED: polyol transporter 5-like isoform X2    256   6e-78   
gb|ERN17552.1|  hypothetical protein AMTR_s00059p00123280               256   6e-78   Amborella trichopoda
ref|XP_009342009.1|  PREDICTED: putative polyol transporter 1           256   7e-78   Pyrus x bretschneideri [bai li]
dbj|BAJ93158.1|  predicted protein                                      255   9e-78   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004985339.1|  PREDICTED: polyol transporter 5-like               255   1e-77   Setaria italica
dbj|BAJ86116.1|  predicted protein                                      255   1e-77   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004985337.1|  PREDICTED: polyol transporter 5-like isoform X1    255   1e-77   Setaria italica
gb|AAN07021.1|  putative mannitol transporter                           255   1e-77   Phelipanche ramosa
ref|XP_010487804.1|  PREDICTED: polyol transporter 5-like               255   2e-77   Camelina sativa [gold-of-pleasure]
ref|XP_006297395.1|  hypothetical protein CARUB_v10013420mg             254   3e-77   Capsella rubella
ref|XP_006649563.1|  PREDICTED: polyol transporter 5-like               254   3e-77   Oryza brachyantha
gb|EYU37769.1|  hypothetical protein MIMGU_mgv1a005015mg                253   4e-77   Erythranthe guttata [common monkey flower]
ref|XP_004148314.2|  PREDICTED: polyol transporter 5-like               254   4e-77   Cucumis sativus [cucumbers]
ref|XP_009350914.1|  PREDICTED: putative polyol transporter 1           254   4e-77   Pyrus x bretschneideri [bai li]
ref|XP_009375838.1|  PREDICTED: putative polyol transporter 1           254   5e-77   Pyrus x bretschneideri [bai li]
gb|KCW62858.1|  hypothetical protein EUGRSUZ_G00452                     253   7e-77   Eucalyptus grandis [rose gum]
ref|XP_002468337.1|  hypothetical protein SORBIDRAFT_01g044010          253   8e-77   Sorghum bicolor [broomcorn]
gb|EYU42630.1|  hypothetical protein MIMGU_mgv1a0059091mg               242   9e-77   Erythranthe guttata [common monkey flower]
ref|XP_009378956.1|  PREDICTED: putative polyol transporter 1           253   1e-76   Pyrus x bretschneideri [bai li]
ref|XP_004958139.1|  PREDICTED: putative polyol transporter 1-like      252   1e-76   Setaria italica
ref|XP_010254894.1|  PREDICTED: polyol transporter 5-like               252   1e-76   Nelumbo nucifera [Indian lotus]
ref|XP_008368694.1|  PREDICTED: polyol transporter 5-like               251   2e-76   
ref|XP_010527595.1|  PREDICTED: polyol transporter 5-like               246   2e-76   Tarenaya hassleriana [spider flower]
ref|XP_010905472.1|  PREDICTED: polyol transporter 5-like               252   2e-76   
ref|XP_004958138.1|  PREDICTED: polyol transporter 5-like               250   7e-76   Setaria italica
tpg|DAA43975.1|  TPA: polyol transporter protein 4                      249   1e-75   
ref|XP_008447047.1|  PREDICTED: polyol transporter 5-like               250   1e-75   Cucumis melo [Oriental melon]
gb|EAY88906.1|  hypothetical protein OsI_10385                          250   1e-75   Oryza sativa Indica Group [Indian rice]
gb|ACG47895.1|  polyol transporter protein 4                            249   2e-75   Zea mays [maize]
ref|XP_010229631.1|  PREDICTED: putative polyol transporter 1           249   2e-75   Brachypodium distachyon [annual false brome]
ref|XP_004958137.1|  PREDICTED: polyol transporter 5-like               249   3e-75   Setaria italica
gb|ABX71752.1|  mannitol transporter                                    249   3e-75   Apium graveolens
ref|XP_006856085.2|  PREDICTED: polyol transporter 5                    248   3e-75   
ref|XP_008245305.1|  PREDICTED: polyol transporter 5-like               248   3e-75   Prunus mume [ume]
ref|XP_006361759.1|  PREDICTED: polyol transporter 5-like               247   5e-75   Solanum tuberosum [potatoes]
gb|EEE58504.1|  hypothetical protein OsJ_09775                          248   5e-75   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008800420.1|  PREDICTED: polyol transporter 5-like               248   6e-75   Phoenix dactylifera
ref|XP_006827103.2|  PREDICTED: polyol transporter 5                    247   7e-75   
emb|CDP17999.1|  unnamed protein product                                247   7e-75   Coffea canephora [robusta coffee]
ref|XP_003562818.1|  PREDICTED: polyol transporter 5-like               248   8e-75   Brachypodium distachyon [annual false brome]
ref|XP_010068107.1|  PREDICTED: polyol transporter 5-like               246   2e-74   Eucalyptus grandis [rose gum]
ref|XP_006827104.1|  PREDICTED: polyol transporter 5                    247   2e-74   
gb|EYU20732.1|  hypothetical protein MIMGU_mgv1a026176mg                246   2e-74   Erythranthe guttata [common monkey flower]
ref|XP_010530848.1|  PREDICTED: LOW QUALITY PROTEIN: putative pol...    246   3e-74   Tarenaya hassleriana [spider flower]
gb|EAZ04481.1|  hypothetical protein OsI_26630                          245   5e-74   Oryza sativa Indica Group [Indian rice]
ref|XP_006649564.1|  PREDICTED: polyol transporter 5-like               245   6e-74   Oryza brachyantha
dbj|BAK00091.1|  predicted protein                                      246   7e-74   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010497306.1|  PREDICTED: putative polyol transporter 1           234   9e-74   
ref|XP_003558586.1|  PREDICTED: polyol transporter 5-like               245   1e-73   Brachypodium distachyon [annual false brome]
emb|CDP02097.1|  unnamed protein product                                244   2e-73   Coffea canephora [robusta coffee]
gb|EMS55537.1|  Putative polyol transporter 1                           240   3e-73   Triticum urartu
ref|XP_011659070.1|  PREDICTED: polyol transporter 5-like               243   7e-73   Cucumis sativus [cucumbers]
ref|NP_001060109.2|  Os07g0582500                                       242   9e-73   
dbj|BAC83311.1|  putative sorbitol transporter                          242   1e-72   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ93015.1|  predicted protein                                      242   2e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS52712.1|  Putative polyol transporter 2                           241   3e-72   Triticum urartu
ref|XP_008800418.1|  PREDICTED: polyol transporter 5-like               241   4e-72   Phoenix dactylifera
gb|AAG43998.1|AF215837_1  mannitol transporter                          240   5e-72   Apium graveolens Dulce Group [celery]
ref|XP_011088360.1|  PREDICTED: polyol transporter 5-like               240   6e-72   Sesamum indicum [beniseed]
ref|XP_008387375.1|  PREDICTED: polyol transporter 5-like               240   8e-72   
gb|KJB12318.1|  hypothetical protein B456_002G011700                    240   8e-72   Gossypium raimondii
gb|KJB12317.1|  hypothetical protein B456_002G011600                    238   2e-71   
ref|XP_006658740.1|  PREDICTED: polyol transporter 5-like               236   1e-70   
ref|XP_011088761.1|  PREDICTED: putative polyol transporter 1           231   1e-70   
gb|ERM94340.1|  hypothetical protein AMTR_s00010p00243630               235   3e-70   
gb|EMT15229.1|  Putative polyol transporter 1                           230   7e-70   
ref|XP_002440825.1|  hypothetical protein SORBIDRAFT_09g007450          235   7e-70   
ref|XP_004148303.1|  PREDICTED: polyol transporter 5-like               234   1e-69   
gb|ABF94465.1|  Sugar transporter family protein, expressed             234   2e-69   
ref|NP_001142160.1|  hypothetical protein                               233   3e-69   
ref|XP_008447045.1|  PREDICTED: polyol transporter 5-like               233   4e-69   
ref|XP_008452333.1|  PREDICTED: polyol transporter 5-like isoform X2    233   5e-69   
ref|XP_008651795.1|  PREDICTED: uncharacterized protein LOC100501...    231   1e-68   
ref|XP_002514303.1|  sugar transporter, putative                        231   1e-68   
gb|ABR16466.1|  unknown                                                 231   2e-68   
ref|XP_011650543.1|  PREDICTED: putative polyol transporter 2           231   2e-68   
gb|EAY77363.1|  hypothetical protein OsI_05348                          229   2e-68   
ref|NP_001045505.2|  Os01g0966900                                       229   3e-68   
emb|CAR82416.1|  polyol transporter                                     219   7e-68   
ref|XP_008386449.1|  PREDICTED: polyol transporter 5-like               228   1e-67   
ref|XP_008667512.1|  PREDICTED: hypothetical protein isoform X1         229   2e-67   
ref|XP_004148302.1|  PREDICTED: putative polyol transporter 2           229   2e-67   
ref|XP_009371465.1|  PREDICTED: polyol transporter 5-like               228   2e-67   
ref|XP_008447044.1|  PREDICTED: polyol transporter 5-like               228   2e-67   
gb|KGN56185.1|  hypothetical protein Csa_3G095020                       227   3e-67   
ref|XP_009780685.1|  PREDICTED: polyol transporter 5-like               217   4e-67   
ref|XP_010680814.1|  PREDICTED: probable polyol transporter 3           227   4e-67   
ref|XP_009112494.1|  PREDICTED: probable polyol transporter 3           226   1e-66   
ref|XP_009607069.1|  PREDICTED: polyol transporter 5-like               226   1e-66   
ref|XP_010531021.1|  PREDICTED: probable polyol transporter 3           226   1e-66   
ref|XP_012076685.1|  PREDICTED: polyol transporter 5-like               226   1e-66   
emb|CDY66291.1|  BnaCnng50240D                                          224   3e-66   
gb|EMT00465.1|  Putative polyol transporter 1                           225   3e-66   
ref|XP_011458741.1|  PREDICTED: polyol transporter 5-like               224   5e-66   
ref|XP_006409145.1|  hypothetical protein EUTSA_v10022657mg             224   5e-66   
ref|XP_010414363.1|  PREDICTED: probable polyol transporter 3           224   7e-66   
ref|XP_012076686.1|  PREDICTED: polyol transporter 5-like               224   7e-66   
emb|CDY66868.1|  BnaUnng01720D                                          223   1e-65   
ref|XP_002460924.1|  hypothetical protein SORBIDRAFT_02g037580          224   1e-65   
ref|XP_010530847.1|  PREDICTED: putative polyol transporter 1           224   1e-65   
ref|XP_007013362.1|  Polyol/monosaccharide transporter 5, putative      223   1e-65   
ref|XP_010467666.1|  PREDICTED: probable polyol transporter 3           223   2e-65   
ref|XP_009774532.1|  PREDICTED: polyol transporter 5-like               223   2e-65   
ref|XP_008670519.1|  PREDICTED: putative polyol transporter 1           223   3e-65   
ref|XP_012084471.1|  PREDICTED: probable polyol transporter 6           222   4e-65   
ref|XP_010489553.1|  PREDICTED: probable polyol transporter 3           222   4e-65   
ref|XP_002514302.1|  sugar transporter, putative                        223   4e-65   
ref|XP_003620669.1|  Myo-inositol transporter                           221   1e-64   
ref|XP_003529995.1|  PREDICTED: polyol transporter 5-like               221   1e-64   
ref|XP_010688202.1|  PREDICTED: polyol transporter 5-like               221   1e-64   
ref|XP_010497436.1|  PREDICTED: putative polyol transporter 1           212   1e-64   
ref|XP_010070046.1|  PREDICTED: probable polyol transporter 6           220   2e-64   
gb|ACG35144.1|  proton myo-inositol cotransporter                       220   2e-64   
ref|NP_001132062.1|  proton myo-inositol cotransporter                  220   2e-64   
ref|XP_008338123.1|  PREDICTED: probable polyol transporter 6           220   3e-64   
ref|XP_009371568.1|  PREDICTED: probable polyol transporter 6           220   3e-64   
ref|XP_010095276.1|  putative polyol transporter 6                      219   3e-64   
ref|XP_008447046.1|  PREDICTED: polyol transporter 5-like               219   3e-64   
ref|XP_011658491.1|  PREDICTED: probable polyol transporter 6           219   4e-64   
gb|KJB40206.1|  hypothetical protein B456_007G051000                    219   5e-64   
ref|XP_008452332.1|  PREDICTED: putative polyol transporter 2 iso...    220   6e-64   
ref|XP_004148315.2|  PREDICTED: polyol transporter 5-like               219   6e-64   
ref|NP_001168177.1|  uncharacterized protein LOC100381931               219   7e-64   
tpg|DAA63328.1|  TPA: hypothetical protein ZEAMMB73_585953              218   7e-64   
ref|XP_007208924.1|  hypothetical protein PRUPE_ppb008257mg             212   8e-64   
ref|XP_002280978.1|  PREDICTED: polyol transporter 5                    218   9e-64   
ref|XP_006451145.1|  hypothetical protein CICLE_v10008031mg             219   9e-64   
ref|XP_007013174.1|  Polyol/monosaccharide transporter 5 isoform 1      219   9e-64   
ref|XP_006297471.1|  hypothetical protein CARUB_v10013492mg             218   1e-63   
ref|XP_010026167.1|  PREDICTED: probable polyol transporter 6           218   1e-63   
ref|XP_007203309.1|  hypothetical protein PRUPE_ppa025908mg             217   2e-63   
ref|XP_007046983.1|  Major facilitator superfamily protein              217   3e-63   
emb|CDP03333.1|  unnamed protein product                                217   3e-63   
ref|XP_010548048.1|  PREDICTED: putative polyol transporter 1           217   3e-63   
ref|XP_008440694.1|  PREDICTED: probable polyol transporter 6           217   3e-63   
ref|XP_007131748.1|  hypothetical protein PHAVU_011G038700g             217   4e-63   
gb|KCW81997.1|  hypothetical protein EUGRSUZ_C03362                     217   5e-63   
ref|XP_010049692.1|  PREDICTED: polyol transporter 5-like               216   7e-63   
ref|XP_004512978.1|  PREDICTED: polyol transporter 5-like               216   9e-63   
ref|XP_008463391.1|  PREDICTED: probable polyol transporter 6           216   9e-63   
ref|XP_003533389.1|  PREDICTED: polyol transporter 5-like               217   1e-62   
ref|XP_006833286.2|  PREDICTED: polyol transporter 5                    216   1e-62   
ref|XP_008242649.1|  PREDICTED: probable polyol transporter 6           216   1e-62   
tpg|DAA41237.1|  TPA: hypothetical protein ZEAMMB73_503211              207   1e-62   
ref|XP_007203539.1|  hypothetical protein PRUPE_ppa1027213mg            216   1e-62   
ref|NP_179438.1|  putative polyol transporter 3                         216   1e-62   
gb|KFK40217.1|  hypothetical protein AALP_AA3G345800                    215   2e-62   
ref|XP_008338588.1|  PREDICTED: probable polyol transporter 6           215   2e-62   
ref|XP_009356716.1|  PREDICTED: probable polyol transporter 6           214   3e-62   
ref|XP_011458734.1|  PREDICTED: probable polyol transporter 6           215   4e-62   
ref|XP_007203922.1|  hypothetical protein PRUPE_ppa017052mg             214   4e-62   
ref|XP_009627595.1|  PREDICTED: probable polyol transporter 6           214   5e-62   
ref|XP_002531429.1|  sugar transporter, putative                        213   6e-62   
ref|XP_004150056.1|  PREDICTED: probable polyol transporter 6           213   7e-62   
ref|XP_006425707.1|  hypothetical protein CICLE_v10027247mg             214   7e-62   
ref|XP_004134957.1|  PREDICTED: probable polyol transporter 4           213   1e-61   
ref|XP_006346993.1|  PREDICTED: probable polyol transporter 6-like      213   1e-61   
gb|AFK48916.1|  unknown                                                 202   1e-61   
ref|XP_009374073.1|  PREDICTED: probable polyol transporter 6           213   1e-61   
emb|CBI28072.3|  unnamed protein product                                218   1e-61   
ref|XP_010649162.1|  PREDICTED: probable polyol transporter 6 iso...    209   2e-61   
dbj|BAO96231.1|  polyol/monosaccharide Transporter 8                    212   2e-61   
ref|XP_009799010.1|  PREDICTED: probable polyol transporter 6           212   3e-61   
gb|ACN26310.1|  unknown                                                 211   3e-61   
ref|XP_004509296.1|  PREDICTED: probable polyol transporter 3-like      212   3e-61   
ref|XP_008241649.1|  PREDICTED: probable polyol transporter 6           212   3e-61   
ref|XP_002886176.1|  predicted protein                                  211   4e-61   
ref|XP_006363185.1|  PREDICTED: probable polyol transporter 6-like      211   5e-61   
gb|KJB64901.1|  hypothetical protein B456_010G071400                    211   6e-61   
ref|XP_004233513.1|  PREDICTED: probable polyol transporter 6 iso...    211   7e-61   
ref|XP_008337386.1|  PREDICTED: polyol transporter 5-like               211   7e-61   
ref|XP_010548339.1|  PREDICTED: probable polyol transporter 6           211   7e-61   
ref|XP_009773456.1|  PREDICTED: probable polyol transporter 4 iso...    211   7e-61   
ref|XP_009773455.1|  PREDICTED: probable polyol transporter 4 iso...    211   7e-61   
ref|XP_006475614.1|  PREDICTED: polyol transporter 5-like isoform X1    211   7e-61   
ref|XP_002310213.2|  mannitol transporter family protein                211   8e-61   
ref|XP_011025750.1|  PREDICTED: probable polyol transporter 3           210   9e-61   
ref|XP_010531022.1|  PREDICTED: probable polyol transporter 6           210   1e-60   
ref|XP_007211557.1|  hypothetical protein PRUPE_ppa004144mg             211   1e-60   
ref|XP_006346943.1|  PREDICTED: probable polyol transporter 6-like      210   1e-60   
emb|CBI17542.3|  unnamed protein product                                208   1e-60   
gb|KCW58602.1|  hypothetical protein EUGRSUZ_H01261                     209   1e-60   
ref|XP_004233968.1|  PREDICTED: probable polyol transporter 6           210   2e-60   
gb|EYU23018.1|  hypothetical protein MIMGU_mgv1a005494mg                209   2e-60   
ref|XP_008225034.1|  PREDICTED: probable polyol transporter 4           210   2e-60   
ref|XP_003561393.1|  PREDICTED: probable polyol transporter 6           209   2e-60   
ref|XP_010686555.1|  PREDICTED: probable polyol transporter 4           210   2e-60   
ref|XP_008439885.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    209   2e-60   
gb|KHG11695.1|  Polyol transporter 5 -like protein                      209   2e-60   
gb|ERM98564.1|  hypothetical protein AMTR_s00109p00027810               208   3e-60   
ref|NP_001141158.1|  hypothetical protein                               209   3e-60   
ref|XP_008679503.1|  PREDICTED: carbohydrate transporter/ sugar p...    209   3e-60   
ref|XP_004232838.1|  PREDICTED: probable polyol transporter 4 iso...    209   3e-60   
ref|XP_003593550.1|  hypothetical protein MTR_2g013310                  209   4e-60   
ref|XP_010536004.1|  PREDICTED: polyol transporter 5-like               208   4e-60   
ref|NP_001146002.1|  uncharacterized protein LOC100279532               208   5e-60   
gb|KHN00554.1|  Putative polyol transporter 3                           208   5e-60   
gb|AFW56602.1|  major myo-inositol transporter iolT                     208   5e-60   
ref|XP_004233514.1|  PREDICTED: probable polyol transporter 6           208   5e-60   
ref|XP_006590681.1|  PREDICTED: probable polyol transporter 3-like      208   5e-60   
ref|XP_002267872.1|  PREDICTED: probable polyol transporter 6 iso...    208   6e-60   
gb|KJB64902.1|  hypothetical protein B456_010G071500                    206   8e-60   
ref|XP_008795662.1|  PREDICTED: probable polyol transporter 6           207   1e-59   
ref|XP_011460253.1|  PREDICTED: probable polyol transporter 4           208   1e-59   
ref|XP_003539908.1|  PREDICTED: probable polyol transporter 4-like      208   1e-59   
ref|XP_006347075.1|  PREDICTED: probable polyol transporter 4-lik...    207   1e-59   
gb|KJB77296.1|  hypothetical protein B456_012G130400                    208   1e-59   
ref|XP_009624322.1|  PREDICTED: probable polyol transporter 4 iso...    207   1e-59   
ref|XP_010239281.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    207   1e-59   
ref|XP_002443259.1|  hypothetical protein SORBIDRAFT_08g016530          207   1e-59   
ref|XP_010099586.1|  Polyol transporter 5                               207   2e-59   
ref|XP_002972026.1|  hypothetical protein SELMODRAFT_441647             209   2e-59   
ref|XP_007152832.1|  hypothetical protein PHAVU_004G163600g             208   2e-59   
ref|XP_009613014.1|  PREDICTED: probable polyol transporter 4           207   2e-59   
ref|XP_009787559.1|  PREDICTED: probable polyol transporter 4           207   2e-59   
ref|XP_002972566.1|  hypothetical protein SELMODRAFT_148545             208   2e-59   
ref|XP_007013177.1|  Polyol/monosaccharide transporter 5 isoform 1      207   2e-59   
gb|EPS67834.1|  hypothetical protein M569_06938                         206   2e-59   
ref|XP_009335311.1|  PREDICTED: probable polyol transporter 4           208   2e-59   
ref|XP_003629474.1|  hypothetical protein MTR_8g077890                  207   2e-59   
gb|ACJ85829.1|  unknown                                                 206   3e-59   
gb|KJB31705.1|  hypothetical protein B456_005G202400                    207   3e-59   
ref|XP_006411974.1|  hypothetical protein EUTSA_v10024974mg             206   3e-59   
gb|EAZ15802.1|  hypothetical protein OsJ_31220                          206   3e-59   
ref|NP_001064429.1|  Os10g0360100                                       206   3e-59   
ref|XP_006360474.1|  PREDICTED: polyol transporter 5-like               207   4e-59   
gb|EYU40145.1|  hypothetical protein MIMGU_mgv1a004984mg                206   4e-59   
ref|XP_002519026.1|  sugar transporter, putative                        207   4e-59   
ref|XP_007148196.1|  hypothetical protein PHAVU_006G188100g             207   4e-59   
dbj|BAO96228.1|  polyol/monosaccharide transporter 3                    206   4e-59   
ref|XP_009773457.1|  PREDICTED: probable polyol transporter 4 iso...    206   5e-59   
ref|XP_006350047.1|  PREDICTED: probable polyol transporter 4-like      206   5e-59   
ref|XP_004251791.1|  PREDICTED: probable polyol transporter 4           206   5e-59   
ref|XP_008371338.1|  PREDICTED: probable polyol transporter 4           207   5e-59   
ref|XP_002984639.1|  hypothetical protein SELMODRAFT_181215             207   6e-59   
gb|EEC66802.1|  hypothetical protein OsI_33208                          205   6e-59   
ref|XP_008229167.1|  PREDICTED: probable polyol transporter 4           206   6e-59   
emb|CCC58382.1|  polyol/monosaccharide transporter 4                    206   7e-59   
gb|AAK13147.1|AC083945_22  Putative sugar transporter                   207   7e-59   
emb|CDY35469.1|  BnaC03g61910D                                          206   7e-59   
emb|CDX75588.1|  BnaA01g01140D                                          205   8e-59   
ref|NP_195385.1|  putative polyol transporter 6                         205   8e-59   
gb|KFK30287.1|  hypothetical protein AALP_AA7G242000                    206   8e-59   
ref|XP_010446763.1|  PREDICTED: probable polyol transporter 6           205   8e-59   
ref|XP_002972029.1|  hypothetical protein SELMODRAFT_96814              206   9e-59   
ref|XP_007215837.1|  hypothetical protein PRUPE_ppa004119mg             206   9e-59   
ref|XP_002978711.1|  hypothetical protein SELMODRAFT_109547             207   1e-58   
ref|XP_002439891.1|  hypothetical protein SORBIDRAFT_09g022100          206   1e-58   
gb|EPS63014.1|  hypothetical protein M569_11773                         204   1e-58   
ref|XP_009142783.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    205   1e-58   
ref|XP_002517946.1|  sugar transporter, putative                        205   1e-58   
ref|XP_006285274.1|  hypothetical protein CARUB_v10006648mg             204   1e-58   
ref|XP_006297425.1|  hypothetical protein CARUB_v10013450mg             205   1e-58   
ref|XP_011016252.1|  PREDICTED: probable polyol transporter 4           205   1e-58   
ref|XP_011027893.1|  PREDICTED: probable polyol transporter 4           205   1e-58   
ref|NP_001151390.1|  carbohydrate transporter/ sugar porter             205   1e-58   
emb|CDY24775.1|  BnaA08g15350D                                          205   2e-58   
ref|XP_004983248.1|  PREDICTED: probable polyol transporter 3-like      205   2e-58   
ref|XP_010317209.1|  PREDICTED: probable polyol transporter 6 iso...    204   2e-58   
ref|XP_009109331.1|  PREDICTED: probable polyol transporter 6           204   2e-58   
ref|XP_003543064.1|  PREDICTED: probable polyol transporter 4-lik...    205   2e-58   
ref|XP_010432153.1|  PREDICTED: probable polyol transporter 6           204   2e-58   
ref|XP_010049436.1|  PREDICTED: polyol transporter 5-like               203   2e-58   
ref|XP_012088309.1|  PREDICTED: probable polyol transporter 4 iso...    205   2e-58   
gb|ERM95231.1|  hypothetical protein AMTR_s00009p00268230               205   2e-58   
ref|XP_003616024.1|  hypothetical protein MTR_5g075300                  204   2e-58   
ref|XP_002866999.1|  hypothetical protein ARALYDRAFT_490969             204   2e-58   
gb|AEI98623.1|  hypothetical protein 111O18.10                          204   2e-58   
gb|AFK37582.1|  unknown                                                 204   2e-58   
emb|CDY67098.1|  BnaCnng53530D                                          204   2e-58   
gb|KFK40451.1|  hypothetical protein AALP_AA3G374800                    204   3e-58   
gb|ACN35873.1|  unknown                                                 202   3e-58   
ref|XP_010242001.1|  PREDICTED: probable polyol transporter 4           206   3e-58   
ref|XP_003545891.1|  PREDICTED: probable polyol transporter 4-lik...    204   3e-58   
ref|XP_010317207.1|  PREDICTED: probable polyol transporter 6 iso...    203   3e-58   
gb|KHG12832.1|  Polyol transporter 5 -like protein                      194   3e-58   
dbj|BAK07233.1|  predicted protein                                      204   3e-58   
ref|XP_010316729.1|  PREDICTED: probable polyol transporter 4 iso...    203   3e-58   
ref|XP_003618299.1|  Mannitol transporter                               204   3e-58   
ref|XP_010035720.1|  PREDICTED: probable polyol transporter 4           204   3e-58   
ref|XP_002319907.2|  mannitol transporter family protein                204   4e-58   
ref|XP_011045507.1|  PREDICTED: probable polyol transporter 4           204   4e-58   



>ref|XP_009596634.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=526

 Score =   311 bits (796),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 167/211 (79%), Positives = 183/211 (87%), Gaps = 1/211 (0%)
 Frame = +3

Query  126  MGDTRPVRNAGSGHIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQ  302
            M D +  RNA  G +  AFDPPKK KRNKYA+A +FLASLASILLGYDIGVMSGA IYI+
Sbjct  1    MADKKQGRNAVCGQLQIAFDPPKKPKRNKYAVACSFLASLASILLGYDIGVMSGAIIYIK  60

Query  303  KDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTN  482
            KDL IND QVEIL GILNLYSLIGS  AGRTSDWIGRR TMVVA+V+FFVGA+LMGF+TN
Sbjct  61   KDLNINDVQVEILAGILNLYSLIGSAAAGRTSDWIGRRNTMVVAAVIFFVGALLMGFATN  120

Query  483  YTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAF  662
            Y FLM GRFVAGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSNFAF
Sbjct  121  YAFLMFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNFAF  180

Query  663  KNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
              +  HLSWRFMLG+G++PSV L +SVLAMP
Sbjct  181  SKLPAHLSWRFMLGIGAVPSVFLAISVLAMP  211



>ref|XP_009766648.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=526

 Score =   308 bits (789),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 167/211 (79%), Positives = 182/211 (86%), Gaps = 1/211 (0%)
 Frame = +3

Query  126  MGDTRPVRNAGSGHIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQ  302
            M D +  RNA  G +  AFDPPKK KRNKYA A +FLASLASILLGYDIGVMSGA IYI+
Sbjct  1    MADKKHGRNAVCGQLQIAFDPPKKPKRNKYATACSFLASLASILLGYDIGVMSGAIIYIK  60

Query  303  KDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTN  482
            KDL IND QVEIL GILNLYSLIGS  AGRTSDWIGRR TMVVA+V+FFVGAILMGF+TN
Sbjct  61   KDLNINDVQVEILAGILNLYSLIGSAAAGRTSDWIGRRNTMVVAAVIFFVGAILMGFATN  120

Query  483  YTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAF  662
            Y FLM GRFVAGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSNFAF
Sbjct  121  YAFLMFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNFAF  180

Query  663  KNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
              +  +LSWRFMLG+G++PSV L +SVLAMP
Sbjct  181  SKLPANLSWRFMLGIGAVPSVFLAISVLAMP  211



>ref|XP_008350306.1| PREDICTED: putative polyol transporter 1, partial [Malus domestica]
Length=282

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = +3

Query  132  DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  311
            D   V +     I  FDPP+K KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI+ DL
Sbjct  7    DDNTVSSQPQKTIEDFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDL  66

Query  312  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  491
            KI+D +VEILLGILNLYSLIGS  AGRTSDW+GRRYT+V+A  +FFVGA+LMGF+TNY F
Sbjct  67   KISDVEVEILLGILNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYAF  126

Query  492  LMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNM  671
            LM GRFVAG+GVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +
Sbjct  127  LMFGRFVAGVGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSKL  186

Query  672  SVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
              HL WR MLGVG+IPS+ L V VLAMP
Sbjct  187  PTHLGWRLMLGVGAIPSIFLAVGVLAMP  214



>ref|XP_011092774.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=519

 Score =   298 bits (763),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = +3

Query  168  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  347
            IPAFDPP+K KRNKYA+A +FLAS+ SILLGYDIGVMSGA IYIQKDL+I+D Q E+++G
Sbjct  9    IPAFDPPQKPKRNKYAMACSFLASMTSILLGYDIGVMSGAIIYIQKDLQISDVQKEVIMG  68

Query  348  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  527
            ILN+YSL+GS  AGRTSDWIGRRYT+V A V+FF GA+LMGF+TNY FLMVGRFVAGIGV
Sbjct  69   ILNVYSLLGSAAAGRTSDWIGRRYTIVFAGVIFFAGALLMGFATNYAFLMVGRFVAGIGV  128

Query  528  GYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGV  707
            GYALMIAPVYTAEVAPAS RGFLTSFPEVFINFGIL+GYVSNFAF  +   L WRFMLG+
Sbjct  129  GYALMIAPVYTAEVAPASSRGFLTSFPEVFINFGILLGYVSNFAFSKLPTSLGWRFMLGI  188

Query  708  GSIPSVLLGVSVLAMP  755
            G+IPS+ L + VLAMP
Sbjct  189  GAIPSIFLALGVLAMP  204



>gb|KHN39768.1| Polyol transporter 5 [Glycine soja]
Length=523

 Score =   298 bits (762),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 176/204 (86%), Gaps = 2/204 (1%)
 Frame = +3

Query  150  NAGSGH--IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKIND  323
             A   H  +  FDPPKK KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI++DLK++D
Sbjct  8    EAAEAHKTLQDFDPPKKRKRNKYAFACAMLASMTSILLGYDIGVMSGAAIYIKRDLKVSD  67

Query  324  TQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVG  503
             Q+EILLGI+NLYSLIGSC+AGRTSDWIGRRYT+V A  +FFVGA+LMGFS NY+FLM G
Sbjct  68   EQIEILLGIINLYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFVGALLMGFSPNYSFLMFG  127

Query  504  RFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHL  683
            RFVAGIG+GYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SN+AF  +++ +
Sbjct  128  RFVAGIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILIGYISNYAFSKLTLKV  187

Query  684  SWRFMLGVGSIPSVLLGVSVLAMP  755
             WR MLGVG+IPSVLL V VLAMP
Sbjct  188  GWRMMLGVGAIPSVLLTVGVLAMP  211



>ref|XP_009345075.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=538

 Score =   298 bits (763),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  132  DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  311
            D    +  GSG +  FDPPKK KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI++DL
Sbjct  8    DNAVSQQPGSGGLSEFDPPKKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKEDL  67

Query  312  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  491
            KI+D ++EILLGI+N+YSLIGS  AGRTSDWIGRRYT+V+A  +FF GAILMGF+TNY F
Sbjct  68   KISDVEIEILLGIINVYSLIGSAAAGRTSDWIGRRYTIVLAGAIFFTGAILMGFATNYVF  127

Query  492  LMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNM  671
            LMVGRFVAGIG+GYALMIAPVYTAEV+PAS RGFLTSFPEVF+N GIL+GYVSN+AF  +
Sbjct  128  LMVGRFVAGIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFVNIGILLGYVSNYAFSKL  187

Query  672  SVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
               L WR MLG+G++PSV+LGV VLAMP
Sbjct  188  PTDLGWRLMLGIGAVPSVILGVGVLAMP  215



>ref|XP_009800568.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=534

 Score =   297 bits (761),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 179/214 (84%), Gaps = 4/214 (2%)
 Frame = +3

Query  126  MGDTRPVRNAGSGHI----PAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  293
            M + +   N G   I      FDPPKK KRNKYAIA +FLASLASILLGYDIGVMSGA I
Sbjct  1    MAEEKLASNNGQPQIVTSIQDFDPPKKPKRNKYAIACSFLASLASILLGYDIGVMSGAII  60

Query  294  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  473
            YI+KDL I DTQVEIL+GILN+YSL GS  AGRTSDWIGRRYTMVVA+ +FF GA+LMGF
Sbjct  61   YIKKDLHITDTQVEILVGILNIYSLFGSAAAGRTSDWIGRRYTMVVAAAIFFAGALLMGF  120

Query  474  STNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSN  653
            +T Y FLMVGRFVAG+GVGYALM+APVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN
Sbjct  121  ATTYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSN  180

Query  654  FAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            FAF  +  +LSWRFMLG+G++PSV L VSVLAMP
Sbjct  181  FAFSRLPTNLSWRFMLGIGAVPSVFLAVSVLAMP  214



>ref|XP_004507415.1| PREDICTED: polyol transporter 5-like [Cicer arietinum]
Length=526

 Score =   296 bits (758),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 177/210 (84%), Gaps = 0/210 (0%)
 Frame = +3

Query  126  MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  305
            M + + V       +  FDP KK KRN YA A A LAS+ SILLGYDIGVMSGAAIYIQ+
Sbjct  1    MSEGKVVEAKAPQTLHDFDPQKKPKRNMYAFACAMLASMTSILLGYDIGVMSGAAIYIQR  60

Query  306  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  485
            DLK++D Q+EILLGI+N+YSLIGSC+AGRTSDWIGRRYT+V A V+FF GA+LMGFS NY
Sbjct  61   DLKVSDVQIEILLGIINIYSLIGSCLAGRTSDWIGRRYTIVFAGVIFFAGALLMGFSPNY  120

Query  486  TFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFK  665
            +FLM GRFVAG+G+GYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GILVGY+SN+AF 
Sbjct  121  SFLMFGRFVAGVGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILVGYISNYAFS  180

Query  666  NMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
             +S+HL WR MLGVG++PSV+L V VLAMP
Sbjct  181  KLSLHLGWRMMLGVGAVPSVILTVGVLAMP  210



>ref|XP_009611551.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=539

 Score =   296 bits (758),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 177/216 (82%), Gaps = 6/216 (3%)
 Frame = +3

Query  126  MGDTRPVRNAGSGHIPA------FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGA  287
            M + +   N G    P       FDPPKK K NKYAIA +FLASLASILLGYDIGVMSGA
Sbjct  1    MAEEKLASNNGVHSQPQIASIRDFDPPKKPKTNKYAIACSFLASLASILLGYDIGVMSGA  60

Query  288  AIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILM  467
             IYIQKDL I D QVEIL+GILN+YSL GS  AGRTSDWIGRRYTMVVA+ +FF GA+LM
Sbjct  61   IIYIQKDLHITDIQVEILVGILNVYSLFGSAAAGRTSDWIGRRYTMVVAAAIFFAGALLM  120

Query  468  GFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYV  647
            GF+T Y FLMVGRFVAG+GVGYALM+APVYTAEV+PAS RGFLTSFPEVFIN GIL+GYV
Sbjct  121  GFATTYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYV  180

Query  648  SNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            SNFAF  +  HLSWRFMLG+G++PSV L VSVLAMP
Sbjct  181  SNFAFSRLPTHLSWRFMLGIGAVPSVFLAVSVLAMP  216



>emb|CAP58706.1| putative polyol transporter protein 1 [Hevea brasiliensis]
 emb|CAN88842.1| polyols transporter 1 [Hevea brasiliensis]
Length=525

 Score =   295 bits (756),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 175/208 (84%), Gaps = 0/208 (0%)
 Frame = +3

Query  132  DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  311
            D  P        +  FDPPKK KRNK+A+A A LAS+ SILLGYDIGVMSGAAIYI+ DL
Sbjct  9    DVNPSSQPAEKTLADFDPPKKPKRNKFALACAALASMTSILLGYDIGVMSGAAIYIKDDL  68

Query  312  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  491
            KI+DTQVEIL+G LN+YSL+GS  AGRTSDWIGRRYT+VVA  +FFVGA+LMGF+TNY F
Sbjct  69   KISDTQVEILVGTLNIYSLVGSAAAGRTSDWIGRRYTIVVAGGIFFVGALLMGFATNYAF  128

Query  492  LMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNM  671
            LMVGRF+AGIGVGYA++IAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSNFAF  +
Sbjct  129  LMVGRFIAGIGVGYAVVIAPVYTAEVSPASSRGFLTSFPEVFINSGILIGYVSNFAFSKL  188

Query  672  SVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
              HL WRFMLG+G+IPSV+L V VL MP
Sbjct  189  PTHLGWRFMLGIGAIPSVVLAVIVLVMP  216



>ref|NP_001281033.1| polyol transporter 5-like [Malus domestica]
 dbj|BAD42345.1| sorbitol transporter [Malus domestica]
Length=535

 Score =   295 bits (756),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = +3

Query  132  DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  311
            D   V +     I  FDPP+K KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI+ DL
Sbjct  7    DDNTVSSQPQKTIADFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDL  66

Query  312  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  491
            KI+D +VE+LLGILNLYSLIGS  AGRTSDW+GRRYT+V+A  +FFVGA+LMGF+TNY+F
Sbjct  67   KISDVEVEVLLGILNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYSF  126

Query  492  LMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNM  671
            LM GRFVAGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +
Sbjct  127  LMFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSKL  186

Query  672  SVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
              HL WR MLGVG+IPS+ L V VLAMP
Sbjct  187  PTHLGWRLMLGVGAIPSIFLAVGVLAMP  214



>gb|ACB56939.1| mannitol transporter [Artemisia annua]
Length=522

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 175/213 (82%), Gaps = 3/213 (1%)
 Frame = +3

Query  126  MGDTRPVRN---AGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIY  296
            M D +P  N   + +  +  FDPPK  KRNKYA A A LAS+ S+LLGYDIGVMSGA IY
Sbjct  1    MADQKPEENGVSSKTKELADFDPPKAPKRNKYAFACAMLASMTSVLLGYDIGVMSGAQIY  60

Query  297  IQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFS  476
            I++DL  +D Q++IL+GILNLYSL+GS  AGRTSDWIGRRYT+V+A V+FF GAILMGF+
Sbjct  61   IKRDLHCSDNQIQILVGILNLYSLVGSAAAGRTSDWIGRRYTIVLAGVIFFTGAILMGFA  120

Query  477  TNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNF  656
            TNY FLM GRFVAGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSNF
Sbjct  121  TNYAFLMFGRFVAGIGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINAGILLGYVSNF  180

Query  657  AFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            AF  + +HL WRFMLG+G+IPS+ L + VL MP
Sbjct  181  AFSKLPLHLGWRFMLGIGAIPSIFLALGVLGMP  213



>gb|ABK29439.1| sugar transport protein [Coffea canephora]
Length=529

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 178/215 (83%), Gaps = 5/215 (2%)
 Frame = +3

Query  126  MGDTRPVRN-AGSGHIPA----FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  290
            MG  +P  N   SG  P     FDPPKK KRNKYA+A +FLAS+ S+LLGYDIGVMSGAA
Sbjct  1    MGTRKPAENDVFSGQTPKVIADFDPPKKPKRNKYALACSFLASMTSVLLGYDIGVMSGAA  60

Query  291  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  470
            IYI++D K++D +VEIL+GILNLYSL+GS  AGRTSDWIGRR T+V AS +FF GA+LMG
Sbjct  61   IYIKRDFKLSDVKVEILVGILNLYSLLGSAAAGRTSDWIGRRLTIVFASAIFFAGALLMG  120

Query  471  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVS  650
            FSTNY FLMVGRFVAG+GVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVS
Sbjct  121  FSTNYAFLMVGRFVAGVGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  180

Query  651  NFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            N+ F  +  HL WRFMLG+G++PSV L + VLAMP
Sbjct  181  NYGFSKLPPHLGWRFMLGIGAVPSVFLALGVLAMP  215



>emb|CDO97075.1| unnamed protein product [Coffea canephora]
Length=529

 Score =   293 bits (751),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 178/215 (83%), Gaps = 5/215 (2%)
 Frame = +3

Query  126  MGDTRPVRN-AGSGHIPA----FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  290
            MG  +P  N   SG  P     FDPPKK KRNKYA+A +FLAS+ S+LLGYDIGVMSGAA
Sbjct  1    MGTRKPAENDVFSGQTPKVIADFDPPKKPKRNKYALACSFLASMTSVLLGYDIGVMSGAA  60

Query  291  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  470
            IYI++D K++D +VEIL+GILNLYSL+GS  AGRTSDWIGRR T+V AS +FF GA+LMG
Sbjct  61   IYIKRDFKLSDVKVEILVGILNLYSLLGSAAAGRTSDWIGRRLTIVFASAIFFAGALLMG  120

Query  471  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVS  650
            FSTNY FLMVGRFVAG+GVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVS
Sbjct  121  FSTNYAFLMVGRFVAGVGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVS  180

Query  651  NFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            N+ F  +  HL WRFMLG+G++PSV L + VLAMP
Sbjct  181  NYGFSKLPPHLGWRFMLGIGAVPSVFLALGVLAMP  215



>ref|XP_008387370.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=538

 Score =   293 bits (751),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = +3

Query  147  RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDT  326
            +  GS  +  FDPPKK KRNKYA   A LAS+ SILLGYDIGVMSGAAIYIQKDLKI+D 
Sbjct  14   QQTGSRGLSDFDPPKKPKRNKYAFGCAILASMTSILLGYDIGVMSGAAIYIQKDLKISDV  73

Query  327  QVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGR  506
            ++EILLGI+N+YSL GS  AGRTSDWIGRRYT+V+A  +FF GA+LMGFSTNY FLMVGR
Sbjct  74   EIEILLGIINVYSLFGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFSTNYAFLMVGR  133

Query  507  FVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLS  686
            FVAGIG+GYALMIAPVYTAEV+PAS RGFLTSFPEVF+N GIL+GYVSN+AF  +  +L 
Sbjct  134  FVAGIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFVNVGILLGYVSNYAFSKLPTNLG  193

Query  687  WRFMLGVGSIPSVLLGVSVLAMP  755
            WR MLG+G++PSV L V VLAMP
Sbjct  194  WRLMLGIGAVPSVFLAVGVLAMP  216



>gb|KEH30426.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=522

 Score =   292 bits (748),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 149/210 (71%), Positives = 177/210 (84%), Gaps = 0/210 (0%)
 Frame = +3

Query  126  MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  305
            M + + V      ++  FDP KK KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI++
Sbjct  1    MSEGKIVEAKAQKNLQDFDPQKKPKRNKYAFACAMLASMTSILLGYDIGVMSGAAIYIKR  60

Query  306  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  485
            DLK++D ++E+LLGI+N+YSLIGSC+AGRTSDWIGRRYT+V A  +FFVGA+LMGFS NY
Sbjct  61   DLKVSDGKIEVLLGIINIYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFVGALLMGFSPNY  120

Query  486  TFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFK  665
             FLM GRFVAG+G+GYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SN+AF 
Sbjct  121  NFLMFGRFVAGVGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYISNYAFS  180

Query  666  NMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
             +S+ L WR MLGVG+IPSV+L V VLAMP
Sbjct  181  KLSLKLGWRMMLGVGAIPSVILAVGVLAMP  210



>ref|XP_003541068.1| PREDICTED: polyol transporter 5-like [Glycine max]
Length=523

 Score =   292 bits (748),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 175/204 (86%), Gaps = 2/204 (1%)
 Frame = +3

Query  150  NAGSGH--IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKIND  323
             A   H  +  FDPPKK KRNKYA A A LAS+ SILLGYDIGVMSGAA+YI++DLK++D
Sbjct  8    EAAEAHKTLEDFDPPKKRKRNKYAFACAVLASMTSILLGYDIGVMSGAALYIKRDLKVSD  67

Query  324  TQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVG  503
             Q+EILLGI+NLYSLIGSC+AGRTSDWIGRRYT+V A  +FFVGA+LMGFS NY+FLM G
Sbjct  68   VQIEILLGIINLYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFVGALLMGFSPNYSFLMFG  127

Query  504  RFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHL  683
            RFVAGIG+GYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SN+ F  +++ +
Sbjct  128  RFVAGIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNYGFSKLTLKV  187

Query  684  SWRFMLGVGSIPSVLLGVSVLAMP  755
             WR MLGVG+IPSV+L V VLAMP
Sbjct  188  GWRMMLGVGAIPSVVLTVGVLAMP  211



>ref|NP_001287655.1| polyol transporter 5-like [Solanum lycopersicum]
 dbj|BAO96229.1| polyol/monosaccharide transporter 4 [Solanum lycopersicum]
Length=541

 Score =   293 bits (749),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  162  GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  341
              I  FDPPKK K NKYAIA  FLASL+SILLGYDIGVMSGA +YI+KDL I D QVEIL
Sbjct  10   ARIQDFDPPKKPKTNKYAIACTFLASLSSILLGYDIGVMSGAILYIKKDLHITDVQVEIL  69

Query  342  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGI  521
            +GILN+YSL GS  AGRTSDWIGRRYTMVVA+ +FF GA+LMGF+T Y FLM GRFVAG+
Sbjct  70   VGILNVYSLFGSAAAGRTSDWIGRRYTMVVAAGIFFAGALLMGFATTYAFLMFGRFVAGV  129

Query  522  GVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFML  701
            GVGYALM+APVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSN  F  +S HLSWRFML
Sbjct  130  GVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINFGILMGYVSNVVFSKLSTHLSWRFML  189

Query  702  GVGSIPSVLLGVSVLAMP  755
            G+G+IPSV L VSVLAMP
Sbjct  190  GIGAIPSVFLAVSVLAMP  207



>ref|XP_009344431.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
 ref|XP_009344432.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=535

 Score =   292 bits (748),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 170/196 (87%), Gaps = 0/196 (0%)
 Frame = +3

Query  168  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  347
            I  FDPP+K KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI+ DLKI+D +VE+LLG
Sbjct  19   IEDFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDLKISDVEVEVLLG  78

Query  348  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  527
            ILNLYSLIGS  AGRTSDW+GRRYT+V+A  +FFVGA+LMGF+TNY FLM GRFVAGIGV
Sbjct  79   ILNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYAFLMFGRFVAGIGV  138

Query  528  GYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGV  707
            GYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +  HL WR MLGV
Sbjct  139  GYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSKLPKHLGWRLMLGV  198

Query  708  GSIPSVLLGVSVLAMP  755
            G+IPS+ L V VLAMP
Sbjct  199  GAIPSIFLAVGVLAMP  214



>gb|AGG19155.1| sorbitol transporter [Pyrus pyrifolia]
Length=535

 Score =   292 bits (748),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 170/196 (87%), Gaps = 0/196 (0%)
 Frame = +3

Query  168  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  347
            I  FDPP+K KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI+ DLKI+D +VE+LLG
Sbjct  19   IEDFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDLKISDVEVEVLLG  78

Query  348  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  527
            ILNLYSLIGS  AGRTSDW+GRRYT+V+A  +FFVGA+LMGF+TNY FLM GRFVAGIGV
Sbjct  79   ILNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYAFLMFGRFVAGIGV  138

Query  528  GYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGV  707
            GYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +  HL WR MLGV
Sbjct  139  GYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSKLPKHLGWRLMLGV  198

Query  708  GSIPSVLLGVSVLAMP  755
            G+IPS+ L V VLAMP
Sbjct  199  GAIPSIFLAVGVLAMP  214



>ref|XP_009375627.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=535

 Score =   292 bits (748),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 169/196 (86%), Gaps = 0/196 (0%)
 Frame = +3

Query  168  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  347
            I  FDPP+K KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI+ DLKI D +VE+LLG
Sbjct  19   IEDFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDLKITDVEVEVLLG  78

Query  348  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  527
            ILNLYSLIGS  AGRTSDW+GRRYT+V+A  +FFVGA+LMGF+TNY FLM GRFVAGIGV
Sbjct  79   ILNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYAFLMFGRFVAGIGV  138

Query  528  GYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGV  707
            GYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +  HL WR MLGV
Sbjct  139  GYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSKLPKHLGWRLMLGV  198

Query  708  GSIPSVLLGVSVLAMP  755
            G+IPS+ L V VLAMP
Sbjct  199  GAIPSIFLAVGVLAMP  214



>ref|XP_004299107.1| PREDICTED: polyol transporter 5-like [Fragaria vesca subsp. vesca]
Length=535

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 177/215 (82%), Gaps = 5/215 (2%)
 Frame = +3

Query  126  MGDTRPVRNAGSGH-----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  290
            M D R   NA SG      I  FDP  K KRNKYA A A LAS+ SILLGYDIGVMSGAA
Sbjct  1    MADRRAEENAVSGQPTQKAIADFDPAPKPKRNKYAFACAMLASMTSILLGYDIGVMSGAA  60

Query  291  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  470
            I+I+ DLKI+D QVE+L+GILNLYSLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMG
Sbjct  61   IFIKDDLKISDVQVEVLMGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMG  120

Query  471  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVS  650
            F+TNY+FLM GRFVAGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+S
Sbjct  121  FATNYSFLMFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYIS  180

Query  651  NFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            N+AF  ++++L WR MLGVG+IPS+ L + VLAMP
Sbjct  181  NWAFSELALNLGWRLMLGVGAIPSIFLAIGVLAMP  215



>ref|XP_008387369.1| PREDICTED: putative polyol transporter 1 isoform X2 [Malus domestica]
Length=535

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = +3

Query  132  DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  311
            D   V +     I  FDPP+K KRNKYA A A LAS+ SILLG DIGVMSGAAIYI+ DL
Sbjct  7    DDNTVSSQPQKTIEDFDPPQKPKRNKYAFACAILASMTSILLGLDIGVMSGAAIYIKDDL  66

Query  312  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  491
            KI+D +VEILLGILNLYSLIGS  AGRTSDW+GRRYT+V+A  +FFVGA+LMGF+TNY F
Sbjct  67   KISDVEVEILLGILNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYAF  126

Query  492  LMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNM  671
            LM GRFVAG+GVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +
Sbjct  127  LMFGRFVAGVGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSKL  186

Query  672  SVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
              HL WR MLGVG+IPS+ L V VLAMP
Sbjct  187  PTHLGWRLMLGVGAIPSIFLAVGVLAMP  214



>ref|XP_002519083.1| sugar transporter, putative [Ricinus communis]
 gb|EEF43294.1| sugar transporter, putative [Ricinus communis]
Length=539

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 176/211 (83%), Gaps = 9/211 (4%)
 Frame = +3

Query  150  NAGSGHIPA---------FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQ  302
            NA S   PA         FDPPKK KRNK+A+A A LAS+ SILLGYDIGVMSGAAIYI+
Sbjct  5    NADSSTQPAPISNKTIADFDPPKKPKRNKFALACAILASMTSILLGYDIGVMSGAAIYIK  64

Query  303  KDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTN  482
             + +++D QVEIL+G LNLYSL+GS  AGRTSDWIGRRYT+VVA  +FFVGA+LMGF+T+
Sbjct  65   DEFRLSDLQVEILVGTLNLYSLVGSAAAGRTSDWIGRRYTIVVAGAIFFVGALLMGFATS  124

Query  483  YTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAF  662
            Y FLMVGRFVAGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSNFAF
Sbjct  125  YAFLMVGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAF  184

Query  663  KNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
              +  HL WRFMLGVG++PSV+L V VLAMP
Sbjct  185  SKLPTHLGWRFMLGVGAVPSVILAVIVLAMP  215



>gb|AFI61955.1| polyol transporter [Camellia sinensis]
Length=532

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 180/214 (84%), Gaps = 4/214 (2%)
 Frame = +3

Query  126  MGDTRPVRNAGSG----HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  293
            M D +P  N  SG    HIPA DPP+K KRNKYA A A LAS+ SILLGYD GVMSGAA+
Sbjct  1    MADRKPQNNGFSGQTQTHIPALDPPQKPKRNKYAFACAILASMTSILLGYDGGVMSGAAL  60

Query  294  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  473
            +I+ DLKI+D Q+E+L+GI++LYSL+G   AGRTSDW+GRRYT+V+A+ +FFVGAILMGF
Sbjct  61   FIKDDLKISDVQLEVLMGIMSLYSLLGCYAAGRTSDWVGRRYTIVIAAAIFFVGAILMGF  120

Query  474  STNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSN  653
            +TNY FLMVGRFVAGIGVGYAL+IAPVYTAEV+PA+ RGFLTSFPEVFIN G+L+GYVSN
Sbjct  121  ATNYAFLMVGRFVAGIGVGYALLIAPVYTAEVSPAASRGFLTSFPEVFINAGVLLGYVSN  180

Query  654  FAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            +AF  + ++L WR MLG+G+IPSV L + VLAMP
Sbjct  181  YAFSKLPLYLGWRLMLGIGAIPSVFLALGVLAMP  214



>ref|XP_006365518.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=566

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  162  GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  341
              I  FDPPKK K NKYAIA  FLASL+SILLGYDIGVMSGA IYI+KDL I D QVEIL
Sbjct  36   ARIQDFDPPKKPKTNKYAIACTFLASLSSILLGYDIGVMSGAIIYIKKDLHITDVQVEIL  95

Query  342  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGI  521
            +GILN+YSL GS  AGRTSDWIGRRYTMVVA+ +FF GA+LMGF+T Y FLM GRFVAG+
Sbjct  96   VGILNVYSLFGSAAAGRTSDWIGRRYTMVVAAGIFFAGALLMGFATTYAFLMFGRFVAGV  155

Query  522  GVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFML  701
            GVGYALM+APVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSN AF  +  HLSWRFML
Sbjct  156  GVGYALMVAPVYTAEVSPASSRGFLTSFPEVFINFGILMGYVSNVAFSKLPTHLSWRFML  215

Query  702  GVGSIPSVLLGVSVLAMP  755
            G+G++PSV L VSVLAMP
Sbjct  216  GIGAVPSVFLAVSVLAMP  233



>ref|XP_009344433.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=537

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 168/193 (87%), Gaps = 0/193 (0%)
 Frame = +3

Query  177  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  356
            FDPPKK+KRNKYA   A LAS+ SILLGYDIGVMSGAAIYIQKDLKI+D Q+EILLGILN
Sbjct  23   FDPPKKLKRNKYAFGCAILASMTSILLGYDIGVMSGAAIYIQKDLKISDVQIEILLGILN  82

Query  357  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  536
            +YSL GS  AGRTSDWIGRRYT+V+A  +FF GA+LMGF+TNY FLMVGRFVAGIGVGYA
Sbjct  83   VYSLFGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYVFLMVGRFVAGIGVGYA  142

Query  537  LMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSI  716
            LMIAPVYTAEV+PAS RGFLTSFPEVF+N GIL+GYVSN+AF  +  +L WR MLGVG++
Sbjct  143  LMIAPVYTAEVSPASSRGFLTSFPEVFVNVGILLGYVSNYAFSKLPTNLGWRLMLGVGAV  202

Query  717  PSVLLGVSVLAMP  755
            P V L + VLAMP
Sbjct  203  PCVFLALGVLAMP  215



>ref|XP_012069681.1| PREDICTED: putative polyol transporter 1 [Jatropha curcas]
 gb|KDP46230.1| hypothetical protein JCGZ_10070 [Jatropha curcas]
Length=542

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = +3

Query  147  RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDT  326
            +N     +  FDPPKK K NK+A+A A LAS+ SILLGYDIGVMSGAAIYI+ DLKI+D 
Sbjct  18   QNQTEKRLADFDPPKKPKSNKFALACAVLASMTSILLGYDIGVMSGAAIYIKDDLKISDL  77

Query  327  QVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGR  506
            QVE+L+G LN+YSL+GS  AGRTSDWIGRRYT+VVA  +FFVGA+LMGF+T Y FLMVGR
Sbjct  78   QVEVLVGTLNIYSLVGSAAAGRTSDWIGRRYTIVVAGAIFFVGALLMGFATTYAFLMVGR  137

Query  507  FVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLS  686
            FVAGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSNFAF  +  HLS
Sbjct  138  FVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNFAFSKLPTHLS  197

Query  687  WRFMLGVGSIPSVLLGVSVLAMP  755
            WRFMLG+G++PSV L + VL MP
Sbjct  198  WRFMLGIGAVPSVFLALIVLVMP  220



>gb|ACC61047.1| mannitol transporter [Gossypium hirsutum]
Length=392

 Score =   286 bits (732),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 177/208 (85%), Gaps = 2/208 (1%)
 Frame = +3

Query  135  TRPVRNAGSGHIPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  311
            TRPV  A + +   F+P  KK KRNK+A A A LASL SILLGYDIGV+SGA IYIQ+DL
Sbjct  13   TRPVM-ADNRNFADFEPAVKKPKRNKFASACAILASLTSILLGYDIGVISGAIIYIQEDL  71

Query  312  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  491
            KIND Q EIL+GILN+YSL+GSC AGRTSDW+GRRYT+V+A  +FF+GA+LMGF+T+Y F
Sbjct  72   KINDVQKEILMGILNVYSLVGSCAAGRTSDWVGRRYTIVLAGAIFFLGALLMGFATSYAF  131

Query  492  LMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNM  671
            LMVGRFVAGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +
Sbjct  132  LMVGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNYAFSKL  191

Query  672  SVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
               L WRFMLG+G+IPSVLL V VLAMP
Sbjct  192  PTDLGWRFMLGIGAIPSVLLAVGVLAMP  219



>ref|XP_007200585.1| hypothetical protein PRUPE_ppa007633mg [Prunus persica]
 gb|EMJ01784.1| hypothetical protein PRUPE_ppa007633mg [Prunus persica]
Length=361

 Score =   285 bits (729),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 152/215 (71%), Positives = 173/215 (80%), Gaps = 5/215 (2%)
 Frame = +3

Query  126  MGDTRPVRNAG-SGH----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  290
            M D R   NA  SG     I  FDPP K KRNKYA A A LAS+ SILLGYDIGVMSGAA
Sbjct  1    MADERAEDNAVVSGQPQKTIADFDPPGKPKRNKYAFACAILASMTSILLGYDIGVMSGAA  60

Query  291  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  470
            IYI+KDLK++D ++E+L+GILNLYSLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMG
Sbjct  61   IYIKKDLKVSDVEIEVLIGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMG  120

Query  471  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVS  650
            F+ NY FLM GRF+AGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL GYVS
Sbjct  121  FAPNYAFLMFGRFIAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILFGYVS  180

Query  651  NFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            N+ F  +  HL WR MLGVG+IP++ L + VLAMP
Sbjct  181  NYGFSKLPTHLGWRLMLGVGAIPAIFLAIGVLAMP  215



>emb|CAJ29291.1| putative polyol transporter protein 4 [Lotus japonicus]
Length=519

 Score =   289 bits (740),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = +3

Query  147  RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDT  326
             NA   ++  FDP KK KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI++DLK++D 
Sbjct  11   ENANQKNLQDFDPQKKPKRNKYAFACAMLASMTSILLGYDIGVMSGAAIYIKRDLKVSDV  70

Query  327  QVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGR  506
            ++EILLGI+NLYSLIGS +AGRTSDWIGRRYT+V A  +FFVGA+LMGFS NY FLM GR
Sbjct  71   KIEILLGIINLYSLIGSGLAGRTSDWIGRRYTIVFAGAIFFVGALLMGFSPNYWFLMFGR  130

Query  507  FVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLS  686
            F+AGIG+GYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SNFAF  +S+ + 
Sbjct  131  FIAGIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNFAFSKLSLKVG  190

Query  687  WRFMLGVGSIPSVLLGVSVLAMP  755
            WR MLGVG++PSV+LGV VLAMP
Sbjct  191  WRMMLGVGALPSVILGVGVLAMP  213



>emb|CAP58707.1| putative polyol transported protein 2 [Hevea brasiliensis]
Length=547

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = +3

Query  177  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  356
            FDP KK KRNK+A A A LAS+ SILLGYDIGVMSGAAIYI+K+LKI+DTQVEIL G LN
Sbjct  25   FDPQKKPKRNKFAFACAILASMTSILLGYDIGVMSGAAIYIKKNLKISDTQVEILAGTLN  84

Query  357  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  536
            +YSL+GS  AGRTSDWIGRRYT+V+A  +FFVGA+LMGF+TNY FLMVGRFVAG+GVGYA
Sbjct  85   IYSLVGSAAAGRTSDWIGRRYTIVMAGGIFFVGALLMGFATNYAFLMVGRFVAGVGVGYA  144

Query  537  LMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSI  716
            LMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSNFAF  +  +LSWRFMLG+G+I
Sbjct  145  LMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNFAFSKLPANLSWRFMLGIGAI  204

Query  717  PSVLLGVSVLAMP  755
            PSV L + VLAMP
Sbjct  205  PSVFLAMMVLAMP  217



>ref|XP_012069657.1| PREDICTED: putative polyol transporter 1 [Jatropha curcas]
Length=542

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = +3

Query  147  RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDT  326
            +N     +  FDPPKK K NK+A+A A LAS+ SILLGYDIGVMSGAAIYI+ DL+I+D 
Sbjct  18   QNQTEKRLADFDPPKKPKSNKFALACAVLASMTSILLGYDIGVMSGAAIYIKDDLQISDF  77

Query  327  QVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGR  506
            QVE+L+G LN+YSL+GS  AGRTSDWIGRRYT+VVA  +FFVGA+LMGF+T Y FLMVGR
Sbjct  78   QVEVLVGTLNIYSLVGSAAAGRTSDWIGRRYTIVVAGAIFFVGALLMGFATTYAFLMVGR  137

Query  507  FVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLS  686
            FVAGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSNFAF  +  HLS
Sbjct  138  FVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNFAFSKLPTHLS  197

Query  687  WRFMLGVGSIPSVLLGVSVLAMP  755
            WRFMLG+G++PSV L + VL MP
Sbjct  198  WRFMLGIGAVPSVFLALIVLVMP  220



>ref|XP_009375628.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=537

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = +3

Query  177  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  356
            FDPPKK KRNKYA   A LAS+ SILLGYDIGVMSGAAIYIQKDLKI+D Q+EILLGILN
Sbjct  23   FDPPKKPKRNKYAFGCAILASMTSILLGYDIGVMSGAAIYIQKDLKISDVQIEILLGILN  82

Query  357  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  536
            +YSL GS  AGRTSDWIGRRYT+V+A  +FF GA+LMGF+TNY FLMVGRFVAGIGVGYA
Sbjct  83   VYSLFGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYVFLMVGRFVAGIGVGYA  142

Query  537  LMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSI  716
            LMIAPVYTAEV+PAS RGFLTSFPEVF+N GIL+GYVSN+AF  +  +L WR MLG+G++
Sbjct  143  LMIAPVYTAEVSPASSRGFLTSFPEVFVNVGILLGYVSNYAFSKLPTNLGWRLMLGIGAV  202

Query  717  PSVLLGVSVLAMP  755
            P V L + VLAMP
Sbjct  203  PCVFLALGVLAMP  215



>ref|XP_008393068.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=538

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 175/208 (84%), Gaps = 0/208 (0%)
 Frame = +3

Query  132  DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  311
            D    +  GS  +  FD PKK KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI++DL
Sbjct  8    DNAVSQQPGSRGLSEFDSPKKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKEDL  67

Query  312  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  491
            KI+D ++EILLGI+N+YSLIGS  AGRTSD IGRRYT+V+A  +FF GA+LMGF+TNY F
Sbjct  68   KISDVEIEILLGIINVYSLIGSAAAGRTSDRIGRRYTIVLAGAIFFTGALLMGFATNYVF  127

Query  492  LMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNM  671
            LMVGRFVAGIG+GYALMIAPVYTAEV+PAS RGFLTSFPEVF+N GIL+GYVSN+AF  +
Sbjct  128  LMVGRFVAGIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFVNIGILLGYVSNYAFSKL  187

Query  672  SVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
              HL WR MLG+G++PSV+LGV VLAMP
Sbjct  188  PTHLGWRLMLGIGAVPSVILGVGVLAMP  215



>gb|EPS69995.1| sugar transport protein [Genlisea aurea]
Length=530

 Score =   288 bits (738),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = +3

Query  177  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  356
            FDPPKK KRNKYA+A AFLAS+ SILLGYDIGVMSGA IYI++D+++ D Q E+++GILN
Sbjct  19   FDPPKKPKRNKYALACAFLASMTSILLGYDIGVMSGAIIYIRRDIRMTDVQQEVIMGILN  78

Query  357  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  536
            LYSLIGS +AGRTSDW+GRRYT+++A  +FF GA+LMGF+TNY FLMVGRFVAGIGVGYA
Sbjct  79   LYSLIGSALAGRTSDWLGRRYTIILAGAIFFFGALLMGFATNYAFLMVGRFVAGIGVGYA  138

Query  537  LMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSI  716
            LMIAPVYTAEVAPAS RGFLTSFPEVFINFGIL+GYVSN+ F  +  HL WRFMLG+G++
Sbjct  139  LMIAPVYTAEVAPASSRGFLTSFPEVFINFGILLGYVSNYGFSKIPQHLGWRFMLGIGAV  198

Query  717  PSVLLGVSVLAMP  755
            PS+L+ V VLAMP
Sbjct  199  PSILIAVGVLAMP  211



>gb|KHN25361.1| Polyol transporter 5 [Glycine soja]
Length=521

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 175/204 (86%), Gaps = 4/204 (2%)
 Frame = +3

Query  150  NAGSGH--IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKIND  323
             A   H  +  FDPPKK KRNKYA A A LAS+ SILLGYDIGVMSGAA+YI++DLK++D
Sbjct  8    EAAEAHKTLEDFDPPKKRKRNKYAFACAVLASMTSILLGYDIGVMSGAALYIKRDLKVSD  67

Query  324  TQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVG  503
             Q+EILLGI+NLYSLIGSC+AGRTSDWIGRRYT+V A  +FFVGA+LMGFS NY+FLM G
Sbjct  68   VQIEILLGIINLYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFVGALLMGFSPNYSFLMFG  127

Query  504  RFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHL  683
            RFVAGIG+GYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SN+ F  +++ +
Sbjct  128  RFVAGIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNYGFSKLTLKV  187

Query  684  SWRFMLGVGSIPSVLLGVSVLAMP  755
             WR MLGVG+IPSV+L  +VLAMP
Sbjct  188  GWRMMLGVGAIPSVVL--TVLAMP  209



>gb|KHG20989.1| Polyol transporter 5 -like protein [Gossypium arboreum]
Length=539

 Score =   288 bits (737),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 177/209 (85%), Gaps = 2/209 (1%)
 Frame = +3

Query  132  DTRPVRNAGSGHIPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKD  308
             TRPV  A + +   F+P  KK KRNK+A A A LASL SILLGYDIGVMSGA IYIQ+D
Sbjct  12   STRPVM-ADNRNFADFEPAVKKPKRNKFAFACAILASLTSILLGYDIGVMSGAIIYIQED  70

Query  309  LKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYT  488
            LKIND Q EIL+GILN+YSL+GSC AGRTSDW+GRRYT+V+A  +FF+GA+LMGF+T+Y 
Sbjct  71   LKINDVQKEILMGILNVYSLVGSCAAGRTSDWVGRRYTIVLAGAIFFLGALLMGFATSYA  130

Query  489  FLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKN  668
            FLMVGRFVAGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  
Sbjct  131  FLMVGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNYAFSK  190

Query  669  MSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            +   L WRFMLG+G+IPSVLL V VLAMP
Sbjct  191  LPTDLGWRFMLGIGAIPSVLLAVGVLAMP  219



>ref|XP_003539021.2| PREDICTED: polyol transporter 5-like [Glycine max]
Length=312

 Score =   280 bits (717),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 165/194 (85%), Gaps = 1/194 (1%)
 Frame = +3

Query  177  FDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGIL  353
            FDPP KK KRN YA A A LA+  SILLGYDIGVMSGAAIYI+KDLK++D Q+EIL+GI 
Sbjct  21   FDPPIKKPKRNTYAFACAMLATTTSILLGYDIGVMSGAAIYIKKDLKVSDVQIEILIGIF  80

Query  354  NLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGY  533
            NLYSLIGSC+AGRTSDWIGRRYT+V A  +FF GAILMGFS NY FLM GRFVAGIG+GY
Sbjct  81   NLYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFAGAILMGFSPNYAFLMFGRFVAGIGMGY  140

Query  534  ALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGS  713
             LMIAPVYT+EV+PAS RGFLTSF EVFIN GIL+GY+SN+AF  M++ L WR MLG G+
Sbjct  141  GLMIAPVYTSEVSPASSRGFLTSFTEVFINVGILLGYISNYAFSKMTLKLGWRMMLGTGA  200

Query  714  IPSVLLGVSVLAMP  755
            IPS+LL V VLAMP
Sbjct  201  IPSILLTVGVLAMP  214



>gb|KJB32189.1| hypothetical protein B456_005G228500 [Gossypium raimondii]
Length=539

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 175/209 (84%), Gaps = 2/209 (1%)
 Frame = +3

Query  132  DTRPVRNAGSGHIPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKD  308
             TRPV  A +     F+P  KK KRNK+A A A LASL SILLGYDIGVMSGA IYIQ+D
Sbjct  12   STRPVM-ADNRSFADFEPAVKKPKRNKFAFACAILASLTSILLGYDIGVMSGAIIYIQED  70

Query  309  LKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYT  488
            LKIND Q EIL+GILN+YSL+GSC AGRTSDW+GRRYT+V+A  +FF+GA+LMGF+T+Y 
Sbjct  71   LKINDVQKEILMGILNVYSLVGSCAAGRTSDWVGRRYTIVLAGAIFFLGALLMGFATSYA  130

Query  489  FLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKN  668
            FLMVGRFVAGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  
Sbjct  131  FLMVGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNYAFSK  190

Query  669  MSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            +   L WRFMLGVG+IPSV L V VLAMP
Sbjct  191  LPTDLGWRFMLGVGAIPSVFLAVGVLAMP  219



>ref|XP_007131851.1| hypothetical protein PHAVU_011G046700g [Phaseolus vulgaris]
 gb|ESW03845.1| hypothetical protein PHAVU_011G046700g [Phaseolus vulgaris]
Length=518

 Score =   285 bits (729),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 168/193 (87%), Gaps = 0/193 (0%)
 Frame = +3

Query  177  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  356
            F+  KK KRNKYA   A LAS+ SILLGYDIGVMSGAAIYI++DLK++D Q+EIL+GI+N
Sbjct  16   FNSSKKPKRNKYAFGCAILASMTSILLGYDIGVMSGAAIYIKRDLKVSDVQIEILMGIIN  75

Query  357  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  536
            LYSLIGSC+AGRTSDWIGRRYT+V A  +FF GA+LMGFS NY FLM GRFVAGIG+GYA
Sbjct  76   LYSLIGSCLAGRTSDWIGRRYTIVFAGTIFFAGALLMGFSPNYLFLMFGRFVAGIGIGYA  135

Query  537  LMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSI  716
            LMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSNFAF  M++ L WR MLG+G++
Sbjct  136  LMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNFAFSKMTLKLGWRMMLGIGAV  195

Query  717  PSVLLGVSVLAMP  755
            PSVLL + VLAMP
Sbjct  196  PSVLLTLGVLAMP  208



>gb|KFK30307.1| hypothetical protein AALP_AA7G244900 [Arabis alpina]
Length=526

 Score =   284 bits (727),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = +3

Query  141  PVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKIN  320
            P     + H+P   PP K KRNKYA A A LAS+ SILLGYDIGVMSGA IYIQ+DLKI 
Sbjct  12   PPPAPATKHVPELGPPVKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIQRDLKIT  71

Query  321  DTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMV  500
            D QV IL GILN+YSLIGSC AG+TSDWIGRRYT+V+A  +FF GA+LMGF+ NY FLM 
Sbjct  72   DIQVGILAGILNIYSLIGSCAAGKTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMF  131

Query  501  GRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVH  680
            GRFVAGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GI++GYVSN AF N  + 
Sbjct  132  GRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGIMLGYVSNLAFSNFPLK  191

Query  681  LSWRFMLGVGSIPSVLLGVSVLAMP  755
            L WRFMLG+G +PSVLL + VLAMP
Sbjct  192  LGWRFMLGIGVVPSVLLALGVLAMP  216



>gb|AAM44082.1| putative sorbitol transporter [Prunus cerasus]
Length=538

 Score =   285 bits (728),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 171/215 (80%), Gaps = 5/215 (2%)
 Frame = +3

Query  126  MGDTRPVRNA-----GSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  290
            M D R   NA        +I  FDPP K KRNKYA A A LAS+ SILLGYDIGVMSGA 
Sbjct  1    MADRRAEYNAVVSGQPQKNIADFDPPGKPKRNKYAFACAILASMTSILLGYDIGVMSGAV  60

Query  291  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  470
            IYI+KDLK++D ++E+L+GILNLYSLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMG
Sbjct  61   IYIKKDLKVSDVEIEVLVGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMG  120

Query  471  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVS  650
            F+ NY FLM GRFVAGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL GYVS
Sbjct  121  FAPNYAFLMFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILFGYVS  180

Query  651  NFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            N+ F  +  HL WR MLGVG+IPS+ L + VLAMP
Sbjct  181  NYGFSKLPTHLGWRLMLGVGAIPSIFLAIGVLAMP  215



>ref|XP_006406559.1| hypothetical protein EUTSA_v10020495mg [Eutrema salsugineum]
 gb|ESQ48012.1| hypothetical protein EUTSA_v10020495mg [Eutrema salsugineum]
Length=529

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 168/200 (84%), Gaps = 0/200 (0%)
 Frame = +3

Query  156  GSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVE  335
            G+ H+P   PP K KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++DLKI+D Q+ 
Sbjct  17   GTKHVPELGPPAKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKISDLQIG  76

Query  336  ILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVA  515
            IL GILN+YSLIGSC AG+TSDWIGRRYT+V+A  +FF GA+LMGF+ NY FLM GRFVA
Sbjct  77   ILAGILNIYSLIGSCAAGKTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMFGRFVA  136

Query  516  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRF  695
            GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GI++GYVSN AF    + L WRF
Sbjct  137  GIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGIMLGYVSNLAFSKFPLKLGWRF  196

Query  696  MLGVGSIPSVLLGVSVLAMP  755
            MLG+G++PSV+L + VLAMP
Sbjct  197  MLGIGAVPSVILAIGVLAMP  216



>ref|XP_007042744.1| Polyol/monosaccharide transporter 5 [Theobroma cacao]
 gb|EOX98575.1| Polyol/monosaccharide transporter 5 [Theobroma cacao]
Length=538

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = +3

Query  177  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  356
            F+P KK KRNK+A A A LASL SILLGYDIGVMSGA IYI+ DLKIND QVEIL+GILN
Sbjct  25   FEPAKKPKRNKFAFACAILASLTSILLGYDIGVMSGAVIYIKDDLKINDVQVEILVGILN  84

Query  357  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  536
            LY L+GSC AGRTSDWIGRRYT+V A  +FFVGA+LMGF+TNY FLMVGRFVAGIGVGYA
Sbjct  85   LYCLVGSCAAGRTSDWIGRRYTIVFACAIFFVGALLMGFATNYAFLMVGRFVAGIGVGYA  144

Query  537  LMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSI  716
            LMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +  ++ WR MLG+G +
Sbjct  145  LMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYVSNYAFSKLPTNIGWRLMLGIGGV  204

Query  717  PSVLLGVSVLAMP  755
            PSV L + V+AMP
Sbjct  205  PSVFLAIGVIAMP  217



>ref|XP_008236795.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=538

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 152/215 (71%), Positives = 173/215 (80%), Gaps = 5/215 (2%)
 Frame = +3

Query  126  MGDTRPVRNAG-SGH----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  290
            M D R   NA  SG     I  FDPP K KRNKYA A A LAS+ SILLGYDIGVMSGAA
Sbjct  1    MADRRAEDNAVVSGQPQKTIADFDPPGKPKRNKYAFACAILASMTSILLGYDIGVMSGAA  60

Query  291  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  470
            IYI+KDLK++D ++E+L+GILNLYSLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMG
Sbjct  61   IYIKKDLKVSDVEIEVLIGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGGIFFAGALLMG  120

Query  471  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVS  650
            F+ NY FLM GRF+AGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL GYVS
Sbjct  121  FAPNYAFLMFGRFIAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILFGYVS  180

Query  651  NFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            N+ F  +  HL WR MLGVG+IP++ L + VLAMP
Sbjct  181  NYGFSKLPTHLGWRLMLGVGAIPAIFLAIGVLAMP  215



>ref|XP_006423215.1| hypothetical protein CICLE_v10028170mg [Citrus clementina]
 gb|ESR36455.1| hypothetical protein CICLE_v10028170mg [Citrus clementina]
Length=535

 Score =   283 bits (725),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = +3

Query  177  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  356
            FDP KK KRN YA  AA LAS+ SILLGYDIGVMSGAA+YI+ D K++DTQ+EIL+GILN
Sbjct  24   FDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDFKVSDTQIEILIGILN  83

Query  357  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  536
            +YSLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMGF+TNY FLM GRFVAG+GVGYA
Sbjct  84   IYSLIGSLAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYAFLMGGRFVAGVGVGYA  143

Query  537  LMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSI  716
            LMIAPVYTAE++PAS RGFLTSFPEVFIN GIL+GYVSN+ F  + +HL WR MLG+G+I
Sbjct  144  LMIAPVYTAELSPASTRGFLTSFPEVFINGGILLGYVSNYGFSKLPLHLGWRMMLGIGAI  203

Query  717  PSVLLGVSVLAMP  755
            PSVLL V VLAMP
Sbjct  204  PSVLLAVGVLAMP  216



>ref|XP_008795608.1| PREDICTED: putative polyol transporter 1 [Phoenix dactylifera]
Length=522

 Score =   283 bits (723),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 172/215 (80%), Gaps = 5/215 (2%)
 Frame = +3

Query  126  MGDTRPVRNAGSGHIPAFDPPKKV-----KRNKYaiaaaflaslasillGYDIGVMSGAA  290
            M D +P     +  +P    P+ V     ++NKYA   A LAS+ SILLGYDIGVMSGAA
Sbjct  1    MTDQKPEATKVASQVPHDSLPEAVAPRPRRKNKYAFGCAMLASMTSILLGYDIGVMSGAA  60

Query  291  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  470
            I+IQ DL + DTQ+EILLGILNLYSL+GS  AGRTSDWIGRRYT+V A+V+FFVGAI+MG
Sbjct  61   IFIQDDLHVTDTQIEILLGILNLYSLVGSLAAGRTSDWIGRRYTIVFAAVIFFVGAIMMG  120

Query  471  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVS  650
             + NY FLMVGRFVAG+GVGYALMIAPVYTAEVAPAS RGFLTSF EVFIN GIL+GYVS
Sbjct  121  LAPNYAFLMVGRFVAGVGVGYALMIAPVYTAEVAPASSRGFLTSFAEVFINSGILLGYVS  180

Query  651  NFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            NFAF  +  HL+WR MLGVG++PSV LGV VLAMP
Sbjct  181  NFAFSKLPEHLAWRLMLGVGAVPSVFLGVGVLAMP  215



>ref|XP_004148857.1| PREDICTED: polyol transporter 5-like [Cucumis sativus]
 gb|KGN61777.1| hypothetical protein Csa_2G245410 [Cucumis sativus]
Length=533

 Score =   283 bits (723),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 175/198 (88%), Gaps = 2/198 (1%)
 Frame = +3

Query  168  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  347
            +P FDPPKK KRNK+++A A LAS+ S+LLGYDIGVMSGAA++I++D +++DT++EIL+G
Sbjct  20   LPDFDPPKKNKRNKFSLACATLASMTSVLLGYDIGVMSGAAMFIKEDFRLSDTKIEILVG  79

Query  348  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  527
            ILNLYSLIGS  AGRTSDWIGRRYTMVVA+V+FF GA+LMGF+T+Y+FLM GRFVAG+GV
Sbjct  80   ILNLYSLIGSAAAGRTSDWIGRRYTMVVAAVIFFAGALLMGFATSYSFLMFGRFVAGVGV  139

Query  528  GYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMS--VHLSWRFML  701
            GYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+ F  +S  V + WR+ML
Sbjct  140  GYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNYGFSKVSDPVKMGWRYML  199

Query  702  GVGSIPSVLLGVSVLAMP  755
            G+G+IPSV L + VL MP
Sbjct  200  GIGAIPSVFLALIVLIMP  217



>gb|AAT06053.2| sorbitol transporter [Malus domestica]
Length=533

 Score =   282 bits (722),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = +3

Query  132  DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  311
            D   V +     I  FDPP+K KRNKYA A A LAS+ SIL+GYDIGVMSGA+IYI+KDL
Sbjct  7    DDNTVSSQPQKTIADFDPPQKPKRNKYAFACAILASMTSILMGYDIGVMSGASIYIEKDL  66

Query  312  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  491
            K+ DTQ+EI++G++ +YSLIGS MAG+TSDW+GRRYT+V++  +FF+GAILMGFSTNYTF
Sbjct  67   KVTDTQIEIMIGVIEIYSLIGSAMAGKTSDWVGRRYTIVISGAIFFIGAILMGFSTNYTF  126

Query  492  LMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNM  671
            LM GRFVAGIGVGYAL IAPVY+AEV+P S RGFLTSFPEVF+N GIL+GY+SN+AF   
Sbjct  127  LMCGRFVAGIGVGYALTIAPVYSAEVSPTSSRGFLTSFPEVFVNIGILLGYLSNYAFSFC  186

Query  672  SVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
             + L WR MLGVG+IPSV L V VLAMP
Sbjct  187  PLDLGWRLMLGVGAIPSVGLAVGVLAMP  214



>gb|AGY96955.1| polyol transporter 1 [Vitis vinifera]
Length=528

 Score =   282 bits (721),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 169/196 (86%), Gaps = 0/196 (0%)
 Frame = +3

Query  168  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  347
            +  FD PKK  RNKYAIA   LAS+ SILLGYDIGVMSGAAIYI+KDLKI+D +VEIL+G
Sbjct  19   VTEFDAPKKKGRNKYAIACTILASMTSILLGYDIGVMSGAAIYIKKDLKISDVEVEILVG  78

Query  348  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  527
            ILN+Y L GS  AGRTSDWIGRRYT+V+ASV+FF+GA+LMGF+TNY FLMVGRFVAGIGV
Sbjct  79   ILNVYCLFGSAAAGRTSDWIGRRYTIVLASVIFFLGALLMGFATNYVFLMVGRFVAGIGV  138

Query  528  GYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGV  707
            GYALMIAPVY AEV+PAS RGF+TSFPEVFIN GIL GY+SN+AF  +  +L WRFMLG+
Sbjct  139  GYALMIAPVYAAEVSPASSRGFITSFPEVFINAGILFGYISNYAFSKLPTNLGWRFMLGI  198

Query  708  GSIPSVLLGVSVLAMP  755
            G+IPSV L + V+AMP
Sbjct  199  GAIPSVFLALVVIAMP  214



>ref|XP_007131850.1| hypothetical protein PHAVU_011G046600g [Phaseolus vulgaris]
 gb|ESW03844.1| hypothetical protein PHAVU_011G046600g [Phaseolus vulgaris]
Length=510

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 166/196 (85%), Gaps = 0/196 (0%)
 Frame = +3

Query  168  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  347
            +  FDPPKK K NKYA   A LAS   ILLGYDIGVM+GAAIYI++DLK++D Q+EILLG
Sbjct  13   LEDFDPPKKHKTNKYAFGCAILASTTCILLGYDIGVMTGAAIYIKRDLKVSDVQIEILLG  72

Query  348  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  527
            I+NLYSLIGSC+AGRTSDW+GRRYT+V A  +FF GA+LMGFS NY+FLM GRFVAGIG+
Sbjct  73   IINLYSLIGSCVAGRTSDWLGRRYTIVFAGTIFFAGALLMGFSPNYSFLMFGRFVAGIGI  132

Query  528  GYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGV  707
            GYALMI PVY+AEV+PAS RGFLTSF EVFIN GIL+GY+SN+AF  M++ L WR MLG+
Sbjct  133  GYALMIGPVYSAEVSPASYRGFLTSFTEVFINGGILLGYISNYAFSKMTLKLGWRMMLGI  192

Query  708  GSIPSVLLGVSVLAMP  755
            G+IPS+LL V VL MP
Sbjct  193  GAIPSILLTVGVLVMP  208



>ref|XP_003631630.1| PREDICTED: polyol transporter 5 [Vitis vinifera]
 gb|ADP37154.1| putative polyol/monosaccharide transporter [Vitis vinifera]
Length=528

 Score =   281 bits (720),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 169/196 (86%), Gaps = 0/196 (0%)
 Frame = +3

Query  168  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  347
            +  FD PKK  RNKYAIA   LAS+ SILLGYDIGVMSGAAIYI+KDLKI+D +VEIL+G
Sbjct  19   VTEFDAPKKNGRNKYAIACTILASMTSILLGYDIGVMSGAAIYIKKDLKISDVEVEILVG  78

Query  348  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  527
            ILN+Y L GS  AGRTSDWIGRRYT+V+ASV+FF+GA+LMGF+TNY FLMVGRFVAGIGV
Sbjct  79   ILNVYCLFGSAAAGRTSDWIGRRYTIVLASVIFFLGALLMGFATNYVFLMVGRFVAGIGV  138

Query  528  GYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGV  707
            GYALMIAPVY AEV+PAS RGF+TSFPEVFIN GIL GY+SN+AF  +  +L WRFMLG+
Sbjct  139  GYALMIAPVYAAEVSPASSRGFITSFPEVFINAGILFGYISNYAFSKLPTNLGWRFMLGI  198

Query  708  GSIPSVLLGVSVLAMP  755
            G+IPSV L + V+AMP
Sbjct  199  GAIPSVFLALVVIAMP  214



>ref|NP_001289249.1| polyol transporter 5-like [Pyrus x bretschneideri]
 ref|XP_009375824.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
 gb|AFM91103.1| sorbitol transporter [Pyrus x bretschneideri]
Length=526

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 175/215 (81%), Gaps = 5/215 (2%)
 Frame = +3

Query  126  MGDTRPVRNAGSGH-----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  290
            M D R    A +G      I  FDPPKK K  K+AIA   LAS+ SILLGYDIGVMSGA+
Sbjct  3    MTDRRAEDKAITGQAQNTSIADFDPPKKAKTKKFAIACGVLASMTSILLGYDIGVMSGAS  62

Query  291  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  470
            ++I+++LKI+D QVEIL G LNLYSLIGS +AGRTSDWIGRRYT+V+A  +FF+GA+LMG
Sbjct  63   LFIKENLKISDVQVEILNGTLNLYSLIGSALAGRTSDWIGRRYTIVLAGTIFFIGALLMG  122

Query  471  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVS  650
            F+ NY FLM GRFVAG+GVGYALMIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GYVS
Sbjct  123  FAPNYAFLMFGRFVAGVGVGYALMIAPVYTAEISPASYRGFLTSFPEVFVNIGILLGYVS  182

Query  651  NFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            N+AF  + +HL+WR MLGVG+ PSV+L V VLAMP
Sbjct  183  NYAFSKLPIHLNWRIMLGVGAFPSVILAVGVLAMP  217



>gb|ACB86853.1| mannitol transporter [Citrus sinensis]
Length=535

 Score =   281 bits (720),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = +3

Query  177  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  356
            FDP KK KRN YA  AA LAS+ SILLGYDIGVMSGAA+YI+ DLK++DT++EIL+GILN
Sbjct  24   FDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDLKVSDTKIEILMGILN  83

Query  357  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  536
            +YSLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMGF+TNY FLM GRF AGIGVGYA
Sbjct  84   IYSLIGSLAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYAFLMGGRFGAGIGVGYA  143

Query  537  LMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSI  716
            LMIAPVYTAE++PAS RGFLTSFPEVFIN GIL+GYVSN+ F  + +HL WR MLG+G+I
Sbjct  144  LMIAPVYTAELSPASTRGFLTSFPEVFINGGILLGYVSNYGFSKLPLHLGWRMMLGIGAI  203

Query  717  PSVLLGVSVLAMP  755
            PSVLL V VLAMP
Sbjct  204  PSVLLAVGVLAMP  216



>ref|XP_010065409.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
 gb|KCW62859.1| hypothetical protein EUGRSUZ_G00453 [Eucalyptus grandis]
Length=535

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 167/196 (85%), Gaps = 0/196 (0%)
 Frame = +3

Query  168  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  347
            I  FDPP + +RNKYA+A A LAS  SILLGYDIGVMSGA IYI+KDLKI+D +VEIL G
Sbjct  24   IEDFDPPARPRRNKYAMACATLASTTSILLGYDIGVMSGAIIYIKKDLKISDVEVEILTG  83

Query  348  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  527
            IL +YSL+GS MAGRTSDWIGRRYT+V+A  +FF GA+LMGF+ NY FLM GRFVAGIGV
Sbjct  84   ILAVYSLLGSAMAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMFGRFVAGIGV  143

Query  528  GYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGV  707
            GYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SN+AF  + ++L WR MLGV
Sbjct  144  GYALMIAPVYTAEVSPASTRGFLTSFPEVFINIGILLGYISNYAFSKLRLNLGWRMMLGV  203

Query  708  GSIPSVLLGVSVLAMP  755
            G+IPSVLL   VLAMP
Sbjct  204  GAIPSVLLAFGVLAMP  219



>ref|XP_006487182.1| PREDICTED: polyol transporter 5-like [Citrus sinensis]
Length=535

 Score =   280 bits (717),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = +3

Query  177  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  356
            FDP KK KRN YA  AA LAS+ SILLGYDIGVMSGAA+YI+ D K++DTQ+EIL+GILN
Sbjct  24   FDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDFKVSDTQIEILIGILN  83

Query  357  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  536
            +YSLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMGF+TNY FLM GRFVAG+GVGYA
Sbjct  84   IYSLIGSLAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYAFLMGGRFVAGVGVGYA  143

Query  537  LMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSI  716
            LMIAPVYTAE++PAS RGFLTSFPEVFIN GIL+GYVSN+ F  + +HL WR MLG+G+I
Sbjct  144  LMIAPVYTAELSPASTRGFLTSFPEVFINGGILLGYVSNYGFSKLPLHLGWRMMLGIGAI  203

Query  717  PSVLLGVSVLAMP  755
            PSVL  V VLAMP
Sbjct  204  PSVLPAVGVLAMP  216



>ref|XP_004148312.2| PREDICTED: polyol transporter 5-like [Cucumis sativus]
 gb|KGN44323.1| Sugar transporter [Cucumis sativus]
Length=516

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = +3

Query  186  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  365
            PKK KRNKYA   A LAS+ASILLGYD+GVMSGAAIYI+KD +IND Q E+++G++NLY+
Sbjct  14   PKKPKRNKYAFMCAILASMASILLGYDVGVMSGAAIYIKKDFQINDVQEEVMIGVINLYA  73

Query  366  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMI  545
            LIG+  AGRTSDWIGRRYTMV+A V+FF+GAILMGF+TNY FLM GRFVAGIGVGYALMI
Sbjct  74   LIGAAAAGRTSDWIGRRYTMVLAGVIFFLGAILMGFATNYEFLMFGRFVAGIGVGYALMI  133

Query  546  APVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSV  725
            +PVYTAEV+PAS RGFLTSFPEVFINFG+L+GY+SNF F  + +HL WRFMLG+G  PS+
Sbjct  134  SPVYTAEVSPASSRGFLTSFPEVFINFGVLLGYISNFFFSKLPLHLGWRFMLGIGVFPSI  193

Query  726  LLGVSVLAMP  755
             L V VL MP
Sbjct  194  FLAVVVLVMP  203



>ref|XP_009112300.1| PREDICTED: polyol transporter 5 [Brassica rapa]
 emb|CDY18552.1| BnaA01g26430D [Brassica napus]
Length=529

 Score =   280 bits (716),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 164/208 (79%), Gaps = 0/208 (0%)
 Frame = +3

Query  132  DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  311
             T P     + H+P   PP K KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++D 
Sbjct  9    QTVPTTAPATKHVPELGPPVKPKRNKYAFACAILASMTSILLGYDIGVMSGALIYIKRDF  68

Query  312  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  491
            KI D QV IL GILN++SLIGSC AG+TSDWIGRR T+V A  +FF GAILMG + NY F
Sbjct  69   KITDLQVSILAGILNIFSLIGSCAAGKTSDWIGRRNTIVFAGAIFFAGAILMGLAPNYAF  128

Query  492  LMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNM  671
            LM GRFVAG+GVGYALMIAPVYTAEVAPAS RGFLTSFPEVFIN GI++GYVSN AF   
Sbjct  129  LMFGRFVAGVGVGYALMIAPVYTAEVAPASSRGFLTSFPEVFINAGIMLGYVSNLAFSKF  188

Query  672  SVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
             + L WRFMLGVGS+PSVLL + VLAMP
Sbjct  189  PLKLGWRFMLGVGSVPSVLLAIGVLAMP  216



>emb|CDX95491.1| BnaC01g33830D [Brassica napus]
Length=531

 Score =   280 bits (716),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 164/208 (79%), Gaps = 0/208 (0%)
 Frame = +3

Query  132  DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  311
             T P     + H+P   PP K KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++D 
Sbjct  9    QTVPTTAPATKHVPELGPPLKPKRNKYAFACAILASMTSILLGYDIGVMSGALIYIKRDF  68

Query  312  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  491
            KI D QV IL GILN++SLIGSC AG+TSDWIGRR T+V A  +FF GAILMG + NY F
Sbjct  69   KITDLQVSILAGILNIFSLIGSCAAGKTSDWIGRRNTIVFAGAIFFAGAILMGLAPNYDF  128

Query  492  LMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNM  671
            LM GRFVAG+GVGYALMIAPVYTAEVAPAS RGFLTSFPEVFIN GI++GYVSN AF   
Sbjct  129  LMFGRFVAGVGVGYALMIAPVYTAEVAPASSRGFLTSFPEVFINAGIMLGYVSNLAFSKF  188

Query  672  SVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
             + L WRFMLGVGS+PSVLL + VLAMP
Sbjct  189  PLKLGWRFMLGVGSVPSVLLAIGVLAMP  216



>ref|NP_001236592.1| sorbitol-like transporter [Glycine max]
 emb|CAD91337.1| sorbitol-like transporter [Glycine max]
Length=523

 Score =   280 bits (716),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 170/204 (83%), Gaps = 2/204 (1%)
 Frame = +3

Query  150  NAGSGH--IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKIND  323
             A   H  +  FDPPKK KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI++DLK++D
Sbjct  8    EAAEAHKTLQDFDPPKKRKRNKYAFACAMLASMTSILLGYDIGVMSGAAIYIKRDLKVSD  67

Query  324  TQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVG  503
             Q+EILLGI+NLYSLIGSC+AGRTSDWIGRRYT+ +   +F VG+ LMGF  +Y+FLM G
Sbjct  68   EQIEILLGIINLYSLIGSCLAGRTSDWIGRRYTIGLGGAIFLVGSTLMGFYPHYSFLMCG  127

Query  504  RFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHL  683
            RFVAGIG+GYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SN+ F  +++ +
Sbjct  128  RFVAGIGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNYGFSKLTLKV  187

Query  684  SWRFMLGVGSIPSVLLGVSVLAMP  755
             WR MLGVG+IPSV+L   VLAMP
Sbjct  188  GWRMMLGVGAIPSVVLTEGVLAMP  211



>ref|XP_010527590.1| PREDICTED: polyol transporter 5-like [Tarenaya hassleriana]
Length=519

 Score =   280 bits (715),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 147/201 (73%), Positives = 168/201 (84%), Gaps = 0/201 (0%)
 Frame = +3

Query  153  AGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQV  332
            A    +P    P K KRNK+A A A LAS+ SILLGYDIGVMSGA IYI++DLKI D ++
Sbjct  14   APEKAVPEMSMPAKPKRNKFAFACAILASMTSILLGYDIGVMSGAIIYIKRDLKIGDGKI  73

Query  333  EILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFV  512
            ++L GILN++SLIGSC AGRTSDWIGRRYT+V+A  +FFVGAILMGF+TNY FLM GRFV
Sbjct  74   QVLTGILNIFSLIGSCAAGRTSDWIGRRYTIVLAGAIFFVGAILMGFATNYAFLMFGRFV  133

Query  513  AGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWR  692
            AGIGVGYALMIAPVYTAEV+PAS RGFL SFPEVFIN GIL+GYVSN+AF  +  +LSWR
Sbjct  134  AGIGVGYALMIAPVYTAEVSPASSRGFLNSFPEVFINAGILLGYVSNYAFSKLPENLSWR  193

Query  693  FMLGVGSIPSVLLGVSVLAMP  755
            FMLGVG+IPSV L V VLAMP
Sbjct  194  FMLGVGAIPSVFLAVGVLAMP  214



>emb|CDY61985.1| BnaC03g73840D [Brassica napus]
Length=530

 Score =   279 bits (713),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 165/197 (84%), Gaps = 0/197 (0%)
 Frame = +3

Query  165  HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILL  344
            H+P   P  K KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++DLKI+D Q+ IL 
Sbjct  26   HVPELGPQAKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKISDLQIGILA  85

Query  345  GILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIG  524
            GILN+YSL+GSC AGRTSDWIGRRYT+V+A  +FF GA+LMGF+ NY FLM GRFVAGIG
Sbjct  86   GILNIYSLLGSCAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMFGRFVAGIG  145

Query  525  VGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLG  704
            VGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GI++GYVSN AF    + L WRFMLG
Sbjct  146  VGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGIMLGYVSNLAFSKFPLKLGWRFMLG  205

Query  705  VGSIPSVLLGVSVLAMP  755
            +G+IPSV+L + VLAMP
Sbjct  206  IGAIPSVVLAIGVLAMP  222



>ref|XP_010096202.1| Polyol transporter 5 [Morus notabilis]
 gb|EXB63597.1| Polyol transporter 5 [Morus notabilis]
Length=541

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 174/214 (81%), Gaps = 4/214 (2%)
 Frame = +3

Query  126  MGDTRPVRNAGSGH----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  293
            M D +   N  SG     I  FDPPK+ ++N +AIA A LAS+ SILLGYDIGVMSGA I
Sbjct  1    MADRKAEVNGISGQTQKTIADFDPPKRPRKNIFAIACAVLASMTSILLGYDIGVMSGAVI  60

Query  294  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  473
            +I++DLKI+D +VEIL GILNLYSL+GS  AGRTSDWIGRRYT+V+A  +FF GA+LMGF
Sbjct  61   FIKEDLKISDVKVEILTGILNLYSLLGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMGF  120

Query  474  STNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSN  653
            +TNY FLM GRFVAGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN
Sbjct  121  ATNYAFLMFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSN  180

Query  654  FAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            +AF  +  +L WR MLGVG+IPSV+L V VL MP
Sbjct  181  YAFSKLPTYLGWRLMLGVGAIPSVMLAVVVLIMP  214



>ref|XP_009135601.1| PREDICTED: polyol transporter 5 [Brassica rapa]
Length=532

 Score =   279 bits (713),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 165/197 (84%), Gaps = 0/197 (0%)
 Frame = +3

Query  165  HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILL  344
            H+P   P  K KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++DLKI+D Q+ IL 
Sbjct  26   HVPELGPQAKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKISDLQIGILA  85

Query  345  GILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIG  524
            GILN+YSL+GSC AGRTSDWIGRRYT+V+A  +FF GA+LMGF+ NY FLM GRFVAGIG
Sbjct  86   GILNIYSLLGSCAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMFGRFVAGIG  145

Query  525  VGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLG  704
            VGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GI++GYVSN AF    + L WRFMLG
Sbjct  146  VGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGIMLGYVSNLAFSKFPLKLGWRFMLG  205

Query  705  VGSIPSVLLGVSVLAMP  755
            +G+IPSV+L + VLAMP
Sbjct  206  IGAIPSVVLAIGVLAMP  222



>ref|XP_010909852.1| PREDICTED: putative polyol transporter 1 [Elaeis guineensis]
Length=520

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 175/215 (81%), Gaps = 5/215 (2%)
 Frame = +3

Query  126  MGDTRPVRNAGSGHIPAFDPP----KKVKRNK-YaiaaaflaslasillGYDIGVMSGAA  290
            M D +P     +   P+   P     +++RNK +A A A LAS+ SILLGYDIGVMSGAA
Sbjct  1    MSDRKPEATKVASQGPSVSLPYAVTPRLRRNKRFAFACAMLASMTSILLGYDIGVMSGAA  60

Query  291  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  470
            I+I+ DL ++DTQ+EILLGILNLYSL+GS  AGRTSDWIGRRYT+V A+V+FF+GAI+MG
Sbjct  61   IFIKDDLHVSDTQIEILLGILNLYSLVGSLAAGRTSDWIGRRYTIVFAAVIFFIGAIMMG  120

Query  471  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVS  650
             + NY FLMVGRFVAG+GVGYALMIAPVYTAEVAPAS RGFLTSFPEVFIN GIL+GYVS
Sbjct  121  LAPNYAFLMVGRFVAGVGVGYALMIAPVYTAEVAPASSRGFLTSFPEVFINSGILLGYVS  180

Query  651  NFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            NFAF  +  HL+WR MLGVG+IPSV LGV VLAMP
Sbjct  181  NFAFARLPQHLNWRLMLGVGAIPSVFLGVGVLAMP  215



>emb|CDP10064.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 172/196 (88%), Gaps = 0/196 (0%)
 Frame = +3

Query  168  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  347
            IP F PP + KRNKY++A A LAS+ SILLGYD GVMSGA +YI++DL ++D Q+EIL+G
Sbjct  17   IPDFGPPPRPKRNKYSLACALLASMTSILLGYDTGVMSGATLYIKQDLHVSDVQIEILVG  76

Query  348  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  527
             +N+YSL+GS +AG+TSD +GRRYT+V+A+VVFFVGA LMGF+TNY FLM GRFVAGIGV
Sbjct  77   TINIYSLVGSAIAGKTSDMVGRRYTIVIAAVVFFVGAFLMGFATNYAFLMFGRFVAGIGV  136

Query  528  GYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGV  707
            GYALMIAPVYTAEVAP+S RGFLTSFPEVFINFG+L+GYVSN+ F  + V+L WRFM+GV
Sbjct  137  GYALMIAPVYTAEVAPSSSRGFLTSFPEVFINFGVLLGYVSNYFFAKLPVNLGWRFMMGV  196

Query  708  GSIPSVLLGVSVLAMP  755
            G++PSVLLG+ VLAMP
Sbjct  197  GALPSVLLGLGVLAMP  212



>ref|XP_002313809.1| putative sorbitol transporter family protein [Populus trichocarpa]
 gb|EEE87764.1| putative sorbitol transporter family protein [Populus trichocarpa]
Length=533

 Score =   278 bits (711),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 171/209 (82%), Gaps = 0/209 (0%)
 Frame = +3

Query  129  GDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKD  308
            GD  P + A    +  FDP KK KRNK+A A A LAS+ S+LLGYDIGVMSGA IYIQ D
Sbjct  9    GDANPSQPALDRTLADFDPVKKPKRNKFAFACAILASMTSVLLGYDIGVMSGANIYIQDD  68

Query  309  LKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYT  488
            LKI+D QV +L+G LNLYSL+GS  AGRTSD IGRRYT+V+A  +FF+G+ILMGF+TNY 
Sbjct  69   LKISDLQVALLVGTLNLYSLVGSAAAGRTSDRIGRRYTIVMAGAIFFLGSILMGFATNYA  128

Query  489  FLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKN  668
            FLMVGRFVAG+GVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  
Sbjct  129  FLMVGRFVAGVGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYVSNYAFSK  188

Query  669  MSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            +  +L WRFMLG+G+IPSV L + VL MP
Sbjct  189  LPTNLGWRFMLGIGAIPSVFLALVVLGMP  217



>gb|AAY86779.1| putative sugar transporter protein [Noccaea caerulescens]
Length=253

 Score =   268 bits (686),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 162/198 (82%), Gaps = 1/198 (1%)
 Frame = +3

Query  165  HIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  341
            H+P +  PP K KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++DLK  D Q+ IL
Sbjct  20   HLPESGPPPAKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKCTDLQIGIL  79

Query  342  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGI  521
             G LN+YSL+GSC AGRTSDWIGRRYT+V+A  +FF GA+LMGFS NY FLM GRFVAG+
Sbjct  80   AGSLNIYSLVGSCAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFSPNYAFLMFGRFVAGV  139

Query  522  GVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFML  701
            GVGYALMIAPVYTAEVAPAS RGFLTSFPEVFIN GI++GYVSN AF    + + WR ML
Sbjct  140  GVGYALMIAPVYTAEVAPASSRGFLTSFPEVFINAGIMLGYVSNLAFSKFPLKVGWRLML  199

Query  702  GVGSIPSVLLGVSVLAMP  755
            G+G++PSVLL + VL MP
Sbjct  200  GIGAVPSVLLAIVVLVMP  217



>ref|XP_007135989.1| hypothetical protein PHAVU_009G008900g [Phaseolus vulgaris]
 gb|ESW07983.1| hypothetical protein PHAVU_009G008900g [Phaseolus vulgaris]
Length=514

 Score =   277 bits (708),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = +3

Query  147  RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDT  326
            + A    +  FDP K  KRNK+A A A LAS+ SILLGYD+GVMSGA IYI++DLK+ D 
Sbjct  5    KAAAQKSLEDFDPKKAPKRNKFAFACAILASMTSILLGYDVGVMSGAVIYIKRDLKLTDV  64

Query  327  QVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGR  506
            Q+EI++GI+NLYSLIGSC+AGRTSDWIGRRYT+V+A  +FF+GAILMGFS NY FLM  R
Sbjct  65   QIEIVVGIINLYSLIGSCLAGRTSDWIGRRYTIVLAGGIFFMGAILMGFSPNYPFLMFAR  124

Query  507  FVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLS  686
            FVAG+G+GYALMIAPVYTAEV+P S RGFLTSFPEVF+N GIL+GY+SN+ F  + +H+ 
Sbjct  125  FVAGVGIGYALMIAPVYTAEVSPPSCRGFLTSFPEVFVNGGILLGYISNYGFSKLPLHMG  184

Query  687  WRFMLGVGSIPSVLLGVSVLAMP  755
            WR MLGVG++PSV+L V VLAMP
Sbjct  185  WRMMLGVGAVPSVILAVGVLAMP  207



>ref|XP_009345071.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   277 bits (708),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 145/215 (67%), Positives = 173/215 (80%), Gaps = 5/215 (2%)
 Frame = +3

Query  126  MGDTRPVRNAGSGH-----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  290
            M D R      +G      I  FDPPKK K  K+AIA   LAS+ SILLGYDIGVMSGA+
Sbjct  3    MTDRRADDQTITGEAQNTCIADFDPPKKAKTKKFAIACGILASMTSILLGYDIGVMSGAS  62

Query  291  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  470
            ++I+++LKI+D QVEIL G LNLYSLIGS +AGRTSDWIGRRYT+V+A  +FF+GAILMG
Sbjct  63   LFIKENLKISDVQVEILNGTLNLYSLIGSALAGRTSDWIGRRYTIVLAGTIFFIGAILMG  122

Query  471  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVS  650
             + NY FLM GRFVAG+GVGYALMIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GYVS
Sbjct  123  LAPNYAFLMFGRFVAGVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNIGILLGYVS  182

Query  651  NFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            N+AF  + +HL+WR MLGVG+ PSV+L + VLAMP
Sbjct  183  NYAFSKLPIHLNWRVMLGVGAFPSVVLAIGVLAMP  217



>ref|XP_008361285.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=527

 Score =   277 bits (708),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 168/196 (86%), Gaps = 0/196 (0%)
 Frame = +3

Query  168  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  347
            I  FDPPKK K  K+AIA   LAS+ SILLGYDIGVMSGA+++I+++LKI+D QVEIL G
Sbjct  22   IADFDPPKKAKTKKFAIACGILASMTSILLGYDIGVMSGASLFIKENLKISDVQVEILNG  81

Query  348  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  527
             LNLYSLIGS +AGRTSDWIGRRYT+V+A  +FF+GAILMG + NY FLM GRFVAG+GV
Sbjct  82   TLNLYSLIGSALAGRTSDWIGRRYTIVLAGTIFFIGAILMGLAPNYAFLMFGRFVAGVGV  141

Query  528  GYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGV  707
            GYALMIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GYVSN+AF  + +HL+WR MLGV
Sbjct  142  GYALMIAPVYTAEISPASFRGFLTSFPEVFVNIGILLGYVSNYAFSKLPIHLNWRVMLGV  201

Query  708  GSIPSVLLGVSVLAMP  755
            G+ PSV+L + VLAMP
Sbjct  202  GAFPSVVLAIGVLAMP  217



>ref|XP_011078883.1| PREDICTED: polyol transporter 5-like isoform X1 [Sesamum indicum]
Length=526

 Score =   277 bits (708),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +3

Query  186  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  365
            P K KRNKYA+A + LAS+ S+LLGYD GVMSGA IYI++DLKI+D Q+EIL+G +N+YS
Sbjct  31   PTKHKRNKYALAISVLASMTSVLLGYDTGVMSGATIYIKRDLKISDVQIEILVGTINIYS  90

Query  366  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMI  545
            L+GS +AGRTSDWIGRRYT+V AS +FF GAILMGF+ NY FLMVGRFVAGIGVGYALMI
Sbjct  91   LLGSAVAGRTSDWIGRRYTIVFASAIFFAGAILMGFAANYAFLMVGRFVAGIGVGYALMI  150

Query  546  APVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSV  725
            APVY AEVAPAS RGFLTSFPEVFINFG+L+GYVSN+AF  + + L WR MLGVG++PS+
Sbjct  151  APVYAAEVAPASCRGFLTSFPEVFINFGVLLGYVSNYAFAKLPLKLGWRLMLGVGAVPSI  210

Query  726  LLGVSVLAMP  755
             L + VLAMP
Sbjct  211  FLAIGVLAMP  220



>ref|XP_009375822.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=520

 Score =   276 bits (706),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 171/212 (81%), Gaps = 2/212 (1%)
 Frame = +3

Query  126  MGDTRPVRNAGSGH--IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYI  299
            M D +P     SG   I  FDPPK  K  K+A+A A LAS+ SILLGYDIGVMSGA+++I
Sbjct  3    MADRKPEDTEASGQKTIADFDPPKAAKTKKFAVACAILASMTSILLGYDIGVMSGASLFI  62

Query  300  QKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFST  479
            +++LKI D QVE+L G LNLYSLIGS +AGRTSDWIGRRYT+V++  +FF GA+LMGF+ 
Sbjct  63   KENLKITDVQVEVLNGTLNLYSLIGSALAGRTSDWIGRRYTIVLSGAIFFAGALLMGFAP  122

Query  480  NYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFA  659
            NY FLM GRF+AG+GVGYALMIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GYVSN+A
Sbjct  123  NYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSNYA  182

Query  660  FKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
               + +HL+WR MLG+G++PS+ L V VL MP
Sbjct  183  LAKLPIHLNWRIMLGIGAVPSLFLAVGVLGMP  214



>ref|NP_001280902.1| putative polyol transporter 1 [Malus domestica]
 dbj|BAD42343.1| sorbitol transporter [Malus domestica]
Length=526

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 173/215 (80%), Gaps = 5/215 (2%)
 Frame = +3

Query  126  MGDTRPVRNAGSG-----HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  290
            M D R   NA +G      I  FDPP K K +K+AIA A LA   S+LLGYDIGVMSGA+
Sbjct  1    MADRRAEENAVTGGPQNTSIEDFDPPMKPKTSKFAIACALLACTTSVLLGYDIGVMSGAS  60

Query  291  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  470
            +YIQK+LKI+D QVE+L G LN+YSL+GS  AGRTSDWIGR+YT+V+A V+F VGA+LMG
Sbjct  61   LYIQKNLKISDVQVEVLAGTLNIYSLLGSAFAGRTSDWIGRKYTIVLAGVIFLVGALLMG  120

Query  471  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVS  650
            F+TNY FLMVGRFVAG+GVGY +MIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GY++
Sbjct  121  FATNYAFLMVGRFVAGVGVGYGMMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYIA  180

Query  651  NFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            N+AF  + +HL WRFMLGVG +P++ L V VL MP
Sbjct  181  NYAFSKLPLHLGWRFMLGVGGVPAIFLTVGVLFMP  215



>ref|XP_010065405.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
 gb|KCW62856.1| hypothetical protein EUGRSUZ_G00450 [Eucalyptus grandis]
Length=535

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 165/196 (84%), Gaps = 0/196 (0%)
 Frame = +3

Query  168  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  347
            I  FDPP + +RNKYA+A A LAS  SILLGYDIGVMSGA IYI++DLKI+D +VEIL G
Sbjct  24   IEDFDPPARPRRNKYAMACATLASTTSILLGYDIGVMSGAIIYIKEDLKISDVEVEILTG  83

Query  348  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  527
            IL +YSL+GS MAGRTSDWIGRRYT+V+A  +FF GA+LMGF+ NY FLM GRFVAGIGV
Sbjct  84   ILAVYSLLGSPMAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMFGRFVAGIGV  143

Query  528  GYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGV  707
            GYALMIAPVYTAEV+PAS RGFL SFPEVFIN GIL+GY+SN+AF  + + L WR MLGV
Sbjct  144  GYALMIAPVYTAEVSPASTRGFLNSFPEVFINIGILLGYISNYAFSKLRLSLGWRMMLGV  203

Query  708  GSIPSVLLGVSVLAMP  755
            G+IPSVLL   VLAMP
Sbjct  204  GAIPSVLLAFGVLAMP  219



>ref|XP_011048787.1| PREDICTED: polyol transporter 5-like [Populus euphratica]
Length=532

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 169/209 (81%), Gaps = 0/209 (0%)
 Frame = +3

Query  129  GDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKD  308
            GD  P + A    +  FDP KK KRNK+A A A +AS+ S+LLGYDIGVMSGA IYIQ D
Sbjct  9    GDANPSQPALDRKLADFDPAKKPKRNKFAFACASIASMTSVLLGYDIGVMSGANIYIQDD  68

Query  309  LKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYT  488
            LKIND QV +L+G LN+YSL+GS  AGRTSD IGRRYT+V+A  +FF+G++LMGF+TNY 
Sbjct  69   LKINDLQVALLVGTLNIYSLVGSAAAGRTSDRIGRRYTIVMAGAIFFLGSVLMGFATNYA  128

Query  489  FLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKN  668
            FLMVGRFVAG+GVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  
Sbjct  129  FLMVGRFVAGVGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSK  188

Query  669  MSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            +  +L WR MLGVG+IPSV L + V  MP
Sbjct  189  LPTNLGWRIMLGVGAIPSVFLALVVFGMP  217



>gb|EMS55536.1| Polyol transporter 5 [Triticum urartu]
Length=515

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 167/196 (85%), Gaps = 0/196 (0%)
 Frame = +3

Query  168  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  347
            +PA   PKK    ++A A A LAS+ SILLGYDIGVMSGA++YIQKDLKINDTQ+E+L+G
Sbjct  6    LPAAVEPKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIQKDLKINDTQLEVLMG  65

Query  348  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  527
            ILN+YSLIGS  AGRTSDWIGRR+T+V A+V+FF GA++MGFS NY  LM GRFVAGIGV
Sbjct  66   ILNVYSLIGSFAAGRTSDWIGRRFTIVFAAVIFFAGALIMGFSVNYAMLMFGRFVAGIGV  125

Query  528  GYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGV  707
            GYALMIAPVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSNFAF  +S+ L WR MLG+
Sbjct  126  GYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNFAFARLSLRLGWRIMLGI  185

Query  708  GSIPSVLLGVSVLAMP  755
            G++PSVLL   VL MP
Sbjct  186  GAVPSVLLAFMVLGMP  201



>gb|KJB12315.1| hypothetical protein B456_002G011400 [Gossypium raimondii]
Length=536

 Score =   275 bits (704),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 169/201 (84%), Gaps = 0/201 (0%)
 Frame = +3

Query  153  AGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQV  332
            AG+  +  F+  KK KRNK+A A + LASLASILLGYDIGVMSGA IYI+ DLKI+D QV
Sbjct  17   AGNKTVADFEVSKKPKRNKFAFACSILASLASILLGYDIGVMSGAIIYIKDDLKISDVQV  76

Query  333  EILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFV  512
            EIL+GILNLY LIG+  AGRTSDWIGRRYT+VVA+ +FFVGA+LMGF+TNY FLMVGRFV
Sbjct  77   EILVGILNLYCLIGAYAAGRTSDWIGRRYTIVVAAAIFFVGALLMGFATNYAFLMVGRFV  136

Query  513  AGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWR  692
            AGIGVG+AL+IAPVYTAEV+PAS RGFL SFPEVFIN G+L+GYVSN+AF  +   L WR
Sbjct  137  AGIGVGFALLIAPVYTAEVSPASSRGFLNSFPEVFINIGLLLGYVSNYAFSKLRADLGWR  196

Query  693  FMLGVGSIPSVLLGVSVLAMP  755
             MLG G+IPSV L + VLAMP
Sbjct  197  VMLGAGAIPSVFLAIGVLAMP  217



>emb|CAD58709.1| polyol transporter [Plantago major]
 emb|CAR82415.1| polyol transporter [Plantago major]
Length=529

 Score =   275 bits (703),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = +3

Query  183  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  362
            P K +KRNKYA+A + LAS+ S+LLGYD GVMSGA  +IQ+DL I D QVE+L+G +N+Y
Sbjct  33   PKKPLKRNKYALAISILASMTSVLLGYDCGVMSGATQFIQEDLIITDVQVELLVGTINIY  92

Query  363  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  542
            SL+GS +AGRTSDW+GRRYT+V AS +FF+GAILMGF+TNY FLMVGRFVAGIGVGYALM
Sbjct  93   SLVGSAVAGRTSDWVGRRYTIVFASTIFFLGAILMGFATNYAFLMVGRFVAGIGVGYALM  152

Query  543  IAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPS  722
            IAPVY AEVAPAS RGFLTSFPEVFINFG+L+GYVSNFAF  + + L WR MLGVG++PS
Sbjct  153  IAPVYAAEVAPASCRGFLTSFPEVFINFGVLLGYVSNFAFAKLPLTLGWRMMLGVGAVPS  212

Query  723  VLLGVSVLAMP  755
            VLLGV VL MP
Sbjct  213  VLLGVGVLYMP  223



>ref|XP_004300990.1| PREDICTED: polyol transporter 5-like [Fragaria vesca subsp. vesca]
Length=530

 Score =   275 bits (702),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 172/215 (80%), Gaps = 5/215 (2%)
 Frame = +3

Query  126  MGDTRPVRNAGSGH-----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  290
            M D R   N          I  FDP  K KRN+YA A A LAS+ SILLGYDIGVMSGAA
Sbjct  1    MADRRAEENGQPTQSTKKAIEDFDPAPKPKRNRYAFACAMLASMTSILLGYDIGVMSGAA  60

Query  291  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  470
            I+I+ DLKI+D QVE+L+GILNLYSLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMG
Sbjct  61   IFIKDDLKISDVQVEVLVGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMG  120

Query  471  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVS  650
            F+TNY+FLM GRFVAGIGVGYALMIAPVYT EV+PAS RGFLTSF ++FIN GIL+GY+S
Sbjct  121  FATNYSFLMFGRFVAGIGVGYALMIAPVYTVEVSPASSRGFLTSFADMFINAGILLGYIS  180

Query  651  NFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            N+AF  ++++L WR MLGVG+IPSV L + V+AMP
Sbjct  181  NWAFSKLALNLGWRLMLGVGAIPSVFLALGVIAMP  215



>ref|XP_008387377.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=520

 Score =   274 bits (701),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 171/212 (81%), Gaps = 2/212 (1%)
 Frame = +3

Query  126  MGDTRPVRNAGSGH--IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYI  299
            M D +P     SG   I  FDPPK  K  K+AIA A LAS+ SILLGYDIGVMSGA+++I
Sbjct  3    MADRKPQNTEASGQKTIADFDPPKAPKTKKFAIACATLASMTSILLGYDIGVMSGASLFI  62

Query  300  QKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFST  479
            +++LKI D QVE+L G LNLYSLIGS +AGRTSDWIGRRYT+V++  +FF GA+LMGF+ 
Sbjct  63   KENLKITDVQVEVLNGTLNLYSLIGSALAGRTSDWIGRRYTIVLSGAIFFAGALLMGFAP  122

Query  480  NYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFA  659
            NY FLM GRF+AG+GVGYALMIAPVYTAE++PAS RG LTSFPEVF+N GIL+GYVSN+A
Sbjct  123  NYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGLLTSFPEVFVNVGILLGYVSNYA  182

Query  660  FKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
               + +HL+WR MLG+G++PS+ L V VLAMP
Sbjct  183  LSXLPIHLNWRIMLGLGAVPSLFLAVGVLAMP  214



>ref|XP_009121242.1| PREDICTED: putative polyol transporter 1, partial [Brassica rapa]
Length=247

 Score =   265 bits (678),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 167/199 (84%), Gaps = 0/199 (0%)
 Frame = +3

Query  159  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  338
             G + A     +  R+++A A A LAS+ SI+LGYDIGVMSGAAI+I++DLK++D Q+EI
Sbjct  8    KGVVTAEAEAPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKEDLKLSDVQLEI  67

Query  339  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  518
            L+GILN+YSL+GS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  68   LMGILNIYSLVGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127

Query  519  IGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFM  698
            IGVGYA+MIAPVYTAEVAPA+ RGFL+SFPE+FIN GIL+GYVSN+ F  + VHL WRFM
Sbjct  128  IGVGYAMMIAPVYTAEVAPATSRGFLSSFPEIFINIGILLGYVSNYFFSKLPVHLGWRFM  187

Query  699  LGVGSIPSVLLGVSVLAMP  755
            LGVGSIPSV L + VLAMP
Sbjct  188  LGVGSIPSVCLAIGVLAMP  206



>gb|KCW55335.1| hypothetical protein EUGRSUZ_I01255 [Eucalyptus grandis]
Length=467

 Score =   272 bits (696),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +3

Query  183  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  362
            P K+  RNKYA A A LAS+ SILLGYDIGVMSGAAI I+K L +ND +VE+L+GI+NLY
Sbjct  28   PKKRPPRNKYAFACAILASMTSILLGYDIGVMSGAAIPIKKQLHLNDVEVEVLVGIINLY  87

Query  363  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  542
            SL+GS +AGRTSDW+GRRYTMV+A  +FFVGAILM F+ NY FLM GRFVAGIGVGYALM
Sbjct  88   SLLGSAVAGRTSDWVGRRYTMVIAGAIFFVGAILMAFAFNYAFLMFGRFVAGIGVGYALM  147

Query  543  IAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPS  722
            IAPVYTAEV+PAS RGFLTSFPEVFINFG+L+GYVSN+ F  + ++L WRFMLG+G +PS
Sbjct  148  IAPVYTAEVSPASARGFLTSFPEVFINFGVLLGYVSNYVFNKLPINLGWRFMLGIGVLPS  207

Query  723  VLLGVSVLAMP  755
            VLL + VLAMP
Sbjct  208  VLLAIGVLAMP  218



>ref|XP_010690917.1| PREDICTED: polyol transporter 5 isoform X2 [Beta vulgaris subsp. 
vulgaris]
 gb|AAB68029.1| putative sugar transporter; member of major facilitative superfamily; 
integral membrane protein [Beta vulgaris]
Length=545

 Score =   274 bits (700),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 171/211 (81%), Gaps = 3/211 (1%)
 Frame = +3

Query  126  MGDTRPVRNAGSGHIPAFDPPKKV-KRNKYaiaaaflaslasillGYDIGVMSGAAIYIQ  302
            M D  P     S  I  FDP KK  KRNK+A A A LAS+ S+LLGYDIGVMSGA IY++
Sbjct  9    MSDPPP--TTASKVIADFDPLKKPPKRNKFAFACATLASMTSVLLGYDIGVMSGAIIYLK  66

Query  303  KDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTN  482
            +D  I+DTQ+ +L+GILN+Y L GS  AGRTSDWIGRRYT+V+A  +FFVGA+LMGF+TN
Sbjct  67   EDWHISDTQIGVLVGILNIYCLFGSFAAGRTSDWIGRRYTIVLAGAIFFVGALLMGFATN  126

Query  483  YTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAF  662
            Y FLMVGRFV GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SN AF
Sbjct  127  YAFLMVGRFVTGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYISNLAF  186

Query  663  KNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
             ++  HLSWRFMLG+G+IPS+ L + VLAMP
Sbjct  187  SSLPTHLSWRFMLGIGAIPSIFLAIGVLAMP  217



>ref|XP_009407915.1| PREDICTED: putative polyol transporter 1 [Musa acuminata subsp. 
malaccensis]
Length=520

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = +3

Query  183  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  362
            PP K   NKYA   A LASLASILLGYDIGVMSGA ++I+ DLK+NDTQ+EILLG+LNLY
Sbjct  19   PPPKRGYNKYATGCAMLASLASILLGYDIGVMSGAELFIKDDLKLNDTQIEILLGVLNLY  78

Query  363  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  542
            SL+GS  AG TSDWIGRRYT+V A+ +FF GA+LMGF+TNY FLMVGRFVAGIGVGYALM
Sbjct  79   SLVGSFAAGFTSDWIGRRYTIVFAATIFFTGALLMGFATNYAFLMVGRFVAGIGVGYALM  138

Query  543  IAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPS  722
            IAP YTAEVAPAS RGFLTSFPEVFIN GIL+GYVSN+AF ++   L WR MLGVG+IPS
Sbjct  139  IAPTYTAEVAPASSRGFLTSFPEVFINSGILLGYVSNYAFSHLRESLGWRLMLGVGAIPS  198

Query  723  VLLGVSVLAMP  755
            V LG+ VLAMP
Sbjct  199  VFLGLGVLAMP  209



>ref|XP_008345143.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=527

 Score =   273 bits (699),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 173/214 (81%), Gaps = 4/214 (2%)
 Frame = +3

Query  126  MGDTRPVRNAGSGH----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  293
            M D     N  SG     I  FDPP K K  K+A+A A LAS+ SILLGYDIGVMSGA++
Sbjct  1    MADQAADNNVVSGQPQNSIADFDPPTKPKTKKFAVACAVLASMTSILLGYDIGVMSGASL  60

Query  294  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  473
            +I+++L I+D QVE+L G LN+YSLIGS +AG+TSDWIGRRYT+V+A  +FF+GA+LMGF
Sbjct  61   FIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGF  120

Query  474  STNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSN  653
            + NY FLM GRF+AG+GVGYALMIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GYVSN
Sbjct  121  APNYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSN  180

Query  654  FAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            FAF  + +HL+WR MLG+G+IPSV L + VLAMP
Sbjct  181  FAFAKLPIHLNWRIMLGIGAIPSVFLALGVLAMP  214



>ref|XP_008387376.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=520

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 170/212 (80%), Gaps = 2/212 (1%)
 Frame = +3

Query  126  MGDTRPVRNAGSGH--IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYI  299
            M D +P     SG   I  FDPPK  K  K+AIA A LAS+ SILLGYDIGVMSGA+++I
Sbjct  3    MADRKPQNTEASGQKTIADFDPPKAXKTKKFAIACATLASMTSILLGYDIGVMSGASLFI  62

Query  300  QKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFST  479
            +++LKI D QVE+L G LNLYSLIGS +AGRTSDWIGRRYT+V++  +FF GA+LMGF+ 
Sbjct  63   KENLKITDVQVEVLNGTLNLYSLIGSALAGRTSDWIGRRYTIVLSGAIFFAGALLMGFAP  122

Query  480  NYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFA  659
            NY FLM GRF+AG+GVGYALMIAPVYTAE++PAS RG LTSFPEVF+N GIL+GYVSN+A
Sbjct  123  NYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGLLTSFPEVFVNVGILLGYVSNYA  182

Query  660  FKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
               + +HL+WR MLG+G++PS+ L V VL MP
Sbjct  183  LSXLPIHLNWRIMLGLGAVPSLFLAVGVLXMP  214



>ref|XP_011088358.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=532

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 175/215 (81%), Gaps = 8/215 (4%)
 Frame = +3

Query  126  MGDTRPVRN---AGSGH--IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  290
            M D    RN   +   H  IPAFDPP+K KRNKYA+A +FLAS+ SILLGYDIGVMSGA 
Sbjct  1    MADGMSARNGVSSAPSHLPIPAFDPPRKPKRNKYALACSFLASMTSILLGYDIGVMSGAI  60

Query  291  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  470
            IYI+K++ + D Q E+++GILNLYSL+GS  AGRTSD    RYT++ A  +FF GA+LMG
Sbjct  61   IYIRKNIHMTDVQKEVIMGILNLYSLLGSAAAGRTSDC---RYTIIFAGAIFFAGALLMG  117

Query  471  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVS  650
            F+T+Y FLMVGRFVAGIGVGYALMIAPVYTAEVAPAS RGFLTSFPEVFINFGIL+GYVS
Sbjct  118  FATSYAFLMVGRFVAGIGVGYALMIAPVYTAEVAPASTRGFLTSFPEVFINFGILLGYVS  177

Query  651  NFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            N+AF  +  +L WRFMLG+G+IPSV + ++VLAMP
Sbjct  178  NYAFSKLPTNLGWRFMLGIGAIPSVFIAIAVLAMP  212



>gb|AEX55225.1| sugar transporter [Allium sativum]
Length=522

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 168/205 (82%), Gaps = 3/205 (1%)
 Frame = +3

Query  150  NAGSGHIP---AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKIN  320
            N  S  IP   A  PP+  K  ++A A A LAS+ SILLGYDIGVMSGAA++I+ DL ++
Sbjct  5    NLDSNIIPNEKADGPPRTKKNTRFASACALLASMTSILLGYDIGVMSGAALFIKDDLNVS  64

Query  321  DTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMV  500
            DTQ+EILLGILNLYSL+GS  AGRTSDWIGRRYT+V A+V+FFVGAI+MG S NY FLMV
Sbjct  65   DTQIEILLGILNLYSLLGSFAAGRTSDWIGRRYTIVFAAVIFFVGAIMMGLSPNYAFLMV  124

Query  501  GRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVH  680
            GRFVAGIGVGYALMIAPVYTAEV+PAS RGFLTSFPE+FIN GIL+GYVSNFAFK +  H
Sbjct  125  GRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEMFINLGILLGYVSNFAFKGLPRH  184

Query  681  LSWRFMLGVGSIPSVLLGVSVLAMP  755
              WR MLG+G+IPSV L V VL MP
Sbjct  185  YGWRVMLGIGAIPSVFLAVGVLGMP  209



>ref|XP_010690916.1| PREDICTED: polyol transporter 5 isoform X1 [Beta vulgaris subsp. 
vulgaris]
 gb|AAB68028.1| putative sugar transporter; member of major facilitative superfamily; 
integral membrane protein [Beta vulgaris]
Length=549

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 171/211 (81%), Gaps = 3/211 (1%)
 Frame = +3

Query  126  MGDTRPVRNAGSGHIPAFDPPKKV-KRNKYaiaaaflaslasillGYDIGVMSGAAIYIQ  302
            M D  P     S  I  FDP KK  KRNK+A A A LAS+ S+LLGYDIGVMSGA IY++
Sbjct  9    MSDPPP--TTASKVIADFDPLKKPPKRNKFAFACATLASMTSVLLGYDIGVMSGAIIYLK  66

Query  303  KDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTN  482
            +D  I+DTQ+ +L+GILN+Y L GS  AGRTSDWIGRRYT+V+A  +FFVGA+LMGF+TN
Sbjct  67   EDWHISDTQIGVLVGILNIYCLFGSFAAGRTSDWIGRRYTIVLAGAIFFVGALLMGFATN  126

Query  483  YTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAF  662
            Y FLMVGRFV GIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SN AF
Sbjct  127  YAFLMVGRFVTGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILLGYISNLAF  186

Query  663  KNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
             ++  HLSWRFMLG+G+IPS+ L + VLAMP
Sbjct  187  SSLPTHLSWRFMLGIGAIPSIFLAIGVLAMP  217



>ref|XP_006577924.1| PREDICTED: polyol transporter 5-like [Glycine max]
Length=509

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = +3

Query  147  RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDT  326
            + A    +  FDP K  +RNKYA A A LAS+ SILLGYD+GVMSGA IYI++DLK+ D 
Sbjct  5    KTATQKSLQDFDPQKTPRRNKYAFACAILASMTSILLGYDVGVMSGAIIYIKRDLKLTDV  64

Query  327  QVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGR  506
            Q+EIL+GI+NLYSLIGSC+AGRTSDWIGRRYT+V+A  +FF GAILMG S NY FLM  R
Sbjct  65   QIEILVGIINLYSLIGSCLAGRTSDWIGRRYTIVLAGSIFFAGAILMGISPNYPFLMFAR  124

Query  507  FVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLS  686
            F+AG+G+GYALMIAPVYT EV+P S RGFLTSFPEVFIN GIL+GY+SN+ F  +S+ L 
Sbjct  125  FIAGVGIGYALMIAPVYTTEVSPPSCRGFLTSFPEVFINGGILLGYISNYGFSKLSLELG  184

Query  687  WRFMLGVGSIPSVLLGVSVLAMP  755
            WR MLGVG++PSV+L + VLAMP
Sbjct  185  WRMMLGVGAVPSVILALGVLAMP  207



>ref|XP_006423216.1| hypothetical protein CICLE_v10028174mg [Citrus clementina]
 gb|ESR36456.1| hypothetical protein CICLE_v10028174mg [Citrus clementina]
Length=535

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = +3

Query  177  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  356
            FDP KK KRN YA  AA LAS+ SILLGYDIGVMSGAA+YI+ D K++DT++EIL+GILN
Sbjct  24   FDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDFKVSDTKIEILIGILN  83

Query  357  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  536
            ++SLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMGF+TNY FLM GRFVAG+GVGYA
Sbjct  84   IFSLIGSLAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYAFLMGGRFVAGVGVGYA  143

Query  537  LMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSI  716
             +IAPVYTAE++PAS RGFLTSFPEVFIN GIL+GYVSN+ F  + +HL WR MLG+G+I
Sbjct  144  ALIAPVYTAELSPASTRGFLTSFPEVFINGGILLGYVSNYGFSKLPLHLGWRMMLGIGAI  203

Query  717  PSVLLGVSVLAMP  755
            PSVL  V  LAMP
Sbjct  204  PSVLPAVGALAMP  216



>ref|XP_008236860.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
Length=525

 Score =   272 bits (696),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 165/196 (84%), Gaps = 0/196 (0%)
 Frame = +3

Query  168  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  347
            I  FDPP+K KRNK+AIA + LA + SILLGYDIGVMSGA ++IQ DLKIND Q++IL G
Sbjct  20   IADFDPPQKPKRNKFAIACSILACMTSILLGYDIGVMSGANLFIQDDLKINDVQIQILTG  79

Query  348  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  527
             LN+YSLIGS +AGRTSDWIGRRYT+V++  +FFVGAILMG +  Y FLM GRFVAGIGV
Sbjct  80   TLNIYSLIGSALAGRTSDWIGRRYTVVLSGAIFFVGAILMGVAPGYGFLMFGRFVAGIGV  139

Query  528  GYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGV  707
            GY LMI+PVYTAE+AP   RGFLTSFPEVF+N GIL+GYVSN+AF  +  HL+WRFMLG+
Sbjct  140  GYGLMISPVYTAEIAPTLSRGFLTSFPEVFVNIGILLGYVSNYAFSKLPAHLAWRFMLGI  199

Query  708  GSIPSVLLGVSVLAMP  755
            G++P+++L V VLAMP
Sbjct  200  GALPAIILAVGVLAMP  215



>ref|XP_006487181.1| PREDICTED: polyol transporter 5-like [Citrus sinensis]
Length=539

 Score =   272 bits (696),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = +3

Query  177  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  356
            FDP KK KRN YA  AA LAS+ SILLGYDIGVMSGAA+YI+ D K++DT++EIL+GILN
Sbjct  24   FDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDFKVSDTKIEILIGILN  83

Query  357  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  536
            ++SLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMGF+TNY FLM GRFVAG+GVGYA
Sbjct  84   IFSLIGSLAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYAFLMGGRFVAGVGVGYA  143

Query  537  LMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSI  716
             +IAPVYTAE++PAS RGFLTSFPEVFIN GIL+GYVSN+ F  + +HL WR MLG+G+I
Sbjct  144  ALIAPVYTAELSPASTRGFLTSFPEVFINGGILLGYVSNYGFSKLPLHLGWRMMLGIGAI  203

Query  717  PSVLLGVSVLAMP  755
            PSVL  V  LAMP
Sbjct  204  PSVLPAVGALAMP  216



>dbj|BAJ85302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=546

 Score =   273 bits (697),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 166/196 (85%), Gaps = 0/196 (0%)
 Frame = +3

Query  168  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  347
            +PA   PKK    ++A A A LAS+ SILLGYDIGVMSGA++YIQKDLKINDTQ+E+L+G
Sbjct  37   LPAAVEPKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIQKDLKINDTQLEVLMG  96

Query  348  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  527
            ILN+YSL+GS  AGRTSDWIGRR+T+V A+V+FF GA++MG S NY  LM GRFVAGIGV
Sbjct  97   ILNVYSLVGSFAAGRTSDWIGRRFTIVFAAVIFFAGALIMGLSVNYAMLMFGRFVAGIGV  156

Query  528  GYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGV  707
            GYALMIAPVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSNFAF  +S+ L WR MLG+
Sbjct  157  GYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNFAFARLSLRLGWRIMLGI  216

Query  708  GSIPSVLLGVSVLAMP  755
            G++PSVLL   VL MP
Sbjct  217  GAVPSVLLAFMVLGMP  232



>ref|XP_012069670.1| PREDICTED: polyol transporter 5-like [Jatropha curcas]
 gb|KDP46229.1| hypothetical protein JCGZ_10069 [Jatropha curcas]
Length=514

 Score =   271 bits (694),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  258  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  437
            GYDIGVMSGAAIYI+ DLKI+D QVE+L+G LN+YSL+GS  AGRTSDWIGRRYT+VVA 
Sbjct  27   GYDIGVMSGAAIYIKDDLKISDLQVEVLVGTLNIYSLVGSAAAGRTSDWIGRRYTIVVAG  86

Query  438  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVF  617
             +FFVGA+LMGF+T Y FLMVGRFVAGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVF
Sbjct  87   AIFFVGALLMGFATTYAFLMVGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVF  146

Query  618  INFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            IN GIL+GYVSNFAF  +  HLSWRFMLG+G++PSV L + VL MP
Sbjct  147  INGGILLGYVSNFAFSKLPTHLSWRFMLGIGAVPSVFLALIVLVMP  192



>ref|XP_010028575.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
Length=544

 Score =   272 bits (696),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +3

Query  183  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  362
            P K+  RNKYA A A LAS+ SILLGYDIGVMSGAAI I+K L +ND +VE+L+GI+NLY
Sbjct  28   PKKRPPRNKYAFACAILASMTSILLGYDIGVMSGAAIPIKKQLHLNDVEVEVLVGIINLY  87

Query  363  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  542
            SL+GS +AGRTSDW+GRRYTMV+A  +FFVGAILM F+ NY FLM GRFVAGIGVGYALM
Sbjct  88   SLLGSAVAGRTSDWVGRRYTMVIAGAIFFVGAILMAFAFNYAFLMFGRFVAGIGVGYALM  147

Query  543  IAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPS  722
            IAPVYTAEV+PAS RGFLTSFPEVFINFG+L+GYVSN+ F  + ++L WRFMLG+G +PS
Sbjct  148  IAPVYTAEVSPASARGFLTSFPEVFINFGVLLGYVSNYVFNKLPINLGWRFMLGIGVLPS  207

Query  723  VLLGVSVLAMP  755
            VLL + VLAMP
Sbjct  208  VLLAIGVLAMP  218



>ref|XP_006856084.1| PREDICTED: polyol transporter 5 [Amborella trichopoda]
 gb|ERN17551.1| hypothetical protein AMTR_s00059p00122840 [Amborella trichopoda]
Length=518

 Score =   271 bits (694),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +3

Query  189  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSL  368
            +K KRNKYA+A AFLAS+ SILLGYDIGVMSGA I+I++DL+I+D +VEIL+G LN+Y L
Sbjct  17   EKPKRNKYALACAFLASMTSILLGYDIGVMSGAVIFIKEDLRISDVEVEILVGSLNIYCL  76

Query  369  IGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIA  548
            IGS  AGRTSDWIGRRYT+V AS +FFVGA++MGF+ NY FLM GR VAGIGVGYALMIA
Sbjct  77   IGSFAAGRTSDWIGRRYTIVFASAIFFVGALMMGFAPNYAFLMAGRVVAGIGVGYALMIA  136

Query  549  PVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVL  728
            PVYTAEVAPAS RGFLTSFPEVFIN GIL GYVSNFAF+ + +HL WR MLGVG+IPSV 
Sbjct  137  PVYTAEVAPASCRGFLTSFPEVFINAGILFGYVSNFAFERLPLHLGWRTMLGVGAIPSVF  196

Query  729  LGVSVLAMP  755
            +GV+VLAMP
Sbjct  197  MGVAVLAMP  205



>gb|AAO39267.1|AF482011_1 sorbitol transporter [Prunus cerasus]
Length=509

 Score =   271 bits (693),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 150/210 (71%), Positives = 168/210 (80%), Gaps = 3/210 (1%)
 Frame = +3

Query  126  MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  305
            M D R   NA SG  P     KK KRN YAI  A LAS+ SILLGYDIGVMSGA+IYIQK
Sbjct  1    MTDRRAQDNAVSGQ-PLLK--KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQK  57

Query  306  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  485
            DLKI+D +VEIL+GILNLYSLIGS  AGRTSDWIGRRYT+V A  +FF GA+LMG +TNY
Sbjct  58   DLKISDVEVEILIGILNLYSLIGSAAAGRTSDWIGRRYTIVFAGAIFFTGALLMGLATNY  117

Query  486  TFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFK  665
             FLMVGRFVAGIGVGYALMIAPVY AEV+PAS RG LTSFPEVF+N GIL+GYV+N+AF 
Sbjct  118  AFLMVGRFVAGIGVGYALMIAPVYNAEVSPASSRGALTSFPEVFVNIGILLGYVANYAFS  177

Query  666  NMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
             + + L WR MLGVG  PSV+L V VL+MP
Sbjct  178  GLPIDLGWRLMLGVGVFPSVILAVGVLSMP  207



>ref|XP_006349557.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=519

 Score =   271 bits (694),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +3

Query  189  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSL  368
            K  KRNKYA+A + LAS+ SILLGYD GVMSGA IYI++DLKI+D Q+EIL+G +N+YSL
Sbjct  10   KSPKRNKYALACSLLASMTSILLGYDTGVMSGAVIYIKEDLKISDVQIEILVGTINIYSL  69

Query  369  IGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIA  548
            +G+ +AGRTSDWIGRRYT+++AS++FFVGAILMGF+ NY FLM GRFVAGIGVGYALMIA
Sbjct  70   VGAAIAGRTSDWIGRRYTIILASLIFFVGAILMGFAPNYWFLMFGRFVAGIGVGYALMIA  129

Query  549  PVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVL  728
            PVYTAEVAPAS RGF TSFPEVFIN G+L+GY+SN+AF  +   L WRFMLG+G IPSVL
Sbjct  130  PVYTAEVAPASCRGFFTSFPEVFINGGVLLGYISNYAFSKLPTKLGWRFMLGIGVIPSVL  189

Query  729  LGVSVLAMP  755
            LG+ VLAMP
Sbjct  190  LGIGVLAMP  198



>ref|XP_009344435.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=526

 Score =   271 bits (694),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 173/215 (80%), Gaps = 5/215 (2%)
 Frame = +3

Query  126  MGDTRPVRNAGSG-----HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  290
            M D R   NA +G      I  FDPPKK K +K+AIA A LA   S+LLGYDIGVMSGA+
Sbjct  1    MADQRVNDNAVTGGPQNTSIEDFDPPKKPKTSKFAIACALLACTTSVLLGYDIGVMSGAS  60

Query  291  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  470
            ++I+++LKI+D QVEIL G LN+YSL+GS  AGRTSDWIGR+YT+V+A V+F VGA+LMG
Sbjct  61   LFIKENLKISDVQVEILAGTLNIYSLLGSAFAGRTSDWIGRKYTIVLAGVIFLVGALLMG  120

Query  471  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVS  650
            F+TNY FLM GRFVAG+GVGY +MIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GY++
Sbjct  121  FATNYAFLMFGRFVAGVGVGYGMMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYIA  180

Query  651  NFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            N+AF  + +HL WRFMLGVG +P++ L V VL MP
Sbjct  181  NYAFSKLPLHLGWRFMLGVGGVPAIFLTVGVLFMP  215



>dbj|BAM66295.1| sorbitol transporter, partial [Pyrus pyrifolia]
Length=454

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +3

Query  261  YDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASV  440
            YDIGVMSGAAIYI+ DLKI+D +VE+LLGILNLYSLIGS  AGRTSDW+GRRYT+V+A  
Sbjct  1    YDIGVMSGAAIYIKDDLKISDVEVEVLLGILNLYSLIGSAAAGRTSDWVGRRYTIVLAGA  60

Query  441  VFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFI  620
            +FFVGA+LMGF+TNY FLM GRFVAGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFI
Sbjct  61   IFFVGALLMGFATNYAFLMFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFI  120

Query  621  NFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            N GIL+GYVSN+AF  +  HL WR MLGVG+IPS+ L V VLAMP
Sbjct  121  NSGILLGYVSNYAFSKLPKHLGWRLMLGVGAIPSIFLAVGVLAMP  165



>ref|XP_009395604.1| PREDICTED: putative polyol transporter 1 [Musa acuminata subsp. 
malaccensis]
Length=561

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 170/211 (81%), Gaps = 5/211 (2%)
 Frame = +3

Query  123  IMGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQ  302
            +MGD +P  N      PA     K +   +A A A LAS+ASILLGYDIGVMSGAAI+I+
Sbjct  49   VMGDQKPEANIMEAVAPA-----KSRNKMFAFACAVLASMASILLGYDIGVMSGAAIFIK  103

Query  303  KDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTN  482
             DLKI+D QVEILLGILNLYSL+GS  AG TSDWIGRRYT+V A+ +FFVGAILMGF+TN
Sbjct  104  DDLKISDVQVEILLGILNLYSLVGSYAAGFTSDWIGRRYTIVFAAGIFFVGAILMGFATN  163

Query  483  YTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAF  662
            Y FLM GRFVAGIGVGYALMIAPVYTAE+APAS RGFLTSFPEVFIN GIL+GYVSN+ F
Sbjct  164  YAFLMAGRFVAGIGVGYALMIAPVYTAEIAPASSRGFLTSFPEVFINSGILLGYVSNYGF  223

Query  663  KNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
             ++   L WRFMLGVG+IPSV L V VLAMP
Sbjct  224  AHLRQSLGWRFMLGVGAIPSVFLAVGVLAMP  254



>gb|ACJ85869.1| unknown [Medicago truncatula]
 gb|AFK48997.1| unknown [Medicago truncatula]
Length=434

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = +3

Query  177  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  356
            FD  KK + NK+A A A LAS+ SILLGYDIGVMSGA IYI++DLK+++ Q+EIL+GI+N
Sbjct  16   FDSQKKPESNKFAFACAILASMTSILLGYDIGVMSGAVIYIKRDLKLSNVQIEILVGIIN  75

Query  357  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  536
            L+SLIGSC+AGRTSDWIGRRYT+V+A  +FF GA+LMGFS N+ FLM  RF+AGIG+GYA
Sbjct  76   LFSLIGSCLAGRTSDWIGRRYTIVLAGSIFFAGALLMGFSPNFAFLMFARFIAGIGIGYA  135

Query  537  LMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSI  716
            LMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SN+ F  + + L WR MLG+G+I
Sbjct  136  LMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNYGFSKLPLRLGWRVMLGIGAI  195

Query  717  PSVLLGVSVLAMP  755
            PSV+L V VLAMP
Sbjct  196  PSVILAVGVLAMP  208



>ref|XP_003603886.1| Mannitol transporter [Medicago truncatula]
 gb|AES74137.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=514

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = +3

Query  177  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  356
            FD  KK + NK+A A A LAS+ SILLGYDIGVMSGA IYI++DLK+++ Q+EIL+GI+N
Sbjct  16   FDSQKKPESNKFAFACAILASMTSILLGYDIGVMSGAVIYIKRDLKLSNVQIEILVGIIN  75

Query  357  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  536
            L+SLIGSC+AGRTSDWIGRRYT+V+A  +FF GA+LMGFS N+ FLM  RF+AGIG+GYA
Sbjct  76   LFSLIGSCLAGRTSDWIGRRYTIVLAGSIFFAGALLMGFSPNFAFLMFARFIAGIGIGYA  135

Query  537  LMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSI  716
            LMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SN+ F  +S+ L WR MLG+G+I
Sbjct  136  LMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNYGFSKLSLRLGWRVMLGIGAI  195

Query  717  PSVLLGVSVLAMP  755
            PSV+L V VLAMP
Sbjct  196  PSVILAVGVLAMP  208



>ref|XP_010527594.1| PREDICTED: polyol transporter 5-like isoform X4 [Tarenaya hassleriana]
Length=526

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +3

Query  183  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  362
            PP+K KRNK+A   A L S+  ILLGYDIGVMSGA IYI++DLKI+D Q+EIL+GILN+Y
Sbjct  17   PPEKPKRNKFAFVCAILVSMTLILLGYDIGVMSGAIIYIKRDLKISDGQIEILVGILNIY  76

Query  363  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  542
            S++G+C AGRTSD IGRRYT+V+A  +FF GAILMGF+TNY FLM GRFVAG GVG+A M
Sbjct  77   SVVGACFAGRTSDLIGRRYTIVLAGGIFFAGAILMGFATNYAFLMFGRFVAGFGVGFAGM  136

Query  543  IAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPS  722
            IAPVYTAE++PAS RGFL SFPEVF+N GIL+GYVSNFAF  + +HL WRFMLGVG+IPS
Sbjct  137  IAPVYTAEISPASSRGFLNSFPEVFVNAGILLGYVSNFAFSKLPLHLGWRFMLGVGAIPS  196

Query  723  VLLGVSVLAMP  755
            +LL + V AMP
Sbjct  197  ILLSIGVFAMP  207



>gb|AIU41385.1| sorbitol transporter 1 [Prunus salicina]
Length=509

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 149/210 (71%), Positives = 169/210 (80%), Gaps = 3/210 (1%)
 Frame = +3

Query  126  MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  305
            M D R   +A SG  P     KK KRN YAI  A LAS+ SILLGYDIGVMSGA+IYIQ+
Sbjct  1    MTDHRAEDSAVSGQ-PLLK--KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQE  57

Query  306  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  485
            DLKI+D +VEIL+GILNLYSLIGS  AGRTSDWIGRRYT+V A  +FF GA+LMGF+TNY
Sbjct  58   DLKISDVEVEILIGILNLYSLIGSAAAGRTSDWIGRRYTIVFAGAIFFTGALLMGFATNY  117

Query  486  TFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFK  665
             FLMVGRFVAGIGVGYALMIAPVY AEV+PAS RG LTSFPEVF+N GIL+GYV+N+AF 
Sbjct  118  AFLMVGRFVAGIGVGYALMIAPVYNAEVSPASSRGALTSFPEVFVNIGILLGYVANYAFS  177

Query  666  NMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
             + ++L WR MLGVG  PSV+L V VL MP
Sbjct  178  GLPINLGWRLMLGVGVFPSVILAVGVLTMP  207



>ref|XP_009602627.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=531

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +3

Query  183  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  362
            P K  KRNKYA A + LAS+ S+LLGYD GVMSGA IYI++DLKI+D Q+EIL+G +N+Y
Sbjct  25   PCKNPKRNKYAFACSLLASMTSVLLGYDTGVMSGAVIYIKEDLKISDVQIEILVGTINIY  84

Query  363  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  542
            SL+G+ +AGRTSDWIGRRYT++ AS +FF GAILMGF+TNY FLM GRFVAGIGVGYALM
Sbjct  85   SLVGAALAGRTSDWIGRRYTIIFASAIFFAGAILMGFATNYGFLMFGRFVAGIGVGYALM  144

Query  543  IAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPS  722
            IAPVYTAEVAPAS RGF TSFPEVFIN G+L+GYVSN+AF  +   L WRFMLG+G IPS
Sbjct  145  IAPVYTAEVAPASCRGFFTSFPEVFINGGVLLGYVSNYAFSKLPTKLGWRFMLGIGVIPS  204

Query  723  VLLGVSVLAMP  755
            V L + VLAMP
Sbjct  205  VFLALGVLAMP  215



>ref|XP_010527591.1| PREDICTED: polyol transporter 5-like isoform X1 [Tarenaya hassleriana]
Length=537

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +3

Query  183  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  362
            PP+K KRNK+A   A L S+  ILLGYDIGVMSGA IYI++DLKI+D Q+EIL+GILN+Y
Sbjct  17   PPEKPKRNKFAFVCAILVSMTLILLGYDIGVMSGAIIYIKRDLKISDGQIEILVGILNIY  76

Query  363  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  542
            S++G+C AGRTSD IGRRYT+V+A  +FF GAILMGF+TNY FLM GRFVAG GVG+A M
Sbjct  77   SVVGACFAGRTSDLIGRRYTIVLAGGIFFAGAILMGFATNYAFLMFGRFVAGFGVGFAGM  136

Query  543  IAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPS  722
            IAPVYTAE++PAS RGFL SFPEVF+N GIL+GYVSNFAF  + +HL WRFMLGVG+IPS
Sbjct  137  IAPVYTAEISPASSRGFLNSFPEVFVNAGILLGYVSNFAFSKLPLHLGWRFMLGVGAIPS  196

Query  723  VLLGVSVLAMP  755
            +LL + V AMP
Sbjct  197  ILLSIGVFAMP  207



>ref|XP_007199793.1| hypothetical protein PRUPE_ppa004456mg [Prunus persica]
 gb|EMJ00992.1| hypothetical protein PRUPE_ppa004456mg [Prunus persica]
Length=509

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 149/210 (71%), Positives = 167/210 (80%), Gaps = 3/210 (1%)
 Frame = +3

Query  126  MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  305
            M D R   NA SG  P     KK KRN YAI  A LAS+ SILLGYDIGVMSGA+IYIQ+
Sbjct  1    MTDHRAEANAVSGQ-PLLK--KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQE  57

Query  306  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  485
            DLKI D +VEIL+GILNLYSLIGS  AGRTSDWIGRRYT+V A  +FF GA+LMGF+TN+
Sbjct  58   DLKITDVEVEILIGILNLYSLIGSAAAGRTSDWIGRRYTIVFAGAIFFTGALLMGFATNF  117

Query  486  TFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFK  665
             FLMVGRFVAGIGVGYALMIAPVY AEV+PAS RG LTSFPEVF+N GIL+GYV+N+AF 
Sbjct  118  AFLMVGRFVAGIGVGYALMIAPVYNAEVSPASSRGALTSFPEVFVNIGILLGYVANYAFS  177

Query  666  NMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
             + + L WR MLGVG  PSV+L V VL MP
Sbjct  178  GLPIDLGWRLMLGVGVFPSVILAVGVLTMP  207



>ref|XP_009375629.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
Length=491

 Score =   269 bits (687),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  258  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  437
            GYDIGVMSGAAIYI+KDLK+ DTQ+EILLGILNLYSLIGS MAGRTSDW+GRRYT+V++ 
Sbjct  7    GYDIGVMSGAAIYIEKDLKVTDTQIEILLGILNLYSLIGSAMAGRTSDWVGRRYTIVISG  66

Query  438  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVF  617
             +FF GAILMG STNYTFLM GRFVAG+GVGYAL IAPVY AEV+PAS RGFLTSFPEVF
Sbjct  67   AIFFTGAILMGLSTNYTFLMCGRFVAGLGVGYALTIAPVYAAEVSPASSRGFLTSFPEVF  126

Query  618  INFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            +N GIL+GY+SN+AF   ++ L WR MLGVG+IPSV+L + VLAMP
Sbjct  127  VNVGILLGYISNYAFSFCALDLGWRLMLGVGAIPSVILAIGVLAMP  172



>gb|AGG19156.1| sorbitol transporter [Pyrus pyrifolia]
Length=491

 Score =   269 bits (687),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  258  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  437
            GYDIGVMSGAAIYI+KDLK+ DTQ+EILLGILNLYSLIGS MAGRTSDW+GRRYT+V++ 
Sbjct  7    GYDIGVMSGAAIYIEKDLKVTDTQIEILLGILNLYSLIGSAMAGRTSDWVGRRYTIVISG  66

Query  438  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVF  617
             +FF GAILMG STNYTFLM GRFVAG+GVGYAL IAPVY AEV+PAS RGFLTSFPEVF
Sbjct  67   AIFFTGAILMGLSTNYTFLMCGRFVAGLGVGYALTIAPVYAAEVSPASSRGFLTSFPEVF  126

Query  618  INFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            +N GIL+GY+SN+AF   ++ L WR MLGVG+IPSV+L + VLAMP
Sbjct  127  VNVGILLGYISNYAFSFCALDLGWRLMLGVGAIPSVILAIGVLAMP  172



>ref|XP_004500821.1| PREDICTED: polyol transporter 5-like [Cicer arietinum]
Length=517

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 166/194 (86%), Gaps = 1/194 (1%)
 Frame = +3

Query  177  FDPPKKV-KRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGIL  353
            FDP KK  + NK+A A A LAS+ SILLGYDIGVMSGA IYI++DLK++D Q+EIL+GI+
Sbjct  19   FDPQKKKPESNKFAFACAILASMTSILLGYDIGVMSGAVIYIRRDLKLSDVQIEILVGII  78

Query  354  NLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGY  533
            NL+SLIGSC+AGRTSDWIGRRYT+V+A  +FF GAILMGFS N+ FLM  RF+AGIG+GY
Sbjct  79   NLFSLIGSCLAGRTSDWIGRRYTIVLAGAIFFAGAILMGFSPNFPFLMFARFIAGIGIGY  138

Query  534  ALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGS  713
            ALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GY+SN+ F  + + L WR MLG+G+
Sbjct  139  ALMIAPVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNYGFSKLPLELGWRVMLGIGA  198

Query  714  IPSVLLGVSVLAMP  755
            IPSV+L V VLAMP
Sbjct  199  IPSVILAVGVLAMP  212



>ref|XP_010527593.1| PREDICTED: polyol transporter 5-like isoform X3 [Tarenaya hassleriana]
Length=528

 Score =   270 bits (690),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +3

Query  183  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  362
            PP+K KRNK+A   A L S+  ILLGYDIGVMSGA IYI++DLKI+D Q+EIL+GILN+Y
Sbjct  17   PPEKPKRNKFAFVCAILVSMTLILLGYDIGVMSGAIIYIKRDLKISDGQIEILVGILNIY  76

Query  363  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  542
            S++G+C AGRTSD IGRRYT+V+A  +FF GAILMGF+TNY FLM GRFVAG GVG+A M
Sbjct  77   SVVGACFAGRTSDLIGRRYTIVLAGGIFFAGAILMGFATNYAFLMFGRFVAGFGVGFAGM  136

Query  543  IAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPS  722
            IAPVYTAE++PAS RGFL SFPEVF+N GIL+GYVSNFAF  + +HL WRFMLGVG+IPS
Sbjct  137  IAPVYTAEISPASSRGFLNSFPEVFVNAGILLGYVSNFAFSKLPLHLGWRFMLGVGAIPS  196

Query  723  VLLGVSVLAMP  755
            +LL + V AMP
Sbjct  197  ILLSIGVFAMP  207



>ref|XP_009344434.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
Length=491

 Score =   269 bits (687),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  258  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  437
            GYDIGVMSGAAIYI+KDLK+ DTQ+EILLGILNLYSLIGS MAGRTSDW+GRRYT+V++ 
Sbjct  7    GYDIGVMSGAAIYIEKDLKVTDTQIEILLGILNLYSLIGSAMAGRTSDWVGRRYTIVISR  66

Query  438  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVF  617
             +FF GAILMG STNYTFLM GRFVAG+GVGYAL IAPVY AEV+PAS RGFLTSFPEVF
Sbjct  67   AIFFTGAILMGLSTNYTFLMCGRFVAGLGVGYALTIAPVYAAEVSPASSRGFLTSFPEVF  126

Query  618  INFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            +N GIL+GY+SN+AF   ++ L WR MLGVG+IPSV+L + VLAMP
Sbjct  127  VNVGILLGYISNYAFSFCALDLGWRLMLGVGAIPSVILAIGVLAMP  172



>ref|XP_008447049.1| PREDICTED: polyol transporter 5 [Cucumis melo]
Length=516

 Score =   269 bits (688),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +3

Query  201  RNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSC  380
            RNKYA   A LAS+ASILLGYD+GVMSGAAIYI+KD +I D Q E+++G++NLY+LIG+ 
Sbjct  19   RNKYAFMCAILASMASILLGYDVGVMSGAAIYIKKDFEITDVQEEVMIGVINLYALIGAA  78

Query  381  MAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYT  560
             AGRTSDWIGRRYTMV+A V+FF+GA+LMGF+TNY FLM GRFVAGIGVGYALMI+PVYT
Sbjct  79   AAGRTSDWIGRRYTMVLAGVIFFLGAVLMGFATNYGFLMFGRFVAGIGVGYALMISPVYT  138

Query  561  AEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVLLGVS  740
            AEV+PAS RGFLTSFPEVFINFG+++GY+SNFAF  + +HL WRFMLG+G  PS+ L V 
Sbjct  139  AEVSPASSRGFLTSFPEVFINFGVMLGYISNFAFSKLPLHLGWRFMLGIGVFPSIFLAVV  198

Query  741  VLAMP  755
            VL MP
Sbjct  199  VLVMP  203



>ref|XP_007199207.1| hypothetical protein PRUPE_ppa021762mg [Prunus persica]
 gb|EMJ00406.1| hypothetical protein PRUPE_ppa021762mg [Prunus persica]
Length=528

 Score =   270 bits (689),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 165/196 (84%), Gaps = 0/196 (0%)
 Frame = +3

Query  168  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  347
            I  FDPP+K KRNK+AIA + LA + SILLGYDIGVMSGA ++IQ DLKIND Q++IL G
Sbjct  20   IADFDPPQKPKRNKFAIACSILACMTSILLGYDIGVMSGANLFIQDDLKINDVQIQILTG  79

Query  348  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  527
             LN+YSL+GS +AGRTSDWIGRRYT+V++  +FFVGAILMG +  Y FLM GRFVAGIGV
Sbjct  80   TLNIYSLVGSGLAGRTSDWIGRRYTVVLSGAIFFVGAILMGVAPGYGFLMFGRFVAGIGV  139

Query  528  GYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGV  707
            GY LMI+PVYTAE+AP   RGFLTSFPEVF+N GIL+GYVSN+AF  +  HL+WRFMLG+
Sbjct  140  GYGLMISPVYTAEIAPTLSRGFLTSFPEVFVNIGILLGYVSNYAFSKLPAHLAWRFMLGI  199

Query  708  GSIPSVLLGVSVLAMP  755
            G++P+++L + VLAMP
Sbjct  200  GALPAIILALGVLAMP  215



>ref|XP_008387373.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=526

 Score =   270 bits (689),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 172/215 (80%), Gaps = 5/215 (2%)
 Frame = +3

Query  126  MGDTRPVRNA-----GSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  290
            M D R   NA      +  I   DPPKK K +K+AIA A LA   S+LLGYDIGVMSGA+
Sbjct  1    MADQRANENAVTSGPQNTSIEDIDPPKKPKTSKFAIACALLACTTSVLLGYDIGVMSGAS  60

Query  291  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  470
            ++I+++LKI+D QVE+L G LN+YSL+GS  AGRTSDWIGR+YT+V+A V+F VGA+LMG
Sbjct  61   LFIKENLKISDVQVEVLAGTLNIYSLLGSAFAGRTSDWIGRKYTIVLAGVIFLVGALLMG  120

Query  471  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVS  650
            F+TNY FLMVGRFVAG+GVGY +MIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GY++
Sbjct  121  FATNYAFLMVGRFVAGVGVGYGMMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYIA  180

Query  651  NFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            N+AF  + +HL WRFMLGVG +P++ L V VL MP
Sbjct  181  NYAFSKLPLHLGWRFMLGVGGVPAIFLTVGVLFMP  215



>emb|CBI32562.3| unnamed protein product [Vitis vinifera]
Length=351

 Score =   264 bits (675),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  258  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  437
            GYDIGVMSGAAIYI+KDLKI+D +VEIL+GILN+Y L GS  AGRTSDWIGRRYT+V+AS
Sbjct  7    GYDIGVMSGAAIYIKKDLKISDVEVEILVGILNVYCLFGSAAAGRTSDWIGRRYTIVLAS  66

Query  438  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVF  617
            V+FF+GA+LMGF+TNY FLMVGRFVAGIGVGYALMIAPVY AEV+PAS RGF+TSFPEVF
Sbjct  67   VIFFLGALLMGFATNYVFLMVGRFVAGIGVGYALMIAPVYAAEVSPASSRGFITSFPEVF  126

Query  618  INFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            IN GIL GY+SN+AF  +  +L WRFMLG+G+IPSV L + V+AMP
Sbjct  127  INAGILFGYISNYAFSKLPTNLGWRFMLGIGAIPSVFLALVVIAMP  172



>ref|XP_006349565.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=518

 Score =   269 bits (688),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 167/199 (84%), Gaps = 0/199 (0%)
 Frame = +3

Query  159  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  338
            S  IP F P KK KRNKYA A + LAS+ S+LLGYD GVMSGA IYI++DLKI+D  +E+
Sbjct  13   SNKIPEFVPLKKPKRNKYAFACSLLASMTSVLLGYDTGVMSGAVIYIKEDLKISDVAIEV  72

Query  339  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  518
            L+G +N+YSL+G+ +AGRTSDWIGRRYT+++AS +F VGA+LMGF+ NY FLM GRFVAG
Sbjct  73   LVGTINIYSLVGAAIAGRTSDWIGRRYTIILASGIFLVGALLMGFAPNYWFLMFGRFVAG  132

Query  519  IGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFM  698
            IGVGYALMIAPVYTAEVAPAS RGF TSFPEVFIN G+L+GY++N+AF  + + L WR M
Sbjct  133  IGVGYALMIAPVYTAEVAPASCRGFCTSFPEVFINAGVLLGYIANYAFSMLPLKLGWRLM  192

Query  699  LGVGSIPSVLLGVSVLAMP  755
            LG+G IPSV+LGV VLAMP
Sbjct  193  LGIGVIPSVMLGVGVLAMP  211



>ref|XP_011078884.1| PREDICTED: polyol transporter 5-like isoform X2 [Sesamum indicum]
Length=524

 Score =   269 bits (688),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 163/190 (86%), Gaps = 2/190 (1%)
 Frame = +3

Query  186  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  365
            P K KRNKYA+A + LAS+ S+LLGY  GVMSGA IYI++DLKI+D Q+EIL+G +N+YS
Sbjct  31   PTKHKRNKYALAISVLASMTSVLLGY--GVMSGATIYIKRDLKISDVQIEILVGTINIYS  88

Query  366  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMI  545
            L+GS +AGRTSDWIGRRYT+V AS +FF GAILMGF+ NY FLMVGRFVAGIGVGYALMI
Sbjct  89   LLGSAVAGRTSDWIGRRYTIVFASAIFFAGAILMGFAANYAFLMVGRFVAGIGVGYALMI  148

Query  546  APVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSV  725
            APVY AEVAPAS RGFLTSFPEVFINFG+L+GYVSN+AF  + + L WR MLGVG++PS+
Sbjct  149  APVYAAEVAPASCRGFLTSFPEVFINFGVLLGYVSNYAFAKLPLKLGWRLMLGVGAVPSI  208

Query  726  LLGVSVLAMP  755
             L + VLAMP
Sbjct  209  FLAIGVLAMP  218



>ref|XP_010468639.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   268 bits (686),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 167/198 (84%), Gaps = 0/198 (0%)
 Frame = +3

Query  162  GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  341
            G + A   P +  R++YA A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL
Sbjct  9    GVVVAEPEPPRGNRSQYAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEIL  68

Query  342  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGI  521
            +GILN+YSLIGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGI
Sbjct  69   MGILNIYSLIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGI  128

Query  522  GVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFML  701
            GVGYA+MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRFML
Sbjct  129  GVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHLGWRFML  188

Query  702  GVGSIPSVLLGVSVLAMP  755
            GVG+IPSV+L + VLAMP
Sbjct  189  GVGAIPSVILAIGVLAMP  206



>gb|EMT15230.1| Polyol transporter 5 [Aegilops tauschii]
Length=524

 Score =   269 bits (687),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  258  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  437
             YDIGVMSGA++YIQKDLKINDTQ+E+L+GILN+YSLIGS  AGRTSDWIGRR+T+V A+
Sbjct  45   AYDIGVMSGASLYIQKDLKINDTQLEVLMGILNVYSLIGSFAAGRTSDWIGRRFTIVFAA  104

Query  438  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVF  617
            V+FF GA++MGFS NY  LM GRFVAGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVF
Sbjct  105  VIFFAGALIMGFSVNYAMLMFGRFVAGIGVGYALMIAPVYTAEVSPASARGFLTSFPEVF  164

Query  618  INFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            INFGIL+GYVSNFAF  +S+ L WR MLG+G++PSVLL   VL MP
Sbjct  165  INFGILLGYVSNFAFARLSLRLGWRIMLGIGAVPSVLLAFMVLGMP  210



>ref|XP_010527592.1| PREDICTED: polyol transporter 5-like isoform X2 [Tarenaya hassleriana]
Length=532

 Score =   269 bits (687),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +3

Query  183  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  362
            PP+K KRNK+A   A L S+  ILLGYDIGVMSGA IYI++DLKI+D Q+EIL+GILN+Y
Sbjct  17   PPEKPKRNKFAFVCAILVSMTLILLGYDIGVMSGAIIYIKRDLKISDGQIEILVGILNIY  76

Query  363  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  542
            S++G+C AGRTSD IGRRYT+V+A  +FF GAILMGF+TNY FLM GRFVAG GVG+A M
Sbjct  77   SVVGACFAGRTSDLIGRRYTIVLAGGIFFAGAILMGFATNYAFLMFGRFVAGFGVGFAGM  136

Query  543  IAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPS  722
            IAPVYTAE++PAS RGFL SFPEVF+N GIL+GYVSNFAF  + +HL WRFMLGVG+IPS
Sbjct  137  IAPVYTAEISPASSRGFLNSFPEVFVNAGILLGYVSNFAFSKLPLHLGWRFMLGVGAIPS  196

Query  723  VLLGVSVLAMP  755
            +LL + V AMP
Sbjct  197  ILLSIGVFAMP  207



>gb|AAL85876.2|AF480069_1 mannitol transporter [Apium graveolens Dulce Group]
 gb|ABH03025.1| mannitol transporter MaT2 [Apium graveolens]
Length=524

 Score =   269 bits (687),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 171/208 (82%), Gaps = 2/208 (1%)
 Frame = +3

Query  132  DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  311
            D+   ++ GS  I  FD  KK KRNKYA   A LAS+ S+LLGYDIGVMSGAAIYI+  L
Sbjct  11   DSGGSKDVGSPVI--FDAVKKPKRNKYAFGCAILASMTSVLLGYDIGVMSGAAIYIKDQL  68

Query  312  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  491
             ++D ++EI++GI+N +SL+GS +AGRTSDWIGRRYTMV+A  +FFVGAILMGF+TNY+F
Sbjct  69   HVSDVKLEIVVGIINFFSLVGSALAGRTSDWIGRRYTMVLAGAIFFVGAILMGFATNYSF  128

Query  492  LMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNM  671
            LM GRFVAGIGVGYALMIAPVYTAEV+ AS RGFLTSFPEVFIN G+L+GYVSN+AF  +
Sbjct  129  LMFGRFVAGIGVGYALMIAPVYTAEVSSASSRGFLTSFPEVFINIGVLLGYVSNYAFSKL  188

Query  672  SVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
              +L WRFMLG+G+IPS+ L + VL MP
Sbjct  189  PANLGWRFMLGIGAIPSIGLAIGVLGMP  216



>ref|XP_010516958.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   268 bits (685),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 166/192 (86%), Gaps = 1/192 (1%)
 Frame = +3

Query  180  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  359
            +PP+   R +YA A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL+GILN+
Sbjct  16   EPPRG-NRTQYAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEILMGILNI  74

Query  360  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYAL  539
            YSLIGS  AGRTSDWIGRRYT+V+A V FF GA+LMGF+TNY F+MVGRFVAGIGVGYA+
Sbjct  75   YSLIGSGAAGRTSDWIGRRYTIVLAGVFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAM  134

Query  540  MIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIP  719
            MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+G+VSN+ F  +  HL WRFMLG+G++P
Sbjct  135  MIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGFVSNYFFSKLPEHLGWRFMLGIGAVP  194

Query  720  SVLLGVSVLAMP  755
            SVLL + VLAMP
Sbjct  195  SVLLAIGVLAMP  206



>ref|XP_008236796.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=509

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 148/210 (70%), Positives = 168/210 (80%), Gaps = 3/210 (1%)
 Frame = +3

Query  126  MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  305
            M D R   +A SG  P     KK KRN YAI  A LAS+ SILLGYDIGVMSGA+IYIQ+
Sbjct  1    MTDRRAEDSAVSGQ-PLLK--KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQE  57

Query  306  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  485
            DLKI D +VEIL+GILNLYSLIGS  AGRTSDWIGRRYT+V A  +FF GA+LMGF+TN+
Sbjct  58   DLKITDVEVEILIGILNLYSLIGSAAAGRTSDWIGRRYTIVFAGAIFFTGALLMGFATNF  117

Query  486  TFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFK  665
             FLMVGRFVAGIGVGYALMIAPVY AEV+PAS RG LTSFPEVF+N GIL+GYV+N+AF 
Sbjct  118  AFLMVGRFVAGIGVGYALMIAPVYNAEVSPASSRGALTSFPEVFVNIGILLGYVANYAFS  177

Query  666  NMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
             + ++L WR MLGVG  PSV+L V VL MP
Sbjct  178  GLPINLGWRLMLGVGVFPSVILAVGVLTMP  207



>ref|NP_001281036.1| polyol transporter 5-like [Malus domestica]
 dbj|BAD42344.1| sorbitol transporter [Malus domestica]
Length=491

 Score =   267 bits (683),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  258  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  437
            GYDIGVMSGAAIYI+KDLK+ DTQ+EILLGILNLYSLIGS MAGRTSDW+GRRYT+V++ 
Sbjct  7    GYDIGVMSGAAIYIEKDLKVTDTQIEILLGILNLYSLIGSAMAGRTSDWVGRRYTIVISG  66

Query  438  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVF  617
             +FF GAILMG STNYTFLM GRFVAG+GVGYAL IAPVY AEV+PAS RGFLTSFPEVF
Sbjct  67   AIFFTGAILMGLSTNYTFLMCGRFVAGLGVGYALTIAPVYAAEVSPASSRGFLTSFPEVF  126

Query  618  INFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            +N GIL+GY+SN+AF   ++ + WR MLGVG+IPSV+L + VLAMP
Sbjct  127  VNVGILLGYISNYAFSFCALDVGWRLMLGVGAIPSVILAIGVLAMP  172



>ref|NP_188513.1| polyol transporter 5 [Arabidopsis thaliana]
 sp|Q8VZ80.2|PLT5_ARATH RecName: Full=Polyol transporter 5; AltName: Full=Protein POLYOL 
TRANSPORTER 5; Short=AtPLT5; AltName: Full=Sugar-proton 
symporter PLT5 [Arabidopsis thaliana]
 dbj|BAB01812.1| sugar transporter protein [Arabidopsis thaliana]
 gb|AEE76153.1| polyol transporter 5 [Arabidopsis thaliana]
Length=539

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 163/198 (82%), Gaps = 1/198 (1%)
 Frame = +3

Query  165  HIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  341
            H+P +  P K  KRN YA A A LAS+ SILLGYDIGVMSGA IYI++DLKIND Q+ IL
Sbjct  19   HVPESVLPAKPPKRNNYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKINDLQIGIL  78

Query  342  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGI  521
             G LN+YSLIGSC AGRTSDWIGRRYT+V+A  +FF GAILMG S NY FLM GRF+AGI
Sbjct  79   AGSLNIYSLIGSCAAGRTSDWIGRRYTIVLAGAIFFAGAILMGLSPNYAFLMFGRFIAGI  138

Query  522  GVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFML  701
            GVGYALMIAPVYTAEV+PAS RGFL SFPEVFIN GI++GYVSN AF N+ + + WR ML
Sbjct  139  GVGYALMIAPVYTAEVSPASSRGFLNSFPEVFINAGIMLGYVSNLAFSNLPLKVGWRLML  198

Query  702  GVGSIPSVLLGVSVLAMP  755
            G+G++PSV+L + VLAMP
Sbjct  199  GIGAVPSVILAIGVLAMP  216



>ref|XP_006409469.1| hypothetical protein EUTSA_v10023129mg [Eutrema salsugineum]
 gb|ESQ50922.1| hypothetical protein EUTSA_v10023129mg [Eutrema salsugineum]
Length=511

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 165/192 (86%), Gaps = 1/192 (1%)
 Frame = +3

Query  180  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  359
            +PP+   R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q EIL+GILN+
Sbjct  16   EPPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQFEILMGILNI  74

Query  360  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYAL  539
            YSLIGS MAGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGIGVGYA+
Sbjct  75   YSLIGSGMAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAM  134

Query  540  MIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIP  719
            MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRFMLG+G++P
Sbjct  135  MIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHLGWRFMLGIGAVP  194

Query  720  SVLLGVSVLAMP  755
            SV L + VLAMP
Sbjct  195  SVFLAIGVLAMP  206



>ref|XP_006299557.1| hypothetical protein CARUB_v10015731mg [Capsella rubella]
 gb|EOA32455.1| hypothetical protein CARUB_v10015731mg [Capsella rubella]
Length=511

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 166/199 (83%), Gaps = 0/199 (0%)
 Frame = +3

Query  159  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  338
             G + A   P +  R++YA A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EI
Sbjct  8    QGVVVAVPEPPRGNRSRYAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEI  67

Query  339  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  518
            L+GILN+YSLIGS  AGRTSDW+GRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  68   LMGILNIYSLIGSGAAGRTSDWLGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127

Query  519  IGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFM  698
            IGVGYA+MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRFM
Sbjct  128  IGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHLGWRFM  187

Query  699  LGVGSIPSVLLGVSVLAMP  755
            LGVG++PSV L + VLAMP
Sbjct  188  LGVGAVPSVFLAIGVLAMP  206



>ref|XP_011037561.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037562.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037564.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037565.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037566.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037567.1| PREDICTED: polyol transporter 5 [Populus euphratica]
Length=531

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 163/208 (78%), Gaps = 0/208 (0%)
 Frame = +3

Query  132  DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  311
            D  P +      +  FDP KK KRNKYA A A LAS+ASILLGYDIGVMSGA  YIQ DL
Sbjct  10   DVNPSQPTTEKTLADFDPVKKPKRNKYAFACAILASVASILLGYDIGVMSGAKDYIQTDL  69

Query  312  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  491
            K++D QV +L+G LN YSL+GS  AG TSDWIGRRYT+VVA  VFF GA+LMGFSTNY F
Sbjct  70   KLSDVQVGLLVGTLNWYSLVGSAAAGVTSDWIGRRYTIVVAGAVFFTGALLMGFSTNYAF  129

Query  492  LMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNM  671
            LMV RFVAGIGVG+ALMIAPVYT EV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +
Sbjct  130  LMVARFVAGIGVGFALMIAPVYTTEVSPASSRGFLTSFPEVFINAGILLGYVSNYAFSKL  189

Query  672  SVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
              +L WR MLGVG+IPSV L + V  MP
Sbjct  190  PTNLGWRIMLGVGAIPSVFLALVVFGMP  217



>dbj|BAM66296.1| sorbitol transporter, partial [Pyrus pyrifolia]
 dbj|BAM66297.1| sorbitol transporter, partial [Pyrus pyrifolia]
Length=454

 Score =   265 bits (678),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +3

Query  261  YDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASV  440
            YDIGVMSGAAIYIQKDLKI+D Q+EILLGILN+YSL GS  AGRTSDWIGRRYT+V+A  
Sbjct  1    YDIGVMSGAAIYIQKDLKISDVQIEILLGILNVYSLFGSAAAGRTSDWIGRRYTIVLAGA  60

Query  441  VFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFI  620
            +FF GA+LMGF+TNY FLMVGRFVAGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVF+
Sbjct  61   IFFAGALLMGFATNYVFLMVGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFV  120

Query  621  NFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            N GIL+GYVSN+AF  +  +L WR MLG+G++P V L + VLAMP
Sbjct  121  NVGILLGYVSNYAFSKLPTNLGWRLMLGIGAVPCVFLALGVLAMP  165



>ref|XP_008236773.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
 ref|XP_008236774.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
Length=528

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 169/216 (78%), Gaps = 6/216 (3%)
 Frame = +3

Query  126  MGDTRPVRNAGSGH------IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGA  287
            M D R   NA SG       I  FDPP+K K NK+AIA A LA   SILLGYDIGVMSGA
Sbjct  1    MADRRVEDNAVSGQLQNDHRIADFDPPQKPKTNKFAIACAILACTTSILLGYDIGVMSGA  60

Query  288  AIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILM  467
             I+IQ DLK++DT++ +L G LN+YSLIGS +AGRTSDWIGRRYT+V++ V+FFVGA+LM
Sbjct  61   NIFIQNDLKLSDTEIAVLAGTLNIYSLIGSALAGRTSDWIGRRYTVVLSGVIFFVGALLM  120

Query  468  GFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYV  647
            G +  Y FLM GRFVAGIGVGY LMIAPVYT E++P   RGFLTSFPEVF+N GIL+GYV
Sbjct  121  GLAPGYAFLMFGRFVAGIGVGYGLMIAPVYTVEISPTLSRGFLTSFPEVFVNLGILLGYV  180

Query  648  SNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            SN+AF  +  +L WR+MLGVG++P+V+L V VLAMP
Sbjct  181  SNYAFSKLPTNLGWRYMLGVGALPAVVLAVGVLAMP  216



>ref|XP_010442448.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   266 bits (681),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 167/199 (84%), Gaps = 0/199 (0%)
 Frame = +3

Query  159  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  338
             G + A   P +  RN++A A A LAS+ SI+LGYDIGV+SGAAI+I+ DLK++D Q+EI
Sbjct  8    QGVVVAEPEPPRGNRNRFAFACAILASMTSIILGYDIGVISGAAIFIKDDLKLSDVQLEI  67

Query  339  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  518
            L+GILN+YS+IGS +AGRTSDWIGRRYT+V+A   FF GAILMGF+TNY F+MVGRFVAG
Sbjct  68   LMGILNIYSIIGSGVAGRTSDWIGRRYTIVLAGAFFFCGAILMGFATNYPFIMVGRFVAG  127

Query  519  IGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFM  698
            IGVGYA+MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRFM
Sbjct  128  IGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHLGWRFM  187

Query  699  LGVGSIPSVLLGVSVLAMP  755
            LG+G+IPSV L + VLAMP
Sbjct  188  LGIGAIPSVFLAIGVLAMP  206



>gb|KJB12316.1| hypothetical protein B456_002G011500 [Gossypium raimondii]
Length=533

 Score =   267 bits (683),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = +3

Query  177  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  356
            F+  KK KRNK+A A A LASLASILLGYDIGVMSGA +YI+ DLKI+D QVEIL+GILN
Sbjct  25   FEVLKKPKRNKFAFACAILASLASILLGYDIGVMSGAILYIKDDLKISDVQVEILVGILN  84

Query  357  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  536
            LY LIG+ +AGRTSDWIGRRYT+VVA+ +FFVGA+LMGF+TNYTFLMVGRFV GIGVG+A
Sbjct  85   LYCLIGAYVAGRTSDWIGRRYTIVVAASIFFVGALLMGFATNYTFLMVGRFVTGIGVGFA  144

Query  537  LMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSI  716
            L+IAPVYTAEV+PAS RGFL SFPEVFIN G+L+GYVSN+AF  +   L WR MLG G+I
Sbjct  145  LLIAPVYTAEVSPASARGFLNSFPEVFINAGLLLGYVSNYAFSKLRADLGWRVMLGAGAI  204

Query  717  PSVLLGVSVLAMP  755
             SV L V VLAMP
Sbjct  205  LSVFLAVGVLAMP  217



>ref|XP_002886203.1| hypothetical protein ARALYDRAFT_343514 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62462.1| hypothetical protein ARALYDRAFT_343514 [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score =   266 bits (681),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 166/199 (83%), Gaps = 0/199 (0%)
 Frame = +3

Query  159  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  338
             G + A   P +  R++YA A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EI
Sbjct  8    QGVVIADSEPPRGNRSRYAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEI  67

Query  339  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  518
            L+GILN+YSLIGS  AGRTSDWIGRR+T+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  68   LMGILNIYSLIGSGAAGRTSDWIGRRFTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127

Query  519  IGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFM  698
            IGVGYA+MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRFM
Sbjct  128  IGVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHLGWRFM  187

Query  699  LGVGSIPSVLLGVSVLAMP  755
            LGVG++PSV L + VLAMP
Sbjct  188  LGVGAVPSVFLAIGVLAMP  206



>ref|NP_179209.1| polyol/monosaccharide transporter 1 [Arabidopsis thaliana]
 sp|Q9XIH7.1|PLT1_ARATH RecName: Full=Putative polyol transporter 1 [Arabidopsis thaliana]
 gb|AAD26954.1| putative sugar transporter [Arabidopsis thaliana]
 gb|AEC06467.1| polyol/monosaccharide transporter 1 [Arabidopsis thaliana]
Length=511

 Score =   266 bits (680),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 166/199 (83%), Gaps = 0/199 (0%)
 Frame = +3

Query  159  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  338
             G + A   P +  R++YA A A LAS+ SI+LGYDIGVMSGA+I+I+ DLK++D Q+EI
Sbjct  8    QGVVIAESEPPRGNRSRYAFACAILASMTSIILGYDIGVMSGASIFIKDDLKLSDVQLEI  67

Query  339  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  518
            L+GILN+YSL+GS  AGRTSDW+GRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  68   LMGILNIYSLVGSGAAGRTSDWLGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127

Query  519  IGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFM  698
            IGVGYA+MIAPVYTAEVAPAS RGFLTSFPE+FIN GIL+GYVSN+ F  +  HL WRFM
Sbjct  128  IGVGYAMMIAPVYTAEVAPASSRGFLTSFPEIFINIGILLGYVSNYFFSKLPEHLGWRFM  187

Query  699  LGVGSIPSVLLGVSVLAMP  755
            LGVG++PSV L + VLAMP
Sbjct  188  LGVGAVPSVFLAIGVLAMP  206



>ref|XP_002305419.2| hypothetical protein POPTR_0004s15960g [Populus trichocarpa]
 gb|EEE85930.2| hypothetical protein POPTR_0004s15960g [Populus trichocarpa]
Length=531

 Score =   266 bits (681),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 163/208 (78%), Gaps = 0/208 (0%)
 Frame = +3

Query  132  DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  311
            D  P +      +  FDP KK KRNK+A A A  AS+ASILLGYDIGVMSGA  YIQ DL
Sbjct  10   DVNPSQPTTEKTLADFDPVKKPKRNKFAFACAITASVASILLGYDIGVMSGAKDYIQTDL  69

Query  312  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  491
            K++D QV +L+G LN YSL+GS  AG TSDWIGRRYT+VVA  VFF GA+LMGFSTNY F
Sbjct  70   KLSDVQVGLLVGTLNWYSLVGSAAAGVTSDWIGRRYTIVVAGAVFFAGALLMGFSTNYAF  129

Query  492  LMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNM  671
            LMV RFVAGIGVG+ALMIAPVYT EV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +
Sbjct  130  LMVARFVAGIGVGFALMIAPVYTTEVSPASSRGFLTSFPEVFINVGILLGYVSNYAFSKL  189

Query  672  SVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
              +L WR MLGVG+IPSV L + V+ MP
Sbjct  190  PTNLGWRIMLGVGAIPSVFLALVVIGMP  217



>ref|XP_009121227.1| PREDICTED: putative polyol transporter 1 [Brassica rapa]
Length=511

 Score =   266 bits (680),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 167/199 (84%), Gaps = 0/199 (0%)
 Frame = +3

Query  159  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  338
             G + A     +  R+++A A A LAS+ SI+LGYDIGVMSGAAI+I++DLK++D Q+EI
Sbjct  8    KGVVTAEAEAPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKEDLKLSDVQLEI  67

Query  339  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  518
            L+GILN+YSL+GS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  68   LMGILNIYSLVGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127

Query  519  IGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFM  698
            IGVGYA+MIAPVYTAEVAPA+ RGFL+SFPE+FIN GIL+GYVSN+ F  + VHL WRFM
Sbjct  128  IGVGYAMMIAPVYTAEVAPATSRGFLSSFPEIFINIGILLGYVSNYFFSKLPVHLGWRFM  187

Query  699  LGVGSIPSVLLGVSVLAMP  755
            LGVGSIPSV L + VLAMP
Sbjct  188  LGVGSIPSVCLAIGVLAMP  206



>ref|XP_009336961.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=526

 Score =   266 bits (681),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 172/215 (80%), Gaps = 5/215 (2%)
 Frame = +3

Query  126  MGDTRPVRNAGSG-----HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  290
            M D R   NA +G      I  FD P K K +K+AIA A LA   S+LLGYDIGVMSGA+
Sbjct  1    MADRRAEENAVTGGPQNTSIEDFDRPMKPKTSKFAIACALLACTTSVLLGYDIGVMSGAS  60

Query  291  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  470
            ++I+++LKI+D QVE+L G LN+YSL+GS  AGRTSDWIGR+YT+V+A V+FFVGA+LMG
Sbjct  61   LFIKENLKISDVQVEVLAGTLNIYSLLGSAFAGRTSDWIGRKYTIVLAGVIFFVGALLMG  120

Query  471  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVS  650
            F+TNY FLMVGRFVAG+GVG+ +MIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GY++
Sbjct  121  FATNYAFLMVGRFVAGVGVGFGMMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYIA  180

Query  651  NFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            N+A   + +HL WRFMLGVG +P++ L V VL MP
Sbjct  181  NYALSKLPLHLGWRFMLGVGGVPALFLTVGVLFMP  215



>emb|CAD58710.1| polyol transporter [Plantago major]
Length=530

 Score =   266 bits (681),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = +3

Query  183  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  362
            P K V RNKYA+A + LAS+ S+LLGYD GVMSGA +YI+ DLKI+D QVE+L+G +N+Y
Sbjct  34   PKKPVTRNKYALAISILASMTSVLLGYDTGVMSGATLYIKDDLKISDVQVELLVGTINIY  93

Query  363  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  542
            SL+GS +AGRTSDW+GRRYT V ASVVFFVGAILMG +TNY FLM GRFVAGIGVGYALM
Sbjct  94   SLVGSAVAGRTSDWVGRRYTTVFASVVFFVGAILMGIATNYVFLMAGRFVAGIGVGYALM  153

Query  543  IAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPS  722
            IAPVY AEVAPAS RGFLTSFPEVFINFG+L+G+VSN+AF    + L WR MLGVG+IP+
Sbjct  154  IAPVYAAEVAPASCRGFLTSFPEVFINFGVLLGFVSNYAFAKFPLKLGWRMMLGVGAIPA  213

Query  723  VLLGVSVLAMP  755
            V L + V+ MP
Sbjct  214  VFLAIGVIYMP  224



>gb|KHN25431.1| Polyol transporter 5 [Glycine soja]
Length=518

 Score =   266 bits (680),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = +3

Query  180  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  359
            +P KK +RNKYA A A LAS+ SILLGYDIGVMSGAA+YIQ+DLK++D Q+EIL GI+NL
Sbjct  14   NPEKKPRRNKYAFACAILASMTSILLGYDIGVMSGAALYIQRDLKVSDVQIEILNGIINL  73

Query  360  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYAL  539
            YS +GS +AGRTSDWIGRRYT+V+A  +FFVGAILMGFS NY FLM GRF AG+G+G+A 
Sbjct  74   YSPVGSFIAGRTSDWIGRRYTIVLAGAIFFVGAILMGFSPNYAFLMFGRFFAGVGIGFAF  133

Query  540  MIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIP  719
            +IAPVYT+E++P+S RGFLTS PEVF+N GIL+GY+SN+ F  +++ L WR MLGVG+IP
Sbjct  134  LIAPVYTSEISPSSSRGFLTSLPEVFLNGGILIGYISNYGFSKLALRLGWRLMLGVGAIP  193

Query  720  SVLLGVSVLAMP  755
            S+L+GV+VLAMP
Sbjct  194  SILIGVAVLAMP  205



>ref|XP_009345072.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=523

 Score =   266 bits (680),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 168/196 (86%), Gaps = 0/196 (0%)
 Frame = +3

Query  168  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  347
            I  FD PKK K +K+AIA A LA   SILLG+DIGVMSGA+++I+++LKI+D QVE+L G
Sbjct  20   IEDFDHPKKPKTSKFAIACALLACTTSILLGFDIGVMSGASLFIKENLKISDVQVEVLAG  79

Query  348  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  527
             LN+YSL+GS +AGRTSDWIGR+YT+V+A V+F VGA+LMGF+TNY FLMVGRFVAG+GV
Sbjct  80   TLNIYSLLGSALAGRTSDWIGRKYTIVLAGVIFLVGALLMGFATNYAFLMVGRFVAGVGV  139

Query  528  GYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGV  707
            GY +MIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GY++N+AF  + +HL+WRFMLGV
Sbjct  140  GYGMMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYIANYAFAKLPLHLAWRFMLGV  199

Query  708  GSIPSVLLGVSVLAMP  755
            G +P++ L + VL MP
Sbjct  200  GGVPAIFLTIGVLFMP  215



>ref|XP_002884156.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60415.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=511

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 166/198 (84%), Gaps = 0/198 (0%)
 Frame = +3

Query  162  GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  341
            G + A   P +  R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL
Sbjct  9    GVVVADSEPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEIL  68

Query  342  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGI  521
            +GILN+YSLIGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGI
Sbjct  69   MGILNIYSLIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGI  128

Query  522  GVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFML  701
            GVGYA+MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRFML
Sbjct  129  GVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFAKLPEHLGWRFML  188

Query  702  GVGSIPSVLLGVSVLAMP  755
            G+G++PSV L + VLAMP
Sbjct  189  GIGAVPSVFLAIGVLAMP  206



>ref|XP_010484928.1| PREDICTED: putative polyol transporter 1 [Camelina sativa]
Length=512

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 167/196 (85%), Gaps = 1/196 (1%)
 Frame = +3

Query  168  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  347
            +   +PP+   R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL+G
Sbjct  12   VTELEPPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDIQLEILMG  70

Query  348  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  527
            ILN+YSLIGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGIGV
Sbjct  71   ILNIYSLIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGV  130

Query  528  GYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGV  707
            GYA+MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GY+SN+ F  +  HLSWRFMLG+
Sbjct  131  GYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYLSNYFFSKLPEHLSWRFMLGI  190

Query  708  GSIPSVLLGVSVLAMP  755
            G++P+V L + VLAMP
Sbjct  191  GAVPAVFLAIGVLAMP  206



>ref|XP_003540961.2| PREDICTED: polyol transporter 5-like [Glycine max]
Length=531

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = +3

Query  180  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  359
            +P KK +RNKYA A A LAS+ SILLGYDIGVMSGAA+YIQ+DLK++D Q+EIL GI+NL
Sbjct  27   NPEKKPRRNKYAFACAILASMTSILLGYDIGVMSGAALYIQRDLKVSDVQIEILNGIINL  86

Query  360  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYAL  539
            YS +GS +AGRTSDWIGRRYT+V+A  +FFVGAILMGFS NY FLM GRF AG+G+G+A 
Sbjct  87   YSPVGSFIAGRTSDWIGRRYTIVLAGAIFFVGAILMGFSPNYAFLMFGRFFAGVGIGFAF  146

Query  540  MIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIP  719
            +IAPVYT+E++P+S RGFLTS PEVF+N GIL+GY+SN+ F  +++ L WR MLGVG+IP
Sbjct  147  LIAPVYTSEISPSSSRGFLTSLPEVFLNGGILIGYISNYGFSKLALRLGWRLMLGVGAIP  206

Query  720  SVLLGVSVLAMP  755
            S+L+GV+VLAMP
Sbjct  207  SILIGVAVLAMP  218



>gb|KFK41272.1| hypothetical protein AALP_AA2G108500 [Arabis alpina]
Length=444

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 165/192 (86%), Gaps = 1/192 (1%)
 Frame = +3

Query  180  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  359
            +PP+   R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL+GILN+
Sbjct  16   EPPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEILMGILNI  74

Query  360  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYAL  539
            YSL+GS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGIGVGYA+
Sbjct  75   YSLVGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAM  134

Query  540  MIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIP  719
            MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  H+ WRFMLG+G++P
Sbjct  135  MIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFAKLPEHIGWRFMLGIGAVP  194

Query  720  SVLLGVSVLAMP  755
            SV L + VLAMP
Sbjct  195  SVFLALGVLAMP  206



>ref|XP_006657888.1| PREDICTED: polyol transporter 5-like [Oryza brachyantha]
Length=510

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 165/199 (83%), Gaps = 0/199 (0%)
 Frame = +3

Query  159  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  338
            S  +P    PKK    K+A A A L+S+ SILLGYDIGVMSGA++YI+KDLK++D +VE+
Sbjct  3    SAALPEAVAPKKKGNFKFAFACAILSSMTSILLGYDIGVMSGASLYIKKDLKLSDGKVEV  62

Query  339  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  518
            L+GILNLYSLIGS  AGRTSDWIGRRYT+V A+V+FF GA+LMGFS N+  LM GRFVAG
Sbjct  63   LMGILNLYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGALLMGFSVNFGMLMFGRFVAG  122

Query  519  IGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFM  698
            IGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSN+AF  + + L WR M
Sbjct  123  IGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSRLPLRLGWRVM  182

Query  699  LGVGSIPSVLLGVSVLAMP  755
            LG+G+ PSVLL + VL MP
Sbjct  183  LGIGAAPSVLLALMVLGMP  201



>tpg|DAA45950.1| TPA: hypothetical protein ZEAMMB73_850316 [Zea mays]
Length=519

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 168/203 (83%), Gaps = 0/203 (0%)
 Frame = +3

Query  147  RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDT  326
            R A  G      PP+K    ++A A A LAS+ SILLGYDIGVMSGAA++I++DLKI+D 
Sbjct  11   RVASDGLPDGVAPPRKKSNVRFAFACAILASMTSILLGYDIGVMSGAALFIKEDLKISDV  70

Query  327  QVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGR  506
            +VE+LLGILNLYSLIGS  AGRTSDWIGRR T+++A+V+FFVGA +MGFS NY  LM GR
Sbjct  71   EVEVLLGILNLYSLIGSFAAGRTSDWIGRRLTIILAAVIFFVGAFMMGFSVNYPMLMAGR  130

Query  507  FVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLS  686
            FVAGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSN+AF ++S+ + 
Sbjct  131  FVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINFGILLGYVSNYAFSHLSLKVG  190

Query  687  WRFMLGVGSIPSVLLGVSVLAMP  755
            WR MLGVG+ PSV+L + VL MP
Sbjct  191  WRLMLGVGAAPSVVLALMVLGMP  213



>ref|XP_010495901.1| PREDICTED: putative polyol transporter 1 [Camelina sativa]
Length=511

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 166/192 (86%), Gaps = 1/192 (1%)
 Frame = +3

Query  180  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  359
            +PP+   R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL+GILN+
Sbjct  16   EPPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDIQLEILMGILNI  74

Query  360  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYAL  539
            YSLIGS  AGRTSDW+GRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGIGVGYA+
Sbjct  75   YSLIGSGAAGRTSDWMGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAM  134

Query  540  MIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIP  719
            MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRFMLG+G++P
Sbjct  135  MIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHLGWRFMLGIGAVP  194

Query  720  SVLLGVSVLAMP  755
            +VLL + VLAMP
Sbjct  195  AVLLAIGVLAMP  206



>ref|XP_007200584.1| hypothetical protein PRUPE_ppa007633mg [Prunus persica]
 gb|EMJ01783.1| hypothetical protein PRUPE_ppa007633mg [Prunus persica]
Length=335

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = +3

Query  264  DIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVV  443
            DIGVMSGAAIYI+KDLK++D ++E+L+GILNLYSLIGS  AGRTSDWIGRRYT+V+A  +
Sbjct  26   DIGVMSGAAIYIKKDLKVSDVEIEVLIGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGAI  85

Query  444  FFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFIN  623
            FF GA+LMGF+ NY FLM GRF+AGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN
Sbjct  86   FFAGALLMGFAPNYAFLMFGRFIAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFIN  145

Query  624  FGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
             GIL GYVSN+ F  +  HL WR MLGVG+IP++ L + VLAMP
Sbjct  146  AGILFGYVSNYGFSKLPTHLGWRLMLGVGAIPAIFLAIGVLAMP  189



>ref|XP_008775333.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=528

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 171/214 (80%), Gaps = 4/214 (2%)
 Frame = +3

Query  126  MGDTRPVRNAGSGHIP----AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  293
            M D +P   A S   P    A + PKK  RNKYA+A A LAS+ SIL GYD+ VMSGA++
Sbjct  1    MDDQKPRAPAISDPPPNQTLALEKPKKPPRNKYALACATLASMTSILSGYDVAVMSGASV  60

Query  294  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  473
            +IQKDL+INDTQ+EIL GI+N++SL+GS  AGRTSDWIGRRYT++ A+ +FF GA+LMG 
Sbjct  61   FIQKDLEINDTQIEILAGIINIFSLVGSVAAGRTSDWIGRRYTIIFAAAIFFAGALLMGL  120

Query  474  STNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSN  653
            +TNY FLMVGRFVAG+GVGYALMIAPVYTAEVAP S RGFLTSFPEVFIN G+L+GYVSN
Sbjct  121  ATNYAFLMVGRFVAGVGVGYALMIAPVYTAEVAPTSSRGFLTSFPEVFINSGVLLGYVSN  180

Query  654  FAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            FAF  +  HL+WR M  VG++P + L ++VLAMP
Sbjct  181  FAFAKLPDHLNWRIMFCVGAVPPIFLAIAVLAMP  214



>ref|XP_010472919.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 166/198 (84%), Gaps = 0/198 (0%)
 Frame = +3

Query  162  GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  341
            G + A   P +  R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL
Sbjct  9    GVVVAEPEPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDIQLEIL  68

Query  342  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGI  521
            +GILN+YSLIGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRF+AGI
Sbjct  69   MGILNIYSLIGSGAAGRTSDWIGRRYTIVLAGSFFFCGALLMGFATNYPFIMVGRFIAGI  128

Query  522  GVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFML  701
            GVGYA+MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRFML
Sbjct  129  GVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHLGWRFML  188

Query  702  GVGSIPSVLLGVSVLAMP  755
            GVG++PSV L + VLAMP
Sbjct  189  GVGAVPSVFLAIGVLAMP  206



>ref|XP_008795604.1| PREDICTED: putative polyol transporter 1 [Phoenix dactylifera]
Length=522

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +3

Query  186  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  365
            P+     +YA A A LAS+ SI+LGYDIGVMSGAA++I+ DL +NDTQ+EILLGILNLYS
Sbjct  26   PRPRHNKRYACACAMLASMTSIILGYDIGVMSGAALFIEDDLHVNDTQIEILLGILNLYS  85

Query  366  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMI  545
            ++GS  AGRTSDWIGRRYT+V A+V+FFVGAI+MG + NY FLMVGRFVAG+GVGYA +I
Sbjct  86   IVGSLAAGRTSDWIGRRYTIVFAAVIFFVGAIMMGLAPNYAFLMVGRFVAGVGVGYAAVI  145

Query  546  APVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSV  725
            A VYTAEVAPAS RGFLTSFPEVFIN GIL+GYVSNFAF  +  +L WR MLGVG++PSV
Sbjct  146  AAVYTAEVAPASSRGFLTSFPEVFINCGILLGYVSNFAFSKLPENLGWRLMLGVGAVPSV  205

Query  726  LLGVSVLAMP  755
             LGV VLAMP
Sbjct  206  FLGVGVLAMP  215



>ref|XP_010472942.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 166/198 (84%), Gaps = 0/198 (0%)
 Frame = +3

Query  162  GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  341
            G + A   P +  R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL
Sbjct  9    GVVVAEPEPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDIQLEIL  68

Query  342  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGI  521
            +GILN+YSLIGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRF+AGI
Sbjct  69   MGILNIYSLIGSGAAGRTSDWIGRRYTIVLAGSFFFCGALLMGFATNYPFIMVGRFIAGI  128

Query  522  GVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFML  701
            GVGYA+MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRFML
Sbjct  129  GVGYAMMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHLGWRFML  188

Query  702  GVGSIPSVLLGVSVLAMP  755
            GVG++PSV L + VLAMP
Sbjct  189  GVGAVPSVFLAIGVLAMP  206



>ref|XP_004983902.1| PREDICTED: polyol transporter 5-like isoform X2 [Setaria italica]
Length=523

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 167/201 (83%), Gaps = 0/201 (0%)
 Frame = +3

Query  153  AGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQV  332
            A  G +P    PKK    ++A A A LAS+ SILLGYDIGVMSGAA++I++DL+I+D +V
Sbjct  13   ASDGRLPDGVAPKKKTNVRFAFACAILASMTSILLGYDIGVMSGAALFIKEDLEISDVEV  72

Query  333  EILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFV  512
            EILLGILNLYSLIGS  AGRTSDWIGRR T+++A+ +FFVGA +MGFS NY  LM GRFV
Sbjct  73   EILLGILNLYSLIGSFAAGRTSDWIGRRLTIILAAAIFFVGAFIMGFSVNYPMLMAGRFV  132

Query  513  AGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWR  692
            AGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSN+AF ++S+ L WR
Sbjct  133  AGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINFGILLGYVSNYAFSHLSLKLGWR  192

Query  693  FMLGVGSIPSVLLGVSVLAMP  755
             MLG+G+ PSV+L + VL MP
Sbjct  193  LMLGIGAAPSVVLALMVLGMP  213



>ref|XP_010442571.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=518

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 165/192 (86%), Gaps = 1/192 (1%)
 Frame = +3

Query  180  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  359
            +PP+   R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL+GILN+
Sbjct  16   EPPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEILMGILNI  74

Query  360  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYAL  539
            YS+IGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGIGVGYA+
Sbjct  75   YSIIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAM  134

Query  540  MIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIP  719
            MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRFMLG+G+IP
Sbjct  135  MIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPEHLGWRFMLGIGAIP  194

Query  720  SVLLGVSVLAMP  755
            SV L + VLAMP
Sbjct  195  SVFLTIGVLAMP  206



>gb|KFK40045.1| hypothetical protein AALP_AA3G322700 [Arabis alpina]
Length=487

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 165/192 (86%), Gaps = 1/192 (1%)
 Frame = +3

Query  180  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  359
            +PP+   R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL+GILN+
Sbjct  16   EPPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEILMGILNI  74

Query  360  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYAL  539
            YSL+GS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRF+AGIGVGYA+
Sbjct  75   YSLVGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFIAGIGVGYAM  134

Query  540  MIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIP  719
            MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRFMLG+G++P
Sbjct  135  MIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFAKLPEHLGWRFMLGIGAVP  194

Query  720  SVLLGVSVLAMP  755
            SV L + VLAMP
Sbjct  195  SVFLALGVLAMP  206



>ref|XP_004983901.1| PREDICTED: polyol transporter 5-like isoform X1 [Setaria italica]
Length=535

 Score =   265 bits (677),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 167/201 (83%), Gaps = 0/201 (0%)
 Frame = +3

Query  153  AGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQV  332
            A  G +P    PKK    ++A A A LAS+ SILLGYDIGVMSGAA++I++DL+I+D +V
Sbjct  13   ASDGRLPDGVAPKKKTNVRFAFACAILASMTSILLGYDIGVMSGAALFIKEDLEISDVEV  72

Query  333  EILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFV  512
            EILLGILNLYSLIGS  AGRTSDWIGRR T+++A+ +FFVGA +MGFS NY  LM GRFV
Sbjct  73   EILLGILNLYSLIGSFAAGRTSDWIGRRLTIILAAAIFFVGAFIMGFSVNYPMLMAGRFV  132

Query  513  AGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWR  692
            AGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSN+AF ++S+ L WR
Sbjct  133  AGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINFGILLGYVSNYAFSHLSLKLGWR  192

Query  693  FMLGVGSIPSVLLGVSVLAMP  755
             MLG+G+ PSV+L + VL MP
Sbjct  193  LMLGIGAAPSVVLALMVLGMP  213



>ref|XP_010507195.1| PREDICTED: polyol transporter 5 [Camelina sativa]
Length=534

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +3

Query  183  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  362
            P K  K+N+YA A A LAS+ SILLGYDIGVMSGA IYI++DLKI DTQ+ IL G LN+Y
Sbjct  27   PAKPPKKNRYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKITDTQIGILAGSLNIY  86

Query  363  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  542
            SLIGSC AG+TSDWIGRRYT+V+A  +FF GAILMG + NY FLM GRF+AGIGVGYALM
Sbjct  87   SLIGSCAAGKTSDWIGRRYTIVLAGAIFFAGAILMGLAPNYAFLMFGRFIAGIGVGYALM  146

Query  543  IAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPS  722
            IAPVYTAEVAPAS RGFL SFPEVFIN GI++GYVSN AF    + L WR MLG+G+IPS
Sbjct  147  IAPVYTAEVAPASSRGFLNSFPEVFINAGIMLGYVSNLAFSKFPLKLGWRLMLGIGAIPS  206

Query  723  VLLGVSVLAMP  755
            V+L + VLAMP
Sbjct  207  VVLAIGVLAMP  217



>ref|XP_009396401.1| PREDICTED: polyol transporter 5-like [Musa acuminata subsp. malaccensis]
Length=513

 Score =   264 bits (675),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +3

Query  186  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  365
            P K K  ++A A A LAS+ SILLGYDIGVMSGAAI+I+ DLKI+DTQVEILLGILNLYS
Sbjct  17   PAKRKSKRFAFACAMLASMTSILLGYDIGVMSGAAIFIKDDLKISDTQVEILLGILNLYS  76

Query  366  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMI  545
            L+GS  AG TSDWIGRRYT+V A+ +FFVGA+LMGF+ NY FLM GRFVAGIGVGYALMI
Sbjct  77   LVGSYAAGFTSDWIGRRYTIVFAAGIFFVGALLMGFAVNYAFLMFGRFVAGIGVGYALMI  136

Query  546  APVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSV  725
            APVYTAEVAPAS RGFLTSFPEVFIN GIL+GYVSN+ F  +   L WR MLGVG+IPSV
Sbjct  137  APVYTAEVAPASSRGFLTSFPEVFINSGILLGYVSNYGFARLRESLGWRLMLGVGAIPSV  196

Query  726  LLGVSVLAMP  755
             L + VLAMP
Sbjct  197  FLALGVLAMP  206



>ref|XP_007201628.1| hypothetical protein PRUPE_ppa021469mg [Prunus persica]
 gb|EMJ02827.1| hypothetical protein PRUPE_ppa021469mg [Prunus persica]
Length=490

 Score =   263 bits (673),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = +3

Query  177  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  356
            FDPP+K KRNK+AIA + +A   SILLGYDIGVMSGA ++IQ DLKIND Q++IL G LN
Sbjct  9    FDPPQKPKRNKFAIACSLMACTTSILLGYDIGVMSGANLFIQDDLKINDVQIQILTGTLN  68

Query  357  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  536
            +YS++GS +AGRTSDWIGRRYT  ++  +F VGAILMG +  YTFLM GRFVAGIGVGY 
Sbjct  69   IYSVLGSALAGRTSDWIGRRYTAFLSGAIFSVGAILMGVAQGYTFLMFGRFVAGIGVGYG  128

Query  537  LMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSI  716
            LMI+PVYTAE+AP   RGFLTSFPEVF+N GIL+GYVSN+AF  +  HL WRFMLG+G++
Sbjct  129  LMISPVYTAEIAPTLSRGFLTSFPEVFVNIGILLGYVSNYAFSKLPAHLYWRFMLGIGAL  188

Query  717  PSVLLGVSVLAMP  755
            P+++L + VLA+P
Sbjct  189  PAIILAIGVLAVP  201



>ref|XP_009121388.1| PREDICTED: LOW QUALITY PROTEIN: putative polyol transporter 1 
[Brassica rapa]
Length=511

 Score =   264 bits (674),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = +3

Query  201  RNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSC  380
            R+++A A A LAS+ SI+LGYDIGVMSGAAI+I++DLK++D Q+EIL+GILN+YSL+GS 
Sbjct  22   RSRFAFACAILASMTSIILGYDIGVMSGAAIFIKEDLKLSDVQLEILMGILNIYSLVGSG  81

Query  381  MAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYT  560
             AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGIGVGYA+MIAPVYT
Sbjct  82   AAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMIAPVYT  141

Query  561  AEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVLLGVS  740
            AEVAPA+ RGFL+SFPE+FIN GIL+GYV N+ F  + VHL WRFMLGVGSIPSV L + 
Sbjct  142  AEVAPATSRGFLSSFPEIFINIGILLGYVXNYFFSKLPVHLGWRFMLGVGSIPSVCLAIG  201

Query  741  VLAMP  755
            VLAMP
Sbjct  202  VLAMP  206



>ref|XP_010435020.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   264 bits (674),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 165/193 (85%), Gaps = 1/193 (1%)
 Frame = +3

Query  177  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  356
             +PP+   R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL+GILN
Sbjct  15   LEPPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDIQLEILMGILN  73

Query  357  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  536
            +YSLIGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGIGVGYA
Sbjct  74   IYSLIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYA  133

Query  537  LMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSI  716
            +MIAPVYTAEVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRFMLG+G++
Sbjct  134  MMIAPVYTAEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFSKLPDHLGWRFMLGIGAV  193

Query  717  PSVLLGVSVLAMP  755
            P+V L + VLAMP
Sbjct  194  PAVFLAIGVLAMP  206



>emb|CDY46218.1| BnaA07g03520D [Brassica napus]
Length=511

 Score =   264 bits (674),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 167/199 (84%), Gaps = 0/199 (0%)
 Frame = +3

Query  159  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  338
             G + A     +  R+++A A A LAS+ SI+LGYDIGVMSGAAI+I++DLK++D Q+EI
Sbjct  8    KGVVTAEAEAPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKEDLKLSDVQLEI  67

Query  339  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  518
            L+GILN+YSL+GS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  68   LMGILNIYSLVGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127

Query  519  IGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFM  698
            IGVGYA+MIAPVYTAEVAPA+ RGFL+SFPE+FIN GIL+GYVSN+ F  + VH+ WRFM
Sbjct  128  IGVGYAMMIAPVYTAEVAPATSRGFLSSFPEIFINIGILLGYVSNYFFAKLPVHIGWRFM  187

Query  699  LGVGSIPSVLLGVSVLAMP  755
            LGVG+IPSV L + VLAMP
Sbjct  188  LGVGAIPSVCLAIGVLAMP  206



>ref|XP_008795606.1| PREDICTED: polyol transporter 5-like isoform X1 [Phoenix dactylifera]
Length=522

 Score =   264 bits (674),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 169/215 (79%), Gaps = 5/215 (2%)
 Frame = +3

Query  126  MGDTRPVRNAGSGHIPAFD-----PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  290
            M D +P     +  +P         P+     +YA A A LAS+ SILLGYDIGVMSGAA
Sbjct  1    MTDQKPEATKVAPQVPHDSLLEAVAPRPRHNKRYAFACAMLASMTSILLGYDIGVMSGAA  60

Query  291  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  470
            ++++ DL +NDTQ+EILLGILNL+S++GS  AGRTSDWIGRRYT+V A+V+FFVGAI+MG
Sbjct  61   LFMKDDLHVNDTQIEILLGILNLFSIVGSLAAGRTSDWIGRRYTIVFAAVIFFVGAIMMG  120

Query  471  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVS  650
             + NY FLMVGRFVAG+GVGYAL+IAPVYT E+APAS RGFLTSFPEVFIN GIL+GYVS
Sbjct  121  LAPNYAFLMVGRFVAGVGVGYALVIAPVYTTELAPASSRGFLTSFPEVFINSGILLGYVS  180

Query  651  NFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            NFAF  + V+L WR MLGVG++PSV L V VLAMP
Sbjct  181  NFAFSKLPVNLGWRLMLGVGAVPSVFLVVGVLAMP  215



>ref|XP_006384498.1| hypothetical protein POPTR_0004s15900g [Populus trichocarpa]
 gb|ERP62295.1| hypothetical protein POPTR_0004s15900g [Populus trichocarpa]
Length=503

 Score =   263 bits (672),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 164/208 (79%), Gaps = 0/208 (0%)
 Frame = +3

Query  132  DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  311
            D  P +      +  FDP KK K NK+A A A LAS+ASILLGYDIGVMSGA  YI+ DL
Sbjct  10   DVNPSQPTTEKTLADFDPVKKPKGNKFAFACAILASMASILLGYDIGVMSGAKDYIKIDL  69

Query  312  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  491
            K++DTQV +L+G LN YSL+GS  AG TSDWIGRRYT+VVA  VFF GA+LMGFSTNY F
Sbjct  70   KLSDTQVGLLVGTLNWYSLVGSAAAGVTSDWIGRRYTIVVAGAVFFAGALLMGFSTNYAF  129

Query  492  LMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNM  671
            LMV RFV GIGVG+ALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF  +
Sbjct  130  LMVARFVTGIGVGFALMIAPVYTAEVSPASSRGFLTSFPEVFINAGILIGYVSNYAFSKL  189

Query  672  SVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
              +L WR MLGVG+IPSV L + V+ MP
Sbjct  190  PTNLGWRIMLGVGAIPSVFLALVVIGMP  217



>ref|XP_010905473.1| PREDICTED: putative polyol transporter 1 [Elaeis guineensis]
Length=523

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 167/215 (78%), Gaps = 5/215 (2%)
 Frame = +3

Query  126  MGDTRPVRNAGSGHIPAFDPPKKV-----KRNKYaiaaaflaslasillGYDIGVMSGAA  290
            M D +P     +  +P    P  V     + NK+A+A   LAS+ +I+LGYDIGVMSGAA
Sbjct  1    MTDQKPEATKVAYQVPHDSLPTAVAPQPWRNNKFAMACGALASMTTIVLGYDIGVMSGAA  60

Query  291  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  470
            I+IQ D  ++DT++EILLGILN+ SLIGS  AGRT+DWIGRRYT+V A+ +FFVGAILMG
Sbjct  61   IFIQDDFHVSDTEIEILLGILNISSLIGSLAAGRTADWIGRRYTIVFAAGIFFVGAILMG  120

Query  471  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVS  650
             + NY FLMVGRF+ GIGVGYA +IA VYTAEVAPAS RGFL SFPEVFINFGILVGY+S
Sbjct  121  LAPNYAFLMVGRFITGIGVGYAGVIAAVYTAEVAPASSRGFLVSFPEVFINFGILVGYLS  180

Query  651  NFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            NFAF  +  HLSWR MLGVG+IPSV LG+ VLAMP
Sbjct  181  NFAFARLPEHLSWRLMLGVGAIPSVFLGIGVLAMP  215



>ref|NP_001281038.1| polyol transporter 5-like [Malus domestica]
 gb|AAO88965.1| sorbitol transporter [Malus domestica]
Length=481

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  258  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  437
            GYDIGVMSGA+++I+++LKI+D QVEI+ G LNLYSLIGS +AGRTSDWIGRRYT+V+A 
Sbjct  7    GYDIGVMSGASLFIKENLKISDVQVEIMNGTLNLYSLIGSALAGRTSDWIGRRYTIVLAG  66

Query  438  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVF  617
             +FF+GA+LMGF+ NY FLM GRFVAG+GVGYALMIAPVYTAE++PAS RGFLTSFPEVF
Sbjct  67   TIFFIGALLMGFAPNYAFLMFGRFVAGVGVGYALMIAPVYTAEISPASFRGFLTSFPEVF  126

Query  618  INFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            +N GIL+GYVSN+AF  + +HL+WR MLGVG+ PSV+L V VLAMP
Sbjct  127  VNIGILLGYVSNYAFSKLPIHLNWRIMLGVGAFPSVILAVGVLAMP  172



>ref|XP_003562817.1| PREDICTED: polyol transporter 5-like [Brachypodium distachyon]
Length=513

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = +3

Query  186  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  365
            PKK    ++A A A LAS+ SILLGYDIGVMSGA+++I+KDL+I+D QVE+L+GILN+YS
Sbjct  12   PKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLFIKKDLQISDVQVEVLMGILNVYS  71

Query  366  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMI  545
            LIGS  AGRTSDWIGRRYT+V A+V+FF GA++MGFS NY  LM GRFVAGIGVGYALMI
Sbjct  72   LIGSFAAGRTSDWIGRRYTIVFAAVIFFAGALVMGFSVNYLMLMFGRFVAGIGVGYALMI  131

Query  546  APVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSV  725
            APVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSN+AF  +S+ L WR MLG+G+ PSV
Sbjct  132  APVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSRLSLRLGWRVMLGIGAAPSV  191

Query  726  LLGVSVLAMP  755
            LL   VL MP
Sbjct  192  LLAFMVLGMP  201



>ref|NP_179210.1| polyol/monosaccharide transporter 2 [Arabidopsis thaliana]
 sp|Q9XIH6.1|PLT2_ARATH RecName: Full=Putative polyol transporter 2 [Arabidopsis thaliana]
 gb|AAD26955.1| putative sugar transporter [Arabidopsis thaliana]
 gb|AEC06468.1| polyol/monosaccharide transporter 2 [Arabidopsis thaliana]
Length=511

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 165/198 (83%), Gaps = 0/198 (0%)
 Frame = +3

Query  162  GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  341
            G + A   P +  R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL
Sbjct  9    GVVVAESEPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEIL  68

Query  342  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGI  521
            +GILN+YSLIGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGI
Sbjct  69   MGILNIYSLIGSGAAGRTSDWIGRRYTIVLAGFFFFCGALLMGFATNYPFIMVGRFVAGI  128

Query  522  GVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFML  701
            GVGYA+MIAPVYT EVAPAS RGFL+SFPE+FIN GIL+GYVSN+ F  +  H+ WRFML
Sbjct  129  GVGYAMMIAPVYTTEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFAKLPEHIGWRFML  188

Query  702  GVGSIPSVLLGVSVLAMP  755
            G+G++PSV L + VLAMP
Sbjct  189  GIGAVPSVFLAIGVLAMP  206



>ref|XP_009345073.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
Length=491

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +3

Query  258  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  437
            GYDIGVMSGA++YI+KDLK+ DTQ+EILLGIL +YSLIGS MAG+TSDW+GRRYT+V++ 
Sbjct  7    GYDIGVMSGASLYIEKDLKVTDTQIEILLGILEIYSLIGSAMAGKTSDWVGRRYTIVISG  66

Query  438  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVF  617
             +FFVGAILMG STNYTFLM GRFVAGIGVGYAL IAPVY+AEVAPAS RGFLTSFPEVF
Sbjct  67   AIFFVGAILMGLSTNYTFLMCGRFVAGIGVGYALTIAPVYSAEVAPASSRGFLTSFPEVF  126

Query  618  INFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            +N GI++GY+SN+AF    + L WR MLGVG+IPSV L V VLAMP
Sbjct  127  VNIGIVLGYLSNYAFSFCPLDLGWRLMLGVGAIPSVGLAVGVLAMP  172



>ref|XP_007131852.1| hypothetical protein PHAVU_011G046800g [Phaseolus vulgaris]
 gb|ESW03846.1| hypothetical protein PHAVU_011G046800g [Phaseolus vulgaris]
Length=519

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 161/194 (83%), Gaps = 0/194 (0%)
 Frame = +3

Query  174  AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGIL  353
            A    K +K N Y  A A LAS+ SILLGYDIGVMSGAAIYI++DLK++D ++EIL+GI 
Sbjct  13   AHQTRKNLKLNNYTFACAILASITSILLGYDIGVMSGAAIYIKRDLKLSDVKIEILVGIF  72

Query  354  NLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGY  533
            NLYSL+GSC+AGRTSDWIGRRYT+V A  +FFVGAILMGFS NY FLM GRFVAG+G+GY
Sbjct  73   NLYSLVGSCLAGRTSDWIGRRYTIVFAGAIFFVGAILMGFSPNYAFLMFGRFVAGVGMGY  132

Query  534  ALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGS  713
            ALMIAPVYTAE++P S RGFLTSF +VFIN GIL+GY+SN+A   M++ L WR MLG+G+
Sbjct  133  ALMIAPVYTAELSPPSSRGFLTSFTDVFINVGILLGYISNYALSKMTLKLGWRMMLGIGA  192

Query  714  IPSVLLGVSVLAMP  755
            +PS+ L V VLAMP
Sbjct  193  VPSMFLTVGVLAMP  206



>ref|XP_002467638.1| hypothetical protein SORBIDRAFT_01g031360 [Sorghum bicolor]
 gb|EER94636.1| hypothetical protein SORBIDRAFT_01g031360 [Sorghum bicolor]
Length=535

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 169/206 (82%), Gaps = 1/206 (0%)
 Frame = +3

Query  141  PVRNAGSGHIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  317
            P   A S  +P    PP+K    ++A A A LAS+ SILLGYDIGVMSGAA++I++DLKI
Sbjct  8    PTNRAASDGLPDGVAPPRKKTNVRFAFACAILASMTSILLGYDIGVMSGAALFIKEDLKI  67

Query  318  NDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLM  497
            +D +VE+LLGILNLYSL+GS  AGRTSDWIGRR T+++A+V+FFVGA +MGFS NY  LM
Sbjct  68   SDVEVEVLLGILNLYSLLGSFAAGRTSDWIGRRLTIILAAVIFFVGAFMMGFSVNYPMLM  127

Query  498  VGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSV  677
             GRFVAGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL+GYVSN+AF ++S+
Sbjct  128  AGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINIGILLGYVSNYAFSHLSL  187

Query  678  HLSWRFMLGVGSIPSVLLGVSVLAMP  755
             + WR MLG+G+ PSV+L + VL MP
Sbjct  188  KVGWRLMLGIGAAPSVVLALMVLGMP  213



>dbj|BAC83310.1| putative sorbitol transporter [Oryza sativa Japonica Group]
 gb|EAZ40438.1| hypothetical protein OsJ_24893 [Oryza sativa Japonica Group]
Length=510

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = +3

Query  159  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  338
            S  +P    PKK    ++A A A LAS+ SILLGYDIGVMSGA++YI+KD  I+D +VE+
Sbjct  3    SAALPEAVAPKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIKKDFNISDGKVEV  62

Query  339  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  518
            L+GILNLYSLIGS  AGRTSDWIGRRYT+V A+V+FF GA LMGF+ NY  LM GRFVAG
Sbjct  63   LMGILNLYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYAMLMFGRFVAG  122

Query  519  IGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFM  698
            IGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSN+AF  + ++L WR M
Sbjct  123  IGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSRLPLNLGWRIM  182

Query  699  LGVGSIPSVLLGVSVLAMP  755
            LG+G+ PSVLL + VL MP
Sbjct  183  LGIGAAPSVLLALMVLGMP  201



>gb|EAZ04480.1| hypothetical protein OsI_26629 [Oryza sativa Indica Group]
Length=510

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = +3

Query  159  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  338
            S  +P    PKK    ++A A A LAS+ SILLGYDIGVMSGA++YI+KD  I+D +VE+
Sbjct  3    SAALPEAVAPKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIKKDFNISDGKVEV  62

Query  339  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  518
            L+GILNLYSLIGS  AGRTSDWIGRRYT+V A+V+FF GA LMGF+ NY  LM GRFVAG
Sbjct  63   LMGILNLYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYAMLMFGRFVAG  122

Query  519  IGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFM  698
            IGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSN+AF  + ++L WR M
Sbjct  123  IGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSRLPLNLGWRIM  182

Query  699  LGVGSIPSVLLGVSVLAMP  755
            LG+G+ PSVLL + VL MP
Sbjct  183  LGIGAAPSVLLALMVLGMP  201



>ref|XP_007200117.1| hypothetical protein PRUPE_ppa018884mg [Prunus persica]
 gb|EMJ01316.1| hypothetical protein PRUPE_ppa018884mg [Prunus persica]
Length=527

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 168/216 (78%), Gaps = 6/216 (3%)
 Frame = +3

Query  126  MGDTRPVRNAGSGH------IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGA  287
            M D R   +A SG       I  FDPP+K K NK+AIA A LA   SILLGYDIGVMSGA
Sbjct  1    MADRRVEESAVSGQLQNDHRIADFDPPQKPKTNKFAIACAILACTTSILLGYDIGVMSGA  60

Query  288  AIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILM  467
             I+IQ DLK++DT++ +L G LN+YSLIGS +AGRTSDWIGRRYT+V++ V+FFVGA+LM
Sbjct  61   NIFIQNDLKLSDTEIAVLAGTLNIYSLIGSALAGRTSDWIGRRYTVVLSGVIFFVGALLM  120

Query  468  GFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYV  647
            G +  Y FLM GRFVAGIGVGY LMIAPVYT E++P   RGFLTSFPEVF+N GIL+GYV
Sbjct  121  GLAPGYAFLMFGRFVAGIGVGYGLMIAPVYTVEISPTLDRGFLTSFPEVFVNLGILLGYV  180

Query  648  SNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            SN+AF  +  +L WR+ML +G++P+V+L V VLAMP
Sbjct  181  SNYAFSKLPTNLGWRYMLALGALPAVVLAVGVLAMP  216



>emb|CDY46217.1| BnaA07g03530D [Brassica napus]
Length=512

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = +3

Query  201  RNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSC  380
            R+++A A A LAS+ SI+LGYDIGVMSGAAI+I++DLK++D Q+EIL+GILN+YSL+GS 
Sbjct  23   RSRFAFACAILASMTSIILGYDIGVMSGAAIFIKEDLKLSDVQLEILMGILNIYSLVGSG  82

Query  381  MAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYT  560
             AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGIGVGYA+MIAPVYT
Sbjct  83   AAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMIAPVYT  142

Query  561  AEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVLLGVS  740
            AEVAPA+ RGFL+SFPE+FIN GIL+GYVSN+ F  +  HL WRFMLGVG+IPSV L + 
Sbjct  143  AEVAPATSRGFLSSFPEIFINIGILLGYVSNYFFAKLPGHLGWRFMLGVGAIPSVCLAIG  202

Query  741  VLAMP  755
            VLAMP
Sbjct  203  VLAMP  207



>ref|XP_008791366.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=507

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 165/192 (86%), Gaps = 0/192 (0%)
 Frame = +3

Query  180  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  359
            + PKK  RNKYA+A A LAS+ SILLGYDI VMSGA+++I+KDLKINDTQ+EIL GI+N+
Sbjct  2    EKPKKPPRNKYALACATLASMTSILLGYDIAVMSGASVFIKKDLKINDTQIEILAGIINI  61

Query  360  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYAL  539
            +SL+GS  AGRTSDWIGRRYT++ A+ +FF GA+LMGF+TNY FLMVGRF+AG+GVGYAL
Sbjct  62   FSLVGSIAAGRTSDWIGRRYTIIFAAAIFFAGALLMGFATNYAFLMVGRFIAGVGVGYAL  121

Query  540  MIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIP  719
            MIAPVYTAEVAP S RGFLTSFPEVFIN G+L+GYVSNFAF  +  HL+WR M  VG++P
Sbjct  122  MIAPVYTAEVAPTSSRGFLTSFPEVFINSGVLLGYVSNFAFAKLPYHLNWRIMFWVGAVP  181

Query  720  SVLLGVSVLAMP  755
             + L ++VLAMP
Sbjct  182  PIFLAIAVLAMP  193



>ref|XP_010465998.1| PREDICTED: polyol transporter 5-like [Camelina sativa]
Length=534

 Score =   262 bits (670),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 161/199 (81%), Gaps = 2/199 (1%)
 Frame = +3

Query  165  HIPAF--DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  338
            H+P+    P K  K+N+YA A A LAS+ SILLGYDIGVMSGA IYI++DL I DTQ+ I
Sbjct  19   HVPSELGVPAKPPKKNRYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLDITDTQIGI  78

Query  339  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  518
            L G LN+YSLIGSC AG+TSDWIGRRYT+V+A  +FF GAILMG + NY FLM GRF+AG
Sbjct  79   LAGSLNIYSLIGSCAAGKTSDWIGRRYTIVLAGAIFFAGAILMGLAPNYAFLMFGRFIAG  138

Query  519  IGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFM  698
            IGVGYALMIAPVYTAEVAPAS RGFL SFPEVFIN GI++GYVSN AF    + L WR M
Sbjct  139  IGVGYALMIAPVYTAEVAPASSRGFLNSFPEVFINAGIMLGYVSNLAFSKFPLKLGWRLM  198

Query  699  LGVGSIPSVLLGVSVLAMP  755
            LG+G++PSV+L + VLAMP
Sbjct  199  LGIGAVPSVVLAIGVLAMP  217



>ref|XP_008653287.1| PREDICTED: polyol transporter 5-like [Zea mays]
 tpg|DAA63325.1| TPA: hypothetical protein ZEAMMB73_442702 [Zea mays]
Length=513

 Score =   261 bits (668),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = +3

Query  159  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  338
            S  +PA   P K    K+A A A LAS+ SILLGYDIGVMSGA++YI+KDLKI+D ++EI
Sbjct  3    SAPLPAAIEPGKKGNVKFAFACAILASMTSILLGYDIGVMSGASLYIKKDLKISDVKLEI  62

Query  339  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  518
            L+GILN+YSLIGS  AGRTSDWIGRRYT+V A+V+FF GA LMGF+ NY  LM GRFVAG
Sbjct  63   LMGILNVYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYWMLMFGRFVAG  122

Query  519  IGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFM  698
            IGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSN+AF  + + L WR M
Sbjct  123  IGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSRLPLRLGWRVM  182

Query  699  LGVGSIPSVLLGVSVLAMP  755
            LG+G+ PSV+L + VL MP
Sbjct  183  LGIGAAPSVVLALMVLGMP  201



>ref|XP_007200254.1| hypothetical protein PRUPE_ppa015090mg [Prunus persica]
 ref|XP_007200263.1| hypothetical protein PRUPE_ppa014975mg [Prunus persica]
 gb|EMJ01453.1| hypothetical protein PRUPE_ppa015090mg [Prunus persica]
 gb|EMJ01462.1| hypothetical protein PRUPE_ppa014975mg [Prunus persica]
Length=527

 Score =   261 bits (668),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 168/216 (78%), Gaps = 6/216 (3%)
 Frame = +3

Query  126  MGDTRPVRNAGSGH------IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGA  287
            M D R   +A SG       I  FDPP+K K NK+AIA A LA   SILLGYDIGVMSGA
Sbjct  1    MADRRVEDSAVSGQLQNDHRIADFDPPQKPKTNKFAIACAILACTTSILLGYDIGVMSGA  60

Query  288  AIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILM  467
             I+IQ DLK++DT++ +L G LN+YSLIGS +AGRTSDWIGRRYT+V++ V+FFVGA+LM
Sbjct  61   NIFIQNDLKLSDTEIAVLAGTLNIYSLIGSALAGRTSDWIGRRYTVVLSGVIFFVGALLM  120

Query  468  GFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYV  647
            G +  Y FLM GRFVAGIGVGY LMIAPVYT E++P   RGFLTSFPEVF+N GIL+GYV
Sbjct  121  GLAPGYAFLMFGRFVAGIGVGYGLMIAPVYTVEISPTLDRGFLTSFPEVFVNLGILLGYV  180

Query  648  SNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            SN+AF  +  +L WR+ML +G++P+V+L V VLAMP
Sbjct  181  SNYAFSKLPTNLGWRYMLALGALPAVVLAVGVLAMP  216



>ref|XP_010445995.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   261 bits (667),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 165/198 (83%), Gaps = 0/198 (0%)
 Frame = +3

Query  162  GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  341
            G + A   P +  R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+E+L
Sbjct  9    GVVVAEPKPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEVL  68

Query  342  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGI  521
            +GILN+YS+IGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGI
Sbjct  69   MGILNIYSIIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGI  128

Query  522  GVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFML  701
            GVGYA+MIAPVYTAEVAPAS RGFL+ FPE+FIN GIL+GYVSN+ F  +  HL WRFML
Sbjct  129  GVGYAMMIAPVYTAEVAPASSRGFLSFFPEIFINIGILLGYVSNYFFSKLPEHLGWRFML  188

Query  702  GVGSIPSVLLGVSVLAMP  755
            G+G+IPS+ L + VLAMP
Sbjct  189  GIGAIPSIFLAIGVLAMP  206



>ref|XP_007200033.1| hypothetical protein PRUPE_ppa024323mg [Prunus persica]
 gb|EMJ01232.1| hypothetical protein PRUPE_ppa024323mg [Prunus persica]
Length=534

 Score =   261 bits (668),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 168/216 (78%), Gaps = 6/216 (3%)
 Frame = +3

Query  126  MGDTRPVRNAGSGH------IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGA  287
            M D R   +A SG       I  FDPP+K K NK+AIA A LA   SILLGYDIGVMSGA
Sbjct  1    MADRRVEDSAVSGQLQNDHRIADFDPPQKPKTNKFAIACAILACTTSILLGYDIGVMSGA  60

Query  288  AIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILM  467
             I+IQ DLK++DT++ +L G LN+YSLIGS +AGRTSDWIGRRYT+V++ V+FFVGA+LM
Sbjct  61   NIFIQNDLKLSDTEIAVLAGTLNIYSLIGSALAGRTSDWIGRRYTVVLSGVIFFVGALLM  120

Query  468  GFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYV  647
            G +  Y FLM GRFVAGIGVGY LMIAPVYT E++P   RGFLTSFPEVF+N GIL+GYV
Sbjct  121  GLAPGYAFLMFGRFVAGIGVGYGLMIAPVYTVEISPTLDRGFLTSFPEVFVNLGILLGYV  180

Query  648  SNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            SN+AF  +  +L WR+ML +G++P+V+L V VLAMP
Sbjct  181  SNYAFSKLPTNLGWRYMLALGALPAVVLAVGVLAMP  216



>emb|CDP17996.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   261 bits (666),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 165/208 (79%), Gaps = 0/208 (0%)
 Frame = +3

Query  132  DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  311
             +R V        P F PP K  +NKYA+A A LA ++S+LLGYD GVMSG  IYIQ+DL
Sbjct  5    QSRAVTRGVESSNPDFGPPPKATKNKYALACALLACMSSVLLGYDTGVMSGGMIYIQRDL  64

Query  312  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  491
            KI+D Q E+L+G +N+YSL+GS +AGRT DW+GRRYT+ +A V+FFVGA LM F+TNY F
Sbjct  65   KISDVQKEVLVGTINVYSLLGSAIAGRTCDWVGRRYTIAMAGVIFFVGAFLMAFATNYAF  124

Query  492  LMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNM  671
            LMVGRFVAGIGVGYA+MIAPVY+AE++P S+RGF+TSF EVFINFG+L+GYVSN+ F  +
Sbjct  125  LMVGRFVAGIGVGYAMMIAPVYSAEISPRSIRGFITSFTEVFINFGVLLGYVSNYFFAKL  184

Query  672  SVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
              +L WRFM+GVG+IPSV+L V  L MP
Sbjct  185  PTNLGWRFMMGVGAIPSVMLFVGGLVMP  212



>ref|NP_001060108.1| Os07g0582400 [Oryza sativa Japonica Group]
 gb|AAL14615.1|AF416867_1 putative sugar transporter [Oryza sativa]
 dbj|BAF22022.1| Os07g0582400 [Oryza sativa Japonica Group]
Length=577

 Score =   262 bits (670),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = +3

Query  159  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  338
            S  +P    PKK    ++A A A LAS+ SILLGYDIGVMSGA++YI+KD  I+D +VE+
Sbjct  70   SAALPEAVAPKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIKKDFNISDGKVEV  129

Query  339  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  518
            L+GILNLYSLIGS  AGRTSDWIGRRYT+V A+V+FF GA LMGF+ NY  LM GRFVAG
Sbjct  130  LMGILNLYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYAMLMFGRFVAG  189

Query  519  IGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFM  698
            IGVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSN+AF  + ++L WR M
Sbjct  190  IGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSRLPLNLGWRIM  249

Query  699  LGVGSIPSVLLGVSVLAMP  755
            LG+G+ PSVLL + VL MP
Sbjct  250  LGIGAAPSVLLALMVLGMP  268



>dbj|BAJ86526.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 160/194 (82%), Gaps = 0/194 (0%)
 Frame = +3

Query  174  AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGIL  353
            A  P K+   NKYA A A LAS+ S+LLGYDI VMSGA +++++DLKI DTQ+EIL GI+
Sbjct  11   AMAPAKRPPINKYAFACALLASMNSVLLGYDISVMSGAQLFMKEDLKITDTQIEILAGII  70

Query  354  NLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGY  533
            ++YSL+GS MAG TSDW+GRRYTMV+A+ +FF GA+LMG + NY FLM GRFVAGIGVGY
Sbjct  71   SIYSLLGSLMAGLTSDWLGRRYTMVLAAAIFFTGALLMGLAPNYAFLMAGRFVAGIGVGY  130

Query  534  ALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGS  713
            ALMIAPVYTAEVAP S RGFLT+FPEVF NFGIL+GYVSNFAF  + VHLSWR M  VG+
Sbjct  131  ALMIAPVYTAEVAPTSSRGFLTTFPEVFNNFGILLGYVSNFAFARLPVHLSWRAMFLVGA  190

Query  714  IPSVLLGVSVLAMP  755
            +P V LG +VLAMP
Sbjct  191  VPPVFLGFAVLAMP  204



>gb|AAO88964.1| sorbitol transporter [Malus domestica]
Length=491

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +3

Query  258  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  437
            GYDIGVMSGA+IYI+KDLK+ DTQ+EI++G++ +YSLIGS MAG+TSDW+GRRYT+V++ 
Sbjct  7    GYDIGVMSGASIYIEKDLKVTDTQIEIMIGVIEIYSLIGSAMAGKTSDWVGRRYTIVISG  66

Query  438  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVF  617
             +FF+GAILMGFSTNYTFLM GRFVAGIGVGYAL IAPVY+AEV+P S RGFLTSFPEVF
Sbjct  67   AIFFIGAILMGFSTNYTFLMCGRFVAGIGVGYALTIAPVYSAEVSPTSSRGFLTSFPEVF  126

Query  618  INFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            +N GIL+GY+SN+AF    + L WR MLGVG+IPSV L V VLAMP
Sbjct  127  VNIGILLGYLSNYAFSFCPLDLGWRLMLGVGAIPSVGLAVGVLAMP  172



>gb|KCW55336.1| hypothetical protein EUGRSUZ_I01255 [Eucalyptus grandis]
Length=425

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +3

Query  258  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  437
            G +IGVMSGAAI I+K L +ND +VE+L+GI+NLYSL+GS +AGRTSDW+GRRYTMV+A 
Sbjct  11   GTNIGVMSGAAIPIKKQLHLNDVEVEVLVGIINLYSLLGSAVAGRTSDWVGRRYTMVIAG  70

Query  438  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVF  617
             +FFVGAILM F+ NY FLM GRFVAGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVF
Sbjct  71   AIFFVGAILMAFAFNYAFLMFGRFVAGIGVGYALMIAPVYTAEVSPASARGFLTSFPEVF  130

Query  618  INFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            INFG+L+GYVSN+ F  + ++L WRFMLG+G +PSVLL + VLAMP
Sbjct  131  INFGVLLGYVSNYVFNKLPINLGWRFMLGIGVLPSVLLAIGVLAMP  176



>ref|XP_002460923.1| hypothetical protein SORBIDRAFT_02g037570 [Sorghum bicolor]
 gb|EER97444.1| hypothetical protein SORBIDRAFT_02g037570 [Sorghum bicolor]
Length=510

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = +3

Query  159  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  338
            S  +P    P K    ++A A A LAS+ SILLGYDIGVMSGA++YI+KDL I D Q+EI
Sbjct  3    SAALPEAVEPGKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIKKDLGITDVQLEI  62

Query  339  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  518
            L+GILN+YSLIGS  AGRTSDWIGRRYT+V A+V+FF GA LMGF+ NY  LM GRFVAG
Sbjct  63   LMGILNVYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYGMLMFGRFVAG  122

Query  519  IGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFM  698
            +GVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSN+AF ++S+ L WR M
Sbjct  123  VGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSHLSLRLGWRVM  182

Query  699  LGVGSIPSVLLGVSVLAMP  755
            LG+G+ PSV+L + VL MP
Sbjct  183  LGIGAAPSVVLALMVLGMP  201



>gb|KEH30425.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=472

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +3

Query  276  MSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVG  455
            MSGAAIYI++DLK++D ++E+LLGI+N+YSLIGSC+AGRTSDWIGRRYT+V A  +FFVG
Sbjct  1    MSGAAIYIKRDLKVSDGKIEVLLGIINIYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFVG  60

Query  456  AILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGIL  635
            A+LMGFS NY FLM GRFVAG+G+GYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL
Sbjct  61   ALLMGFSPNYNFLMFGRFVAGVGIGYALMIAPVYTAEVSPASSRGFLTSFPEVFINSGIL  120

Query  636  VGYVSNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            +GY+SN+AF  +S+ L WR MLGVG+IPSV+L V VLAMP
Sbjct  121  LGYISNYAFSKLSLKLGWRMMLGVGAIPSVILAVGVLAMP  160



>ref|XP_008668471.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA43976.1| TPA: hypothetical protein ZEAMMB73_311171 [Zea mays]
Length=524

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 160/194 (82%), Gaps = 0/194 (0%)
 Frame = +3

Query  174  AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGIL  353
            A  P K+   NKYA A A LAS+ S+LLGYDI VMSGA +++++DLKI DTQ+EIL G++
Sbjct  11   AVAPAKRPPINKYAFACALLASMNSVLLGYDISVMSGAQLFMKEDLKITDTQIEILAGVI  70

Query  354  NLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGY  533
            N+YSL GS  AG TSDW+GRRYTMV+A+ +FF GA+LMGF+  Y FLMVGRFVAGIGVG+
Sbjct  71   NIYSLFGSLAAGLTSDWLGRRYTMVLAAAIFFTGALLMGFAPGYGFLMVGRFVAGIGVGF  130

Query  534  ALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGS  713
            ALMIAPVYTAEVAP S RGFLTSFPEVF NFGIL+GYVSNFAF  + VHLSWR M  VG+
Sbjct  131  ALMIAPVYTAEVAPTSARGFLTSFPEVFNNFGILLGYVSNFAFARLPVHLSWRAMFLVGA  190

Query  714  IPSVLLGVSVLAMP  755
            +P V LGV+VLAMP
Sbjct  191  VPPVFLGVAVLAMP  204



>emb|CDP18000.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 162/195 (83%), Gaps = 0/195 (0%)
 Frame = +3

Query  171  PAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGI  350
            P   PP K KRNKYA+A A LA ++S+LLGYD GVMSGA IYIQ+DLKIND Q EIL+G 
Sbjct  18   PDSVPPPKPKRNKYALACALLACMSSVLLGYDTGVMSGAMIYIQRDLKINDVQKEILVGT  77

Query  351  LNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVG  530
            +N+YSL+GS +AGRT DWIGRRYT+ +A V+FF GAILM  +TNY FLM GRFVAG+GVG
Sbjct  78   INVYSLLGSAIAGRTCDWIGRRYTIAMAGVIFFAGAILMACATNYAFLMFGRFVAGLGVG  137

Query  531  YALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVG  710
            YALMIAPVY+AE++P S+RGF+TSF EVFINFG+L+GYVSN+ F  ++ +L WRFM+GVG
Sbjct  138  YALMIAPVYSAEISPRSIRGFITSFTEVFINFGVLLGYVSNYFFAKLATNLGWRFMMGVG  197

Query  711  SIPSVLLGVSVLAMP  755
            +IPSV+L V  L MP
Sbjct  198  AIPSVMLFVGGLIMP  212



>ref|XP_002885281.1| ATPLT5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61540.1| ATPLT5 [Arabidopsis lyrata subsp. lyrata]
Length=538

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 162/198 (82%), Gaps = 1/198 (1%)
 Frame = +3

Query  165  HIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  341
            H+P +  P K  KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++DLKI+D ++ IL
Sbjct  19   HVPESVLPAKPPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKISDLEIGIL  78

Query  342  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGI  521
             G LN+YSLIGSC AG+TSD IGRRYT+V+A  +FF GAILMG + NY FLM GRFVAGI
Sbjct  79   AGSLNIYSLIGSCAAGKTSDLIGRRYTIVLAGAIFFAGAILMGLAPNYAFLMFGRFVAGI  138

Query  522  GVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFML  701
            GVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GI++GYVSN AF    + L WR ML
Sbjct  139  GVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGIMLGYVSNLAFSKFPLKLGWRLML  198

Query  702  GVGSIPSVLLGVSVLAMP  755
            G+G++PSV+L + VLAMP
Sbjct  199  GIGAVPSVILALGVLAMP  216



>gb|AAY88181.2| mannitol transporter 1 [Olea europaea]
Length=480

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +3

Query  258  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  437
            GYDIGVMSGAAIYI+  L ++D ++EI++GI+N +SL+GS +AGRTSDWIGRRYTMV+A 
Sbjct  7    GYDIGVMSGAAIYIKDQLHVSDVKLEIVVGIINFFSLVGSALAGRTSDWIGRRYTMVLAG  66

Query  438  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVF  617
             +FFVGAILMGF+TNY+FLM GRFVAGIGVGYALMIAPVYTAEV+PAS RGFLTSFPEVF
Sbjct  67   AIFFVGAILMGFATNYSFLMFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVF  126

Query  618  INFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            IN G+L+GYVSN+AF  +  +L WRFMLG+G+IPS+ L + VL MP
Sbjct  127  INIGVLLGYVSNYAFSKLPANLGWRFMLGIGAIPSIGLAIGVLGMP  172



>ref|XP_003607077.1| Sorbitol-like transporter [Medicago truncatula]
 gb|AES89274.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=520

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = +3

Query  177  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  356
            F P KK+KRNK+A A A LAS+ SILLGYDIGVMSGAAIYI++DLK+ D Q+EILLGI+N
Sbjct  15   FGPQKKLKRNKFACACAILASMTSILLGYDIGVMSGAAIYIKRDLKVTDVQIEILLGIIN  74

Query  357  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  536
            LYS IGS +AGR SDWIGRRYT+V+A ++FFVGA+LMG S NY FLM GRF AG+G+G+A
Sbjct  75   LYSPIGSYIAGRLSDWIGRRYTIVLAGLIFFVGAVLMGLSPNYAFLMFGRFFAGVGIGFA  134

Query  537  LMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSI  716
             +IAPVYT+EV+P S RGFLTS PEVF+N GILVGY+SN+ F  + +   WR MLG+G+I
Sbjct  135  FLIAPVYTSEVSPTSSRGFLTSLPEVFLNGGILVGYISNYGFSKLPLRYGWRVMLGIGAI  194

Query  717  PSVLLGVSVLAMP  755
            PS++L ++VLAMP
Sbjct  195  PSIILAMAVLAMP  207



>ref|XP_008466921.1| PREDICTED: putative polyol transporter 1, partial [Cucumis melo]
Length=200

 Score =   249 bits (636),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 143/162 (88%), Gaps = 2/162 (1%)
 Frame = +3

Query  276  MSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVG  455
            MSGAAI+I+ D K++DT++EIL+GILNLYSLIGS  AGRTSDWIGRRYTMVVA+V+FF G
Sbjct  1    MSGAAIFIKDDFKLSDTKIEILVGILNLYSLIGSAAAGRTSDWIGRRYTMVVAAVIFFAG  60

Query  456  AILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGIL  635
            A+LMGF+TNY+FLM GRFVAG+GVGYALMIAPVYTAEV+PAS RGFLTSFPEVFIN GIL
Sbjct  61   ALLMGFATNYSFLMFGRFVAGVGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFINAGIL  120

Query  636  VGYVSNFAFKNMS--VHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            +GYVSN+ F  +S  V + WR+MLG+G++PSV L V VL MP
Sbjct  121  LGYVSNYGFSKVSDPVTMGWRYMLGIGAVPSVFLAVIVLIMP  162



>ref|XP_003558585.1| PREDICTED: putative polyol transporter 1 [Brachypodium distachyon]
Length=526

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 158/194 (81%), Gaps = 0/194 (0%)
 Frame = +3

Query  174  AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGIL  353
            A  P K+   NKYA A A LAS+ S+LLGYDI VMSGA +++++DLKI DTQ+EIL G++
Sbjct  16   AVAPAKRPPINKYAFACALLASMNSVLLGYDISVMSGAQLFMKEDLKITDTQIEILAGVI  75

Query  354  NLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGY  533
            N+YSL GS  AG TSDW+GRRYTMV+A+ +FF GA+LMG + NY FLM GRFVAGIGVGY
Sbjct  76   NIYSLFGSLAAGLTSDWLGRRYTMVLAAAIFFTGALLMGLAPNYAFLMAGRFVAGIGVGY  135

Query  534  ALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGS  713
            ALMIAPVYTAEVAP S RGFLTSFPEVF NFGIL+GYVSNFAF  + VHLSWR M  VG+
Sbjct  136  ALMIAPVYTAEVAPTSARGFLTSFPEVFNNFGILLGYVSNFAFARLPVHLSWRAMFLVGA  195

Query  714  IPSVLLGVSVLAMP  755
            +P + LG +VLAMP
Sbjct  196  VPPIFLGFAVLAMP  209



>ref|XP_010527168.1| PREDICTED: putative polyol transporter 1 [Tarenaya hassleriana]
Length=362

 Score =   254 bits (648),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 163/199 (82%), Gaps = 2/199 (1%)
 Frame = +3

Query  159  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  338
            +G + +  P +   R  YA A A LAS++SI+LGYDIGV+SGA+I+IQ DLK++D Q+EI
Sbjct  8    AGTVTSQQPDRS--RRLYATACAVLASMSSIVLGYDIGVVSGASIFIQDDLKLSDLQLEI  65

Query  339  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  518
             +GILNLYS++GS +AGRTSDWIGRRYT+V+A   F  GA+LMGF+TNY F+MVGRFVAG
Sbjct  66   FMGILNLYSIVGSGLAGRTSDWIGRRYTIVLAGCFFIAGALLMGFATNYPFIMVGRFVAG  125

Query  519  IGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFM  698
            IGVGY +MIAPVYT EVAPAS RGFL+SFPE+FIN GIL+GYVSNF F  +  HL WRFM
Sbjct  126  IGVGYGMMIAPVYTTEVAPASSRGFLSSFPEIFINIGILLGYVSNFFFAQLPEHLGWRFM  185

Query  699  LGVGSIPSVLLGVSVLAMP  755
            LG+G++P+V L + VLAMP
Sbjct  186  LGIGAVPAVFLALGVLAMP  204



>ref|NP_001150711.1| LOC100284344 [Zea mays]
 gb|ACG40102.1| polyol transporter protein 4 [Zea mays]
 gb|AFW89354.1| polyol transporter protein 4 [Zea mays]
Length=531

 Score =   259 bits (661),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 164/203 (81%), Gaps = 1/203 (0%)
 Frame = +3

Query  150  NAGSGHIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDT  326
            + G+  +P A  P K+   NKYA A A LAS+ S+LLGYDI VMSGA +++++DLKI DT
Sbjct  2    STGTDAVPVAVAPAKRPPINKYAFACALLASMNSVLLGYDISVMSGAQLFMKEDLKITDT  61

Query  327  QVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGR  506
            Q+EIL G++N+YSL GS  AG TSDW+GRRYTMV+A+ +FF GA+LMG + +Y FLM GR
Sbjct  62   QIEILAGVINIYSLFGSLAAGLTSDWLGRRYTMVLAAAIFFTGALLMGLAPDYGFLMAGR  121

Query  507  FVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLS  686
            FVAGIGVG+ALMIAPVYTAEVAP S RGFLTSFPEVF NFGIL+GYVSNFAF  + VHLS
Sbjct  122  FVAGIGVGFALMIAPVYTAEVAPTSARGFLTSFPEVFNNFGILLGYVSNFAFARLPVHLS  181

Query  687  WRFMLGVGSIPSVLLGVSVLAMP  755
            WR M  VG++P V LGV+VLAMP
Sbjct  182  WRAMFLVGAVPPVFLGVAVLAMP  204



>ref|XP_008245258.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=511

 Score =   258 bits (659),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = +3

Query  177  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  356
            FDP  K KRNK+AIA + LA   SILLGYDIGVMSGA + IQ DLKIND Q++IL G LN
Sbjct  9    FDPSLKPKRNKFAIACSLLACTPSILLGYDIGVMSGANLSIQDDLKINDVQIQILTGTLN  68

Query  357  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  536
            +YS+IGS +AGRTSDWIGRRYT V++  +FFVGAILMGF+  Y FLM GRFVAGIGVGY 
Sbjct  69   IYSVIGSALAGRTSDWIGRRYTAVLSGAIFFVGAILMGFAPGYAFLMFGRFVAGIGVGYG  128

Query  537  LMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSI  716
            LMI+PVYTAE+AP   RGFLTSFPEVF+N GIL+GYVSN+AF  +   L WRFMLG+G++
Sbjct  129  LMISPVYTAEIAPTLSRGFLTSFPEVFVNIGILLGYVSNYAFSKLPAPLYWRFMLGIGAL  188

Query  717  PSVLLGVSVLAMP  755
            P+++L + VLA+P
Sbjct  189  PAIILAIGVLAVP  201



>ref|XP_008359575.1| PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Malus 
domestica]
Length=527

 Score =   258 bits (660),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 173/214 (81%), Gaps = 4/214 (2%)
 Frame = +3

Query  126  MGDTRPVRNAGSGH----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  293
            M D R   N  SG     I  FDPPKK K  K+A+A A LAS+ SILLGYDIGVMS A++
Sbjct  1    MADQRAENNVVSGQPQNSIADFDPPKKPKTKKFAVACAVLASMTSILLGYDIGVMSXASL  60

Query  294  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  473
            +I+++L I+D QVE+L G  N+YSLIGS +AG+TSDWIGRRYT+V+A  +FF+GA+LMGF
Sbjct  61   FIKENLNISDVQVEVLNGTXNIYSLIGSALAGKTSDWIGRRYTIVLAETIFFIGALLMGF  120

Query  474  STNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSN  653
            + NY FLM GRF+AG+GVGYALMIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GYVSN
Sbjct  121  APNYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSN  180

Query  654  FAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            FA   + +HL+WR MLG+G+IPSV L +SVLAMP
Sbjct  181  FALAELPIHLNWRIMLGIGAIPSVFLALSVLAMP  214



>ref|XP_009407903.1| PREDICTED: polyol transporter 5-like [Musa acuminata subsp. malaccensis]
Length=507

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 155/190 (82%), Gaps = 0/190 (0%)
 Frame = +3

Query  186  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  365
            P+K KRN YA+  + LAS+ SI+ GYD+ VMSGA ++I+ DLKI+DT++EIL GI+N+YS
Sbjct  4    PEKPKRNMYALGCSCLASMTSIVSGYDVAVMSGANLFIKNDLKIDDTKIEILAGIINVYS  63

Query  366  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMI  545
            +IGS  AGRTSDWIGRRYTM++A  +FF GA++M  + NY  LM GRFVAG+GVGYA MI
Sbjct  64   IIGSIAAGRTSDWIGRRYTMILACAIFFTGALVMALAPNYAILMAGRFVAGVGVGYAFMI  123

Query  546  APVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSV  725
            APVY AEVAPAS RGFLTSFPEVFINFG+L+GYVSNFAF  +  HLSWR M GVG++P V
Sbjct  124  APVYAAEVAPASSRGFLTSFPEVFINFGVLLGYVSNFAFAGLPEHLSWRMMFGVGAVPPV  183

Query  726  LLGVSVLAMP  755
             L + VLAMP
Sbjct  184  FLALGVLAMP  193



>ref|XP_008236797.1| PREDICTED: putative polyol transporter 2 [Prunus mume]
Length=531

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 166/215 (77%), Gaps = 5/215 (2%)
 Frame = +3

Query  126  MGDTRPVRNAGSGH-----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  290
            M D +   NA SG      I  FDPP+K   NK+AIA A LA + SILLGYDIGVMSGA 
Sbjct  4    MTDQKVEDNAVSGEPQNKRIADFDPPEKPNANKFAIACATLACMTSILLGYDIGVMSGAN  63

Query  291  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  470
            I+I+ DLKI D QVEIL G LN+YSLIGS +AG TSDWIGRRYT+V++  +FFVGAILMG
Sbjct  64   IFIKDDLKITDVQVEILAGTLNIYSLIGSGLAGVTSDWIGRRYTIVLSGTIFFVGAILMG  123

Query  471  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVS  650
             +  Y  LM GRFVAG+GVGY LMIAPVYT E++PA  RGFLTSFPEVF+N GIL+GYVS
Sbjct  124  VAPGYGLLMFGRFVAGVGVGYGLMIAPVYTVEISPALSRGFLTSFPEVFVNVGILLGYVS  183

Query  651  NFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            N+AF  + VH+ WRFMLG+G++PS++L   VLAMP
Sbjct  184  NYAFSKLPVHMGWRFMLGLGALPSIVLVFGVLAMP  218



>ref|NP_001049269.1| Os03g0197100 [Oryza sativa Japonica Group]
 gb|ABF94464.1| mannitol transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11183.1| Os03g0197100 [Oryza sativa Japonica Group]
 gb|EAY88905.1| hypothetical protein OsI_10384 [Oryza sativa Indica Group]
 gb|EAZ25930.1| hypothetical protein OsJ_09774 [Oryza sativa Japonica Group]
 dbj|BAG91937.1| unnamed protein product [Oryza sativa Japonica Group]
Length=517

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 157/194 (81%), Gaps = 0/194 (0%)
 Frame = +3

Query  174  AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGIL  353
            A  P K+   NKYA   A LAS+ S+LLGYDI VMSGA I++++DLKI DTQ+EIL G++
Sbjct  10   AVAPAKRPPINKYAFGCALLASMNSVLLGYDISVMSGAQIFMKEDLKITDTQIEILAGVI  69

Query  354  NLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGY  533
            N+YSL GS  AG TSDW+GRRYTMV+A+ +FF GA+LMG + NY FLM GRFVAGIGVGY
Sbjct  70   NIYSLFGSLAAGMTSDWLGRRYTMVLAAAIFFTGALLMGLAPNYAFLMAGRFVAGIGVGY  129

Query  534  ALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGS  713
            ALMIAPVYTAEVAP S RGFLTSFPEVF N GIL+GYVSNFAF  + VHLSWR M  VG+
Sbjct  130  ALMIAPVYTAEVAPTSARGFLTSFPEVFNNSGILLGYVSNFAFARLPVHLSWRAMFLVGA  189

Query  714  IPSVLLGVSVLAMP  755
            +P + LG++VLAMP
Sbjct  190  VPPIFLGIAVLAMP  203



>ref|XP_010254895.1| PREDICTED: polyol transporter 5-like [Nelumbo nucifera]
Length=531

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +3

Query  186  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  365
            P K +  ++A+A A +AS+ SILLGYDIGVMSGA I+I+ +L I DTQVEIL+G+ +LYS
Sbjct  18   PAKRQNKRFAMACATIASMVSILLGYDIGVMSGAVIFIKDNLHITDTQVEILVGVFHLYS  77

Query  366  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMI  545
            LIGS  AGRTSDWIGRR T++ A+V+FFVGA++MG + NY FLMVGRFVAGIGVGYALMI
Sbjct  78   LIGSTAAGRTSDWIGRRCTIIFAAVIFFVGALMMGLAPNYAFLMVGRFVAGIGVGYALMI  137

Query  546  APVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSV  725
            APVYTAEVAP S RGFLTSFPEVFIN GIL+GYVSN+AF  +  HL+WR MLG+G+IPSV
Sbjct  138  APVYTAEVAPTSCRGFLTSFPEVFINGGILLGYVSNYAFAGLPNHLNWRLMLGIGAIPSV  197

Query  726  LLGVSVLAMP  755
            LLG  V+ MP
Sbjct  198  LLGFGVMGMP  207



>ref|XP_002463086.1| hypothetical protein SORBIDRAFT_02g037590 [Sorghum bicolor]
 gb|EER99607.1| hypothetical protein SORBIDRAFT_02g037590 [Sorghum bicolor]
Length=505

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = +3

Query  186  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  365
            P+K    KYA   A LAS+A I++GYDIGVMSGAAIYI+KDL I D Q+EI++GILN+YS
Sbjct  7    PRKKSNVKYASMCAILASMAVIIVGYDIGVMSGAAIYIKKDLNITDVQLEIVMGILNIYS  66

Query  366  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMI  545
            LIGS  AGRTSDWIGRR+T+V A+V+FF G++LMGF+ NY  LM GRFVAG+GVGYA+MI
Sbjct  67   LIGSFAAGRTSDWIGRRFTVVFAAVIFFAGSLLMGFAVNYAMLMAGRFVAGVGVGYAIMI  126

Query  546  APVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSV  725
            APVYTAE++PA+VRGFLTSFPEVFIN GIL+GYVSNFAF  + ++L WR MLG+G+ PS 
Sbjct  127  APVYTAEISPAAVRGFLTSFPEVFINVGILLGYVSNFAFARLPLYLGWRVMLGIGAAPSA  186

Query  726  LLGVSVLAMP  755
            LL + V  MP
Sbjct  187  LLALMVFVMP  196



>ref|NP_001147446.1| sorbitol transporter [Zea mays]
 gb|ACF84429.1| unknown [Zea mays]
 gb|ACG27557.1| sorbitol transporter [Zea mays]
 tpg|DAA43973.1| TPA: Sorbitol transporter [Zea mays]
Length=525

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 169/211 (80%), Gaps = 1/211 (0%)
 Frame = +3

Query  126  MGDTRPVRNAGSGHIPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQ  302
            M +++    A  G IPA + P K+   NKYA+A A LAS+ SILLGYD+ VMSGA ++++
Sbjct  1    MSNSKQHDAADDGGIPAPEAPAKRPPLNKYALACAVLASMNSILLGYDVSVMSGAQLFMK  60

Query  303  KDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTN  482
            +DLKI DTQ+EIL GI+N+YSL+GS  AGRTSDW+GRRYTMV+A+ +FF GA++MG + +
Sbjct  61   QDLKITDTQIEILAGIINIYSLVGSLAAGRTSDWLGRRYTMVLAAAIFFAGALIMGLAPS  120

Query  483  YTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAF  662
            YT LM+GRFVAG+GVGYALMIAPVYTAEV+P S RG LTSFPEVFIN G+L+GYVSN+AF
Sbjct  121  YTILMLGRFVAGVGVGYALMIAPVYTAEVSPTSARGLLTSFPEVFINTGVLLGYVSNYAF  180

Query  663  KNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
              + VHLSWR M  VG++P + L + VLAMP
Sbjct  181  HGLPVHLSWRVMFLVGAVPPIFLALGVLAMP  211



>ref|XP_007200667.1| hypothetical protein PRUPE_ppa015294mg [Prunus persica]
 gb|EMJ01866.1| hypothetical protein PRUPE_ppa015294mg [Prunus persica]
Length=538

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 167/215 (78%), Gaps = 5/215 (2%)
 Frame = +3

Query  126  MGDTRPVRNAGSGH-----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  290
            M D +   NA SG      I  FDPP+K   +K+AIA A LA + SILLGYDIGVMSGA 
Sbjct  1    MTDRKVEDNAVSGEPQNKRIADFDPPEKPNASKFAIACATLACMTSILLGYDIGVMSGAN  60

Query  291  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  470
            I+I+ DLKI D QVE+L G LN+YSLIGS +AG TSDWIGRRYT+V++  +FF+GAILMG
Sbjct  61   IFIKDDLKITDVQVEVLAGTLNIYSLIGSGLAGVTSDWIGRRYTIVLSGTIFFIGAILMG  120

Query  471  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVS  650
             +  Y  LM GRFVAGIGVGY LMIAPVYT E++PA  RGFLTSFPEVF+N GIL+GYVS
Sbjct  121  VAPGYGLLMFGRFVAGIGVGYGLMIAPVYTVEISPALSRGFLTSFPEVFVNVGILLGYVS  180

Query  651  NFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            N+AF  + VH+ WRFMLG+G++PS++L V VLAMP
Sbjct  181  NYAFSKLPVHMGWRFMLGLGAVPSIVLVVGVLAMP  215



>gb|EMS50618.1| Polyol transporter 5 [Triticum urartu]
Length=311

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 160/197 (81%), Gaps = 1/197 (1%)
 Frame = +3

Query  168  IPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILL  344
            IPA + P K+   NKYA+A A LAS+ SILLGYD+ VMSGA I++++DL I DTQ+E+L 
Sbjct  9    IPAGEAPAKRAPLNKYALACAILASMNSILLGYDVSVMSGAQIFMKRDLHITDTQIEVLA  68

Query  345  GILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIG  524
            GI+N++SL+GS  AGRTSDWIGRRYTMV+ASV+FF GA++MG +  Y  LM+GRFVAG+G
Sbjct  69   GIINIFSLVGSLAAGRTSDWIGRRYTMVLASVIFFAGALIMGLAPGYAVLMLGRFVAGVG  128

Query  525  VGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLG  704
            VGYALMIAPVYTAEVAP S RG LTSFPEVFIN G+L+GY+SN+AF  + VHLSWR M  
Sbjct  129  VGYALMIAPVYTAEVAPTSARGLLTSFPEVFINTGVLLGYISNYAFHGLPVHLSWRAMFL  188

Query  705  VGSIPSVLLGVSVLAMP  755
             G++P V L V VLAMP
Sbjct  189  AGAVPPVFLAVGVLAMP  205



>ref|XP_008795607.1| PREDICTED: polyol transporter 5-like isoform X2 [Phoenix dactylifera]
Length=487

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = +3

Query  264  DIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVV  443
            DIGVMSGAA++++ DL +NDTQ+EILLGILNL+S++GS  AGRTSDWIGRRYT+V A+V+
Sbjct  17   DIGVMSGAALFMKDDLHVNDTQIEILLGILNLFSIVGSLAAGRTSDWIGRRYTIVFAAVI  76

Query  444  FFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFIN  623
            FFVGAI+MG + NY FLMVGRFVAG+GVGYAL+IAPVYT E+APAS RGFLTSFPEVFIN
Sbjct  77   FFVGAIMMGLAPNYAFLMVGRFVAGVGVGYALVIAPVYTTELAPASSRGFLTSFPEVFIN  136

Query  624  FGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
             GIL+GYVSNFAF  + V+L WR MLGVG++PSV L V VLAMP
Sbjct  137  SGILLGYVSNFAFSKLPVNLGWRLMLGVGAVPSVFLVVGVLAMP  180



>ref|XP_007042751.1| Polyol/monosaccharide transporter 5, putative [Theobroma cacao]
 gb|EOX98582.1| Polyol/monosaccharide transporter 5, putative [Theobroma cacao]
Length=532

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = +3

Query  177  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  356
            F+P  K KRN +A A A LASL +ILLGYDIGVMSGA I+I+KDLKIND QVEIL+GILN
Sbjct  24   FEPANKPKRNLFAFACAVLASLTTILLGYDIGVMSGAIIFIKKDLKINDVQVEILVGILN  83

Query  357  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  536
            L  L+GS  AGRTSDWIGRRYT+V+A+ +FFVGA+LM F+TNY  LM GRF+ GIG G+A
Sbjct  84   LCCLVGSFAAGRTSDWIGRRYTIVLANAIFFVGALLMAFATNYALLMFGRFIGGIGAGFA  143

Query  537  LMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSI  716
            +MIA VYTAE++PAS RGFLTSF EV IN GIL+GYVSN+AF  + ++L WRFMLGVG+I
Sbjct  144  IMIALVYTAELSPASSRGFLTSFTEVSINGGILLGYVSNYAFSKLPMNLGWRFMLGVGAI  203

Query  717  PSVLLGVSVLAMP  755
            PSV LGV VLAMP
Sbjct  204  PSVFLGVGVLAMP  216



>ref|XP_009342010.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   257 bits (656),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 173/214 (81%), Gaps = 4/214 (2%)
 Frame = +3

Query  126  MGDTRPVRNAGSGH----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  293
            M D R   N   G     I  FDPPKK K  K+AIA A LAS+ SILLGYDIGVMSGA++
Sbjct  3    MADQRAENNVVFGQHQNSIADFDPPKKPKTKKFAIACAVLASMTSILLGYDIGVMSGASL  62

Query  294  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  473
            +I+++L I+D QVE+L G LN+YSLIGS +AG+TSDWIGRRYT+V+A  +FF+GA+LMGF
Sbjct  63   FIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGF  122

Query  474  STNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSN  653
            + NY FLM GRF+AG+GVGYALMIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GYVSN
Sbjct  123  APNYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSN  182

Query  654  FAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            FA   + +HL+WR MLG+G+IPSV L + VLAMP
Sbjct  183  FALAKLPIHLNWRIMLGIGAIPSVFLALGVLAMP  216



>ref|XP_008465477.1| PREDICTED: polyol transporter 5-like [Cucumis melo]
Length=517

 Score =   256 bits (655),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 168/210 (80%), Gaps = 1/210 (0%)
 Frame = +3

Query  126  MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  305
            M D +   ++ S H  A  P  K KRN YA A + +AS+AS+LLGYDIGVMSGA I+IQK
Sbjct  1    MSDRQHETSSISYH-SAPPPATKPKRNYYAFACSTMASMASVLLGYDIGVMSGAVIFIQK  59

Query  306  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  485
            D KI+D ++EIL+GI++LY+++G+  AGRTSDWIGRRYTM +A+  FFVGAILMG STNY
Sbjct  60   DFKISDVKLEILVGIISLYAILGTAAAGRTSDWIGRRYTMGLAAAFFFVGAILMGLSTNY  119

Query  486  TFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFK  665
            +FLM GRF AGIG+G+A +IAPVYT E++PA+ RG  TSFPE+FIN GIL+GYVSNFAF 
Sbjct  120  SFLMFGRFFAGIGIGFASLIAPVYTTEISPAASRGCFTSFPEIFINVGILLGYVSNFAFS  179

Query  666  NMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
             +  HLSWRFMLG+G+IPS++L + VL MP
Sbjct  180  KLPTHLSWRFMLGIGAIPSIILAIVVLIMP  209



>ref|XP_009342008.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   256 bits (655),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 173/214 (81%), Gaps = 4/214 (2%)
 Frame = +3

Query  126  MGDTRPVRNAGSGH----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  293
            M D R   N   G     I  FDPPKK K  K+A+A A LAS+ SILLGYDIGVMSGA++
Sbjct  1    MADQRAENNVVFGQPQNSIADFDPPKKPKTKKFAVACAVLASMTSILLGYDIGVMSGASL  60

Query  294  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  473
            +I+++L I+D QVE+L G LN+YSLIGS +AG+TSDWIGRRYT+V+A  +FF+GA+LMGF
Sbjct  61   FIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGF  120

Query  474  STNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSN  653
            + NY FLM GRF+AG+GVGYALMIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GYVSN
Sbjct  121  APNYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSN  180

Query  654  FAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            FA   + +HL+WR MLG+G+IPSV L + VLAMP
Sbjct  181  FALAKLPIHLNWRIMLGIGAIPSVFLALGVLAMP  214



>ref|XP_009350912.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   256 bits (655),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 173/214 (81%), Gaps = 4/214 (2%)
 Frame = +3

Query  126  MGDTRPVRNAGSGH----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  293
            M D R   N   G     I  FDPPKK K  K+A+A A LAS+ SILLGYDIGVMSGA++
Sbjct  1    MADQRAENNVVFGQPQNSIADFDPPKKPKTKKFAVACAVLASMTSILLGYDIGVMSGASL  60

Query  294  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  473
            +I+++L I+D QVE+L G LN+YSLIGS +AG+TSDWIGRRYT+V+A  +FF+GA+LMGF
Sbjct  61   FIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGF  120

Query  474  STNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSN  653
            + NY FLM GRF+AG+GVGYALMIAPVYTAE++PAS RGFLTSFPEVF+N GIL+GYVSN
Sbjct  121  APNYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVNVGILLGYVSN  180

Query  654  FAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            FA   + +HL+WR MLG+G+IPSV L + VLAMP
Sbjct  181  FALAKLPIHLNWRIMLGIGAIPSVFLALGVLAMP  214



>ref|XP_004985338.1| PREDICTED: polyol transporter 5-like isoform X2 [Setaria italica]
Length=504

 Score =   256 bits (653),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 165/204 (81%), Gaps = 1/204 (0%)
 Frame = +3

Query  147  RNAGSGHIPAFDPPKKVKR-NKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKIND  323
            +   S  IPA + P K +  NKYA+A A LAS+ SILLGYD+ VMSGA +++++DLKI D
Sbjct  3    KQDASDGIPAAEAPAKRRPLNKYALACAILASMNSILLGYDVSVMSGAQLFMKQDLKITD  62

Query  324  TQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVG  503
            TQ+EIL GI+N+YSL+GS  AGRTSDWIGRRYTMV+A+ +FF GA++MG + +Y  LM+G
Sbjct  63   TQIEILAGIINIYSLVGSLAAGRTSDWIGRRYTMVLAAAIFFAGALIMGLAPSYAILMLG  122

Query  504  RFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHL  683
            RFVAG+GVGYALMIAPVYTAEVAP S RG LTSFPEVFIN G+L+GYVSN+AF ++ VHL
Sbjct  123  RFVAGVGVGYALMIAPVYTAEVAPTSARGLLTSFPEVFINTGVLLGYVSNYAFHSLPVHL  182

Query  684  SWRFMLGVGSIPSVLLGVSVLAMP  755
            SWR M  VG++P + L + VLAMP
Sbjct  183  SWRVMFLVGAVPPLFLALGVLAMP  206



>gb|ERN17552.1| hypothetical protein AMTR_s00059p00123280 [Amborella trichopoda]
Length=513

 Score =   256 bits (653),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = +3

Query  189  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSL  368
            +K +RNKYA+A A LAS+ SILLGYDIGVMSGA ++I+ DL IND +VEIL+G LN++SL
Sbjct  14   EKPQRNKYALACATLASMTSILLGYDIGVMSGAILFIKDDLHINDVEVEILVGSLNIFSL  73

Query  369  IGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIA  548
            IGS  AGRTSD+IGRRYT+V A  +FFVGA++MGF+ NY FLM GR VAGIGVGYALMIA
Sbjct  74   IGSAAAGRTSDYIGRRYTIVFAGGIFFVGALMMGFAPNYAFLMAGRVVAGIGVGYALMIA  133

Query  549  PVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVL  728
            PVYTAEVAPAS RGFLTSFPEVFIN GIL+GYVSN+ F  +   LSWR MLGVG+IP V 
Sbjct  134  PVYTAEVAPASSRGFLTSFPEVFINLGILLGYVSNYVFARLPEDLSWRLMLGVGAIPPVF  193

Query  729  LGVSVLAMP  755
            L V VLAMP
Sbjct  194  LAVGVLAMP  202



>ref|XP_009342009.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   256 bits (654),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +3

Query  258  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  437
            GYDIGVMSGA+++I+++L I+D QVE+L G LN+YSLIGS +AG+TSDWIGRRYT+V+A 
Sbjct  51   GYDIGVMSGASLFIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAG  110

Query  438  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVF  617
             +FF+GA+LMGF+ NY FLM GRF+AG+GVGYALMIAPVYTAE++PAS RGFLTSFPEVF
Sbjct  111  TIFFIGALLMGFAPNYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGFLTSFPEVF  170

Query  618  INFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            +N GIL+GYVSNFA   + +HL+WR MLG+G+IPSV L + VLAMP
Sbjct  171  VNVGILLGYVSNFALAKLPIHLNWRIMLGIGAIPSVFLALGVLAMP  216



>dbj|BAJ93158.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score =   255 bits (652),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 162/200 (81%), Gaps = 1/200 (1%)
 Frame = +3

Query  159  SGHIPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVE  335
            +  IPA + P K+   NKYA+A A LAS+ SILLGYD+ VMSGA I++++DL I DTQ+E
Sbjct  6    AADIPAAEAPAKRPPLNKYALACAILASMNSILLGYDVSVMSGAQIFMKRDLNITDTQIE  65

Query  336  ILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVA  515
            IL GI+N++SL+GS  AGRTSDWIGRRYTMV+ASV+FF GA++MG + +Y  LM+GRFVA
Sbjct  66   ILAGIINIFSLVGSLAAGRTSDWIGRRYTMVLASVIFFAGALIMGLAPSYAVLMLGRFVA  125

Query  516  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRF  695
            G+GVGYALMIAPVYTAEVAP S RG LTSFPEVFIN G+L+GY+SNFAF  + VHLSWR 
Sbjct  126  GVGVGYALMIAPVYTAEVAPTSARGLLTSFPEVFINTGVLLGYISNFAFHGLPVHLSWRA  185

Query  696  MLGVGSIPSVLLGVSVLAMP  755
            M   G++P V L + VLAMP
Sbjct  186  MFLAGAVPPVFLAIGVLAMP  205



>ref|XP_004985339.1| PREDICTED: polyol transporter 5-like [Setaria italica]
Length=523

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = +3

Query  189  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSL  368
            K+   NKYA A+A LAS+ S+LLGYDI VMSGA +++++DLKI DTQ+EIL G++N+YSL
Sbjct  16   KRAPINKYAFASALLASMNSVLLGYDISVMSGAQLFMKEDLKITDTQIEILAGVINIYSL  75

Query  369  IGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIA  548
             GS  AG TSDW+GRRYTMV+A+ +FF GA+LMG + +Y  LMVGRFVAGIGVG+ALMIA
Sbjct  76   FGSLAAGFTSDWLGRRYTMVLAAAIFFTGALLMGLAPDYALLMVGRFVAGIGVGFALMIA  135

Query  549  PVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVL  728
            PVYTAEVAP S RGFLTSFPEVF NFGIL+GYVSNFAF  + VHLSWR M  VG++P V 
Sbjct  136  PVYTAEVAPTSARGFLTSFPEVFNNFGILLGYVSNFAFARLPVHLSWRAMFLVGAVPPVF  195

Query  729  LGVSVLAMP  755
            LGV+VLAMP
Sbjct  196  LGVAVLAMP  204



>dbj|BAJ86116.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97918.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 162/200 (81%), Gaps = 1/200 (1%)
 Frame = +3

Query  159  SGHIPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVE  335
            +  IPA + P K+   NKYA+A A LAS+ SILLGYD+ VMSGA I++++DL I DTQ+E
Sbjct  6    AADIPAAEAPAKRPPLNKYALACAILASMNSILLGYDVSVMSGAQIFMKRDLNITDTQIE  65

Query  336  ILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVA  515
            IL GI+N++SL+GS  AGRTSDWIGRRYTMV+ASV+FF GA++MG + +Y  LM+GRFVA
Sbjct  66   ILAGIINIFSLVGSLAAGRTSDWIGRRYTMVLASVIFFAGALIMGLAPSYAVLMLGRFVA  125

Query  516  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRF  695
            G+GVGYALMIAPVYTAEVAP S RG LTSFPEVFIN G+L+GY+SNFAF  + VHLSWR 
Sbjct  126  GVGVGYALMIAPVYTAEVAPTSARGLLTSFPEVFINTGVLLGYISNFAFHGLPVHLSWRA  185

Query  696  MLGVGSIPSVLLGVSVLAMP  755
            M   G++P V L + VLAMP
Sbjct  186  MFLAGAVPPVFLAIGVLAMP  205



>ref|XP_004985337.1| PREDICTED: polyol transporter 5-like isoform X1 [Setaria italica]
Length=517

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 165/204 (81%), Gaps = 1/204 (0%)
 Frame = +3

Query  147  RNAGSGHIPAFDPPKKVKR-NKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKIND  323
            +   S  IPA + P K +  NKYA+A A LAS+ SILLGYD+ VMSGA +++++DLKI D
Sbjct  3    KQDASDGIPAAEAPAKRRPLNKYALACAILASMNSILLGYDVSVMSGAQLFMKQDLKITD  62

Query  324  TQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVG  503
            TQ+EIL GI+N+YSL+GS  AGRTSDWIGRRYTMV+A+ +FF GA++MG + +Y  LM+G
Sbjct  63   TQIEILAGIINIYSLVGSLAAGRTSDWIGRRYTMVLAAAIFFAGALIMGLAPSYAILMLG  122

Query  504  RFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHL  683
            RFVAG+GVGYALMIAPVYTAEVAP S RG LTSFPEVFIN G+L+GYVSN+AF ++ VHL
Sbjct  123  RFVAGVGVGYALMIAPVYTAEVAPTSARGLLTSFPEVFINTGVLLGYVSNYAFHSLPVHL  182

Query  684  SWRFMLGVGSIPSVLLGVSVLAMP  755
            SWR M  VG++P + L + VLAMP
Sbjct  183  SWRVMFLVGAVPPLFLALGVLAMP  206



>gb|AAN07021.1| putative mannitol transporter [Orobanche ramosa]
Length=519

 Score =   255 bits (651),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 166/203 (82%), Gaps = 3/203 (1%)
 Frame = +3

Query  147  RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDT  326
            R+ GS      + PKK   N YA+  + +AS+ SILLGYD GVMSGA +YI+KDLKI D 
Sbjct  13   RSGGSPTKALINKPKK---NMYALLISVMASMTSILLGYDTGVMSGATLYIKKDLKITDV  69

Query  327  QVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGR  506
            QVEIL+G++N+YSLIGS +AGRTSD++GRR T+V+ASV+FFVGA +MG + NY  LMVGR
Sbjct  70   QVEILVGLINIYSLIGSAVAGRTSDYLGRRITIVIASVIFFVGAAVMGLANNYAVLMVGR  129

Query  507  FVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLS  686
            FVAG+GVGYALMIAPVY AEVAPAS RGFLTSFPEVFINFG+L+GY+SN+AF   S+ L 
Sbjct  130  FVAGLGVGYALMIAPVYAAEVAPASSRGFLTSFPEVFINFGVLLGYLSNYAFAKFSLKLG  189

Query  687  WRFMLGVGSIPSVLLGVSVLAMP  755
            WR MLGVG++P++ +G++V+ MP
Sbjct  190  WRLMLGVGALPAIFIGLAVIVMP  212



>ref|XP_010487804.1| PREDICTED: polyol transporter 5-like [Camelina sativa]
Length=535

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 157/191 (82%), Gaps = 0/191 (0%)
 Frame = +3

Query  183  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  362
            P K  K+N+YA A A LAS+ SILLGYDIGVMSGA IYI++DLKI+D ++ +L G LN+Y
Sbjct  27   PGKPPKKNRYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKISDFEIGVLAGSLNIY  86

Query  363  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  542
            SLIGSC AG+TSDWIGRRYT+V+A  +FF GAILMG + NY FLM GRF+AGIGVGYALM
Sbjct  87   SLIGSCAAGKTSDWIGRRYTIVLAGAIFFAGAILMGLAPNYAFLMFGRFIAGIGVGYALM  146

Query  543  IAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPS  722
            IAPVYTAEVAPAS RGFL SFPEVFIN GI++GYVSN AF    + L WR MLG+G++PS
Sbjct  147  IAPVYTAEVAPASSRGFLNSFPEVFINAGIMLGYVSNLAFSKFPLKLGWRLMLGIGAVPS  206

Query  723  VLLGVSVLAMP  755
            V+L +  LAMP
Sbjct  207  VVLAIGGLAMP  217



>ref|XP_006297395.1| hypothetical protein CARUB_v10013420mg [Capsella rubella]
 gb|EOA30293.1| hypothetical protein CARUB_v10013420mg [Capsella rubella]
Length=536

 Score =   254 bits (650),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 157/189 (83%), Gaps = 0/189 (0%)
 Frame = +3

Query  189  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSL  368
            K  K NKYA A A LAS+ SILLGYDIGVMSGA IYI++DL I+D ++ IL GILN++SL
Sbjct  27   KPPKMNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLNISDFKIGILAGILNIFSL  86

Query  369  IGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIA  548
            IGSC AG+TSD IGRRYT+V+A  +FF GAILMG + NY FLM GRFVAGIGVGYALMIA
Sbjct  87   IGSCAAGKTSDLIGRRYTIVLAGAIFFAGAILMGLAPNYAFLMFGRFVAGIGVGYALMIA  146

Query  549  PVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVL  728
            PVYTAEV+PAS RGFLTSFPEVFIN GI++GYVSN AF N  + L WR MLGVG+IPSV+
Sbjct  147  PVYTAEVSPASSRGFLTSFPEVFINAGIMLGYVSNLAFSNFPLKLGWRLMLGVGAIPSVV  206

Query  729  LGVSVLAMP  755
            L V VLAMP
Sbjct  207  LAVGVLAMP  215



>ref|XP_006649563.1| PREDICTED: polyol transporter 5-like [Oryza brachyantha]
Length=521

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 155/189 (82%), Gaps = 0/189 (0%)
 Frame = +3

Query  189  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSL  368
            K+   NKYA   A LAS+ S+LLGYDI VMSGA I++++DLKI DTQ+EIL G++N+YSL
Sbjct  16   KRPPINKYAFGCALLASMNSVLLGYDISVMSGAQIFMKEDLKITDTQIEILAGVINIYSL  75

Query  369  IGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIA  548
             GS  AG TSDW+GRRYTMV+A+ +FF GA+LMG + NY FLM GRFVAGIGVGYALMIA
Sbjct  76   FGSLAAGLTSDWLGRRYTMVLAAAIFFTGALLMGLAPNYAFLMAGRFVAGIGVGYALMIA  135

Query  549  PVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVL  728
            PVYTAEVAP S RGFLTSFPEVF N GIL+GYVSNFAF  + VHLSWR M  VG++P + 
Sbjct  136  PVYTAEVAPTSARGFLTSFPEVFNNSGILLGYVSNFAFARLPVHLSWRAMFLVGAVPPIF  195

Query  729  LGVSVLAMP  755
            LG++VLAMP
Sbjct  196  LGIAVLAMP  204



>gb|EYU37769.1| hypothetical protein MIMGU_mgv1a005015mg [Erythranthe guttata]
Length=500

 Score =   253 bits (647),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 155/189 (82%), Gaps = 0/189 (0%)
 Frame = +3

Query  189  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSL  368
             K K NKYA+A + LAS+ SILLGYDIGVMSGA IYIQKDLKI D Q E+++GILNLYSL
Sbjct  4    SKAKTNKYALACSILASMTSILLGYDIGVMSGAIIYIQKDLKITDVQTEVVMGILNLYSL  63

Query  369  IGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIA  548
            IGS  AGRTSDWIGRRYT+V A V+FF GA+LMGF+TNY FLM GRFVAG+GVG+A+MIA
Sbjct  64   IGSAAAGRTSDWIGRRYTIVFAGVIFFAGALLMGFATNYAFLMAGRFVAGVGVGFAMMIA  123

Query  549  PVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVL  728
            PVY AEV+P + RG  TS PEVFIN GIL+GYVSN AF  + + + WR MLG+G++PSV+
Sbjct  124  PVYAAEVSPPASRGLFTSLPEVFINIGILLGYVSNVAFSGLPLDIGWRLMLGIGAVPSVI  183

Query  729  LGVSVLAMP  755
            + + VL MP
Sbjct  184  IALGVLFMP  192



>ref|XP_004148314.2| PREDICTED: polyol transporter 5-like [Cucumis sativus]
 gb|KGN44327.1| hypothetical protein Csa_7G253820 [Cucumis sativus]
Length=519

 Score =   254 bits (648),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 167/210 (80%), Gaps = 1/210 (0%)
 Frame = +3

Query  126  MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  305
            M D +   ++ S H  A  P  K KRN YA A + +AS+AS+LLGYDIGVMSGA I+IQK
Sbjct  1    MADRQHETSSISYH-SAPPPTNKPKRNYYAFACSTMASMASVLLGYDIGVMSGAVIFIQK  59

Query  306  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  485
            D +I+D ++EIL+GI++LY++IG+  AGR SDWIGRRYTM +A+  FFVGAILMG STNY
Sbjct  60   DFQISDVKLEILVGIISLYAIIGTAAAGRISDWIGRRYTMGLAAAFFFVGAILMGLSTNY  119

Query  486  TFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFK  665
            +FLM GRF AGIG+G+A +IAPVYT E++PA+ RG  TSFPE+FIN GIL+GYVSNFAF 
Sbjct  120  SFLMFGRFFAGIGIGFASLIAPVYTTEISPAASRGCFTSFPEIFINVGILLGYVSNFAFS  179

Query  666  NMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
             +  HLSWRFMLG+G+IPS++L + VL MP
Sbjct  180  KLPTHLSWRFMLGIGAIPSIILAIVVLIMP  209



>ref|XP_009350914.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   254 bits (648),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +3

Query  258  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  437
            GYDIGVMSGA+++I+++L I+D QVE+L G LN+YSLIGS +AG+TSDWIGRRYT+V+A 
Sbjct  51   GYDIGVMSGASLFIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAG  110

Query  438  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVF  617
             +FF+GA+LMGF+ NY FLM GRF+AG+GVGYALMIAPVYTAE++PAS RGFLTSFPEVF
Sbjct  111  TIFFIGALLMGFAPNYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGFLTSFPEVF  170

Query  618  INFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            +N GIL+GYVSNF    + +HL+WR MLG+G+IPSV L + VLAMP
Sbjct  171  VNVGILLGYVSNFPLAKLPIHLNWRIMLGIGAIPSVFLALGVLAMP  216



>ref|XP_009375838.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=528

 Score =   254 bits (648),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 140/213 (66%), Positives = 172/213 (81%), Gaps = 3/213 (1%)
 Frame = +3

Query  126  MGDTRPVRNAGSGH---IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIY  296
            M D R   N  S     I  FDPPKK K  K+A+A A LAS+ SILLGYDIGVMSGA+++
Sbjct  3    MADQRAKNNVVSSQPQNIVDFDPPKKPKTKKFAVACAILASMTSILLGYDIGVMSGASLF  62

Query  297  IQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFS  476
            I+++L I+D QVE+L G LN+YSLIGS +AG+TSDWIGRRYT+V+A  +FF+GA+LMGF+
Sbjct  63   IKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGFA  122

Query  477  TNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNF  656
             NY FLM GRF+AG+GVGYALMIAPV TAE++PAS RGFLTSFPEVF+N GIL+GYVSNF
Sbjct  123  PNYAFLMFGRFIAGVGVGYALMIAPVSTAEISPASFRGFLTSFPEVFVNVGILLGYVSNF  182

Query  657  AFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            A   + +HL+WR MLG+G+IPSV L + VLAMP
Sbjct  183  ALAKLPIHLNWRIMLGIGAIPSVFLALGVLAMP  215



>gb|KCW62858.1| hypothetical protein EUGRSUZ_G00452 [Eucalyptus grandis]
Length=529

 Score =   253 bits (647),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 165/209 (79%), Gaps = 2/209 (1%)
 Frame = +3

Query  126  MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  305
            M D   V  A  G   A +  K  ++NKYA A A LAS+ S+LLGYD+GVMSGA I++ +
Sbjct  1    MADRNTV--AKDGISDAGNQRKSPRKNKYAFACAILASMTSVLLGYDVGVMSGAIIFVVE  58

Query  306  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  485
            +LKIN  +VE+L+G++NLYSL+GS MAGRTSDWIGRRYT+V++  +FF GA+LMG + NY
Sbjct  59   ELKINHVEVEVLMGVINLYSLVGSAMAGRTSDWIGRRYTIVLSGAIFFAGALLMGLAPNY  118

Query  486  TFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFK  665
             FLM GRFVAGIGVGY LMIAPVYTAEV+P S RGFLTSFPEVFIN G+L+GY+SN+AF 
Sbjct  119  AFLMFGRFVAGIGVGYGLMIAPVYTAEVSPVSSRGFLTSFPEVFINLGVLLGYISNYAFS  178

Query  666  NMSVHLSWRFMLGVGSIPSVLLGVSVLAM  752
             + + L WR MLGVG+IPSV+L + VLAM
Sbjct  179  KLPLKLGWRLMLGVGAIPSVMLALGVLAM  207



>ref|XP_002468337.1| hypothetical protein SORBIDRAFT_01g044010 [Sorghum bicolor]
 gb|EER95335.1| hypothetical protein SORBIDRAFT_01g044010 [Sorghum bicolor]
Length=524

 Score =   253 bits (646),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 157/189 (83%), Gaps = 0/189 (0%)
 Frame = +3

Query  189  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSL  368
            K+   NKYA A A LAS+ S+LLGYDI VMSGA +++++DLKI DTQ+EIL G++N+YSL
Sbjct  16   KRPPINKYAFACALLASMNSVLLGYDISVMSGAQLFMKEDLKITDTQIEILAGVINIYSL  75

Query  369  IGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIA  548
             GS  AG TSDW+GRRYTMV+A+ +FF GA+LMG + +Y  LMVGRFVAGIGVG+ALMIA
Sbjct  76   FGSLAAGFTSDWLGRRYTMVLAAAIFFTGALLMGLAPDYGLLMVGRFVAGIGVGFALMIA  135

Query  549  PVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVL  728
            PVYTAEVAP S RGFLTSFPEVF NFGIL+GYVSNFAF  + VHLSWR M  VG++P V 
Sbjct  136  PVYTAEVAPTSARGFLTSFPEVFNNFGILLGYVSNFAFARLPVHLSWRAMFLVGAVPPVF  195

Query  729  LGVSVLAMP  755
            LGV+VLAMP
Sbjct  196  LGVAVLAMP  204



>gb|EYU42630.1| hypothetical protein MIMGU_mgv1a0059091mg, partial [Erythranthe 
guttata]
Length=189

 Score =   242 bits (618),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  168  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  347
            IP FDPPKK KRN YA+A +FLAS+ SILLGYDIGVMSGA IYIQ++  I   Q E+++G
Sbjct  18   IPGFDPPKKPKRNMYALACSFLASMTSILLGYDIGVMSGAIIYIQEEFGITSVQKEVVMG  77

Query  348  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  527
            ILN+YSL+GS  AGRTSDWIGRRYT+V+A  +FFVGA+LMGF+TNY FLMVGRFVAGIGV
Sbjct  78   ILNVYSLLGSAAAGRTSDWIGRRYTIVLAGAIFFVGALLMGFATNYAFLMVGRFVAGIGV  137

Query  528  GYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKN  668
            GYALMIAPVYTAEVAPAS RGFL+SFPEVFINFG  +GYVSNFAF  
Sbjct  138  GYALMIAPVYTAEVAPASSRGFLSSFPEVFINFGTQLGYVSNFAFSK  184



>ref|XP_009378956.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=530

 Score =   253 bits (645),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 174/215 (81%), Gaps = 5/215 (2%)
 Frame = +3

Query  126  MGDTRPVRNA--GSGH--IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  293
            M D R   N   G  H  I  FDPPKK K  K+A+A A LAS+ SILLGYDIGVMSGA++
Sbjct  3    MADQRAENNVVFGQPHNSIADFDPPKKPKTKKFAVACAVLASMTSILLGYDIGVMSGASL  62

Query  294  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  473
            +I+++L I+D QVE+L G LN+YSLIGS +AG+TSDWIGRRYT+V+A  +FF+GA+LMGF
Sbjct  63   FIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGF  122

Query  474  STNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGF-LTSFPEVFINFGILVGYVS  650
            + NY FLM GRF+AG+GVGYALMIAPVYTAE++PAS RGF LTSFPEVF+N GIL+GYVS
Sbjct  123  APNYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGFLLTSFPEVFVNVGILLGYVS  182

Query  651  NFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            NFA   + +HL+WR MLG+G+IPSV L + VLAMP
Sbjct  183  NFALAKLPIHLNWRIMLGIGAIPSVFLALGVLAMP  217



>ref|XP_004958139.1| PREDICTED: putative polyol transporter 1-like [Setaria italica]
Length=508

 Score =   252 bits (644),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 154/190 (81%), Gaps = 0/190 (0%)
 Frame = +3

Query  186  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  365
            PKK     YA   + LAS+ASI+LGYDIGVMSGAA+YI+KDLKI D Q+EIL+GILN YS
Sbjct  7    PKKKSNVTYAFICSILASMASIILGYDIGVMSGAALYIKKDLKITDVQLEILMGILNFYS  66

Query  366  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMI  545
            LIGS  AGRTSDWIGRR+T+VVA+  FF GA+LMG + +Y  LM GRFVAG+GVGY LMI
Sbjct  67   LIGSFAAGRTSDWIGRRFTVVVAAAFFFSGALLMGLAGDYATLMFGRFVAGVGVGYGLMI  126

Query  546  APVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSV  725
            APVYTAEV+PAS RGFLTSF EVFIN GIL+GYVSN+AF  + +HL WR MLG+G+ PSV
Sbjct  127  APVYTAEVSPASARGFLTSFSEVFINIGILLGYVSNYAFARLPLHLGWRVMLGIGAAPSV  186

Query  726  LLGVSVLAMP  755
            LL + V  MP
Sbjct  187  LLALMVFGMP  196



>ref|XP_010254894.1| PREDICTED: polyol transporter 5-like [Nelumbo nucifera]
Length=504

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 157/206 (76%), Gaps = 0/206 (0%)
 Frame = +3

Query  138  RPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  317
            + +  +    I   + P K +R K+A+  A LAS+ SILLGYD GVMSGA I+I+ DLKI
Sbjct  6    QKIETSAVHEILEIESPNKYRRKKFALTCATLASMISILLGYDTGVMSGAIIFIKDDLKI  65

Query  318  NDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLM  497
            NDTQ+E+L+GI+NL SL+GS  AGRTSDWIGRRYT+V A+V+FFVGA+LMG + NY  LM
Sbjct  66   NDTQIEVLVGIINLCSLVGSVAAGRTSDWIGRRYTIVFAAVIFFVGALLMGLAPNYAVLM  125

Query  498  VGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSV  677
             GR VAG GVGYALMIAPVYTAE+APA  RG LTSF E+FIN G+L+GYVSNFAF  +  
Sbjct  126  AGRIVAGFGVGYALMIAPVYTAELAPALSRGLLTSFTEIFINAGVLLGYVSNFAFSKLPE  185

Query  678  HLSWRFMLGVGSIPSVLLGVSVLAMP  755
            HL WR MLG G+IPSV    +VL MP
Sbjct  186  HLGWRLMLGAGAIPSVFFAFAVLTMP  211



>ref|XP_008368694.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=485

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = +3

Query  264  DIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVV  443
            DIGVMSGA+++I+++L I+D QVE+L G LN+YSLIGS +AG+TSDWIGRRYT+V+A  +
Sbjct  9    DIGVMSGASLFIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTI  68

Query  444  FFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFIN  623
            FF+GA+LMGF+ NY FLM GRF+AG+GVGYALMIAPVYTAE++PAS RGFLTSFPEVF+N
Sbjct  69   FFIGALLMGFAPNYAFLMFGRFIAGVGVGYALMIAPVYTAEISPASFRGFLTSFPEVFVN  128

Query  624  FGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
             GIL+GYVSNFA   + +HL+WR MLG+G+IPSV L + VLAMP
Sbjct  129  VGILLGYVSNFALAKLPIHLNWRIMLGIGAIPSVFLALGVLAMP  172



>ref|XP_010527595.1| PREDICTED: polyol transporter 5-like [Tarenaya hassleriana]
Length=334

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 157/189 (83%), Gaps = 0/189 (0%)
 Frame = +3

Query  189  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSL  368
            ++ KRN++    A L S+  ILLGYDIGVMSGA IYI++D+K++D Q+EIL+GIL++YSL
Sbjct  8    ERPKRNRFPFVCAILVSMILILLGYDIGVMSGAIIYIKRDMKLSDVQIEILVGILSIYSL  67

Query  369  IGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIA  548
            +GS +AGRTSDWIGRRYT+V+A  +FF GA+LMGF+T+Y FLM GRFVAG  +G+A MIA
Sbjct  68   VGSSLAGRTSDWIGRRYTIVLAGGIFFAGALLMGFATDYAFLMFGRFVAGFSIGFAGMIA  127

Query  549  PVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVL  728
            PVY AE++PAS RGFLTSFPEV +N GIL+GYVSN+AF  + + L WR MLG+G++PSV+
Sbjct  128  PVYIAEISPASSRGFLTSFPEVSVNVGILLGYVSNYAFSRLPLGLGWRLMLGIGAVPSVV  187

Query  729  LGVSVLAMP  755
            L V VLAMP
Sbjct  188  LAVGVLAMP  196



>ref|XP_010905472.1| PREDICTED: polyol transporter 5-like [Elaeis guineensis]
Length=525

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 167/210 (80%), Gaps = 5/210 (2%)
 Frame = +3

Query  138  RPVRNAGSGHIP----AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  305
            +P + A S  +P      + PK    NKYA+A A LAS+ S LLGYDI VMSGA+++IQK
Sbjct  3    KPKQPAVSDPLPNQTLGLEKPKP-PTNKYALACATLASMTSTLLGYDIAVMSGASVFIQK  61

Query  306  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  485
            DLK++DTQ+EIL G++NLYSLIGS  AGRTSDWIGRRYT++ A+ +FF GA+LMG + NY
Sbjct  62   DLKVSDTQIEILAGVINLYSLIGSIAAGRTSDWIGRRYTIIFAAAIFFAGALLMGLAPNY  121

Query  486  TFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFK  665
              LMVGRFVAGIGVGYALMIAPVYTAEVAP S RGFLTSFPEVFIN G+L+GYVSNFAF 
Sbjct  122  AILMVGRFVAGIGVGYALMIAPVYTAEVAPTSARGFLTSFPEVFINSGVLLGYVSNFAFS  181

Query  666  NMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
             +S H++WR M  VG++P + L ++VLAMP
Sbjct  182  KLSYHINWRIMFCVGAVPPIFLAIAVLAMP  211



>ref|XP_004958138.1| PREDICTED: polyol transporter 5-like [Setaria italica]
Length=509

 Score =   250 bits (639),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +3

Query  186  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  365
            PKK    KYA   A LAS+ASI+LGYDIGVMSGAA+YI+KDLKI D Q+EIL+GILN+YS
Sbjct  12   PKKKSNVKYASFCAILASMASIILGYDIGVMSGAALYIKKDLKITDVQLEILMGILNVYS  71

Query  366  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMI  545
            LIGS  AGRTSDWIGRR+T+V A+ +FF GA+LMGF+ NY  LM GRFVAG+GVGYA+MI
Sbjct  72   LIGSFAAGRTSDWIGRRFTVVFAAAIFFAGALLMGFAVNYAMLMAGRFVAGVGVGYAIMI  131

Query  546  APVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSV  725
            APVYTAE++PA+ RGFLTSFPEVFIN GIL+GYVSN+AF  + +HLSWR MLG+G++PS 
Sbjct  132  APVYTAEISPAAARGFLTSFPEVFINIGILLGYVSNYAFARLPLHLSWRVMLGIGAVPSA  191

Query  726  LLGVSVLAMP  755
            LL + V  MP
Sbjct  192  LLALMVFGMP  201



>tpg|DAA43975.1| TPA: polyol transporter protein 4 [Zea mays]
Length=499

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = +3

Query  264  DIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVV  443
            DI VMSGA +++++DLKI DTQ+EIL G++N+YSL GS  AG TSDW+GRRYTMV+A+ +
Sbjct  16   DISVMSGAQLFMKEDLKITDTQIEILAGVINIYSLFGSLAAGLTSDWLGRRYTMVLAAAI  75

Query  444  FFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFIN  623
            FF GA+LMGF+  Y FLMVGRFVAGIGVG+ALMIAPVYTAEVAP S RGFLTSFPEVF N
Sbjct  76   FFTGALLMGFAPGYGFLMVGRFVAGIGVGFALMIAPVYTAEVAPTSARGFLTSFPEVFNN  135

Query  624  FGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            FGIL+GYVSNFAF  + VHLSWR M  VG++P V LGV+VLAMP
Sbjct  136  FGILLGYVSNFAFARLPVHLSWRAMFLVGAVPPVFLGVAVLAMP  179



>ref|XP_008447047.1| PREDICTED: polyol transporter 5-like [Cucumis melo]
Length=519

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 157/199 (79%), Gaps = 0/199 (0%)
 Frame = +3

Query  159  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  338
            +  I    PP   KRN YA   + +AS+AS+LLGYDIGVMSGAAI+IQ+D +I+D +VEI
Sbjct  20   TSSISDHSPPPAAKRNNYAFVCSTMASMASVLLGYDIGVMSGAAIFIQEDFRISDLEVEI  79

Query  339  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  518
            L+GI++LYS++GS  AGRTSDWIGRRYTM +A+  F VGA+LMG +TNY FLM GRF AG
Sbjct  80   LVGIISLYSILGSVAAGRTSDWIGRRYTMGIAAAFFLVGAVLMGLATNYAFLMFGRFFAG  139

Query  519  IGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFM  698
            +G G+A +IAPVYTAE++PA+ RG  T+FPE+FIN GIL+GYVSNFAF     HLSWRFM
Sbjct  140  VGTGFAGLIAPVYTAEISPAASRGCFTTFPEIFINVGILLGYVSNFAFSKFPTHLSWRFM  199

Query  699  LGVGSIPSVLLGVSVLAMP  755
            LGVG IPSV L + VL MP
Sbjct  200  LGVGLIPSVGLVIIVLVMP  218



>gb|EAY88906.1| hypothetical protein OsI_10385 [Oryza sativa Indica Group]
Length=521

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 161/200 (81%), Gaps = 1/200 (1%)
 Frame = +3

Query  159  SGHIPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVE  335
            S  +PA + P K+   NKYA+A A LAS+ SILLGYDI VMSGA  +++KDL I+D +VE
Sbjct  6    SSDVPAAEAPAKRAPLNKYALACAILASMNSILLGYDISVMSGAQKFMKKDLNISDAKVE  65

Query  336  ILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVA  515
            +L GI+N+YSL+GS  AGRTSDWIGRRYTMV+ASV+FF GA++MG + +Y  +M+GRFVA
Sbjct  66   VLAGIINIYSLVGSLAAGRTSDWIGRRYTMVLASVIFFAGALIMGLAPSYAIVMLGRFVA  125

Query  516  GIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRF  695
            G+GVGYALMIAPVYTAEVAP S RG LTSFPEVFIN G+L+GYVSNFAF  + +H+ WR 
Sbjct  126  GVGVGYALMIAPVYTAEVAPTSARGLLTSFPEVFINAGVLLGYVSNFAFYRLPLHIGWRV  185

Query  696  MLGVGSIPSVLLGVSVLAMP  755
            M  VG++P V L V VLAMP
Sbjct  186  MFLVGAVPPVFLAVGVLAMP  205



>gb|ACG47895.1| polyol transporter protein 4 [Zea mays]
Length=524

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = +3

Query  264  DIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVV  443
            DI VMSGA +++++DLKI DTQ+EIL G++N+YSL GS  AG TSDW+GRRYTMV+A+ +
Sbjct  16   DISVMSGAQLFMKEDLKITDTQIEILAGVINIYSLFGSLAAGLTSDWLGRRYTMVLAAAI  75

Query  444  FFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFIN  623
            FF GA+LMGF+  Y FLMVGRFVAGIGVG+ALMIAPVYTAEVAP S RGFLTSFPEVF N
Sbjct  76   FFTGALLMGFAPGYGFLMVGRFVAGIGVGFALMIAPVYTAEVAPTSARGFLTSFPEVFNN  135

Query  624  FGILVGYVSNFAFKNMSVHLSWRFMLGVGSIPSVLLGVSVLAMP  755
            FGIL+GYVSNFAF  + VHLSWR M  VG++P V LGV+VLAMP
Sbjct  136  FGILLGYVSNFAFARLPVHLSWRAMFLVGAVPPVFLGVAVLAMP  179



>ref|XP_010229631.1| PREDICTED: putative polyol transporter 1 [Brachypodium distachyon]
Length=520

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = +3

Query  165  HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILL  344
             +P    PKK    KYA   A +AS+ASI+LGYDIGV+SGA++YI+KDLKI D Q+EIL+
Sbjct  5    ELPEAVEPKKKSNLKYAFICAIVASMASIVLGYDIGVISGASLYIKKDLKITDAQLEILV  64

Query  345  GILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIG  524
            GIL++YSLIGS  AGRTSDWIGRR+T+V  S  FF GA+LMGF+ +Y  LM GRFVAGIG
Sbjct  65   GILSIYSLIGSFAAGRTSDWIGRRFTVVFVSAFFFAGALLMGFAGSYAMLMFGRFVAGIG  124

Query  525  VGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLG  704
            VGYA++IAPVYTAE++PAS RGFLTSFPEVFIN GIL+GYVSN+AF  + + L WRFMLG
Sbjct  125  VGYAMVIAPVYTAEISPASARGFLTSFPEVFINVGILLGYVSNYAFARLPLSLGWRFMLG  184

Query  705  VGSIPSVLLGVSVLAMP  755
            +G+ P VLL V V+ MP
Sbjct  185  IGAAPPVLLAVLVVNMP  201



>ref|XP_004958137.1| PREDICTED: polyol transporter 5-like [Setaria italica]
Length=515

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 162/199 (81%), Gaps = 0/199 (0%)
 Frame = +3

Query  159  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  338
            S  +P    PKK    ++A A A LAS+ SILLGYDIGVMSGA++YIQKDLKI D ++E+
Sbjct  3    SAALPEAVEPKKKGNTRFAFACAILASMTSILLGYDIGVMSGASLYIQKDLKITDKELEV  62

Query  339  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  518
            L+GILN+YSLIGS  AGRTSDWIGRRYT+V A+ +FF GA LMGF+ NY  LM GRFVAG
Sbjct  63   LMGILNVYSLIGSFAAGRTSDWIGRRYTIVFAAAIFFAGAFLMGFAVNYGMLMFGRFVAG  122

Query  519  IGVGYALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFM  698
            +GVGYALMIAPVYTAEV+PAS RGFLTSFPEVFINFGIL+GYVSN+AF  + + L WR M
Sbjct  123  VGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSRLPLKLGWRVM  182

Query  699  LGVGSIPSVLLGVSVLAMP  755
            LG+G+ PSV+L + VL MP
Sbjct  183  LGIGAAPSVVLALMVLGMP  201



>gb|ABX71752.1| mannitol transporter [Apium graveolens]
Length=524

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 163/195 (84%), Gaps = 0/195 (0%)
 Frame = +3

Query  171  PAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGI  350
            P FD  KK K NKYA A + LAS+ SILLGYD GVMSGAAIYI+KDL+  D Q+EI++GI
Sbjct  21   PLFDAEKKPKNNKYAFACSILASMTSILLGYDTGVMSGAAIYIKKDLRFTDVQIEIIVGI  80

Query  351  LNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVG  530
            +N++SL+GS +AGRTSDWIGRRYTMV+A  +FF GA LMG +TN+ FLMVGRFVAGIGVG
Sbjct  81   INIFSLLGSFLAGRTSDWIGRRYTMVLAGGIFFAGAFLMGCATNFEFLMVGRFVAGIGVG  140

Query  531  YALMIAPVYTAEVAPASVRGFLTSFPEVFINFGILVGYVSNFAFKNMSVHLSWRFMLGVG  710
            YA+MIAPVYT EVAPAS RGFLTSFPEVFIN G+++GYVSNFAF  + + L WRFMLG+G
Sbjct  141  YAMMIAPVYTTEVAPASSRGFLTSFPEVFINAGVMLGYVSNFAFAKLPLWLGWRFMLGIG  200

Query  711  SIPSVLLGVSVLAMP  755
            ++PSV L + VL MP
Sbjct  201  AVPSVGLAIGVLYMP  215



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1469386858550