BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3495

Length=1187
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011073820.1|  PREDICTED: probably inactive leucine-rich re...    354   7e-109   Sesamum indicum [beniseed]
ref|XP_006364689.1|  PREDICTED: probably inactive leucine-rich re...    350   4e-107   Solanum tuberosum [potatoes]
emb|CDP14623.1|  unnamed protein product                                345   2e-105   Coffea canephora [robusta coffee]
ref|XP_009765958.1|  PREDICTED: probably inactive leucine-rich re...    345   3e-105   Nicotiana sylvestris
ref|XP_009589223.1|  PREDICTED: probably inactive leucine-rich re...    342   2e-104   Nicotiana tomentosiformis
ref|XP_004247993.1|  PREDICTED: probably inactive leucine-rich re...    341   6e-104   Solanum lycopersicum
ref|XP_002518223.1|  receptor protein kinase, putative                  332   1e-100   Ricinus communis
ref|XP_010023583.1|  PREDICTED: probably inactive leucine-rich re...    327   9e-99    Eucalyptus grandis [rose gum]
ref|XP_010528265.1|  PREDICTED: probably inactive leucine-rich re...    323   5e-97    Tarenaya hassleriana [spider flower]
ref|XP_011042759.1|  PREDICTED: probably inactive leucine-rich re...    322   9e-97    Populus euphratica
ref|XP_002265846.1|  PREDICTED: probably inactive leucine-rich re...    322   2e-96    Vitis vinifera
ref|XP_007034091.1|  Leucine-rich receptor-like protein kinase fa...    321   2e-96    
ref|XP_002321093.1|  leucine-rich repeat transmembrane protein ki...    319   1e-95    Populus trichocarpa [western balsam poplar]
ref|XP_009371148.1|  PREDICTED: probably inactive leucine-rich re...    316   2e-94    Pyrus x bretschneideri [bai li]
ref|XP_011000023.1|  PREDICTED: probably inactive leucine-rich re...    315   3e-94    Populus euphratica
ref|XP_004296675.1|  PREDICTED: probably inactive leucine-rich re...    314   6e-94    Fragaria vesca subsp. vesca
ref|XP_010268319.1|  PREDICTED: probably inactive leucine-rich re...    313   1e-93    Nelumbo nucifera [Indian lotus]
ref|XP_002302895.2|  leucine-rich repeat transmembrane protein ki...    313   2e-93    
ref|XP_006840189.1|  PREDICTED: probably inactive leucine-rich re...    310   2e-92    
gb|KJB37929.1|  hypothetical protein B456_006G227000                    309   4e-92    Gossypium raimondii
ref|XP_008453972.1|  PREDICTED: probably inactive leucine-rich re...    310   4e-92    Cucumis melo [Oriental melon]
ref|XP_010555905.1|  PREDICTED: probably inactive leucine-rich re...    309   8e-92    Tarenaya hassleriana [spider flower]
ref|XP_003518672.1|  PREDICTED: probably inactive leucine-rich re...    307   3e-91    Glycine max [soybeans]
gb|KHG00472.1|  hypothetical protein F383_20103                         307   3e-91    Gossypium arboreum [tree cotton]
gb|KHN27185.1|  Probably inactive leucine-rich repeat receptor-li...    306   4e-91    Glycine soja [wild soybean]
gb|KHN13843.1|  Probably inactive leucine-rich repeat receptor-li...    305   1e-90    Glycine soja [wild soybean]
ref|XP_003552656.1|  PREDICTED: probably inactive leucine-rich re...    305   1e-90    Glycine max [soybeans]
gb|KFK33718.1|  hypothetical protein AALP_AA5G051000                    304   3e-90    Arabis alpina [alpine rockcress]
ref|XP_004152295.1|  PREDICTED: probably inactive leucine-rich re...    304   4e-90    Cucumis sativus [cucumbers]
ref|XP_010514517.1|  PREDICTED: probably inactive leucine-rich re...    304   5e-90    Camelina sativa [gold-of-pleasure]
ref|NP_189443.2|  probably inactive leucine-rich repeat receptor-...    304   6e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008337525.1|  PREDICTED: probably inactive leucine-rich re...    301   4e-89    Malus domestica [apple tree]
ref|XP_010425587.1|  PREDICTED: probably inactive leucine-rich re...    301   5e-89    Camelina sativa [gold-of-pleasure]
gb|EPS70115.1|  hypothetical protein M569_04636                         298   3e-88    Genlisea aurea
ref|XP_010555906.1|  PREDICTED: probably inactive leucine-rich re...    298   5e-88    Tarenaya hassleriana [spider flower]
ref|XP_006290541.1|  hypothetical protein CARUB_v10016623mg             298   6e-88    Capsella rubella
ref|XP_009151898.1|  PREDICTED: probably inactive leucine-rich re...    296   3e-87    Brassica rapa
ref|XP_002875419.1|  hypothetical protein ARALYDRAFT_484589             295   9e-87    
ref|XP_007225370.1|  hypothetical protein PRUPE_ppa000838mg             294   2e-86    
ref|XP_006395381.1|  hypothetical protein EUTSA_v10003580mg             294   2e-86    Eutrema salsugineum [saltwater cress]
ref|XP_003621730.1|  Probably inactive leucine-rich repeat recept...    293   4e-86    Medicago truncatula
ref|XP_008244427.1|  PREDICTED: probably inactive leucine-rich re...    292   7e-86    Prunus mume [ume]
ref|XP_006494521.1|  PREDICTED: probably inactive leucine-rich re...    292   8e-86    Citrus sinensis [apfelsine]
ref|XP_006421080.1|  hypothetical protein CICLE_v10004238mg             291   1e-85    Citrus clementina [clementine]
emb|CDY20032.1|  BnaA09g02190D                                          292   1e-85    Brassica napus [oilseed rape]
ref|XP_009111587.1|  PREDICTED: probably inactive leucine-rich re...    291   2e-85    Brassica rapa
ref|XP_010107246.1|  Probably inactive leucine-rich repeat recept...    290   1e-84    
ref|XP_007139297.1|  hypothetical protein PHAVU_008G017400g             287   6e-84    Phaseolus vulgaris [French bean]
ref|XP_012072583.1|  PREDICTED: probably inactive leucine-rich re...    285   3e-83    Jatropha curcas
ref|XP_010502811.1|  PREDICTED: probably inactive leucine-rich re...    285   5e-83    Camelina sativa [gold-of-pleasure]
emb|CDY00141.1|  BnaC09g01600D                                          282   4e-82    
ref|XP_010673272.1|  PREDICTED: probably inactive leucine-rich re...    276   4e-80    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009589224.1|  PREDICTED: probably inactive leucine-rich re...    267   7e-77    
ref|XP_004492049.1|  PREDICTED: probably inactive leucine-rich re...    261   2e-74    Cicer arietinum [garbanzo]
ref|XP_009403616.1|  PREDICTED: probably inactive leucine-rich re...    259   9e-74    Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI39439.3|  unnamed protein product                                256   2e-73    Vitis vinifera
ref|XP_010929848.1|  PREDICTED: probably inactive leucine-rich re...    252   2e-71    Elaeis guineensis
ref|XP_009406353.1|  PREDICTED: probably inactive leucine-rich re...    251   3e-71    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002459131.1|  hypothetical protein SORBIDRAFT_03g046350          249   4e-70    
dbj|BAB92869.1|  putative receptor-like protein kinase                  246   2e-69    Oryza sativa Japonica Group [Japonica rice]
gb|EAY77289.1|  hypothetical protein OsI_05265                          246   4e-69    Oryza sativa Indica Group [Indian rice]
ref|XP_004971314.1|  PREDICTED: probably inactive leucine-rich re...    246   5e-69    Setaria italica
dbj|BAJ85468.1|  predicted protein                                      241   2e-67    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACN33819.1|  unknown                                                 241   2e-67    Zea mays [maize]
ref|NP_001170194.1|  uncharacterized protein LOC100384143 precursor     230   3e-67    
ref|XP_008672259.1|  PREDICTED: uncharacterized protein LOC100216...    241   4e-67    
emb|CDX85183.1|  BnaC07g24940D                                          239   8e-67    
ref|XP_009415955.1|  PREDICTED: probably inactive leucine-rich re...    239   8e-67    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008655312.1|  PREDICTED: uncharacterized protein LOC100384...    237   5e-66    Zea mays [maize]
gb|KJB67930.1|  hypothetical protein B456_010G218400                    231   6e-65    Gossypium raimondii
ref|XP_006435929.1|  hypothetical protein CICLE_v10030625mg             233   1e-64    
ref|XP_006486161.1|  PREDICTED: probably inactive leucine-rich re...    233   1e-64    Citrus sinensis [apfelsine]
gb|KDO67528.1|  hypothetical protein CISIN_1g002321mg                   232   1e-64    Citrus sinensis [apfelsine]
ref|XP_003567498.1|  PREDICTED: probably inactive leucine-rich re...    232   4e-64    Brachypodium distachyon [annual false brome]
gb|KJB67929.1|  hypothetical protein B456_010G218400                    231   4e-64    Gossypium raimondii
gb|KHG03607.1|  hypothetical protein F383_26757                         230   7e-64    Gossypium arboreum [tree cotton]
ref|XP_009623562.1|  PREDICTED: probably inactive leucine-rich re...    227   7e-63    Nicotiana tomentosiformis
ref|XP_009757206.1|  PREDICTED: probably inactive leucine-rich re...    227   9e-63    Nicotiana sylvestris
gb|EYU32740.1|  hypothetical protein MIMGU_mgv1a000860mg                227   1e-62    Erythranthe guttata [common monkey flower]
ref|XP_008776998.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    227   2e-62    
ref|XP_007011288.1|  Leucine-rich repeat protein kinase family pr...    225   5e-62    
ref|XP_008456960.1|  PREDICTED: probably inactive leucine-rich re...    224   1e-61    Cucumis melo [Oriental melon]
ref|XP_007207150.1|  hypothetical protein PRUPE_ppa000904mg             224   1e-61    Prunus persica
ref|XP_008244834.1|  PREDICTED: probably inactive leucine-rich re...    223   3e-61    Prunus mume [ume]
gb|KJB73018.1|  hypothetical protein B456_011G209800                    223   5e-61    Gossypium raimondii
gb|KHG09451.1|  hypothetical protein F383_09289                         222   7e-61    Gossypium arboreum [tree cotton]
ref|XP_008788529.1|  PREDICTED: probably inactive leucine-rich re...    222   7e-61    Phoenix dactylifera
ref|XP_002520879.1|  ATP binding protein, putative                      221   1e-60    Ricinus communis
ref|XP_010931370.1|  PREDICTED: probably inactive leucine-rich re...    221   1e-60    Elaeis guineensis
ref|XP_010922754.1|  PREDICTED: probably inactive leucine-rich re...    221   1e-60    Elaeis guineensis
ref|XP_004240861.1|  PREDICTED: probably inactive leucine-rich re...    220   2e-60    Solanum lycopersicum
ref|XP_006290555.1|  hypothetical protein CARUB_v10016642mg             220   2e-60    
ref|XP_009372024.1|  PREDICTED: probably inactive leucine-rich re...    220   3e-60    Pyrus x bretschneideri [bai li]
ref|XP_006290556.1|  hypothetical protein CARUB_v10016642mg             220   3e-60    Capsella rubella
ref|XP_008350571.1|  PREDICTED: probably inactive leucine-rich re...    213   4e-60    
ref|XP_004241084.1|  PREDICTED: probably inactive leucine-rich re...    219   5e-60    Solanum lycopersicum
ref|XP_006358746.1|  PREDICTED: probably inactive leucine-rich re...    219   5e-60    Solanum tuberosum [potatoes]
ref|XP_011002596.1|  PREDICTED: probably inactive leucine-rich re...    219   7e-60    Populus euphratica
ref|XP_002267737.3|  PREDICTED: probably inactive leucine-rich re...    219   7e-60    Vitis vinifera
ref|XP_008233886.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    219   8e-60    Prunus mume [ume]
ref|XP_006357297.1|  PREDICTED: probably inactive leucine-rich re...    219   8e-60    Solanum tuberosum [potatoes]
ref|XP_008681357.1|  PREDICTED: uncharacterized protein LOC100304...    218   2e-59    
gb|KFK34877.1|  Leucine-rich repeat protein kinase family protein       218   2e-59    Arabis alpina [alpine rockcress]
ref|XP_004146470.1|  PREDICTED: probably inactive leucine-rich re...    217   4e-59    Cucumis sativus [cucumbers]
ref|XP_002878081.1|  hypothetical protein ARALYDRAFT_907079             217   4e-59    Arabidopsis lyrata subsp. lyrata
ref|XP_010253073.1|  PREDICTED: probably inactive leucine-rich re...    216   6e-59    Nelumbo nucifera [Indian lotus]
ref|XP_012091046.1|  PREDICTED: probably inactive leucine-rich re...    216   7e-59    
ref|XP_010921155.1|  PREDICTED: probably inactive leucine-rich re...    216   7e-59    
ref|XP_012091138.1|  PREDICTED: probably inactive leucine-rich re...    216   7e-59    Jatropha curcas
ref|XP_002323672.2|  hypothetical protein POPTR_0016s14410g             216   8e-59    Populus trichocarpa [western balsam poplar]
ref|XP_010921154.1|  PREDICTED: probably inactive leucine-rich re...    216   9e-59    
ref|NP_191196.1|  leucine-rich repeat protein kinase-like protein       216   1e-58    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008792235.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    216   1e-58    
ref|XP_007220278.1|  hypothetical protein PRUPE_ppa000889mg             216   1e-58    
ref|XP_006842493.1|  PREDICTED: probably inactive leucine-rich re...    216   1e-58    Amborella trichopoda
ref|XP_004984462.1|  PREDICTED: probably inactive leucine-rich re...    215   2e-58    Setaria italica
ref|XP_004137674.1|  PREDICTED: probably inactive leucine-rich re...    215   2e-58    Cucumis sativus [cucumbers]
ref|XP_002275275.1|  PREDICTED: probably inactive leucine-rich re...    215   2e-58    Vitis vinifera
ref|XP_002467905.1|  hypothetical protein SORBIDRAFT_01g036160          214   3e-58    Sorghum bicolor [broomcorn]
ref|NP_001239730.1|  probably inactive leucine-rich repeat recept...    214   3e-58    Glycine max [soybeans]
ref|XP_008370260.1|  PREDICTED: probably inactive leucine-rich re...    214   3e-58    
ref|XP_009402208.1|  PREDICTED: probably inactive leucine-rich re...    214   4e-58    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011010875.1|  PREDICTED: probably inactive leucine-rich re...    214   4e-58    Populus euphratica
ref|XP_007136420.1|  hypothetical protein PHAVU_009G043600g             214   4e-58    Phaseolus vulgaris [French bean]
ref|XP_011010876.1|  PREDICTED: probably inactive leucine-rich re...    214   5e-58    Populus euphratica
ref|XP_006402993.1|  hypothetical protein EUTSA_v10005773mg             213   7e-58    Eutrema salsugineum [saltwater cress]
ref|XP_010553156.1|  PREDICTED: probably inactive leucine-rich re...    213   1e-57    Tarenaya hassleriana [spider flower]
ref|XP_008442319.1|  PREDICTED: probably inactive leucine-rich re...    213   1e-57    Cucumis melo [Oriental melon]
ref|XP_010683484.1|  PREDICTED: probably inactive leucine-rich re...    213   1e-57    Beta vulgaris subsp. vulgaris [field beet]
gb|AAL49790.1|  unknown protein                                         213   1e-57    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006429586.1|  hypothetical protein CICLE_v10010994mg             213   1e-57    
ref|XP_006481196.1|  PREDICTED: probably inactive leucine-rich re...    212   2e-57    Citrus sinensis [apfelsine]
gb|KDO64103.1|  hypothetical protein CISIN_1g002094mg                   212   2e-57    Citrus sinensis [apfelsine]
ref|XP_008388889.1|  PREDICTED: probably inactive leucine-rich re...    206   2e-57    
ref|XP_006398567.1|  hypothetical protein EUTSA_v10012579mg             212   2e-57    Eutrema salsugineum [saltwater cress]
ref|XP_002309183.1|  hypothetical protein POPTR_0006s10910g             212   3e-57    
ref|NP_001290509.1|  probably inactive leucine-rich repeat recept...    211   3e-57    Elaeis guineensis
ref|XP_002528692.1|  Brassinosteroid LRR receptor kinase precurso...    211   3e-57    Ricinus communis
ref|XP_010103654.1|  Probably inactive leucine-rich repeat recept...    212   3e-57    Morus notabilis
ref|XP_010253067.1|  PREDICTED: probably inactive leucine-rich re...    211   3e-57    Nelumbo nucifera [Indian lotus]
ref|XP_011019006.1|  PREDICTED: probably inactive leucine-rich re...    211   6e-57    Populus euphratica
ref|XP_011019007.1|  PREDICTED: probably inactive leucine-rich re...    211   6e-57    Populus euphratica
ref|XP_002870895.1|  hypothetical protein ARALYDRAFT_486880             211   6e-57    
ref|XP_004305081.1|  PREDICTED: probably inactive leucine-rich re...    210   8e-57    Fragaria vesca subsp. vesca
ref|XP_008782666.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    210   1e-56    
ref|XP_002319878.2|  leucine-rich repeat transmembrane protein ki...    210   1e-56    Populus trichocarpa [western balsam poplar]
ref|XP_004492560.1|  PREDICTED: probably inactive leucine-rich re...    210   1e-56    Cicer arietinum [garbanzo]
ref|XP_009416321.1|  PREDICTED: probably inactive leucine-rich re...    209   2e-56    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011084816.1|  PREDICTED: probably inactive leucine-rich re...    209   2e-56    Sesamum indicum [beniseed]
ref|XP_011001391.1|  PREDICTED: probably inactive leucine-rich re...    209   3e-56    Populus euphratica
ref|XP_002325929.2|  leucine-rich repeat transmembrane protein ki...    209   3e-56    
ref|XP_010067617.1|  PREDICTED: probably inactive leucine-rich re...    209   3e-56    Eucalyptus grandis [rose gum]
ref|XP_003522510.2|  PREDICTED: probably inactive leucine-rich re...    209   3e-56    Glycine max [soybeans]
ref|XP_008808300.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    209   3e-56    
ref|XP_007033525.1|  Leucine-rich receptor-like protein kinase fa...    209   3e-56    
gb|KJB71525.1|  hypothetical protein B456_011G127000                    208   5e-56    Gossypium raimondii
ref|NP_195809.1|  leucine-rich receptor-like protein kinase             208   6e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010525412.1|  PREDICTED: probably inactive leucine-rich re...    207   9e-56    Tarenaya hassleriana [spider flower]
ref|XP_003521989.1|  PREDICTED: probably inactive leucine-rich re...    207   1e-55    Glycine max [soybeans]
ref|XP_007140080.1|  hypothetical protein PHAVU_008G082500g             207   1e-55    Phaseolus vulgaris [French bean]
gb|EEC75203.1|  hypothetical protein OsI_11455                          206   2e-55    Oryza sativa Indica Group [Indian rice]
gb|KFK24685.1|  hypothetical protein AALP_AA8G011600                    206   3e-55    Arabis alpina [alpine rockcress]
ref|XP_009362809.1|  PREDICTED: probably inactive leucine-rich re...    206   3e-55    Pyrus x bretschneideri [bai li]
ref|XP_009349085.1|  PREDICTED: probably inactive leucine-rich re...    206   3e-55    Pyrus x bretschneideri [bai li]
ref|XP_003516434.1|  PREDICTED: probably inactive leucine-rich re...    206   3e-55    Glycine max [soybeans]
gb|KHN11868.1|  Probably inactive leucine-rich repeat receptor-li...    206   5e-55    Glycine soja [wild soybean]
ref|XP_009793754.1|  PREDICTED: probably inactive leucine-rich re...    205   5e-55    Nicotiana sylvestris
ref|XP_006279331.1|  hypothetical protein CARUB_v10012717mg             205   8e-55    Capsella rubella
ref|XP_003623626.1|  Receptor-like protein kinase                       204   1e-54    
gb|AES79844.2|  LRR receptor-like kinase family protein                 204   1e-54    Medicago truncatula
ref|XP_004308984.1|  PREDICTED: probably inactive leucine-rich re...    204   1e-54    Fragaria vesca subsp. vesca
emb|CDP13903.1|  unnamed protein product                                204   1e-54    Coffea canephora [robusta coffee]
ref|XP_003605286.1|  Receptor-like protein kinase                       203   2e-54    Medicago truncatula
ref|XP_008369373.1|  PREDICTED: probably inactive leucine-rich re...    203   3e-54    
ref|XP_010092789.1|  Probably inactive leucine-rich repeat recept...    202   4e-54    Morus notabilis
ref|XP_004246289.1|  PREDICTED: probably inactive leucine-rich re...    202   8e-54    Solanum lycopersicum
ref|XP_009363794.1|  PREDICTED: probably inactive leucine-rich re...    202   8e-54    Pyrus x bretschneideri [bai li]
ref|NP_001050035.1|  Os03g0335500                                       201   1e-53    
gb|KEH35536.1|  leucine-rich receptor-like kinase family protein        201   2e-53    Medicago truncatula
ref|XP_006341303.1|  PREDICTED: probably inactive leucine-rich re...    201   2e-53    Solanum tuberosum [potatoes]
ref|XP_003557968.1|  PREDICTED: probably inactive leucine-rich re...    200   3e-53    Brachypodium distachyon [annual false brome]
ref|XP_006650049.1|  PREDICTED: probably inactive leucine-rich re...    200   3e-53    Oryza brachyantha
gb|EPS70735.1|  hypothetical protein M569_04020                         200   4e-53    Genlisea aurea
ref|XP_004502826.1|  PREDICTED: probably inactive leucine-rich re...    200   4e-53    Cicer arietinum [garbanzo]
ref|XP_007134721.1|  hypothetical protein PHAVU_010G070400g             200   6e-53    Phaseolus vulgaris [French bean]
ref|XP_003533657.2|  PREDICTED: probably inactive leucine-rich re...    199   7e-53    Glycine max [soybeans]
ref|XP_004138394.1|  PREDICTED: probably inactive leucine-rich re...    199   8e-53    Cucumis sativus [cucumbers]
ref|XP_010427454.1|  PREDICTED: probably inactive leucine-rich re...    199   1e-52    
gb|EAZ26832.1|  hypothetical protein OsJ_10748                          199   1e-52    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009406870.1|  PREDICTED: probably inactive leucine-rich re...    198   2e-52    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010043193.1|  PREDICTED: probably inactive leucine-rich re...    197   5e-52    Eucalyptus grandis [rose gum]
ref|XP_010504542.1|  PREDICTED: probably inactive leucine-rich re...    197   6e-52    Camelina sativa [gold-of-pleasure]
ref|XP_004514781.1|  PREDICTED: probably inactive leucine-rich re...    197   6e-52    
ref|XP_009116341.1|  PREDICTED: probably inactive leucine-rich re...    196   7e-52    Brassica rapa
ref|XP_010451924.1|  PREDICTED: probably inactive leucine-rich re...    196   1e-51    
dbj|BAK06250.1|  predicted protein                                      196   1e-51    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010412798.1|  PREDICTED: probably inactive leucine-rich re...    196   2e-51    
ref|XP_008456780.1|  PREDICTED: probably inactive leucine-rich re...    195   2e-51    Cucumis melo [Oriental melon]
gb|EMT18823.1|  Putative LRR receptor-like serine/threonine-prote...    195   3e-51    
ref|XP_001771841.1|  predicted protein                                  194   6e-51    
dbj|BAF79960.1|  receptor-like kinase                                   193   2e-50    Marchantia polymorpha
ref|XP_009614707.1|  PREDICTED: probably inactive leucine-rich re...    191   7e-50    Nicotiana tomentosiformis
ref|XP_010424006.1|  PREDICTED: probably inactive leucine-rich re...    191   7e-50    
ref|XP_010424007.1|  PREDICTED: probably inactive leucine-rich re...    191   8e-50    
ref|XP_006646695.1|  PREDICTED: probably inactive leucine-rich re...    191   8e-50    Oryza brachyantha
ref|XP_010490496.1|  PREDICTED: probably inactive leucine-rich re...    189   4e-49    
ref|XP_009789234.1|  PREDICTED: probably inactive leucine-rich re...    188   6e-49    Nicotiana sylvestris
gb|EAY76307.1|  hypothetical protein OsI_04242                          186   2e-48    Oryza sativa Indica Group [Indian rice]
dbj|BAB85306.1|  putative receptor-like protein kinase                  186   3e-48    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010670069.1|  PREDICTED: probably inactive leucine-rich re...    184   1e-47    Beta vulgaris subsp. vulgaris [field beet]
gb|EYU35201.1|  hypothetical protein MIMGU_mgv1a000839mg                182   9e-47    Erythranthe guttata [common monkey flower]
ref|XP_009125388.1|  PREDICTED: probably inactive leucine-rich re...    181   1e-46    Brassica rapa
ref|XP_011095143.1|  PREDICTED: probably inactive leucine-rich re...    178   3e-45    Sesamum indicum [beniseed]
ref|XP_002458686.1|  hypothetical protein SORBIDRAFT_03g038240          175   2e-44    Sorghum bicolor [broomcorn]
ref|XP_011076585.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    175   2e-44    Sesamum indicum [beniseed]
emb|CBI25352.3|  unnamed protein product                                172   2e-43    Vitis vinifera
gb|KDO44074.1|  hypothetical protein CISIN_1g0027171mg                  172   2e-43    Citrus sinensis [apfelsine]
gb|EYU42026.1|  hypothetical protein MIMGU_mgv1a000905mg                172   4e-43    Erythranthe guttata [common monkey flower]
ref|XP_004970391.1|  PREDICTED: probably inactive leucine-rich re...    171   5e-43    Setaria italica
emb|CDY27220.1|  BnaA09g35820D                                          171   7e-43    Brassica napus [oilseed rape]
tpg|DAA57062.1|  TPA: putative leucine-rich repeat receptor-like ...    169   3e-42    
ref|NP_001045445.1|  Os01g0957100                                       167   2e-41    
emb|CDX72142.1|  BnaC08g27320D                                          166   4e-41    
ref|XP_001769840.1|  predicted protein                                  165   6e-41    
ref|XP_002990711.1|  hypothetical protein SELMODRAFT_132189             164   1e-40    
ref|XP_001759642.1|  predicted protein                                  164   2e-40    
gb|KDO44075.1|  hypothetical protein CISIN_1g0027171mg                  161   8e-40    Citrus sinensis [apfelsine]
ref|XP_002972654.1|  hypothetical protein SELMODRAFT_98598              160   3e-39    Selaginella moellendorffii
emb|CDY04822.1|  BnaAnng00040D                                          159   6e-39    
ref|XP_002988156.1|  hypothetical protein SELMODRAFT_40688              157   2e-38    
ref|XP_010232495.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    154   6e-37    Brachypodium distachyon [annual false brome]
ref|XP_002439964.1|  hypothetical protein SORBIDRAFT_09g023480          150   6e-36    Sorghum bicolor [broomcorn]
ref|XP_004961741.1|  PREDICTED: probably inactive leucine-rich re...    150   6e-36    
ref|XP_001763904.1|  predicted protein                                  150   8e-36    
emb|CBI18033.3|  unnamed protein product                                148   2e-35    Vitis vinifera
ref|NP_001055847.2|  Os05g0478300                                       149   3e-35    
ref|XP_001775671.1|  predicted protein                                  146   1e-34    
ref|XP_008649763.1|  PREDICTED: probably inactive leucine-rich re...    147   1e-34    Zea mays [maize]
ref|XP_002301998.2|  leucine-rich repeat family protein                 144   1e-33    Populus trichocarpa [western balsam poplar]
ref|XP_011028955.1|  PREDICTED: probable LRR receptor-like serine...    144   2e-33    Populus euphratica
gb|EEE64100.1|  hypothetical protein OsJ_18931                          141   7e-33    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010092461.1|  putative LRR receptor-like serine/threonine-...    141   1e-32    Morus notabilis
ref|XP_003602344.1|  Kinase-like protein                                141   1e-32    Medicago truncatula
ref|XP_006372760.1|  hypothetical protein POPTR_0017s04790g             140   2e-32    
ref|XP_002306906.2|  hypothetical protein POPTR_0005s25640g             139   6e-32    
ref|XP_011045147.1|  PREDICTED: probable LRR receptor-like serine...    139   7e-32    Populus euphratica
ref|XP_009337700.1|  PREDICTED: probable LRR receptor-like serine...    138   1e-31    Pyrus x bretschneideri [bai li]
ref|XP_003602347.1|  Leucine-rich repeat receptor-like protein ki...    137   2e-31    Medicago truncatula
ref|XP_011047703.1|  PREDICTED: receptor-like protein kinase HSL1       136   4e-31    Populus euphratica
ref|XP_004309920.1|  PREDICTED: probable LRR receptor-like serine...    136   5e-31    Fragaria vesca subsp. vesca
ref|XP_012076101.1|  PREDICTED: receptor-like protein kinase            136   6e-31    Jatropha curcas
ref|XP_002460722.1|  hypothetical protein SORBIDRAFT_02g033810          136   6e-31    
ref|XP_004303842.1|  PREDICTED: receptor-like protein kinase            135   7e-31    Fragaria vesca subsp. vesca
emb|CBI21262.3|  unnamed protein product                                132   9e-31    Vitis vinifera
ref|XP_004233867.2|  PREDICTED: LRR receptor-like serine/threonin...    135   1e-30    Solanum lycopersicum
ref|XP_009335506.1|  PREDICTED: probable LRR receptor-like serine...    135   1e-30    Pyrus x bretschneideri [bai li]
gb|KEH43005.1|  LRR receptor-like kinase family protein                 134   2e-30    Medicago truncatula
ref|XP_008387972.1|  PREDICTED: probable LRR receptor-like serine...    135   2e-30    
ref|XP_011036960.1|  PREDICTED: probable LRR receptor-like serine...    134   2e-30    Populus euphratica
dbj|BAJ95144.1|  predicted protein                                      134   2e-30    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AES98523.2|  LRR receptor-like kinase family protein                 134   2e-30    Medicago truncatula
ref|XP_011033036.1|  PREDICTED: leucine-rich repeat receptor-like...    134   2e-30    Populus euphratica
gb|AAX96200.1|  Leucine Rich Repeat, putative                           132   3e-30    Oryza sativa Japonica Group [Japonica rice]
tpg|DAA40884.1|  TPA: putative leucine-rich repeat receptor-like ...    134   3e-30    
ref|XP_003615565.1|  Receptor protein kinase-like protein               134   3e-30    
ref|XP_010247922.1|  PREDICTED: receptor-like protein kinase HSL1       134   3e-30    Nelumbo nucifera [Indian lotus]
ref|XP_008347354.1|  PREDICTED: probable LRR receptor-like serine...    134   4e-30    
ref|XP_008357139.1|  PREDICTED: probable LRR receptor-like serine...    134   4e-30    
ref|XP_008377180.1|  PREDICTED: probable LRR receptor-like serine...    134   4e-30    
ref|XP_008803301.1|  PREDICTED: probable LRR receptor-like serine...    133   4e-30    Phoenix dactylifera
ref|XP_007025138.1|  Leucine-rich receptor-like protein kinase fa...    133   5e-30    
ref|XP_006591868.1|  PREDICTED: receptor-like protein kinase HSL1...    133   5e-30    Glycine max [soybeans]
ref|NP_001241340.1|  receptor-like protein kinase HSL1-like             133   6e-30    Glycine max [soybeans]
ref|XP_002991272.1|  hypothetical protein SELMODRAFT_236241             132   7e-30    
gb|KHG10910.1|  Receptor-like protein kinase HSL1                       132   7e-30    Gossypium arboreum [tree cotton]
ref|XP_002991210.1|  hypothetical protein SELMODRAFT_236225             132   8e-30    
ref|XP_012076103.1|  PREDICTED: receptor-like protein kinase            132   8e-30    
ref|XP_011072726.1|  PREDICTED: receptor-like protein kinase isof...    132   9e-30    
dbj|BAK02926.1|  predicted protein                                      132   9e-30    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002310940.2|  leucine-rich repeat transmembrane protein ki...    132   9e-30    
ref|XP_006279948.1|  hypothetical protein CARUB_v10025818mg             132   9e-30    
ref|XP_011072724.1|  PREDICTED: receptor-like protein kinase isof...    132   9e-30    
ref|NP_001047431.1|  Os02g0615500                                       132   1e-29    
ref|XP_003605636.1|  Receptor-like protein kinase                       130   1e-29    
ref|XP_010930577.1|  PREDICTED: receptor-like protein kinase HSL1       132   1e-29    
gb|KDP34454.1|  hypothetical protein JCGZ_11925                         132   1e-29    
dbj|BAJ86449.1|  predicted protein                                      132   1e-29    
ref|XP_009760433.1|  PREDICTED: receptor-like protein kinase            132   1e-29    
ref|XP_002980098.1|  hypothetical protein SELMODRAFT_30384              132   1e-29    
gb|EEE57372.1|  hypothetical protein OsJ_07527                          132   1e-29    
ref|XP_009409684.1|  PREDICTED: putative receptor-like protein ki...    132   1e-29    
ref|XP_006365571.1|  PREDICTED: LRR receptor-like serine/threonin...    132   1e-29    
ref|XP_009595503.1|  PREDICTED: LRR receptor-like serine/threonin...    132   1e-29    
ref|XP_003617047.1|  Receptor-like protein kinase                       132   2e-29    
ref|NP_180206.1|  leucine-rich repeat-containing protein                128   2e-29    
ref|XP_010999778.1|  PREDICTED: probable LRR receptor-like serine...    131   2e-29    
ref|XP_006481406.1|  PREDICTED: putative receptor-like protein ki...    131   2e-29    
ref|XP_004293509.1|  PREDICTED: LRR receptor-like serine/threonin...    131   2e-29    
ref|XP_002978660.1|  hypothetical protein SELMODRAFT_109190             130   2e-29    
ref|XP_010540887.1|  PREDICTED: receptor-like protein kinase 5          131   2e-29    
emb|CDP01924.1|  unnamed protein product                                131   3e-29    
ref|XP_002992683.1|  hypothetical protein SELMODRAFT_40400              130   4e-29    
gb|AHY03429.1|  lrr protein                                             126   5e-29    
ref|XP_010243324.1|  PREDICTED: probable LRR receptor-like serine...    130   5e-29    
ref|XP_009801818.1|  PREDICTED: LRR receptor-like serine/threonin...    130   5e-29    
gb|KJB31630.1|  hypothetical protein B456_005G199100                    130   5e-29    
ref|XP_007148699.1|  hypothetical protein PHAVU_005G007100g             127   6e-29    
ref|XP_004491002.1|  PREDICTED: probably inactive leucine-rich re...    129   6e-29    
ref|XP_007158959.1|  hypothetical protein PHAVU_002G196200g             130   6e-29    
ref|XP_010518789.1|  PREDICTED: LRR receptor-like serine/threonin...    129   7e-29    
ref|XP_006377415.1|  hypothetical protein POPTR_0011s05710g             129   8e-29    
ref|XP_009336724.1|  PREDICTED: probable LRR receptor-like serine...    130   8e-29    
ref|XP_012085656.1|  PREDICTED: probable inactive leucine-rich re...    129   8e-29    
ref|XP_010414844.1|  PREDICTED: receptor-like protein kinase HSL1...    129   8e-29    
ref|XP_002982402.1|  hypothetical protein SELMODRAFT_116152             130   8e-29    
ref|XP_010414842.1|  PREDICTED: receptor-like protein kinase HSL1...    129   8e-29    
ref|XP_010547578.1|  PREDICTED: LRR receptor-like serine/threonin...    129   8e-29    
ref|NP_001048834.1|  Os03g0127700                                       129   9e-29    
ref|XP_007136059.1|  hypothetical protein PHAVU_009G014500g             129   1e-28    
ref|XP_010919178.1|  PREDICTED: probable LRR receptor-like serine...    129   1e-28    
gb|EEE57058.1|  hypothetical protein OsJ_06864                          129   1e-28    
ref|XP_002309766.2|  hypothetical protein POPTR_0007s01340g             129   1e-28    
gb|EMT28034.1|  Putative LRR receptor-like serine/threonine-prote...    129   1e-28    
ref|XP_004238615.2|  PREDICTED: probable LRR receptor-like serine...    129   1e-28    
ref|XP_009620321.1|  PREDICTED: probable LRR receptor-like serine...    129   1e-28    
emb|CBI19800.3|  unnamed protein product                                129   1e-28    
ref|XP_008377233.1|  PREDICTED: probable LRR receptor-like serine...    129   1e-28    
ref|XP_011004857.1|  PREDICTED: probable leucine-rich repeat rece...    126   1e-28    
ref|XP_009415416.1|  PREDICTED: probably inactive leucine-rich re...    129   1e-28    
gb|EMT16678.1|  LRR receptor-like serine/threonine-protein kinase...    129   1e-28    
ref|XP_008387983.1|  PREDICTED: probable LRR receptor-like serine...    129   1e-28    
gb|KCW85317.1|  hypothetical protein EUGRSUZ_B02157                     129   2e-28    
dbj|BAD23652.1|  putative leucine rich repeat containing protein ...    129   2e-28    
gb|EAY88364.1|  hypothetical protein OsI_09819                          128   2e-28    
ref|XP_009337701.1|  PREDICTED: probable LRR receptor-like serine...    129   2e-28    
ref|XP_004957750.1|  PREDICTED: LRR receptor-like serine/threonin...    129   2e-28    
ref|XP_002990527.1|  hypothetical protein SELMODRAFT_131809             120   2e-28    
ref|XP_006425530.1|  hypothetical protein CICLE_v10027574mg             128   2e-28    
ref|XP_010441796.1|  PREDICTED: putative receptor-like protein ki...    128   2e-28    
ref|XP_009104866.1|  PREDICTED: receptor-like protein kinase HSL1       128   2e-28    
ref|XP_006466917.1|  PREDICTED: probable LRR receptor-like serine...    128   2e-28    
ref|XP_009767344.1|  PREDICTED: probable LRR receptor-like serine...    128   3e-28    
ref|XP_006342011.1|  PREDICTED: probable LRR receptor-like serine...    128   3e-28    
ref|XP_009409686.1|  PREDICTED: putative receptor-like protein ki...    129   3e-28    
ref|XP_002305776.1|  leucine-rich repeat receptor-like protein ki...    128   3e-28    
ref|XP_008783789.1|  PREDICTED: probable inactive leucine-rich re...    127   3e-28    
ref|XP_002880782.1|  hypothetical protein ARALYDRAFT_901383             125   3e-28    
ref|XP_002966565.1|  hypothetical protein SELMODRAFT_407578             128   3e-28    
emb|CDY50444.1|  BnaC06g24200D                                          127   4e-28    
ref|XP_010052092.1|  PREDICTED: LRR receptor-like serine/threonin...    127   4e-28    
ref|XP_004493833.1|  PREDICTED: leucine-rich repeat receptor-like...    127   4e-28    
ref|XP_002305057.2|  hypothetical protein POPTR_0004s05880g             127   4e-28    
ref|XP_009400129.1|  PREDICTED: probable LRR receptor-like serine...    127   4e-28    
ref|XP_008780314.1|  PREDICTED: probable LRR receptor-like serine...    127   4e-28    
ref|XP_009421476.1|  PREDICTED: receptor-like protein kinase HSL1       127   4e-28    
ref|XP_007046741.1|  Leucine-rich receptor-like protein kinase fa...    127   5e-28    
emb|CDP16274.1|  unnamed protein product                                127   5e-28    
ref|XP_010664968.1|  PREDICTED: probable LRR receptor-like serine...    127   5e-28    
ref|XP_007204673.1|  hypothetical protein PRUPE_ppa000484mg             127   5e-28    
ref|XP_010428087.1|  PREDICTED: receptor-like protein kinase HSL1       127   6e-28    
ref|XP_002311912.2|  leucine-rich repeat transmembrane protein ki...    127   6e-28    
gb|KEH39683.1|  LRR receptor-like kinase family protein                 127   6e-28    
ref|XP_006365570.1|  PREDICTED: LRR receptor-like serine/threonin...    127   6e-28    
ref|XP_011628427.1|  PREDICTED: probable LRR receptor-like serine...    127   6e-28    
ref|XP_007134648.1|  hypothetical protein PHAVU_010G064900g             126   6e-28    
ref|XP_011033024.1|  PREDICTED: receptor-like protein kinase isof...    127   7e-28    
gb|KJB59771.1|  hypothetical protein B456_009G271000                    127   7e-28    
ref|XP_010245658.1|  PREDICTED: probable leucine-rich repeat rece...    127   7e-28    
ref|XP_010113380.1|  putative LRR receptor-like serine/threonine-...    127   7e-28    
ref|XP_011033023.1|  PREDICTED: receptor-like protein kinase isof...    127   8e-28    
ref|WP_040586508.1|  hypothetical protein                               120   8e-28    
ref|XP_007225421.1|  hypothetical protein PRUPE_ppa000498mg             126   8e-28    
ref|WP_045480302.1|  hypothetical protein                               120   9e-28    
ref|XP_002994468.1|  hypothetical protein SELMODRAFT_432388             121   9e-28    
gb|KDO45821.1|  hypothetical protein CISIN_1g002063mg                   126   9e-28    
emb|CDP20424.1|  unnamed protein product                                125   9e-28    
gb|KDO45819.1|  hypothetical protein CISIN_1g002063mg                   126   9e-28    
ref|XP_004500957.1|  PREDICTED: probable LRR receptor-like serine...    126   9e-28    
ref|XP_011001223.1|  PREDICTED: receptor-like protein kinase HSL1       126   9e-28    
ref|XP_010261079.1|  PREDICTED: probable LRR receptor-like serine...    126   9e-28    
ref|XP_010227269.1|  PREDICTED: LRR receptor-like serine/threonin...    126   9e-28    
ref|XP_002984565.1|  hypothetical protein SELMODRAFT_234577             126   1e-27    
ref|XP_006382632.1|  hypothetical protein POPTR_0005s03970g             126   1e-27    
ref|XP_009804960.1|  PREDICTED: probable LRR receptor-like serine...    126   1e-27    
gb|ERN19496.1|  hypothetical protein AMTR_s00069p00201070               125   1e-27    
ref|XP_009780300.1|  PREDICTED: receptor-like protein kinase HAIKU2     126   1e-27    
gb|EEE69278.1|  hypothetical protein OsJ_28546                          126   1e-27    
ref|NP_177694.1|  putative leucine-rich receptor-like protein kinase    126   1e-27    
ref|XP_002280668.1|  PREDICTED: probable LRR receptor-like serine...    126   1e-27    
ref|XP_008390700.1|  PREDICTED: leucine-rich repeat receptor-like...    126   1e-27    
ref|XP_004293192.1|  PREDICTED: probable LRR receptor-like serine...    126   1e-27    
ref|XP_008390699.1|  PREDICTED: leucine-rich repeat receptor-like...    126   1e-27    
ref|XP_006478192.1|  PREDICTED: receptor-like protein kinase HAIK...    125   1e-27    
ref|XP_010262890.1|  PREDICTED: probable inactive leucine-rich re...    120   1e-27    
ref|XP_002517850.1|  Receptor protein kinase CLAVATA1 precursor, ...    125   1e-27    
gb|EMT31747.1|  LRR receptor-like serine/threonine-protein kinase...    125   1e-27    
ref|XP_011027770.1|  PREDICTED: receptor-like protein kinase HSL1       125   1e-27    
ref|XP_007217616.1|  hypothetical protein PRUPE_ppa016276mg             125   1e-27    
ref|XP_008795782.1|  PREDICTED: LRR receptor-like serine/threonin...    126   2e-27    
ref|XP_009394620.1|  PREDICTED: leucine-rich repeat receptor-like...    125   2e-27    
gb|KJB11031.1|  hypothetical protein B456_001G237400                    125   2e-27    
ref|XP_010264019.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    125   2e-27    
emb|CBI29426.3|  unnamed protein product                                124   2e-27    
ref|XP_011096686.1|  PREDICTED: receptor-like protein kinase HAIKU2     125   2e-27    
ref|XP_007020166.1|  Leucine-rich receptor-like protein kinase fa...    125   2e-27    
ref|XP_010471238.1|  PREDICTED: receptor-like protein kinase HSL1       125   2e-27    
ref|XP_002268598.2|  PREDICTED: leucine-rich repeat receptor-like...    125   2e-27    
ref|XP_010681334.1|  PREDICTED: DNA-damage-repair/toleration prot...    124   2e-27    
ref|XP_004502737.1|  PREDICTED: probable LRR receptor-like serine...    125   2e-27    
dbj|BAJ92367.1|  predicted protein                                      125   2e-27    
ref|XP_007020168.1|  Leucine-rich receptor-like protein kinase fa...    125   2e-27    
ref|XP_002452447.1|  hypothetical protein SORBIDRAFT_04g026010          125   2e-27    
gb|EMT02279.1|  Putative LRR receptor-like serine/threonine-prote...    125   2e-27    
ref|XP_007020167.1|  Leucine-rich receptor-like protein kinase fa...    125   2e-27    
gb|KJB43373.1|  hypothetical protein B456_007G196700                    125   2e-27    
ref|XP_002521777.1|  Receptor protein kinase CLAVATA1 precursor, ...    125   2e-27    
ref|XP_009394202.1|  PREDICTED: receptor-like protein kinase HSL1       125   2e-27    
ref|XP_009773345.1|  PREDICTED: receptor-like protein 12                122   2e-27    
ref|XP_002272319.3|  PREDICTED: LRR receptor-like serine/threonin...    125   2e-27    
ref|XP_004292244.2|  PREDICTED: leucine-rich repeat receptor-like...    125   2e-27    
ref|XP_010414755.1|  PREDICTED: receptor-like protein 12                122   2e-27    
ref|XP_002510975.1|  Receptor protein kinase CLAVATA1 precursor, ...    125   2e-27    
ref|XP_004978818.1|  PREDICTED: LRR receptor-like serine/threonin...    125   2e-27    
ref|XP_010428589.1|  PREDICTED: probable LRR receptor-like serine...    125   2e-27    
ref|XP_006441549.1|  hypothetical protein CICLE_v10018710mg             125   2e-27    
emb|CAN78669.1|  hypothetical protein VITISV_031289                     125   2e-27    
ref|XP_008455491.1|  PREDICTED: receptor-like protein kinase HSL1       125   2e-27    
gb|AET00007.2|  LRR receptor-like kinase                                125   2e-27    
ref|XP_002532618.1|  serine-threonine protein kinase, plant-type,...    121   2e-27    
ref|XP_007017699.1|  Leucine-rich receptor-like protein kinase fa...    125   2e-27    
gb|KEH28332.1|  LRR receptor-like kinase                                125   2e-27    
gb|KHG02848.1|  LRR receptor-like serine/threonine-protein kinase...    125   3e-27    
ref|XP_004978819.1|  PREDICTED: LRR receptor-like serine/threonin...    125   3e-27    
dbj|BAK00073.1|  predicted protein                                      122   3e-27    
ref|WP_027271448.1|  hypothetical protein                               119   3e-27    
ref|XP_003617048.1|  Receptor protein kinase-like protein               125   3e-27    
ref|XP_009149171.1|  PREDICTED: leucine-rich repeat receptor-like...    125   3e-27    
dbj|BAJ84911.1|  predicted protein                                      125   3e-27    
ref|XP_009149170.1|  PREDICTED: leucine-rich repeat receptor-like...    125   3e-27    
tpg|DAA62772.1|  TPA: putative leucine-rich repeat receptor-like ...    125   3e-27    
ref|XP_011466035.1|  PREDICTED: probable leucine-rich repeat rece...    125   3e-27    
ref|XP_009123618.1|  PREDICTED: putative receptor-like protein ki...    124   3e-27    
ref|XP_002891052.1|  hypothetical protein ARALYDRAFT_890947             121   3e-27    
ref|XP_006663115.1|  PREDICTED: probable LRR receptor-like serine...    124   4e-27    
ref|XP_009628481.1|  PREDICTED: receptor-like protein kinase HAIKU2     124   4e-27    
ref|XP_003617046.1|  Receptor protein kinase-like protein               124   4e-27    
ref|XP_010933925.1|  PREDICTED: probable LRR receptor-like serine...    124   4e-27    
ref|XP_007157942.1|  hypothetical protein PHAVU_002G111100g             124   4e-27    
ref|XP_003532650.1|  PREDICTED: LRR receptor-like serine/threonin...    124   4e-27    
emb|CBI21827.3|  unnamed protein product                                124   4e-27    
gb|KDO35965.1|  hypothetical protein CISIN_1g041953mg                   119   4e-27    
ref|XP_006465521.1|  PREDICTED: leucine-rich repeat receptor-like...    120   4e-27    
ref|XP_003516395.1|  PREDICTED: probable inactive leucine-rich re...    123   4e-27    
ref|XP_012076921.1|  PREDICTED: probable LRR receptor-like serine...    121   4e-27    
ref|XP_004288299.1|  PREDICTED: leucine-rich repeat receptor-like...    124   4e-27    
ref|XP_007025532.1|  HAESA-like 1 isoform 1                             124   5e-27    
ref|XP_002887421.1|  hypothetical protein ARALYDRAFT_476351             124   5e-27    
ref|XP_011658684.1|  PREDICTED: receptor-like protein kinase HSL1       124   5e-27    
ref|XP_007025533.1|  HAESA-like 1 isoform 2                             124   5e-27    
gb|KFK45089.1|  hypothetical protein AALP_AA1G342400                    121   5e-27    
ref|XP_010534090.1|  PREDICTED: receptor-like protein kinase HSL1       124   6e-27    
ref|XP_002512766.1|  Leucine-rich repeat receptor protein kinase ...    122   6e-27    
gb|KHN28978.1|  LRR receptor-like serine/threonine-protein kinase...    124   6e-27    
gb|KJB60054.1|  hypothetical protein B456_009G287800                    124   6e-27    
ref|XP_004499669.1|  PREDICTED: probable leucine-rich repeat rece...    121   6e-27    
emb|CAN65669.1|  hypothetical protein VITISV_002859                     124   6e-27    
ref|XP_003551621.1|  PREDICTED: probable LRR receptor-like serine...    124   6e-27    
ref|XP_006412020.1|  hypothetical protein EUTSA_v10024296mg             124   7e-27    
ref|XP_002891051.1|  predicted protein                                  123   7e-27    
emb|CBI37259.3|  unnamed protein product                                123   8e-27    
ref|XP_010647590.1|  PREDICTED: probable LRR receptor-like serine...    119   8e-27    
ref|XP_008456679.1|  PREDICTED: receptor-like protein kinase HAIKU2     123   8e-27    
ref|XP_007131311.1|  hypothetical protein PHAVU_011G003200g             123   8e-27    
ref|XP_003579254.1|  PREDICTED: probable LRR receptor-like serine...    123   8e-27    
ref|XP_009114790.1|  PREDICTED: leucine-rich repeat receptor-like...    120   8e-27    
ref|XP_004233092.1|  PREDICTED: LRR receptor-like serine/threonin...    124   8e-27    
ref|XP_002509423.1|  protein with unknown function                      123   9e-27    
ref|XP_010542683.1|  PREDICTED: probable leucine-rich repeat rece...    120   9e-27    
gb|KDP44797.1|  hypothetical protein JCGZ_01297                         124   9e-27    
ref|XP_010446816.1|  PREDICTED: probable LRR receptor-like serine...    123   9e-27    
gb|EPS68268.1|  hypothetical protein M569_06502                         123   9e-27    
ref|XP_009587870.1|  PREDICTED: probable LRR receptor-like serine...    123   9e-27    
ref|XP_006480347.1|  PREDICTED: probable LRR receptor-like serine...    123   9e-27    
ref|XP_004308965.1|  PREDICTED: probable leucine-rich repeat rece...    122   9e-27    
gb|EMT06260.1|  Putative LRR receptor-like serine/threonine-prote...    123   1e-26    
ref|XP_006480349.1|  PREDICTED: probable LRR receptor-like serine...    123   1e-26    
gb|KDO48827.1|  hypothetical protein CISIN_1g044860mg                   118   1e-26    
ref|XP_010063641.1|  PREDICTED: receptor-like protein kinase            123   1e-26    
ref|XP_010230325.1|  PREDICTED: putative receptor-like protein ki...    123   1e-26    
ref|XP_008649415.1|  PREDICTED: LRR receptor-like serine/threonin...    123   1e-26    
ref|XP_008808464.1|  PREDICTED: leucine-rich repeat receptor-like...    123   1e-26    
ref|XP_006305835.1|  hypothetical protein CARUB_v10010875mg             120   1e-26    
ref|XP_006480348.1|  PREDICTED: probable LRR receptor-like serine...    123   1e-26    
ref|XP_006480343.1|  PREDICTED: probable LRR receptor-like serine...    123   1e-26    
ref|XP_006480345.1|  PREDICTED: probable LRR receptor-like serine...    123   1e-26    
ref|XP_010250769.1|  PREDICTED: probable inactive leucine-rich re...    122   1e-26    
gb|EEE51301.1|  hypothetical protein OsJ_32252                          122   1e-26    
ref|NP_001176249.1|  Os10g0531700                                       122   1e-26    
ref|XP_004140933.1|  PREDICTED: receptor-like protein kinase HAIKU2     123   1e-26    
ref|XP_001774832.1|  CLL3 clavata1-like receptor S/T protein kina...    123   1e-26    



>ref|XP_011073820.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=1009

 Score =   354 bits (909),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 184/272 (68%), Positives = 218/272 (80%), Gaps = 0/272 (0%)
 Frame = +3

Query  330   SGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEV  509
             +G  G E+LQLNDDVLGLIV KSG QDP   L +W+EDD+SPCAW F+KC+P N RVSEV
Sbjct  22    TGCFGGETLQLNDDVLGLIVLKSGFQDPFKSLDSWNEDDESPCAWKFIKCNPGNNRVSEV  81

Query  510   DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP  689
              L GLGLSGKIGRGLEKL+ L VLSL+SNN +G I P+L L+ NL+ LNLSKNS+SG VP
Sbjct  82    SLDGLGLSGKIGRGLEKLQSLKVLSLSSNNLTGSIIPELALIPNLERLNLSKNSLSGNVP  141

Query  690   DSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNH  869
              SL ++SSLQFLDLS NSLSGP+ D M +N  SLR+LS AG+  EGPIPS+L +CT LNH
Sbjct  142   SSLSDVSSLQFLDLSQNSLSGPLPDDMFQNCFSLRYLSFAGNRLEGPIPSTLPRCTTLNH  201

Query  870   LNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSG  1049
             LNLS+N FSG+P FSGGIW LTRLRTLD+SNN L+G +P+G + +HNLKEL L  N FSG
Sbjct  202   LNLSSNHFSGNPNFSGGIWSLTRLRTLDLSNNLLTGPVPVGMAVMHNLKELILHGNQFSG  261

Query  1050  EIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              +P D+GLCPHLSRLD S NL  G +P+SLQR
Sbjct  262   ALPADVGLCPHLSRLDFSNNLLIGPVPQSLQR  293


 Score = 96.3 bits (238),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 75/215 (35%), Positives = 123/215 (57%), Gaps = 5/215 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             + E+ LHG   SG +   +    HL+ L  ++N   G +   L  L  L+ L+L+ N ++
Sbjct  249   LKELILHGNQFSGALPADVGLCPHLSRLDFSNNLLIGPVPQSLQRLNALKFLSLANNFLT  308

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G  P  +G MSSL++LD S N L+G +  SM  +L SL+FLSL+ +   G IP+++++ +
Sbjct  309   GDFPQWIGQMSSLEYLDFSNNGLTGSLPTSM-GDLKSLKFLSLSNNKLSGSIPTTIAEIS  367

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFL-HNLKELSLGS  1034
              L+ + L  N F+G      G++ + +L  +D+S NEL+GS+P  +S L   L+ L L  
Sbjct  368   SLSLVRLRGNTFNGS--IPEGLFDM-KLDEVDLSRNELTGSIPPASSKLSETLQILDLSG  424

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             N+ +G+IP ++GL   L  L+LS N     +P  L
Sbjct  425   NNITGDIPAEMGLFSRLRYLNLSWNNLESRMPPEL  459


 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 112/208 (54%), Gaps = 9/208 (4%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGV--ISPqlglltnlqtlnlSKNSISGTVPDSLG  701
             L G I   L +   LN L+L+SN+FSG    S  +  LT L+TL+LS N ++G VP  + 
Sbjct  185   LEGPIPSTLPRCTTLNHLNLSSNHFSGNPNFSGGIWSLTRLRTLDLSNNLLTGPVPVGMA  244

Query  702   NMSSLQFLDLSGNSLSG--PVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLN  875
              M +L+ L L GN  SG  P    +  +L  L F   + +   GP+P SL +   L  L+
Sbjct  245   VMHNLKELILHGNQFSGALPADVGLCPHLSRLDF---SNNLLIGPVPQSLQRLNALKFLS  301

Query  876   LSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEI  1055
             L+NN  +GD  F   I  ++ L  LD SNN L+GSLP     L +LK LSL +N  SG I
Sbjct  302   LANNFLTGD--FPQWIGQMSSLEYLDFSNNGLTGSLPTSMGDLKSLKFLSLSNNKLSGSI  359

Query  1056  PVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             P  +     LS + L  N F G+IPE L
Sbjct  360   PTTIAEISSLSLVRLRGNTFNGSIPEGL  387


 Score = 78.2 bits (191),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 80/262 (31%), Positives = 123/262 (47%), Gaps = 51/262 (19%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +S +D     L G + + L++L  L  LSLA+N  +G     +G +++L+ L+ S N ++
Sbjct  273   LSRLDFSNNLLIGPVPQSLQRLNALKFLSLANNFLTGDFPQWIGQMSSLEYLDFSNNGLT  332

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G++P S+G++ SL+FL LS N LSG +  ++ E + SL  + L G++F G IP  L    
Sbjct  333   GSLPTSMGDLKSLKFLSLSNNKLSGSIPTTIAE-ISSLSLVRLRGNTFNGSIPEGLFDMK  391

Query  858   L------------------------LNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNN  965
             L                        L  L+LS N  +GD     G++  +RLR L++S N
Sbjct  392   LDEVDLSRNELTGSIPPASSKLSETLQILDLSGNNITGDIPAEMGLF--SRLRYLNLSWN  449

Query  966   ELSGSLPIGASFLHNLKELSLGS------------------------NHFSGEIPVDLGL  1073
              L   +P    F  NL  L L S                        N  +G +P ++G 
Sbjct  450   NLESRMPPELGFFQNLTVLDLRSSGLIGSIPGDICDSGSLAILQLDGNSLTGPVPEEIGN  509

Query  1074  CPHLSRLDLSENLFTGTIPESL  1139
             C  L  L LS N  +G IPES+
Sbjct  510   CSSLYLLSLSHNNLSGPIPESM  531


 Score = 59.3 bits (142),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 72/213 (34%), Positives = 103/213 (48%), Gaps = 28/213 (13%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  671
             ++ EVDL    L+G I     KL E L +L L+ NN +G I  ++GL + L+ LNLS N+
Sbjct  391   KLDEVDLSRNELTGSIPPASSKLSETLQILDLSGNNITGDIPAEMGLFSRLRYLNLSWNN  450

Query  672   ISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSK  851
             +   +P  LG   +L  LDL  + L G +   + ++ GSL  L L G+S  GP+P  +  
Sbjct  451   LESRMPPELGFFQNLTVLDLRSSGLIGSIPGDICDS-GSLAILQLDGNSLTGPVPEEIGN  509

Query  852   CTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLG  1031
             C+                           L  L +S+N LSG +P   S L  LK L L 
Sbjct  510   CS--------------------------SLYLLSLSHNNLSGPIPESMSLLSKLKILKLE  543

Query  1032  SNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
              N  SGEIP +LG   +L   ++S N   G +P
Sbjct  544   VNQLSGEIPQELGRLENLLIANISYNRLVGRLP  576



>ref|XP_006364689.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=1011

 Score =   350 bits (897),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 183/266 (69%), Positives = 219/266 (82%), Gaps = 1/266 (0%)
 Frame = +3

Query  351   SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
             ++QLNDDVLGLIVFKS + DP S L +WSEDD+SPCAW ++KC+P NGRV+E++L+GL L
Sbjct  27    TMQLNDDVLGLIVFKSALLDPYSKLLSWSEDDNSPCAWEYIKCNPMNGRVTELNLNGLSL  86

Query  531   SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  710
             SGKIGRGLEKL+ L VLSL++NNF+G ISP+L LLTNL+ LN S N +SG +P S  NM+
Sbjct  87    SGKIGRGLEKLQSLKVLSLSNNNFTGAISPELALLTNLENLNFSHNGLSGNIPGSFSNMT  146

Query  711   SLQFLDLSGNSLSGPVSDSMLENLG-SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
             SLQFLDLS N+LSGPVSD+M +N G SLR+LSL+G+  EG  P ++SKCT LNHLNLS N
Sbjct  147   SLQFLDLSENALSGPVSDTMFDNCGDSLRYLSLSGNFLEGSFPKTVSKCTSLNHLNLSRN  206

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDL  1067
              FSGDP FSGGIWGLTRLRTLD+S+NELSG +PIG S LH LKE  L  NHFSG++P D+
Sbjct  207   HFSGDPGFSGGIWGLTRLRTLDLSHNELSGLVPIGVSVLHQLKECLLQGNHFSGDLPADI  266

Query  1068  GLCPHLSRLDLSENLFTGTIPESLQR  1145
             G CPHL+RLDLS N FTG IP SLQR
Sbjct  267   GFCPHLNRLDLSNNQFTGQIPMSLQR  292


 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 83/216 (38%), Positives = 114/216 (53%), Gaps = 11/216 (5%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGV--ISPqlglltnlqtlnlSKNSISG  680
             + L G  L G   + + K   LN L+L+ N+FSG    S  +  LT L+TL+LS N +SG
Sbjct  177   LSLSGNFLEGSFPKTVSKCTSLNHLNLSRNHFSGDPGFSGGIWGLTRLRTLDLSHNELSG  236

Query  681   TVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLG---SLRFLSLAGSSFEGPIPSSLSK  851
              VP  +  +  L+   L GN  SG     +  ++G    L  L L+ + F G IP SL +
Sbjct  237   LVPIGVSVLHQLKECLLQGNHFSG----DLPADIGFCPHLNRLDLSNNQFTGQIPMSLQR  292

Query  852   CTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLG  1031
               +L+ L+LSNN  +GD  F   I  ++ L  LD+S N L G+LP     L  LK LSL 
Sbjct  293   VNVLSFLSLSNNMINGD--FPQWISNMSSLEYLDLSGNSLEGALPDSIGDLKMLKYLSLS  350

Query  1032  SNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              N  SG IP  +  C  LS + + EN  TG+IPE L
Sbjct  351   GNKLSGNIPKSMVYCTSLSTIRMKENALTGSIPEGL  386


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 110/211 (52%), Gaps = 3/211 (1%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL G  L G +   +  L+ L  LSL+ N  SG I   +   T+L T+ + +N+++G++
Sbjct  323   LDLSGNSLEGALPDSIGDLKMLKYLSLSGNKLSGNIPKSMVYCTSLSTIRMKENALTGSI  382

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P+ L  +  L+  D S N L+G +     +   SL+ L L+G++  G IP+ +   + L 
Sbjct  383   PEGLFGIG-LEEADFSRNELTGSIPPGSGKFFESLQVLDLSGNNLTGNIPAEVGLFSKLR  441

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
             +LNLS N F    R    +     L  LD+ ++ L GS+P       +L  L L  N F+
Sbjct  442   YLNLSWNNFQS--RLPPEVGYFQNLTVLDLRHSALVGSIPGDICDSGSLGILQLDGNSFT  499

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             G IP ++G C  L  L LS N  +G+IP SL
Sbjct  500   GPIPDEIGNCSSLYLLSLSHNNLSGSIPRSL  530


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 74/214 (35%), Positives = 104/214 (49%), Gaps = 28/214 (13%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + E D     L+G I  G  K  E L VL L+ NN +G I  ++GL + L+ LNLS N+ 
Sbjct  391   LEEADFSRNELTGSIPPGSGKFFESLQVLDLSGNNLTGNIPAEVGLFSKLRYLNLSWNNF  450

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
                +P  +G   +L  LDL  ++L G +   + ++ GSL  L L G+SF GPIP  +  C
Sbjct  451   QSRLPPEVGYFQNLTVLDLRHSALVGSIPGDICDS-GSLGILQLDGNSFTGPIPDEIGNC  509

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             +                           L  L +S+N LSGS+P   S L  LK L L  
Sbjct  510   S--------------------------SLYLLSLSHNNLSGSIPRSLSMLKKLKILKLEY  543

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPES  1136
             N  SGEIP +LG   +L  +++S N   G +P S
Sbjct  544   NQLSGEIPQELGKLENLLAVNISYNRLVGRLPMS  577



>emb|CDP14623.1| unnamed protein product [Coffea canephora]
Length=1020

 Score =   345 bits (885),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 179/268 (67%), Positives = 211/268 (79%), Gaps = 0/268 (0%)
 Frame = +3

Query  342   GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  521
               +SL LNDDVLGLIVFKS + DP SHL +WSEDD SPCAW FVKC+P NGRVSEV L G
Sbjct  35    AEDSLPLNDDVLGLIVFKSAIYDPFSHLESWSEDDSSPCAWEFVKCNPRNGRVSEVSLDG  94

Query  522   LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG  701
             LGLSGK+GRGLEKL+ L VLSL++NN +G ISP+  L+T L+ LNLS+N++ G +P S+ 
Sbjct  95    LGLSGKMGRGLEKLQDLKVLSLSNNNLTGSISPEFALITGLERLNLSQNNLRGNIPSSVA  154

Query  702   NMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLS  881
             NMSS+QFLDLS N LSGP+SD + EN  SLRF+SLAG+  EG  P++LS+CT LNH N+S
Sbjct  155   NMSSIQFLDLSENLLSGPISDDIFENCQSLRFISLAGNLLEGAFPTTLSRCTNLNHQNMS  214

Query  882   NNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             NN FSGDP F      LTRLRTLD+SNNELSG LP+G S +HNLKEL L  NHFSG IP 
Sbjct  215   NNHFSGDPNFKEMFQSLTRLRTLDLSNNELSGQLPLGISAMHNLKELLLQGNHFSGSIPT  274

Query  1062  DLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             D+G CPHLS +D S NLFTG +PESLQR
Sbjct  275   DIGFCPHLSTIDFSNNLFTGALPESLQR  302


 Score = 94.7 bits (234),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 114/214 (53%), Gaps = 3/214 (1%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +S +D      +G +   L++L  LN  SL++N   G     +  L++L+ L+ S N + 
Sbjct  282   LSTIDFSNNLFTGALPESLQRLNALNFFSLSNNVLDGDFPQWINKLSSLEYLDFSGNKLQ  341

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G++P S+G M++L+FLDLS N L+G +  SM    G L  + L+G++  G IP  L    
Sbjct  342   GSLPMSIGEMNALEFLDLSNNRLTGNIPTSMAL-CGGLSVIQLSGNALNGSIPEGLFDME  400

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSN  1037
             L + L+LS N  +G    SG       L  LD+S N L+G LP        L+ L+L  N
Sbjct  401   L-DELDLSRNELTGSIP-SGSSELFESLHVLDLSGNNLTGGLPAEMGLYSKLRYLNLSWN  458

Query  1038  HFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              F   +P ++G   +L+ LDL  +  TG+IPE +
Sbjct  459   SFQSRLPPEIGYYQNLTVLDLRNSALTGSIPEDI  492


 Score = 94.4 bits (233),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 79/247 (32%), Positives = 124/247 (50%), Gaps = 23/247 (9%)
 Frame = +3

Query  465   NFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnl  644
             NF +   +  R+  +DL    LSG++  G+  + +L  L L  N+FSG I   +G   +L
Sbjct  223   NFKEMFQSLTRLRTLDLSNNELSGQLPLGISAMHNLKELLLQGNHFSGSIPTDIGFCPHL  282

Query  645   qtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFE  824
              T++ S N  +G +P+SL  +++L F  LS N L G      +  L SL +L  +G+  +
Sbjct  283   STIDFSNNLFTGALPESLQRLNALNFFSLSNNVLDGDFP-QWINKLSSLEYLDFSGNKLQ  341

Query  825   GPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWG---------------------LTRL  941
             G +P S+ +   L  L+LSNNR +G+   S  + G                        L
Sbjct  342   GSLPMSIGEMNALEFLDLSNNRLTGNIPTSMALCGGLSVIQLSGNALNGSIPEGLFDMEL  401

Query  942   RTLDVSNNELSGSLPIGASFL-HNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFT  1118
               LD+S NEL+GS+P G+S L  +L  L L  N+ +G +P ++GL   L  L+LS N F 
Sbjct  402   DELDLSRNELTGSIPSGSSELFESLHVLDLSGNNLTGGLPAEMGLYSKLRYLNLSWNSFQ  461

Query  1119  GTIPESL  1139
               +P  +
Sbjct  462   SRLPPEI  468


 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 112/215 (52%), Gaps = 9/215 (4%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGV--ISPqlglltnlqtlnlSKNSISG  680
             + L G  L G     L +  +LN  ++++N+FSG          LT L+TL+LS N +SG
Sbjct  187   ISLAGNLLEGAFPTTLSRCTNLNHQNMSNNHFSGDPNFKEMFQSLTRLRTLDLSNNELSG  246

Query  681   TVPDSLGNMSSLQFLDLSGNSLSG--PVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
              +P  +  M +L+ L L GN  SG  P       +L ++ F   + + F G +P SL + 
Sbjct  247   QLPLGISAMHNLKELLLQGNHFSGSIPTDIGFCPHLSTIDF---SNNLFTGALPESLQRL  303

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
               LN  +LSNN   GD  F   I  L+ L  LD S N+L GSLP+    ++ L+ L L +
Sbjct  304   NALNFFSLSNNVLDGD--FPQWINKLSSLEYLDFSGNKLQGSLPMSIGEMNALEFLDLSN  361

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             N  +G IP  + LC  LS + LS N   G+IPE L
Sbjct  362   NRLTGNIPTSMALCGGLSVIQLSGNALNGSIPEGL  396


 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 108/211 (51%), Gaps = 3/211 (1%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +D  G  L G +   + ++  L  L L++N  +G I   + L   L  + LS N+++G++
Sbjct  333   LDFSGNKLQGSLPMSIGEMNALEFLDLSNNRLTGNIPTSMALCGGLSVIQLSGNALNGSI  392

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P+ L +M  L  LDLS N L+G +     E   SL  L L+G++  G +P+ +   + L 
Sbjct  393   PEGLFDME-LDELDLSRNELTGSIPSGSSELFESLHVLDLSGNNLTGGLPAEMGLYSKLR  451

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
             +LNLS N F    R    I     L  LD+ N+ L+GS+P       +++ L L  N  +
Sbjct  452   YLNLSWNSFQS--RLPPEIGYYQNLTVLDLRNSALTGSIPEDICDSGSIRILQLDENSLT  509

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             G IP ++G C  L  L LS N  TG IP S+
Sbjct  510   GPIPNEIGNCSSLFLLSLSHNSLTGPIPPSV  540



>ref|XP_009765958.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=1012

 Score =   345 bits (884),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 181/272 (67%), Positives = 226/272 (83%), Gaps = 1/272 (0%)
 Frame = +3

Query  333   GAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  512
             G+   E+LQLNDDVLGLIVFKS + DP S L +W+EDD+SPCAW F+KC+P NGRVSE++
Sbjct  24    GSLAGETLQLNDDVLGLIVFKSTLLDPNSKLLSWNEDDNSPCAWEFIKCNPMNGRVSELN  83

Query  513   LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  692
             L+GL LSGKIGRGLEKL+ L VLSL++NNF+G ISP+L LLTNL+ LNLS+N ++G +P 
Sbjct  84    LNGLSLSGKIGRGLEKLQSLQVLSLSNNNFTGPISPELALLTNLENLNLSQNGLTGNIPP  143

Query  693   SLGNMSSLQFLDLSGNSLSGPVSDSMLENLG-SLRFLSLAGSSFEGPIPSSLSKCTLLNH  869
             S+  ++SLQFLDLS NSLSGPVSD+M +N G SLR+LSL+G+  EG  P+++SKC  LNH
Sbjct  144   SISKITSLQFLDLSQNSLSGPVSDTMFDNCGNSLRYLSLSGNFLEGAFPTTVSKCNNLNH  203

Query  870   LNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSG  1049
             LN+S N  SGDP FSGG+WGLTRLRTLD+S+NELSG +P+G S LH LKEL L  N FSG
Sbjct  204   LNVSRNHLSGDPGFSGGLWGLTRLRTLDLSHNELSGLVPVGISVLHQLKELLLQGNQFSG  263

Query  1050  EIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             ++P D+G CPHL++LDLSENLFTG IPES+Q+
Sbjct  264   KLPSDIGYCPHLNKLDLSENLFTGAIPESVQK  295


 Score =   118 bits (296),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 122/213 (57%), Gaps = 5/213 (2%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             ++ E+ L G   SGK+   +    HLN L L+ N F+G I   +  L  L  L+LS N I
Sbjct  250   QLKELLLQGNQFSGKLPSDIGYCPHLNKLDLSENLFTGAIPESVQKLNALSFLSLSNNMI  309

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
             +G  P  + NMSSL++LD SGNS+ G + DS + +L  L++LSL+G+   G IP S+  C
Sbjct  310   NGDFPQWISNMSSLEYLDFSGNSIEGTLPDS-IGDLKMLKYLSLSGNKLSGKIPKSMVYC  368

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGA-SFLHNLKELSLG  1031
             T L+ + L  N  +G      G++G+  L   D S NELSGS+P G+  F  +L+ L L 
Sbjct  369   TSLSTIRLKENALTGS--IPEGLFGIG-LEEADFSRNELSGSIPPGSGKFFESLQVLDLS  425

Query  1032  SNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
              N+ +G IP ++GL   L  L+LS N F   +P
Sbjct  426   GNNLTGNIPAEVGLFSKLRYLNLSWNNFQSRLP  458


 Score = 89.4 bits (220),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 83/213 (39%), Positives = 112/213 (53%), Gaps = 5/213 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGV--ISPqlglltnlqtlnlSKNSISG  680
             + L G  L G     + K  +LN L+++ N+ SG    S  L  LT L+TL+LS N +SG
Sbjct  180   LSLSGNFLEGAFPTTVSKCNNLNHLNVSRNHLSGDPGFSGGLWGLTRLRTLDLSHNELSG  239

Query  681   TVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTL  860
              VP  +  +  L+ L L GN  SG +  S +     L  L L+ + F G IP S+ K   
Sbjct  240   LVPVGISVLHQLKELLLQGNQFSGKLP-SDIGYCPHLNKLDLSENLFTGAIPESVQKLNA  298

Query  861   LNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNH  1040
             L+ L+LSNN  +GD  F   I  ++ L  LD S N + G+LP     L  LK LSL  N 
Sbjct  299   LSFLSLSNNMINGD--FPQWISNMSSLEYLDFSGNSIEGTLPDSIGDLKMLKYLSLSGNK  356

Query  1041  FSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              SG+IP  +  C  LS + L EN  TG+IPE L
Sbjct  357   LSGKIPKSMVYCTSLSTIRLKENALTGSIPEGL  389


 Score = 77.8 bits (190),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 80/261 (31%), Positives = 123/261 (47%), Gaps = 49/261 (19%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             ++++DL     +G I   ++KL  L+ LSL++N  +G     +  +++L+ L+ S NSI 
Sbjct  275   LNKLDLSENLFTGAIPESVQKLNALSFLSLSNNMINGDFPQWISNMSSLEYLDFSGNSIE  334

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSML-----------EN---------------  779
             GT+PDS+G++  L++L LSGN LSG +  SM+           EN               
Sbjct  335   GTLPDSIGDLKMLKYLSLSGNKLSGKIPKSMVYCTSLSTIRLKENALTGSIPEGLFGIGL  394

Query  780   ---------------------LGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFS  896
                                    SL+ L L+G++  G IP+ +   + L +LNLS N F 
Sbjct  395   EEADFSRNELSGSIPPGSGKFFESLQVLDLSGNNLTGNIPAEVGLFSKLRYLNLSWNNFQ  454

Query  897   GDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLC  1076
                R    +     L  LD+  + L GS+P       +L  L L  N F+G IP ++G C
Sbjct  455   S--RLPPEVGYFQNLTVLDLRYSALVGSIPGDICDSGSLGILQLDGNSFTGPIPDEIGNC  512

Query  1077  PHLSRLDLSENLFTGTIPESL  1139
               L  L LS N  +G+IP SL
Sbjct  513   SSLYLLSLSHNNLSGSIPRSL  533


 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 103/212 (49%), Gaps = 28/212 (13%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + E D     LSG I  G  K  E L VL L+ NN +G I  ++GL + L+ LNLS N+ 
Sbjct  394   LEEADFSRNELSGSIPPGSGKFFESLQVLDLSGNNLTGNIPAEVGLFSKLRYLNLSWNNF  453

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
                +P  +G   +L  LDL  ++L G +   + ++ GSL  L L G+SF GPIP  +  C
Sbjct  454   QSRLPPEVGYFQNLTVLDLRYSALVGSIPGDICDS-GSLGILQLDGNSFTGPIPDEIGNC  512

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             +                           L  L +S+N LSGS+P   S L  LK L L  
Sbjct  513   S--------------------------SLYLLSLSHNNLSGSIPRSLSMLRKLKILKLEY  546

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             N  SGEIP DLG   +L  +++S N   G +P
Sbjct  547   NQLSGEIPQDLGKLENLLAVNISYNRLVGRLP  578



>ref|XP_009589223.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Nicotiana tomentosiformis]
Length=1012

 Score =   342 bits (878),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 181/272 (67%), Positives = 223/272 (82%), Gaps = 1/272 (0%)
 Frame = +3

Query  333   GAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  512
             G+   E+LQLNDDVLGLIVFKS + DP S L +W+EDD+SPCAW F+KC+P NGRVSE++
Sbjct  24    GSLADETLQLNDDVLGLIVFKSALLDPNSKLLSWNEDDNSPCAWEFIKCNPMNGRVSELN  83

Query  513   LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  692
             L+GL LSGKIGRGLEKL+ L VLSL++NNF+G ISP+LGLL NL+ LNLS+N +SG +P 
Sbjct  84    LNGLSLSGKIGRGLEKLQSLQVLSLSNNNFTGPISPELGLLINLENLNLSQNGLSGNIPA  143

Query  693   SLGNMSSLQFLDLSGNSLSGPVSDSMLENLG-SLRFLSLAGSSFEGPIPSSLSKCTLLNH  869
             S+  M+SLQFLDLS NSLSGPVSD++ +N G SLR+LSL+G+  EG  P+++SKC  LNH
Sbjct  144   SISKMTSLQFLDLSENSLSGPVSDTIFDNCGNSLRYLSLSGNFLEGAFPTTVSKCNNLNH  203

Query  870   LNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSG  1049
             LN+S N  SGDP FS G+WGLTRLRTLD+S+NELSG +P G S LH LKE  L  N FSG
Sbjct  204   LNVSRNHLSGDPGFSEGLWGLTRLRTLDLSHNELSGLVPNGVSLLHQLKEFLLQGNQFSG  263

Query  1050  EIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             E+P D+G CPHL++LDLSENLFTG IPES+Q+
Sbjct  264   ELPSDIGFCPHLNKLDLSENLFTGAIPESVQK  295


 Score =   113 bits (283),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 83/213 (39%), Positives = 119/213 (56%), Gaps = 5/213 (2%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             ++ E  L G   SG++   +    HLN L L+ N F+G I   +  L  L  L LS N I
Sbjct  250   QLKEFLLQGNQFSGELPSDIGFCPHLNKLDLSENLFTGAIPESVQKLNALSFLTLSNNMI  309

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
             +G  P  + NMSSL++LD SGNSL G + DS + +L  L++LSL+G+   G IP S+  C
Sbjct  310   NGDFPQWISNMSSLEYLDFSGNSLEGSLPDS-IGDLKMLKYLSLSGNKLSGNIPKSMVYC  368

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGA-SFLHNLKELSLG  1031
             T L+ + L  N  +G      G++G+  L   D S NELSGS+P G+     +L+ L L 
Sbjct  369   TSLSTIRLKENALTGS--IPEGLFGIG-LEEADFSRNELSGSIPPGSGKLFESLQVLDLS  425

Query  1032  SNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
              N+ +G IP ++GL   L  L+LS N F   +P
Sbjct  426   GNNLTGNIPAEVGLFSKLRYLNLSWNNFQSRLP  458


 Score = 89.4 bits (220),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 110/213 (52%), Gaps = 5/213 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGV--ISPqlglltnlqtlnlSKNSISG  680
             + L G  L G     + K  +LN L+++ N+ SG    S  L  LT L+TL+LS N +SG
Sbjct  180   LSLSGNFLEGAFPTTVSKCNNLNHLNVSRNHLSGDPGFSEGLWGLTRLRTLDLSHNELSG  239

Query  681   TVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTL  860
              VP+ +  +  L+   L GN  SG +  S +     L  L L+ + F G IP S+ K   
Sbjct  240   LVPNGVSLLHQLKEFLLQGNQFSGELP-SDIGFCPHLNKLDLSENLFTGAIPESVQKLNA  298

Query  861   LNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNH  1040
             L+ L LSNN  +GD  F   I  ++ L  LD S N L GSLP     L  LK LSL  N 
Sbjct  299   LSFLTLSNNMINGD--FPQWISNMSSLEYLDFSGNSLEGSLPDSIGDLKMLKYLSLSGNK  356

Query  1041  FSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              SG IP  +  C  LS + L EN  TG+IPE L
Sbjct  357   LSGNIPKSMVYCTSLSTIRLKENALTGSIPEGL  389


 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 74/212 (35%), Positives = 103/212 (49%), Gaps = 28/212 (13%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + E D     LSG I  G  KL E L VL L+ NN +G I  ++GL + L+ LNLS N+ 
Sbjct  394   LEEADFSRNELSGSIPPGSGKLFESLQVLDLSGNNLTGNIPAEVGLFSKLRYLNLSWNNF  453

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
                +P  +G   +L  LDL  ++L G +   + ++ GSL  L L G+S  GPIP  +  C
Sbjct  454   QSRLPPEVGYFQNLTVLDLRYSALVGSIPGDICDS-GSLGILQLDGNSLTGPIPDEIGNC  512

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             +                           L  L +S+N LSGS+P   S L  LK L L  
Sbjct  513   S--------------------------SLYLLSLSHNNLSGSIPRSLSMLRKLKILKLEY  546

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             N  SGEIP +LG   +L  +++S N   G +P
Sbjct  547   NQLSGEIPQELGKLENLLAVNISYNRLVGRLP  578



>ref|XP_004247993.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=1012

 Score =   341 bits (875),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 179/266 (67%), Positives = 216/266 (81%), Gaps = 1/266 (0%)
 Frame = +3

Query  351   SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
             ++QLNDDVLGLIVFKS + DP S L +WSEDD+SPCAW ++KC+P NGRV+E++L+GL L
Sbjct  27    TMQLNDDVLGLIVFKSALLDPYSKLLSWSEDDNSPCAWEYIKCNPMNGRVNELNLNGLSL  86

Query  531   SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  710
             SGKIGRGLEKL+ L VLSL++NNF+G ISP+L LLTNL+ LN S N +SG +P S   M+
Sbjct  87    SGKIGRGLEKLQSLKVLSLSNNNFTGAISPELALLTNLENLNFSHNGLSGNIPGSFSKMT  146

Query  711   SLQFLDLSGNSLSGPVSDSMLENLG-SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
             SLQFLDLS N+LSGPVSD+M +N   SLR+LSL+G+  EG  P ++SKCT LNHLNLS N
Sbjct  147   SLQFLDLSENALSGPVSDTMFDNCSDSLRYLSLSGNYLEGSFPKTVSKCTSLNHLNLSRN  206

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDL  1067
              FSGDP FS GIWGLTRLRTLD+S+NELSG +PIG S LH LKE  L  NHFSG++P D+
Sbjct  207   HFSGDPGFSEGIWGLTRLRTLDLSHNELSGLVPIGVSVLHQLKECLLQGNHFSGDLPADI  266

Query  1068  GLCPHLSRLDLSENLFTGTIPESLQR  1145
             G CPHL+RLDLS N FTG IP SLQ+
Sbjct  267   GYCPHLNRLDLSNNQFTGQIPMSLQK  292


 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 112/211 (53%), Gaps = 5/211 (2%)
 Frame = +3

Query  513   LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGV--ISPqlglltnlqtlnlSKNSISGTV  686
             L G  L G   + + K   LN L+L+ N+FSG    S  +  LT L+TL+LS N +SG V
Sbjct  179   LSGNYLEGSFPKTVSKCTSLNHLNLSRNHFSGDPGFSEGIWGLTRLRTLDLSHNELSGLV  238

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P  +  +  L+   L GN  SG +  + +     L  L L+ + F G IP SL K   L+
Sbjct  239   PIGVSVLHQLKECLLQGNHFSGDLP-ADIGYCPHLNRLDLSNNQFTGQIPMSLQKVNALS  297

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
              L+LSNN  +GD  F   I  ++ L  LD+S N L G+LP     L  LK LSL  N  S
Sbjct  298   FLSLSNNMINGD--FPQWISNMSSLEYLDLSGNSLEGALPDSIGDLKMLKYLSLSGNKLS  355

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             G IP  +  C  LS + + EN FTG+IPE L
Sbjct  356   GNIPKSMVYCTSLSTIRIKENAFTGSIPEGL  386


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 79/261 (30%), Positives = 124/261 (48%), Gaps = 49/261 (19%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             ++ +DL     +G+I   L+K+  L+ LSL++N  +G     +  +++L+ L+LS NS+ 
Sbjct  272   LNRLDLSNNQFTGQIPMSLQKVNALSFLSLSNNMINGDFPQWISNMSSLEYLDLSGNSLE  331

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSML-----------EN---------------  779
             G +PDS+G++  L++L LSGN LSG +  SM+           EN               
Sbjct  332   GALPDSIGDLKMLKYLSLSGNKLSGNIPKSMVYCTSLSTIRIKENAFTGSIPEGLFGIGL  391

Query  780   ---------------------LGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFS  896
                                    SL+ L L+G++  G IP+ +   + L +LNLS N F 
Sbjct  392   EEADFSRNELTGSIPPGSGKFFESLQVLDLSGNNLTGNIPAEVGLFSKLRYLNLSWNNFQ  451

Query  897   GDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLC  1076
                R    +     L  LD+ ++ L GS+P       +L  L L  N F+G IP ++G C
Sbjct  452   S--RLPPEVGYFQNLTVLDLRHSALVGSIPGDICDSGSLGILQLDGNSFTGPIPDEIGNC  509

Query  1077  PHLSRLDLSENLFTGTIPESL  1139
               L  L LS N  +G+IP SL
Sbjct  510   SSLYLLSLSHNNLSGSIPRSL  530


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 74/214 (35%), Positives = 104/214 (49%), Gaps = 28/214 (13%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + E D     L+G I  G  K  E L VL L+ NN +G I  ++GL + L+ LNLS N+ 
Sbjct  391   LEEADFSRNELTGSIPPGSGKFFESLQVLDLSGNNLTGNIPAEVGLFSKLRYLNLSWNNF  450

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
                +P  +G   +L  LDL  ++L G +   + ++ GSL  L L G+SF GPIP  +  C
Sbjct  451   QSRLPPEVGYFQNLTVLDLRHSALVGSIPGDICDS-GSLGILQLDGNSFTGPIPDEIGNC  509

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             +                           L  L +S+N LSGS+P   S L  LK L L  
Sbjct  510   S--------------------------SLYLLSLSHNNLSGSIPRSLSMLKKLKILKLEY  543

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPES  1136
             N  SGEIP +LG   +L  +++S N   G +P S
Sbjct  544   NQLSGEIPQELGKLENLLAVNISYNRLVGRLPMS  577



>ref|XP_002518223.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF44166.1| receptor protein kinase, putative [Ricinus communis]
Length=1007

 Score =   332 bits (852),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 172/264 (65%), Positives = 218/264 (83%), Gaps = 0/264 (0%)
 Frame = +3

Query  351   SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
             ++QLNDDVLGLIVFKS + DP+S L++WSEDDDSPC+W F++C+ ANGRVS V L GLGL
Sbjct  27    TIQLNDDVLGLIVFKSDLVDPSSTLSSWSEDDDSPCSWKFIECNSANGRVSHVSLDGLGL  86

Query  531   SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  710
             SGK+G+GL+KL+HL VLSL+ NNFSG ISP L L+ +L++LNLS NS+SG +P S  NM+
Sbjct  87    SGKLGKGLQKLQHLKVLSLSHNNFSGEISPDLPLIPSLESLNLSHNSLSGLIPSSFVNMT  146

Query  711   SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNR  890
             +++FLDLS NSLSGP+ D++ +N  SLR++SLAG+S +GP+PS+L++C+ LN LNLS+N 
Sbjct  147   TVRFLDLSENSLSGPLPDNLFQNCLSLRYISLAGNSLQGPLPSTLARCSSLNTLNLSSNH  206

Query  891   FSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLG  1070
             FSG+P F  GIW L RLRTLD+SNNE SGSLPIG S LHNLK+L L  N FSG +PVD G
Sbjct  207   FSGNPDFFSGIWSLKRLRTLDLSNNEFSGSLPIGVSSLHNLKDLQLQGNRFSGTLPVDTG  266

Query  1071  LCPHLSRLDLSENLFTGTIPESLQ  1142
             LC HL RLDLS NLFTG +P+SL+
Sbjct  267   LCTHLLRLDLSNNLFTGALPDSLK  290


 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 125/240 (52%), Gaps = 29/240 (12%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL     SG +  G+  L +L  L L  N FSG +    GL T+L  L+LS N  
Sbjct  222   RLRTLDLSNNEFSGSLPIGVSSLHNLKDLQLQGNRFSGTLPVDTGLCTHLLRLDLSNNLF  281

Query  675   SGTVPDSL------------------------GNMSSLQFLDLSGNSLSGPVSDSMLENL  782
             +G +PDSL                        GN+ +L++LD S N L+G +  S + +L
Sbjct  282   TGALPDSLKWLGSLTFISLSNNMFTDDFPQWIGNIRNLEYLDFSSNLLTGSLPSS-ISDL  340

Query  783   GSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSN  962
              SL F++L+ + F G IP+S+ + + L+ + L  N F G      G++ L  L  +D S+
Sbjct  341   KSLYFINLSNNKFTGQIPTSMVQFSKLSVIRLRGNSFIG--TIPEGLFNLG-LEEVDFSD  397

Query  963   NELSGSLPIGAS-FLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             N+L GS+P G+S F  +L+ L L  N+ +G I  ++GL  +L  L+LS N     +P+ L
Sbjct  398   NKLIGSIPAGSSKFYGSLQILDLSRNNLTGNIRAEMGLSSNLRYLNLSWNNLQSRMPQEL  457


 Score = 77.8 bits (190),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 106/212 (50%), Gaps = 28/212 (13%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLE-HLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + EVD     L G I  G  K    L +L L+ NN +G I  ++GL +NL+ LNLS N++
Sbjct  390   LEEVDFSDNKLIGSIPAGSSKFYGSLQILDLSRNNLTGNIRAEMGLSSNLRYLNLSWNNL  449

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
                +P  LG   +L  LDL  +++SG +   + E+ GSL  L L G+S  G IP  +  C
Sbjct  450   QSRMPQELGYFQNLTVLDLRNSAISGSIPADICES-GSLSILQLDGNSIVGSIPEEIGNC  508

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             +                           +  L +S+N LSG +P   + L+NLK L L  
Sbjct  509   S--------------------------TMYLLSLSHNNLSGPIPKSIAKLNNLKILKLEF  542

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             N  SGEIP++LG   +L  +++S N+  G +P
Sbjct  543   NKLSGEIPLELGKLENLLAVNISYNMLIGRLP  574


 Score = 77.4 bits (189),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 107/207 (52%), Gaps = 5/207 (2%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L+G +   +  L+ L  ++L++N F+G I   +   + L  + L  NS  GT+P+ L N+
Sbjct  329   LTGSLPSSISDLKSLYFINLSNNKFTGQIPTSMVQFSKLSVIRLRGNSFIGTIPEGLFNL  388

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLS-N  884
               L+ +D S N L G +     +  GSL+ L L+ ++  G I + +   + L +LNLS N
Sbjct  389   G-LEEVDFSDNKLIGSIPAGSSKFYGSLQILDLSRNNLTGNIRAEMGLSSNLRYLNLSWN  447

Query  885   NRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVD  1064
             N  S  P+  G    LT    LD+ N+ +SGS+P       +L  L L  N   G IP +
Sbjct  448   NLQSRMPQELGYFQNLT---VLDLRNSAISGSIPADICESGSLSILQLDGNSIVGSIPEE  504

Query  1065  LGLCPHLSRLDLSENLFTGTIPESLQR  1145
             +G C  +  L LS N  +G IP+S+ +
Sbjct  505   IGNCSTMYLLSLSHNNLSGPIPKSIAK  531



>ref|XP_010023583.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW59891.1| hypothetical protein EUGRSUZ_H02618 [Eucalyptus grandis]
Length=1012

 Score =   327 bits (839),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 171/268 (64%), Positives = 207/268 (77%), Gaps = 0/268 (0%)
 Frame = +3

Query  339   GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  518
             G   S QLNDDVLGLIVFKS + DP+S L +WSEDD SPC+W +V+C P  GRV++V L 
Sbjct  32    GDDVSAQLNDDVLGLIVFKSDLTDPSSSLVSWSEDDASPCSWRYVQCDPLTGRVAQVSLD  91

Query  519   GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  698
             GLGLSGKIGRGLEKL+ L VLSL+ NNF+G ISPQL L + LQ LNLS+N +SG  P SL
Sbjct  92    GLGLSGKIGRGLEKLDRLKVLSLSRNNFTGSISPQLSLPSGLQRLNLSRNGLSGPFPTSL  151

Query  699   GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNL  878
              N+SS++FLDLS NS SGP+ D +  +  SL F+S AG+  EGPIPSSL+KCT LN LNL
Sbjct  152   VNVSSIRFLDLSENSFSGPLPDGLFGSCSSLHFISFAGNRLEGPIPSSLAKCTFLNSLNL  211

Query  879   SNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
             S N+FSGDP F+ GIW + RLR LD+SNN LSG +P G S +HNLKEL LG NHF+G++P
Sbjct  212   SGNKFSGDPNFASGIWTMQRLRVLDLSNNMLSGPIPTGVSAVHNLKELRLGGNHFAGQLP  271

Query  1059  VDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
              D+GLCPHL+ LD S+NL TG +P SLQ
Sbjct  272   ADVGLCPHLTALDFSDNLLTGALPASLQ  299


 Score = 99.8 bits (247),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 122/215 (57%), Gaps = 5/215 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             + E+ L G   +G++   +    HL  L  + N  +G +   L  L +L +L+L+ N ++
Sbjct  256   LKELRLGGNHFAGQLPADVGLCPHLTALDFSDNLLTGALPASLQYLYSLVSLSLANNMLT  315

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G  P+ +G ++SLQ+LD SGN  +G +  S+  NL SLR+LSL+G+   G IP SL+ C+
Sbjct  316   GDFPNWIGKITSLQYLDFSGNKFTGSIPTSV-GNLQSLRYLSLSGNELSGSIPLSLAYCS  374

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFL-HNLKELSLGS  1034
              L  + L +N  +G     GG++ L  L+ +D+S N+L G +P G+S L  +L  L L  
Sbjct  375   KLTVIRLRDNSITGS--VPGGLFDLG-LQEVDLSKNKLVGPIPPGSSKLFQSLHTLDLSR  431

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             N+ SG IP ++ L   L  L+LS N  +  +P  L
Sbjct  432   NNLSGVIPAEMDLLSTLRYLNLSWNGLSSRMPPEL  466


 Score = 79.0 bits (193),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 76/212 (36%), Positives = 103/212 (49%), Gaps = 28/212 (13%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + EVDL    L G I  G  KL + L+ L L+ NN SGVI  ++ LL+ L+ LNLS N +
Sbjct  399   LQEVDLSKNKLVGPIPPGSSKLFQSLHTLDLSRNNLSGVIPAEMDLLSTLRYLNLSWNGL  458

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
             S  +P  LG   +L  LD   N L G +   + ++  SL  L L G++  GPIP  +  C
Sbjct  459   SSRMPPELGYFQNLTVLDFRNNDLYGSIPGDICDS-RSLAILQLDGNALTGPIPEEIENC  517

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             +                           L  L +S+N LSG +P   S L NLK L L  
Sbjct  518   S--------------------------SLYLLSLSHNNLSGPIPKSVSMLSNLKILKLEF  551

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             N  SGEIP +LG    L  +++S N  TG +P
Sbjct  552   NELSGEIPQELGKLEDLLAVNISHNRLTGRLP  583


 Score = 77.8 bits (190),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 73/211 (35%), Positives = 104/211 (49%), Gaps = 3/211 (1%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +D  G   +G I   +  L+ L  LSL+ N  SG I   L   + L  + L  NSI+G+V
Sbjct  331   LDFSGNKFTGSIPTSVGNLQSLRYLSLSGNELSGSIPLSLAYCSKLTVIRLRDNSITGSV  390

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P  L ++  LQ +DLS N L GP+     +   SL  L L+ ++  G IP+ +   + L 
Sbjct  391   PGGLFDLG-LQEVDLSKNKLVGPIPPGSSKLFQSLHTLDLSRNNLSGVIPAEMDLLSTLR  449

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
             +LNLS N  S   R    +     L  LD  NN+L GS+P       +L  L L  N  +
Sbjct  450   YLNLSWNGLSS--RMPPELGYFQNLTVLDFRNNDLYGSIPGDICDSRSLAILQLDGNALT  507

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             G IP ++  C  L  L LS N  +G IP+S+
Sbjct  508   GPIPEEIENCSSLYLLSLSHNNLSGPIPKSV  538



>ref|XP_010528265.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Tarenaya hassleriana]
Length=1011

 Score =   323 bits (827),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 172/269 (64%), Positives = 208/269 (77%), Gaps = 0/269 (0%)
 Frame = +3

Query  339   GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  518
             G A S QLNDDVLGLIVFK+ + DP+SHL +W+EDD SPC+W ++KC+PA GRVSE+ L 
Sbjct  23    GDAGSFQLNDDVLGLIVFKADINDPSSHLESWNEDDYSPCSWKYIKCNPATGRVSEISLD  82

Query  519   GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  698
             GLGLSGKIGRG++KL+HL VLSL+ NNF+G I PQ+GL+T LQ LNLS N +SG +P SL
Sbjct  83    GLGLSGKIGRGVQKLQHLKVLSLSDNNFTGNIIPQIGLITGLQKLNLSHNRLSGIIPSSL  142

Query  699   GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNL  878
             G++SSL+FLDLS NSLSG + D    N   LR+LSLA +  EGPIPSSL++C+LLN LNL
Sbjct  143   GSISSLKFLDLSENSLSGTIPDDFFRNNSPLRYLSLAKNMLEGPIPSSLARCSLLNTLNL  202

Query  879   SNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
             S+NRFSG+P F  GIW L RLRTLD+SNN LSG +P G   L  LK L L  N FSG +P
Sbjct  203   SSNRFSGNPSFVSGIWTLQRLRTLDLSNNSLSGLIPSGIPALQLLKVLHLRGNKFSGPLP  262

Query  1059  VDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              D+G CPHL RLDLS NLF+G +P  LQR
Sbjct  263   ADIGFCPHLKRLDLSYNLFSGEVPSPLQR  291


 Score = 98.2 bits (243),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 119/220 (54%), Gaps = 5/220 (2%)
 Frame = +3

Query  483   PANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlS  662
             PA   +  + L G   SG +   +    HL  L L+ N FSG +   L  L +L   +LS
Sbjct  242   PALQLLKVLHLRGNKFSGPLPADIGFCPHLKRLDLSYNLFSGEVPSPLQRLNSLMFFSLS  301

Query  663   KNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSS  842
              N +SG  P  + ++SSL+ LDLS N+LSG +  SM  NL SL+ L L+ +  +G IP+S
Sbjct  302   NNVLSGDFPQWITSLSSLEHLDLSNNALSGELPSSM-GNLRSLKHLVLSKNQLKGEIPAS  360

Query  843   LSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGAS-FLHNLKE  1019
             L+ CT L+ + L  N F+G      G + L  L  +D S+N L+GSLP G+S    +L+ 
Sbjct  361   LAYCTELSVIQLKGNSFTGS--VPAGFFDLG-LEEIDFSHNALTGSLPRGSSRIFESLRV  417

Query  1020  LSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             L L  N+  G IP ++GL   L  L+LS N     IP  L
Sbjct  418   LDLSRNNLGGSIPGEVGLFIQLRYLNLSWNDLQTRIPPEL  457


 Score = 65.9 bits (159),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 102/189 (54%), Gaps = 4/189 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + E+D     L+G + RG  ++ E L VL L+ NN  G I  ++GL   L+ LNLS N +
Sbjct  390   LEEIDFSHNALTGSLPRGSSRIFESLRVLDLSRNNLGGSIPGEVGLFIQLRYLNLSWNDL  449

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
                +P  LG + +L  LDL  ++L+G V   + E+  SL+ L L G+S  GPIP  +  C
Sbjct  450   QTRIPPELGFLQNLTVLDLRNSALTGSVPADICES-QSLQILQLDGNSLIGPIPEGIGNC  508

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             + LN L+LS+N   G  +    +  L +L+ L +  N+L G +P     L NL  ++   
Sbjct  509   SSLNLLSLSHNNLIG--QIPKSLSNLRKLKILKLEVNDLRGEIPPELGKLQNLLAVNFSF  566

Query  1035  NHFSGEIPV  1061
             NH  G +PV
Sbjct  567   NHLVGRLPV  575


 Score = 62.4 bits (150),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 70/214 (33%), Positives = 101/214 (47%), Gaps = 3/214 (1%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +  +DL    LSG++   +  L  L  L L+ N   G I   L   T L  + L  NS +
Sbjct  319   LEHLDLSNNALSGELPSSMGNLRSLKHLVLSKNQLKGEIPASLAYCTELSVIQLKGNSFT  378

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G+VP    ++  L+ +D S N+L+G +         SLR L L+ ++  G IP  +    
Sbjct  379   GSVPAGFFDLG-LEEIDFSHNALTGSLPRGSSRIFESLRVLDLSRNNLGGSIPGEVGLFI  437

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSN  1037
              L +LNLS N      R    +  L  L  LD+ N+ L+GS+P       +L+ L L  N
Sbjct  438   QLRYLNLSWNDLQT--RIPPELGFLQNLTVLDLRNSALTGSVPADICESQSLQILQLDGN  495

Query  1038  HFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
                G IP  +G C  L+ L LS N   G IP+SL
Sbjct  496   SLIGPIPEGIGNCSSLNLLSLSHNNLIGQIPKSL  529



>ref|XP_011042759.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
 ref|XP_011042760.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=1012

 Score =   322 bits (825),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 177/293 (60%), Positives = 229/293 (78%), Gaps = 2/293 (1%)
 Frame = +3

Query  273   IMGFRsmlllvflsvlsvTSGAGGAES--LQLNDDVLGLIVFKSGVQDPASHLATWSEDD  446
             +MG+  +LL + +SV+    G  G++S  +Q+NDDV GLIVFK+ + DP S+L++W+EDD
Sbjct  6     VMGYSHLLLYLLVSVVVSLKGCMGSDSGPIQMNDDVFGLIVFKADLIDPFSYLSSWNEDD  65

Query  447   DSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPql  626
             DSPC+W F++C+P +GRVS+V L GLGLSG++G+GL+KL+HL  LSL+ NNFSG IS +L
Sbjct  66    DSPCSWKFIECNPVSGRVSQVSLDGLGLSGRLGKGLQKLQHLKTLSLSQNNFSGGISHEL  125

Query  627   glltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSL  806
             G L+NL+ LNLS NSISG +P  L NMSS++FLDLS NS SGP+ D++  N  SLR+LSL
Sbjct  126   GFLSNLERLNLSHNSISGLIPSFLDNMSSIKFLDLSENSFSGPLPDNLFRNSQSLRYLSL  185

Query  807   AGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLP  986
             AG+  +GPIPSSL  C+ LN +NLSNN FSGDP FS GIW L RLR LD+S+NE SGS+P
Sbjct  186   AGNLLQGPIPSSLVSCSSLNTINLSNNHFSGDPDFSSGIWSLKRLRKLDLSHNEFSGSVP  245

Query  987   IGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              G S +H LKEL L  N FSG +P D+GLCPHL+RLDLS NLF+G +PESL+R
Sbjct  246   QGVSAIHFLKELQLQGNRFSGPLPGDIGLCPHLNRLDLSRNLFSGVLPESLRR  298


 Score =   103 bits (256),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 126/215 (59%), Gaps = 5/215 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             + E+ L G   SG +   +    HLN L L+ N FSGV+   L  L+++   +LSKN ++
Sbjct  254   LKELQLQGNRFSGPLPGDIGLCPHLNRLDLSRNLFSGVLPESLRRLSSMSFFSLSKNMLA  313

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G  P  +G++++L++LDLS N+L+G +  S + +L SLR+LSL+ +   G IP+S+  CT
Sbjct  314   GEFPRWIGSLTNLEYLDLSSNALTGSIPSS-IGDLKSLRYLSLSNNKLFGIIPTSVVSCT  372

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGA-SFLHNLKELSLGS  1034
             +L+ + L  N F+G      G++ L  L  +D S+N L GS+P G+ +F  +L  L L  
Sbjct  373   MLSVIRLRGNSFNGS--IPEGLFDLG-LEEVDFSDNGLVGSIPSGSITFFSSLHTLDLSK  429

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             N+ +G IP + GL  +L  L+LS N     +P  L
Sbjct  430   NNLTGHIPAERGLSSNLRYLNLSWNNLESRMPLEL  464


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 74/206 (36%), Positives = 107/206 (52%), Gaps = 5/206 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRG-LEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + EVD    GL G I  G +     L+ L L+ NN +G I  + GL +NL+ LNLS N++
Sbjct  397   LEEVDFSDNGLVGSIPSGSITFFSSLHTLDLSKNNLTGHIPAERGLSSNLRYLNLSWNNL  456

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
                +P  LG   +L  LDL  ++L G +   + E+ GSL  L L G+S  G IP  +  C
Sbjct  457   ESRMPLELGYFQNLTVLDLRNSALVGFIPADICES-GSLNILQLDGNSLVGQIPEEIGNC  515

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             + L  L+LS N  SG       I  L +L+ L +  NEL+G +P+    L NL  +++  
Sbjct  516   SSLYLLSLSQNNLSGS--IPESISRLNKLKILKLEFNELTGEIPLELGKLENLLAVNVSY  573

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENL  1112
             N   G +PV  G+ P L +  L  NL
Sbjct  574   NKLEGRLPVG-GIFPSLDQSALQGNL  598



>ref|XP_002265846.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=1012

 Score =   322 bits (824),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 174/264 (66%), Positives = 216/264 (82%), Gaps = 0/264 (0%)
 Frame = +3

Query  354   LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
             +Q+NDDVLGLIVFKSG+ DP+S L +WSEDDDSPC+W FV+C+P+ GRVSEV + GLGLS
Sbjct  34    IQINDDVLGLIVFKSGLHDPSSRLDSWSEDDDSPCSWEFVQCNPSTGRVSEVSVDGLGLS  93

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  713
             GKIGRGLEKL++L VLSL+ NNFSG ISP+L L+T L+ LNLS NS+SG +P SL NM+S
Sbjct  94    GKIGRGLEKLQNLKVLSLSFNNFSGSISPELALITGLERLNLSHNSLSGRIPSSLSNMTS  153

Query  714   LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRF  893
             ++FLDLS NSL+GP+ D M EN  SLR LSL+ +  EGPIPS+L +CT L++LNLS+N+F
Sbjct  154   IRFLDLSHNSLAGPIPDEMFENYSSLRSLSLSMNFLEGPIPSALLRCTTLSNLNLSSNQF  213

Query  894   SGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGL  1073
             SG+  FS GIW L RLRTLD+S+N  SGS+P G + +HNLKEL L  N FSG +PVD+GL
Sbjct  214   SGNLDFSSGIWTLNRLRTLDLSHNVFSGSVPDGVAAIHNLKELQLQGNRFSGPLPVDIGL  273

Query  1074  CPHLSRLDLSENLFTGTIPESLQR  1145
             CPHL RLD   NLFTG++P+SLQR
Sbjct  274   CPHLRRLDFCHNLFTGSLPDSLQR  297


 Score = 95.9 bits (237),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 113/215 (53%), Gaps = 5/215 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             + E+ L G   SG +   +    HL  L    N F+G +   L  L +L    +S N ++
Sbjct  253   LKELQLQGNRFSGPLPVDIGLCPHLRRLDFCHNLFTGSLPDSLQRLNSLVFFGVSNNLLA  312

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G  P  +G+MSS++++D SGN  +G +  SM  NL SL+FLSL+ +   G IP SL  C 
Sbjct  313   GDFPQWIGSMSSVEYVDFSGNGFTGSLPASM-GNLKSLQFLSLSDNRLTGSIPGSLFYCP  371

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFL-HNLKELSLGS  1034
              L+ + L  N FSG      G++ L  L  +D+S NEL G +P G+S L  +L  L L  
Sbjct  372   KLSVIRLRGNGFSGS--IPEGLFDLG-LDEVDLSGNELEGPIPPGSSRLFESLHSLDLSR  428

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             N  +G IP ++GL   L  L+LS N     +P  L
Sbjct  429   NKLTGSIPAEIGLFSSLRYLNLSWNSLRSRMPPEL  463


 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 79/209 (38%), Positives = 111/209 (53%), Gaps = 11/209 (5%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVI--SPqlglltnlqtlnlSKNSISGTVPDSLG  701
             L G I   L +   L+ L+L+SN FSG +  S  +  L  L+TL+LS N  SG+VPD + 
Sbjct  189   LEGPIPSALLRCTTLSNLNLSSNQFSGNLDFSSGIWTLNRLRTLDLSHNVFSGSVPDGVA  248

Query  702   NMSSLQFLDLSGNSLSGPVSDSMLENLG---SLRFLSLAGSSFEGPIPSSLSKCTLLNHL  872
              + +L+ L L GN  SGP+      ++G    LR L    + F G +P SL +   L   
Sbjct  249   AIHNLKELQLQGNRFSGPLP----VDIGLCPHLRRLDFCHNLFTGSLPDSLQRLNSLVFF  304

Query  873   NLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGE  1052
              +SNN  +GD  F   I  ++ +  +D S N  +GSLP     L +L+ LSL  N  +G 
Sbjct  305   GVSNNLLAGD--FPQWIGSMSSVEYVDFSGNGFTGSLPASMGNLKSLQFLSLSDNRLTGS  362

Query  1053  IPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             IP  L  CP LS + L  N F+G+IPE L
Sbjct  363   IPGSLFYCPKLSVIRLRGNGFSGSIPEGL  391


 Score = 79.0 bits (193),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 70/214 (33%), Positives = 99/214 (46%), Gaps = 3/214 (1%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             V  VD  G G +G +   +  L+ L  LSL+ N  +G I   L     L  + L  N  S
Sbjct  325   VEYVDFSGNGFTGSLPASMGNLKSLQFLSLSDNRLTGSIPGSLFYCPKLSVIRLRGNGFS  384

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G++P+ L ++  L  +DLSGN L GP+         SL  L L+ +   G IP+ +   +
Sbjct  385   GSIPEGLFDLG-LDEVDLSGNELEGPIPPGSSRLFESLHSLDLSRNKLTGSIPAEIGLFS  443

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSN  1037
              L +LNLS N      R    +     L  LD+ N  L GS+P       +L  L L  N
Sbjct  444   SLRYLNLSWNSLRS--RMPPELGYFQNLTVLDLRNTFLFGSIPGDICDSGSLGILQLDGN  501

Query  1038  HFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
               +G IP + G C  L  L +S N   G+IP+S 
Sbjct  502   SLTGPIPDEFGNCSSLYLLSMSHNELNGSIPKSF  535


 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 104/212 (49%), Gaps = 28/212 (13%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + EVDL G  L G I  G  +L E L+ L L+ N  +G I  ++GL ++L+ LNLS NS+
Sbjct  396   LDEVDLSGNELEGPIPPGSSRLFESLHSLDLSRNKLTGSIPAEIGLFSSLRYLNLSWNSL  455

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
                +P  LG   +L  LDL    L G +   + ++ GSL  L L G+S  GPIP     C
Sbjct  456   RSRMPPELGYFQNLTVLDLRNTFLFGSIPGDICDS-GSLGILQLDGNSLTGPIPDEFGNC  514

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             +                           L  L +S+NEL+GS+P   + L  L+ L L  
Sbjct  515   S--------------------------SLYLLSMSHNELNGSIPKSFAMLKKLEILRLEF  548

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             N  SGEIP +LG   +L  +++S N   G +P
Sbjct  549   NELSGEIPRELGSLENLLAVNVSYNRLIGRLP  580



>ref|XP_007034091.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY05017.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=1011

 Score =   321 bits (823),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 173/294 (59%), Positives = 232/294 (79%), Gaps = 1/294 (0%)
 Frame = +3

Query  267   IYIMGFRsmlllvflsvlsvTSGAGGAE-SLQLNDDVLGLIVFKSGVQDPASHLATWSED  443
             + +MGFR +++ + LS+  +    G  + S+QLNDDVLGLIVFKS ++DP+S+L +W+ED
Sbjct  4     MVVMGFRQLVVFLLLSMAVLHGCMGNDDASIQLNDDVLGLIVFKSDIKDPSSYLDSWNED  63

Query  444   DDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPq  623
             D+SPC+W F++C+P NGRVSEV L+GLGLSGKIG+GL+KL++L VLSL+ NNFSG ISP+
Sbjct  64    DNSPCSWRFIQCNPVNGRVSEVSLNGLGLSGKIGKGLQKLQYLKVLSLSHNNFSGSISPE  123

Query  624   lglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLS  803
             LGL+ +L+ LNLS NS+SG +P S  NM+S++FLDLSGNSLSG V D + +   SLR+LS
Sbjct  124   LGLIGSLERLNLSHNSLSGRIPSSFVNMNSIRFLDLSGNSLSGSVPDDLFQTCSSLRYLS  183

Query  804   LAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSL  983
             LA +S EG +PS+L++C  LN L+LS N FSG+  F+ GI+ + RLRTLD+S+NE SG++
Sbjct  184   LAENSLEGQLPSTLARCFSLNTLDLSKNHFSGNIDFASGIYNMQRLRTLDLSHNEFSGTV  243

Query  984   PIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             P G   LHNLKEL L  N FSG +P+D+G CPHL+ LDLS NLFTG +P+SLQR
Sbjct  244   PEGVFALHNLKELLLQDNRFSGPMPLDIGFCPHLNTLDLSYNLFTGPLPDSLQR  297


 Score =   102 bits (254),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 110/192 (57%), Gaps = 5/192 (3%)
 Frame = +3

Query  567   HLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSL  746
             HLN L L+ N F+G +   L  L  L   +LS N  +G  P  +GNMS+L +LD S NSL
Sbjct  276   HLNTLDLSYNLFTGPLPDSLQRLNFLSFFSLSNNMFTGDFPQGIGNMSNLAYLDFSSNSL  335

Query  747   SGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIW  926
             +G +  S + NL +L +L L+ +   G IP+SL  C  L+ ++L +N F+G      G++
Sbjct  336   TGSLPSS-IGNLKALNYLRLSNNRLTGNIPTSLGYCFQLSTIHLRDNGFNGS--LPAGLF  392

Query  927   GLTRLRTLDVSNNELSGSLPIGASFL-HNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLS  1103
              L  L  +D SNN L+GS+P G+S L  +L+EL L  N   G IP ++GL  ++  L+LS
Sbjct  393   DLG-LEEIDFSNNALTGSIPRGSSRLFESLQELDLSRNSLQGSIPAEMGLFANMRYLNLS  451

Query  1104  ENLFTGTIPESL  1139
              N     IP  L
Sbjct  452   WNNLQSRIPPEL  463


 Score =   101 bits (251),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 115/209 (55%), Gaps = 11/209 (5%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVI--SPqlglltnlqtlnlSKNSISGTVPDSLG  701
             L G++   L +   LN L L+ N+FSG I  +  +  +  L+TL+LS N  SGTVP+ + 
Sbjct  189   LEGQLPSTLARCFSLNTLDLSKNHFSGNIDFASGIYNMQRLRTLDLSHNEFSGTVPEGVF  248

Query  702   NMSSLQFLDLSGNSLSGPVSDSMLENLG---SLRFLSLAGSSFEGPIPSSLSKCTLLNHL  872
              + +L+ L L  N  SGP    M  ++G    L  L L+ + F GP+P SL +   L+  
Sbjct  249   ALHNLKELLLQDNRFSGP----MPLDIGFCPHLNTLDLSYNLFTGPLPDSLQRLNFLSFF  304

Query  873   NLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGE  1052
             +LSNN F+GD  F  GI  ++ L  LD S+N L+GSLP     L  L  L L +N  +G 
Sbjct  305   SLSNNMFTGD--FPQGIGNMSNLAYLDFSSNSLTGSLPSSIGNLKALNYLRLSNNRLTGN  362

Query  1053  IPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             IP  LG C  LS + L +N F G++P  L
Sbjct  363   IPTSLGYCFQLSTIHLRDNGFNGSLPAGL  391


 Score = 93.6 bits (231),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 76/206 (37%), Positives = 111/206 (54%), Gaps = 5/206 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + E+D     L+G I RG  +L E L  L L+ N+  G I  ++GL  N++ LNLS N++
Sbjct  396   LEEIDFSNNALTGSIPRGSSRLFESLQELDLSRNSLQGSIPAEMGLFANMRYLNLSWNNL  455

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
                +P  LG   +L  LDL  N+L G V   + E+ GSL  L + G+S  GPIP  +  C
Sbjct  456   QSRIPPELGLFQNLTVLDLRNNTLYGAVPGDICES-GSLAILQMDGNSLTGPIPEEIGNC  514

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             + L  L+LS+N  SG       I  L++L+ L +  NELSG +P     L NL  +++  
Sbjct  515   SSLYMLSLSHNNLSGS--IPKTISNLSKLKILKLEFNELSGEIPQEIGLLQNLLAVNISY  572

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENL  1112
             N  +G +PV  G+ P L +  L  NL
Sbjct  573   NQLTGRLPVG-GIFPSLDQSALQGNL  597


 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 63/205 (31%), Positives = 96/205 (47%), Gaps = 5/205 (2%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L+G I   L     L+ + L  N F+G + P       L+ ++ S N+++G++P     +
Sbjct  359   LTGNIPTSLGYCFQLSTIHLRDNGFNGSL-PAGLFDLGLEEIDFSNNALTGSIPRGSSRL  417

Query  708   -SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSN  884
               SLQ LDLS NSL G +   M     ++R+L+L+ ++ +  IP  L     L  L+L N
Sbjct  418   FESLQELDLSRNSLQGSIPAEM-GLFANMRYLNLSWNNLQSRIPPELGLFQNLTVLDLRN  476

Query  885   NRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVD  1064
             N   G     G I     L  L +  N L+G +P       +L  LSL  N+ SG IP  
Sbjct  477   NTLYG--AVPGDICESGSLAILQMDGNSLTGPIPEEIGNCSSLYMLSLSHNNLSGSIPKT  534

Query  1065  LGLCPHLSRLDLSENLFTGTIPESL  1139
             +     L  L L  N  +G IP+ +
Sbjct  535   ISNLSKLKILKLEFNELSGEIPQEI  559



>ref|XP_002321093.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE99408.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=1006

 Score =   319 bits (817),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 173/291 (59%), Positives = 227/291 (78%), Gaps = 2/291 (1%)
 Frame = +3

Query  276   MGFRsmlllvflsvlsvTSGAGGAES--LQLNDDVLGLIVFKSGVQDPASHLATWSEDDD  449
             MGF  +LL   +S ++   G  G++S  +Q+NDDVLGLIVFKS + DP+S+L++W+EDDD
Sbjct  1     MGFSHLLLYFLVSSVASLRGCTGSDSVPIQINDDVLGLIVFKSDLSDPSSYLSSWNEDDD  60

Query  450   SPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlg  629
             SPC+W F++C+P +GRVS+V L GLGLSG++G+GL+KL+H+  LSL+ NNFSG  S + G
Sbjct  61    SPCSWKFIECNPVSGRVSQVSLDGLGLSGRLGKGLQKLQHVKTLSLSHNNFSGDFSLEFG  120

Query  630   lltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  809
             L+++L++LNLS NS+SG +P  L NMSSL+FLDLS NS +GP+ D +  N  SLR+LSLA
Sbjct  121   LISSLESLNLSHNSLSGLIPSFLDNMSSLKFLDLSENSFTGPLPDDLFRNSFSLRYLSLA  180

Query  810   GSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPI  989
             G+  +GPIPSSL  C+ LN +NLSNN+FSGDP F  G W L RLR LD+S+NE SGS+P 
Sbjct  181   GNLLQGPIPSSLFSCSSLNTINLSNNQFSGDPDFVTGTWSLERLRKLDLSHNEFSGSVPQ  240

Query  990   GASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
             G S +HNLKEL L  N FSG +PVD+GLC HL+RLDLS NLF+G +PESLQ
Sbjct  241   GVSAIHNLKELHLQGNRFSGPLPVDIGLCRHLNRLDLSSNLFSGALPESLQ  291


 Score =   110 bits (274),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 127/215 (59%), Gaps = 5/215 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             + E+ L G   SG +   +    HLN L L+SN FSG +   L  L+++   +LSKN ++
Sbjct  248   LKELHLQGNRFSGPLPVDIGLCRHLNRLDLSSNLFSGALPESLQGLSSINYFSLSKNMLT  307

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G  P  +G++S+L++LDLS N+L+G +S S + +L SLR+LSL+ +   G IP+S+  CT
Sbjct  308   GEFPRWIGSLSNLEYLDLSSNALTGSISSS-IGDLKSLRYLSLSNNKLLGNIPASIVSCT  366

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGAS-FLHNLKELSLGS  1034
             +L+ + L  N F+G      G++ L  L  +D S+N L GS+P G+S F  +L  L L  
Sbjct  367   MLSAIRLRGNSFNGS--IPEGLFDLG-LEEVDFSHNGLIGSIPSGSSTFFTSLHTLDLSR  423

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             N+ +G IP ++GL   L  L+LS N     +P  L
Sbjct  424   NNLTGHIPAEMGLSSDLRYLNLSWNNLESRMPPEL  458


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 107/206 (52%), Gaps = 5/206 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + EVD    GL G I  G       L+ L L+ NN +G I  ++GL ++L+ LNLS N++
Sbjct  391   LEEVDFSHNGLIGSIPSGSSTFFTSLHTLDLSRNNLTGHIPAEMGLSSDLRYLNLSWNNL  450

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
                +P  LG   +L  LDL  N+L+G +   + E+ GSL  L L G+S  G +P  +  C
Sbjct  451   ESRMPPELGYFQNLTVLDLRSNALAGSIPADICES-GSLNILQLDGNSLVGQVPEEIGNC  509

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             + L  L+LS N  SG       I  L +L+ L +  NEL+G +P     L NL  +++  
Sbjct  510   SSLYLLSLSQNNLSGS--IPKSISRLDKLKILKLEFNELTGEVPQELGKLENLLAVNISY  567

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENL  1112
             N   G +PV  G+ P L +  L  NL
Sbjct  568   NKLIGRLPVR-GIFPSLDQSALQGNL  592



>ref|XP_009371148.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=1009

 Score =   316 bits (810),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 164/264 (62%), Positives = 214/264 (81%), Gaps = 1/264 (0%)
 Frame = +3

Query  357   QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             QLN DVLGL+VFKS + DP+S+LA+W+ED++SPC+W +V+C+PA GRVS++ L GLGL G
Sbjct  32    QLNSDVLGLLVFKSDIHDPSSYLASWNEDENSPCSWEYVQCNPATGRVSQLSLEGLGLRG  91

Query  537   KIGRGLEKLEHLNVLSLASNNFSGVISPqlgll-tnlqtlnlSKNSISGTVPDSLGNMSS  713
             KIG+GL+ L++L VLSL+SNNFSG ISP+   L +NL+ LNLS NS+SG +P +L NMSS
Sbjct  92    KIGKGLQNLQNLKVLSLSSNNFSGDISPEKLALPSNLEKLNLSHNSLSGIIPTNLFNMSS  151

Query  714   LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRF  893
             ++FLDLS NSLSGP+ D++ +N  SLR+LSL+G+  EGP+PS+L +C+ LN LNLSNN F
Sbjct  152   IKFLDLSENSLSGPLPDNLFDNCFSLRYLSLSGNLLEGPLPSTLPRCSSLNGLNLSNNHF  211

Query  894   SGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGL  1073
             SG+P F+ GIW L RLRTLD+SNN  SGS+  G S +HNLKEL L SNHFSG +P D+GL
Sbjct  212   SGNPDFASGIWSLARLRTLDLSNNAFSGSVSQGISAVHNLKELLLQSNHFSGSLPGDIGL  271

Query  1074  CPHLSRLDLSENLFTGTIPESLQR  1145
             CPHL ++DLS N+FT  + +SLQR
Sbjct  272   CPHLEKIDLSYNMFTDALQDSLQR  295


 Score = 89.7 bits (221),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 82/262 (31%), Positives = 124/262 (47%), Gaps = 47/262 (18%)
 Frame = +3

Query  492   GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSG---------------------  608
              R+  +DL     SG + +G+  + +L  L L SN+FSG                     
Sbjct  225   ARLRTLDLSNNAFSGSVSQGISAVHNLKELLLQSNHFSGSLPGDIGLCPHLEKIDLSYNM  284

Query  609   ---VISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLEN  779
                 +   L  L +L   +LS N  SG  P  +G+MSSL++LD S N  +G +  SM  +
Sbjct  285   FTDALQDSLQRLNSLTFFSLSDNMFSGDFPQWIGSMSSLKYLDFSNNGFTGSLPPSM-SD  343

Query  780   LGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG---DPRFSGGI-------WG  929
             L SL +LSL+ +   G IP+SL+ C  L  + L  N F+G   +  F+ G+        G
Sbjct  344   LRSLNYLSLSNNKLVGTIPTSLAYCNDLLVIRLRGNTFTGSIPEGLFNLGLEEIDFSHMG  403

Query  930   LT------------RLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGL  1073
             LT             LR LD+S+N L G++P       NL+ L+L  N+    +P +LG 
Sbjct  404   LTGSIPPGSSRLFESLRMLDLSSNNLKGNIPAEVGLFSNLRYLNLSWNNLQSRMPPELGF  463

Query  1074  CPHLSRLDLSENLFTGTIPESL  1139
               +L+ LDL  +   G+IPE +
Sbjct  464   FQNLTVLDLRNSALFGSIPEDV  485


 Score = 78.2 bits (191),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 73/253 (29%), Positives = 120/253 (47%), Gaps = 5/253 (2%)
 Frame = +3

Query  387   VFKSGVQDPASHL--ATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEK  560
             +F   +QD    L   T+    D+  + +F +   +   +  +D    G +G +   +  
Sbjct  284   MFTDALQDSLQRLNSLTFFSLSDNMFSGDFPQWIGSMSSLKYLDFSNNGFTGSLPPSMSD  343

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             L  LN LSL++N   G I   L    +L  + L  N+ +G++P+ L N+  L+ +D S  
Sbjct  344   LRSLNYLSLSNNKLVGTIPTSLAYCNDLLVIRLRGNTFTGSIPEGLFNLG-LEEIDFSHM  402

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
              L+G +         SLR L L+ ++ +G IP+ +   + L +LNLS N      R    
Sbjct  403   GLTGSIPPGSSRLFESLRMLDLSSNNLKGNIPAEVGLFSNLRYLNLSWNNLQS--RMPPE  460

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDL  1100
             +     L  LD+ N+ L GS+P       +L  L L  N  +G IP ++G C  L  + L
Sbjct  461   LGFFQNLTVLDLRNSALFGSIPEDVCDSGSLAILQLDGNSLTGSIPDEIGNCSSLYLMSL  520

Query  1101  SENLFTGTIPESL  1139
             S N  +GTIP+S+
Sbjct  521   SHNNLSGTIPKSI  533


 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 72/212 (34%), Positives = 109/212 (51%), Gaps = 28/212 (13%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + E+D   +GL+G I  G  +L E L +L L+SNN  G I  ++GL +NL+ LNLS N++
Sbjct  394   LEEIDFSHMGLTGSIPPGSSRLFESLRMLDLSSNNLKGNIPAEVGLFSNLRYLNLSWNNL  453

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
                +P  LG   +L  LDL  ++L G + + + ++ GSL  L L G+S  G IP  +  C
Sbjct  454   QSRMPPELGFFQNLTVLDLRNSALFGSIPEDVCDS-GSLAILQLDGNSLTGSIPDEIGNC  512

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             +                           L  + +S+N LSG++P   S L+ LK L L  
Sbjct  513   S--------------------------SLYLMSLSHNNLSGTIPKSISKLNKLKILKLEF  546

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             N  SGEIP +LG   +L  +++S N   G +P
Sbjct  547   NELSGEIPQELGKLENLLAVNISYNRLVGRLP  578



>ref|XP_011000023.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=1006

 Score =   315 bits (807),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 175/292 (60%), Positives = 229/292 (78%), Gaps = 2/292 (1%)
 Frame = +3

Query  276   MGFRsmlllvflsvlsvTSGAGGAES--LQLNDDVLGLIVFKSGVQDPASHLATWSEDDD  449
             MGF  +LL   +S ++   G  G++S  +Q+NDDVLGLIVFKS ++DP+S+L++W+EDDD
Sbjct  1     MGFSHLLLYFLVSSVASLRGCTGSDSVPIQINDDVLGLIVFKSDLRDPSSYLSSWNEDDD  60

Query  450   SPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlg  629
             SPC+W F++C+P +GRVS+V L GLGLSG++G+GL+KL+H+  LSL+ NNFSG  S + G
Sbjct  61    SPCSWKFIECNPVSGRVSQVSLDGLGLSGRLGKGLQKLQHVKTLSLSHNNFSGDFSLEFG  120

Query  630   lltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  809
             L+++L++LNLS NS+SG +P  L NMSS++FLDLS NS SGP+ D +  N  SLR+LSLA
Sbjct  121   LISSLESLNLSHNSLSGLIPSFLDNMSSIKFLDLSENSFSGPLPDDLFRNSFSLRYLSLA  180

Query  810   GSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPI  989
             G+  +GPIPSSL  C+ LN +NLSNN FSGDP F  GIW L RLR LD+S+NE SGS+P 
Sbjct  181   GNLLQGPIPSSLLSCSSLNTINLSNNYFSGDPDFVTGIWSLERLRKLDLSHNEFSGSVPR  240

Query  990   GASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             G S +HNLKEL L  N FSG +PVD+GLCPHL+RLD S NLF+G +PESLQR
Sbjct  241   GVSAIHNLKELQLQGNRFSGPLPVDIGLCPHLNRLDFSSNLFSGALPESLQR  292


 Score =   108 bits (271),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 126/215 (59%), Gaps = 5/215 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             + E+ L G   SG +   +    HLN L  +SN FSG +   L  L+++   + SKN ++
Sbjct  248   LKELQLQGNRFSGPLPVDIGLCPHLNRLDFSSNLFSGALPESLQRLSSINYFSSSKNMLT  307

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G  P  +G++S+L++LDLS N+L+G +S S + +L SLR+LSL+ +   G IP+S+  CT
Sbjct  308   GEFPRWIGSLSNLEYLDLSSNALTGSISSS-IGDLKSLRYLSLSDNKLLGNIPASIVSCT  366

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGAS-FLHNLKELSLGS  1034
             +L+ + L  N F+G      G++ L  L  +D S+N L+GS+P G+S F  +L  L L  
Sbjct  367   MLSVIRLRGNSFNGS--IPEGLFELG-LEGVDFSHNGLTGSIPSGSSTFFTSLHTLDLSR  423

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             N+ +G IP ++GL   L  L+LS N     +P  L
Sbjct  424   NNLTGHIPAEMGLSSDLRYLNLSWNNLESRMPPEL  458


 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 106/203 (52%), Gaps = 5/203 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGT  683
             VD    GL+G I  G       L+ L L+ NN +G I  ++GL ++L+ LNLS N++   
Sbjct  394   VDFSHNGLTGSIPSGSSTFFTSLHTLDLSRNNLTGHIPAEMGLSSDLRYLNLSWNNLESR  453

Query  684   VPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLL  863
             +P  LG   +L  LDL  N+L+G +   + E+ GSL  L L G+S  G +P  +  C+ L
Sbjct  454   MPPELGYFQNLTVLDLRSNALAGSIPADICES-GSLNILQLDGNSLVGQVPEEIGNCSSL  512

Query  864   NHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHF  1043
               L+LS N  SG       I  L +L+ L +  NEL+G +P     L NL  +++  N  
Sbjct  513   YLLSLSQNNLSGS--IPKSISRLDKLKILKLEFNELTGEVPQELGKLENLLAVNISYNKL  570

Query  1044  SGEIPVDLGLCPHLSRLDLSENL  1112
              G +PV  G+ P L +  L  NL
Sbjct  571   IGRLPVG-GIFPSLDQSALQGNL  592



>ref|XP_004296675.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=1006

 Score =   314 bits (805),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 164/264 (62%), Positives = 212/264 (80%), Gaps = 1/264 (0%)
 Frame = +3

Query  354   LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
             +QLN DVLGL+VFKS + DP+S+L++W+EDDDSPC+WNF++C+P+ GRVS+++L GLGL 
Sbjct  26    VQLNYDVLGLLVFKSDLHDPSSYLSSWNEDDDSPCSWNFIQCNPSTGRVSQLNLDGLGLK  85

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVISPqlgllt-nlqtlnlSKNSISGTVPDSLGNMS  710
             GK G+GL+ L+HL VLSL+ NNF+G +SP+   L  +LQTLNLS+NS SG VP +L N S
Sbjct  86    GKPGKGLQNLQHLKVLSLSGNNFTGELSPEKLALPPSLQTLNLSRNSFSGLVPTTLVNFS  145

Query  711   SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNR  890
             S++FLDLS NSLSG + DS+     SLR+LSL+G+  EG +PS+LSKC+ LN LN+SNNR
Sbjct  146   SIRFLDLSQNSLSGSLPDSLFGACSSLRYLSLSGNLLEGNLPSTLSKCSSLNSLNISNNR  205

Query  891   FSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLG  1070
             FSG+P F  GIW L RLR+LD+SNN LSG +P G S +HNLKE+ +  NHFSG IP D+G
Sbjct  206   FSGNPDFESGIWSLKRLRSLDLSNNALSGFVPKGISSIHNLKEILIQRNHFSGTIPFDIG  265

Query  1071  LCPHLSRLDLSENLFTGTIPESLQ  1142
             LCPHL R+D SENLFTG +P+SLQ
Sbjct  266   LCPHLGRIDFSENLFTGELPQSLQ  289


 Score = 92.8 bits (229),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 107/189 (57%), Gaps = 4/189 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + E+D   +GL+G I  G  KL E L +L L+ NN  G I  ++GL +NL+ LN S N++
Sbjct  389   LEEIDFSNMGLTGSIPPGSSKLFESLKMLDLSRNNLKGNIPAEVGLFSNLRYLNFSWNNL  448

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
                +P  LG  S+L  LDL  ++LSGP+   + ++ GSL  L L G+S  GPIP  +  C
Sbjct  449   QSRIPPELGFFSNLTVLDLRNSALSGPIPGEICDS-GSLDILQLDGNSLTGPIPDEIGNC  507

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             + L  ++LS+N  SG       I  L +L  L +  NELSG +P+    L NL  +++  
Sbjct  508   SSLYLMSLSHNNLSG--VIPKSISKLGKLVILKLEFNELSGEIPLELGKLENLLAVNISY  565

Query  1035  NHFSGEIPV  1061
             N  +G +PV
Sbjct  566   NRLTGRLPV  574


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 79/258 (31%), Positives = 123/258 (48%), Gaps = 47/258 (18%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL    LSG + +G+  + +L  + +  N+FSG I   +GL  +L  ++ S+N  
Sbjct  221   RLRSLDLSNNALSGFVPKGISSIHNLKEILIQRNHFSGTIPFDIGLCPHLGRIDFSENLF  280

Query  675   SGTVPDSL------------------------GNMSSLQFLDLSGNSLSGPVSDSMLENL  782
             +G +P SL                        GN+SSL++LD S N  +G +  SM  +L
Sbjct  281   TGELPQSLQMLNFLTFMSLSDNMFNGDFPQWIGNLSSLEYLDFSNNGFTGSLPPSM-GDL  339

Query  783   GSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG---DPRFSGGI-------WGL  932
              SL +LSL+ +   G +P+SL  C  L+ + L  N FSG   +  F  G+        GL
Sbjct  340   RSLSYLSLSNNKLVGTLPTSLVYCNKLSVIRLRGNDFSGSIPEGLFDLGLEEIDFSNMGL  399

Query  933   T------------RLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLC  1076
             T             L+ LD+S N L G++P       NL+ L+   N+    IP +LG  
Sbjct  400   TGSIPPGSSKLFESLKMLDLSRNNLKGNIPAEVGLFSNLRYLNFSWNNLQSRIPPELGFF  459

Query  1077  PHLSRLDLSENLFTGTIP  1130
              +L+ LDL  +  +G IP
Sbjct  460   SNLTVLDLRNSALSGPIP  477


 Score = 67.8 bits (164),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 66/229 (29%), Positives = 108/229 (47%), Gaps = 25/229 (11%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
              +G   + +  L  L  L  ++N F+G + P +G L +L  L+LS N + GT+P SL   
Sbjct  304   FNGDFPQWIGNLSSLEYLDFSNNGFTGSLPPSMGDLRSLSYLSLSNNKLVGTLPTSLVYC  363

Query  708   SSLQFLDLSGNSLSGPVSDSMLE---------NLG--------------SLRFLSLAGSS  818
             + L  + L GN  SG + + + +         N+G              SL+ L L+ ++
Sbjct  364   NKLSVIRLRGNDFSGSIPEGLFDLGLEEIDFSNMGLTGSIPPGSSKLFESLKMLDLSRNN  423

Query  819   FEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGAS  998
              +G IP+ +   + L +LN S N      R    +   + L  LD+ N+ LSG +P    
Sbjct  424   LKGNIPAEVGLFSNLRYLNFSWNNLQS--RIPPELGFFSNLTVLDLRNSALSGPIPGEIC  481

Query  999   FLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
                +L  L L  N  +G IP ++G C  L  + LS N  +G IP+S+ +
Sbjct  482   DSGSLDILQLDGNSLTGPIPDEIGNCSSLYLMSLSHNNLSGVIPKSISK  530



>ref|XP_010268319.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=1009

 Score =   313 bits (803),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 166/264 (63%), Positives = 206/264 (78%), Gaps = 0/264 (0%)
 Frame = +3

Query  351   SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
             SLQLNDDVLGLIVFK+ + DP+S L +W+EDD++PC+W +V+C P++GRV+E+ L GLGL
Sbjct  32    SLQLNDDVLGLIVFKTDLHDPSSLLGSWNEDDNTPCSWKYVRCDPSSGRVTELSLDGLGL  91

Query  531   SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  710
             SGKIGRGLEKL++L VLSL+ NNF+G ISP+L L+ +L TLNLS NS+SG +P  LGNMS
Sbjct  92    SGKIGRGLEKLQNLQVLSLSHNNFTGDISPELSLIGSLTTLNLSHNSLSGRIPVELGNMS  151

Query  711   SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNR  890
             +L+FLDLS NSLSGP+ D + +N  SL F S A +  EGP+P++LS+CT L  LNLSNN 
Sbjct  152   ALRFLDLSENSLSGPLPDGLFQNCFSLHFFSSAWNILEGPVPATLSRCTSLVGLNLSNNH  211

Query  891   FSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLG  1070
             FSG+P F  G+W L  LR+LD+S N  SGS+P G S L NLK L    NHFSG IP DLG
Sbjct  212   FSGNPDFVNGVWSLKNLRSLDISRNAFSGSVPDGISALDNLKNLQFQGNHFSGPIPADLG  271

Query  1071  LCPHLSRLDLSENLFTGTIPESLQ  1142
             LC HL+ LDLS NLFTG +PESLQ
Sbjct  272   LCQHLTHLDLSNNLFTGALPESLQ  295


 Score = 87.0 bits (214),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 84/236 (36%), Positives = 124/236 (53%), Gaps = 23/236 (10%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +  +   G   SG I   L   +HL  L L++N F+G +   L  L+ L+ L+LS N  S
Sbjct  252   LKNLQFQGNHFSGPIPADLGLCQHLTHLDLSNNLFTGALPESLQRLSLLRFLSLSDNLFS  311

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G  P  + NMSSL++LD SGNS +G +  +M + L  L +LSL+G+   G +P++L+ C 
Sbjct  312   GDFPWWISNMSSLEYLDFSGNSFTGNLPATM-DQLKLLSYLSLSGNRLTGGVPATLAYCY  370

Query  858   LLNHLNLSNNRFSGD-PR----------------FSGGI-WGLTRL----RTLDVSNNEL  971
              L+ + L  N F+G  P+                FSG I  G +RL    R LD+S N+L
Sbjct  371   RLSAIRLRGNGFNGSIPQGLFDLGLEEIDLSRNEFSGSIPAGSSRLFESLRALDLSANKL  430

Query  972   SGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +G +P       NL+ L+L  N     +P +LG   +LS LDL  +   G+IPE L
Sbjct  431   TGDIPAEMGLFSNLRYLNLSWNSLRSRLPPELGYFQNLSVLDLRNSALYGSIPEDL  486


 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 121/236 (51%), Gaps = 29/236 (12%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +D+     SG +  G+  L++L  L    N+FSG I   LGL  +L  L+LS N  +G +
Sbjct  231   LDISRNAFSGSVPDGISALDNLKNLQFQGNHFSGPIPADLGLCQHLTHLDLSNNLFTGAL  290

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGP------------  830
             P+SL  +S L+FL LS N  SG      + N+ SL +L  +G+SF G             
Sbjct  291   PESLQRLSLLRFLSLSDNLFSGDFP-WWISNMSSLEYLDFSGNSFTGNLPATMDQLKLLS  349

Query  831   ------------IPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELS  974
                         +P++L+ C  L+ + L  N F+G      G++ L  L  +D+S NE S
Sbjct  350   YLSLSGNRLTGGVPATLAYCYRLSAIRLRGNGFNGS--IPQGLFDLG-LEEIDLSRNEFS  406

Query  975   GSLPIGASFL-HNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             GS+P G+S L  +L+ L L +N  +G+IP ++GL  +L  L+LS N     +P  L
Sbjct  407   GSIPAGSSRLFESLRALDLSANKLTGDIPAEMGLFSNLRYLNLSWNSLRSRLPPEL  462


 Score = 69.3 bits (168),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 78/213 (37%), Positives = 111/213 (52%), Gaps = 5/213 (2%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVI-SPqlglltnlqtlnlSKNS  671
             R+S + L G G +G I +GL  L  L  + L+ N FSG I +    L  +L+ L+LS N 
Sbjct  371   RLSAIRLRGNGFNGSIPQGLFDL-GLEEIDLSRNEFSGSIPAGSSRLFESLRALDLSANK  429

Query  672   ISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSK  851
             ++G +P  +G  S+L++L+LS NSL   +    L    +L  L L  S+  G IP  L  
Sbjct  430   LTGDIPAEMGLFSNLRYLNLSWNSLRSRLPPE-LGYFQNLSVLDLRNSALYGSIPEDLCD  488

Query  852   CTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLG  1031
              T L  L L  N  +G       I   + L  L +SNN+L+GS+P   S L  LK L L 
Sbjct  489   STSLAILQLDGNSLTGP--IPDEIGNCSSLYLLSLSNNQLNGSIPKAMSRLKKLKILKLE  546

Query  1032  SNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
              N  SGEIP +LG   +L  +++S N   G +P
Sbjct  547   FNELSGEIPQELGKLDNLLAVNISYNKLVGRLP  579


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 111/206 (54%), Gaps = 5/206 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + E+DL     SG I  G  +L E L  L L++N  +G I  ++GL +NL+ LNLS NS+
Sbjct  395   LEEIDLSRNEFSGSIPAGSSRLFESLRALDLSANKLTGDIPAEMGLFSNLRYLNLSWNSL  454

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
                +P  LG   +L  LDL  ++L G + + + ++  SL  L L G+S  GPIP  +  C
Sbjct  455   RSRLPPELGYFQNLSVLDLRNSALYGSIPEDLCDST-SLAILQLDGNSLTGPIPDEIGNC  513

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             + L  L+LSNN+ +G       +  L +L+ L +  NELSG +P     L NL  +++  
Sbjct  514   SSLYLLSLSNNQLNGS--IPKAMSRLKKLKILKLEFNELSGEIPQELGKLDNLLAVNISY  571

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENL  1112
             N   G +PV  G+  +L +  L  NL
Sbjct  572   NKLVGRLPVG-GIFQNLDQSALQGNL  596



>ref|XP_002302895.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE82168.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=1012

 Score =   313 bits (802),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 176/293 (60%), Positives = 230/293 (78%), Gaps = 2/293 (1%)
 Frame = +3

Query  273   IMGFRsmlllvflsvlsvTSGAGGAES--LQLNDDVLGLIVFKSGVQDPASHLATWSEDD  446
             +MG+  +LL + +S++    G  G++S  +Q+NDDV GLIVFK+ + DP+S+L++W+EDD
Sbjct  6     VMGYSHLLLYLLVSIVVSLEGCMGSDSVPIQINDDVFGLIVFKADLIDPSSYLSSWNEDD  65

Query  447   DSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPql  626
             DSPC+W F++C+P +GRVS+V L GLGLSG++G+GL+KL+HL  LSL+ NNFSG IS +L
Sbjct  66    DSPCSWKFIECNPVSGRVSQVSLDGLGLSGRLGKGLQKLQHLKTLSLSQNNFSGGISLEL  125

Query  627   glltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSL  806
             G L+NL+ LNLS NS+SG +P  L NMSS++FLDLS NS SGP+ D++  N  SLR+LSL
Sbjct  126   GFLSNLERLNLSHNSLSGLIPSFLDNMSSIKFLDLSENSFSGPLPDNLFRNSHSLRYLSL  185

Query  807   AGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLP  986
             AG+  +GPIPSSL  C+ LN +NLSNN FSGDP FS GIW L RLR LD+S+NE SGS+P
Sbjct  186   AGNLLQGPIPSSLLSCSSLNTINLSNNHFSGDPDFSSGIWSLKRLRKLDLSHNEFSGSVP  245

Query  987   IGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              G S +H LKEL L  N FSG +P D+GLCPHL+RLDLS NLF+G +PESLQR
Sbjct  246   QGVSAIHFLKELQLQGNRFSGPLPGDIGLCPHLNRLDLSRNLFSGALPESLQR  298


 Score =   105 bits (262),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 126/215 (59%), Gaps = 5/215 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             + E+ L G   SG +   +    HLN L L+ N FSG +   L  L+++   +LSKN ++
Sbjct  254   LKELQLQGNRFSGPLPGDIGLCPHLNRLDLSRNLFSGALPESLQRLSSMSLFSLSKNMLA  313

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G  P  +G++++L++LDLS N+L+G +  S + +L SLR+LSL+ +   G IP+S+  CT
Sbjct  314   GEFPRWIGSLTNLEYLDLSSNALTGSIPSS-IGDLKSLRYLSLSNNKLFGIIPTSMVSCT  372

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGA-SFLHNLKELSLGS  1034
             +L+ + L  N F+G      G++ L RL  +D S+N L GS+P G+ +F  +L  L L  
Sbjct  373   MLSVIRLRGNSFNGS--IPEGLFDL-RLEEVDFSDNGLVGSIPSGSITFFSSLHTLDLSK  429

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             N+ +G IP + GL  +L  L+LS N     +P  L
Sbjct  430   NNLTGHIPAERGLSSNLRYLNLSWNNLESRMPLEL  464


 Score = 75.1 bits (183),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 76/207 (37%), Positives = 107/207 (52%), Gaps = 5/207 (2%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRG-LEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  671
             R+ EVD    GL G I  G +     L+ L L+ NN +G I  + GL +NL+ LNLS N+
Sbjct  396   RLEEVDFSDNGLVGSIPSGSITFFSSLHTLDLSKNNLTGHIPAERGLSSNLRYLNLSWNN  455

Query  672   ISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSK  851
             +   +P  LG   +L  LDL  ++L G +   + E+ GSL  L L G+S  G IP  +  
Sbjct  456   LESRMPLELGYFQNLTVLDLRNSALVGLIPADICES-GSLNILQLDGNSLVGQIPEEIGN  514

Query  852   CTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLG  1031
             C+ L  L+LS N  SG       I  L +L+ L +  NEL+G +P     L NL  +++ 
Sbjct  515   CSSLYLLSLSQNNLSGS--IPESISRLNKLKILKLEFNELTGEIPQELGKLENLLAVNVS  572

Query  1032  SNHFSGEIPVDLGLCPHLSRLDLSENL  1112
              N   G +PV  G+ P L R  L  NL
Sbjct  573   YNKLVGRLPVG-GIFPSLDRSALQGNL  598



>ref|XP_006840189.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Amborella trichopoda]
 gb|ERN01864.1| hypothetical protein AMTR_s00089p00108500 [Amborella trichopoda]
Length=975

 Score =   310 bits (793),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 163/264 (62%), Positives = 201/264 (76%), Gaps = 0/264 (0%)
 Frame = +3

Query  351   SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
             SLQLNDDVLGLIVFK+G+QDP S L++WSEDDDSPC WNFV+C   +GRV+EV L GL L
Sbjct  33    SLQLNDDVLGLIVFKAGIQDPTSSLSSWSEDDDSPCHWNFVQCDRNSGRVTEVSLDGLSL  92

Query  531   SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  710
             SGKIGRGLEKL++L  LSL++NNFSG I+P+L  + +L+ LNLS+NS+SG++P SLGNMS
Sbjct  93    SGKIGRGLEKLQNLQALSLSNNNFSGTINPELARIESLRRLNLSRNSLSGSIPPSLGNMS  152

Query  711   SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNR  890
             S+Q LD S NSLSG + D +  N  SLRF++L G+SFEG +P +LSKC  L  LNLS+N 
Sbjct  153   SIQVLDFSENSLSGTIPDYVFNNCFSLRFVNLGGNSFEGSLPYTLSKCMFLGGLNLSSNH  212

Query  891   FSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLG  1070
               GDP F  GIW L RLR LD+SNN  SG +P G + LHNLKEL L  N FSG +P+D+G
Sbjct  213   LQGDPDFVNGIWLLKRLRVLDLSNNGFSGPVPEGVAGLHNLKELHLQGNLFSGSLPLDIG  272

Query  1071  LCPHLSRLDLSENLFTGTIPESLQ  1142
              C HL  LD S N+F+G +P S Q
Sbjct  273   FCIHLMHLDFSNNIFSGALPSSFQ  296


 Score = 77.4 bits (189),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 70/221 (32%), Positives = 104/221 (47%), Gaps = 33/221 (15%)
 Frame = +3

Query  468   FVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlq  647
               KC     R+SE+       +G +   L   E L VL L+ N+  G I P++   +NL 
Sbjct  367   LAKCD----RLSEIRFRDNLFNGTMA--LLPFESLQVLDLSKNDLRGSIPPEIIFCSNLT  420

Query  648   tlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEG  827
               NLS NS+   +P  LG++  L  LDL  + L G +++++  +  SL  L+L G+S  G
Sbjct  421   YFNLSWNSLDSRIPPELGDLHMLSELDLRYSGLHGSIAENLCSS-KSLSVLALDGNSLSG  479

Query  828   PIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLH  1007
             PIP  +  C+                           L  L +SNN L+GS+P     L 
Sbjct  480   PIPQEIGSCS--------------------------NLYVLSLSNNSLNGSIPSSLLKLQ  513

Query  1008  NLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
              L+ L++  N  SGEIP +LG    L  ++LS N  TG +P
Sbjct  514   KLEVLNMALNKLSGEIPQELGGLESLVAVNLSYNQLTGRLP  554


 Score = 59.7 bits (143),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 66/213 (31%), Positives = 95/213 (45%), Gaps = 35/213 (16%)
 Frame = +3

Query  588   ASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN---------------------  704
             A NN  G + P +G + +LQ L+ S N   G +PDSLGN                     
Sbjct  307   AGNNLMGELPPWIGNMKSLQYLDFSSNGFKGILPDSLGNLKLLSYLSLSHNSLSGSIPES  366

Query  705   ------MSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
                   +S ++F D   N  +G ++   L    SL+ L L+ +   G IP  +  C+ L 
Sbjct  367   LAKCDRLSEIRFRD---NLFNGTMA---LLPFESLQVLDLSKNDLRGSIPPEIIFCSNLT  420

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
             + NLS N    D R    +  L  L  LD+  + L GS+        +L  L+L  N  S
Sbjct  421   YFNLSWNSL--DSRIPPELGDLHMLSELDLRYSGLHGSIAENLCSSKSLSVLALDGNSLS  478

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             G IP ++G C +L  L LS N   G+IP SL +
Sbjct  479   GPIPQEIGSCSNLYVLSLSNNSLNGSIPSSLLK  511



>gb|KJB37929.1| hypothetical protein B456_006G227000 [Gossypium raimondii]
Length=988

 Score =   309 bits (792),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 159/271 (59%), Positives = 211/271 (78%), Gaps = 0/271 (0%)
 Frame = +3

Query  333   GAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  512
             G   + S+QLNDDVLGLIVFKS ++DP+S+L +W+EDD+SPC+W F+KC+P NGRVSEV 
Sbjct  28    GDDESSSVQLNDDVLGLIVFKSDIKDPSSYLESWNEDDNSPCSWRFIKCNPNNGRVSEVS  87

Query  513   LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  692
             L GLGLSGKIG+GL+KLE+L VLSL+ NNFSG+I    G+L +L+ L+LS N++SG++P 
Sbjct  88    LDGLGLSGKIGKGLQKLEYLKVLSLSRNNFSGIIGRAFGVLNSLERLDLSYNNLSGSIPS  147

Query  693   SLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHL  872
             +  NM+S++FLDLS NSLSG + + + +   SLRFLSL+ +SF+G +PS+LSKC+ LN+L
Sbjct  148   TFVNMNSIRFLDLSRNSLSGSIPEELFQTCSSLRFLSLSENSFDGQLPSTLSKCSYLNYL  207

Query  873   NLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGE  1052
             N+S N FSG+  F  GIW + RLR LD+S N  SGS+P G   LH LK+L L  N FSG 
Sbjct  208   NVSKNHFSGNIDFVSGIWSMYRLRALDLSYNSFSGSVPEGVLALHYLKQLHLQFNGFSGP  267

Query  1053  IPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             +P D+GLCPHL+ LD S NLF+G +P+SLQR
Sbjct  268   MPADIGLCPHLNSLDFSHNLFSGPLPDSLQR  298


 Score = 92.4 bits (228),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 110/206 (53%), Gaps = 5/206 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + ++DL    L+G I RG   L E L  L L+ NN  G I  ++GL  NL+ LNLS N +
Sbjct  373   LEDMDLSDNRLNGSIPRGSSSLFESLRNLDLSRNNLEGTIPAEMGLFANLRYLNLSWNKL  432

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
               ++P  LG   +L  LDL  N+LSG V+  + E+ GSL  L L G+S  GPIP  +  C
Sbjct  433   ESSIPPELGLFPNLTMLDLRNNALSGDVAGDICES-GSLVILQLDGNSLTGPIPDEIGNC  491

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             + L  L LS+N  +G       I  LT L+ L +  NELSG +P     L NL  +++  
Sbjct  492   SSLYSLTLSHNNLTGS--IPKSISKLTELKILKLEFNELSGEIPKELGLLENLLAVNVSY  549

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENL  1112
             N   G +PV  G+ P L +  L  NL
Sbjct  550   NQLIGRLPVG-GIFPSLDQSALQGNL  574


 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 111/211 (53%), Gaps = 5/211 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             + ++ L   G SG +   +    HLN L  + N FSG +   L  L +L   +LS N  +
Sbjct  254   LKQLHLQFNGFSGPMPADIGLCPHLNSLDFSHNLFSGPLPDSLQRLNSLVFFSLSYNMFT  313

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
                P  +  +SSL+ LD S NSL+G +  S   NL +L++L L+ +   G IP+ L    
Sbjct  314   SEFPSWISTLSSLEHLDFSSNSLTGSLPSST-GNLKTLKYLRLSNNKLVGSIPAGLFDLG  372

Query  858   LLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             L   ++LS+NR +G  PR S  ++    LR LD+S N L G++P       NL+ L+L  
Sbjct  373   L-EDMDLSDNRLNGSIPRGSSSLF--ESLRNLDLSRNNLEGTIPAEMGLFANLRYLNLSW  429

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTI  1127
             N     IP +LGL P+L+ LDL  N  +G +
Sbjct  430   NKLESSIPPELGLFPNLTMLDLRNNALSGDV  460


 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 73/229 (32%), Positives = 113/229 (49%), Gaps = 25/229 (11%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
              SG +   L++L  L   SL+ N F+      +  L++L+ L+ S NS++G++P S GN+
Sbjct  288   FSGPLPDSLQRLNSLVFFSLSYNMFTSEFPSWISTLSSLEHLDFSSNSLTGSLPSSTGNL  347

Query  708   SSLQFLDLSGNSLSGPVS----DSMLENLG-------------------SLRFLSLAGSS  818
              +L++L LS N L G +     D  LE++                    SLR L L+ ++
Sbjct  348   KTLKYLRLSNNKLVGSIPAGLFDLGLEDMDLSDNRLNGSIPRGSSSLFESLRNLDLSRNN  407

Query  819   FEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGAS  998
              EG IP+ +     L +LNLS N+         G++    L  LD+ NN LSG +     
Sbjct  408   LEGTIPAEMGLFANLRYLNLSWNKLESSIPPELGLF--PNLTMLDLRNNALSGDVAGDIC  465

Query  999   FLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
                +L  L L  N  +G IP ++G C  L  L LS N  TG+IP+S+ +
Sbjct  466   ESGSLVILQLDGNSLTGPIPDEIGNCSSLYSLTLSHNNLTGSIPKSISK  514



>ref|XP_008453972.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=1010

 Score =   310 bits (793),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 206/265 (78%), Gaps = 1/265 (0%)
 Frame = +3

Query  351   SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
             S QLNDD+LGLIVFKS + DP+S L++WSEDDDSPC+W F+KC+P NGRVSEV + GLGL
Sbjct  29    SPQLNDDILGLIVFKSDLHDPSSALSSWSEDDDSPCSWKFIKCNPINGRVSEVSIDGLGL  88

Query  531   SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  710
             SG+IGRGLEKL+HL VLSL+ NNF+G ++PQL L  +L  +N S+NS+SG +P SL +MS
Sbjct  89    SGRIGRGLEKLQHLKVLSLSGNNFTGNLNPQLALPPSLDRVNFSRNSLSGRIPVSLISMS  148

Query  711   SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSL-SKCTLLNHLNLSNN  887
             S++FLD S N LSGP+ D M  N  SL +LSLA + F+GP+P++L + C  LN LNLS N
Sbjct  149   SVRFLDFSDNLLSGPLPDEMFVNCSSLHYLSLASNMFQGPVPNTLPTSCLYLNTLNLSTN  208

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDL  1067
             +FSG   F+ GIW LTRLRTLD+SNN+ SG LP G S +HNLKEL L +N FSG +P DL
Sbjct  209   QFSGSVNFAPGIWSLTRLRTLDLSNNDFSGVLPQGISAIHNLKELKLQNNQFSGPLPSDL  268

Query  1068  GLCPHLSRLDLSENLFTGTIPESLQ  1142
             GLC HL++LD+S N  TG +P S++
Sbjct  269   GLCLHLAKLDVSGNRLTGPLPNSMR  293


 Score = 99.0 bits (245),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 127/240 (53%), Gaps = 29/240 (12%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL     SG + +G+  + +L  L L +N FSG +   LGL  +L  L++S N +
Sbjct  225   RLRTLDLSNNDFSGVLPQGISAIHNLKELKLQNNQFSGPLPSDLGLCLHLAKLDVSGNRL  284

Query  675   SGTVPDSL------------------------GNMSSLQFLDLSGNSLSGPVSDSMLENL  782
             +G +P+S+                        GNM+ L+++D S N  +G +  +M   L
Sbjct  285   TGPLPNSMRLLTSLTFFNIGFNSFSDELPQWIGNMTRLEYMDFSSNGFTGSLPLTM-GVL  343

Query  783   GSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSN  962
              S++++S + +   G IP +L +C+ L+ + L  NRF+G  R   G++ L  L  +D+S 
Sbjct  344   RSVKYMSFSNNKLTGNIPETLMECSELSVIKLEGNRFNG--RVPEGLFELG-LEEMDLSK  400

Query  963   NELSGSLPIGASFLH-NLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             NEL GS+P+G+S L+  L  + L SN   G  P ++GL  +L  L+LS N F   IP  +
Sbjct  401   NELIGSIPVGSSKLYEKLTRMDLSSNRLEGNFPAEMGLYRNLRYLNLSWNEFKAKIPPEM  460


 Score = 92.4 bits (228),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 71/194 (37%), Positives = 109/194 (56%), Gaps = 7/194 (4%)
 Frame = +3

Query  567   HLNVLSLASNNFSGVI--SPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             +LN L+L++N FSG +  +P +  LT L+TL+LS N  SG +P  +  + +L+ L L  N
Sbjct  199   YLNTLNLSTNQFSGSVNFAPGIWSLTRLRTLDLSNNDFSGVLPQGISAIHNLKELKLQNN  258

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PRFSG  917
               SGP+   +   L  L  L ++G+   GP+P+S+   T L   N+  N FS + P++ G
Sbjct  259   QFSGPLPSDLGLCL-HLAKLDVSGNRLTGPLPNSMRLLTSLTFFNIGFNSFSDELPQWIG  317

Query  918   GIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLD  1097
                 +TRL  +D S+N  +GSLP+    L ++K +S  +N  +G IP  L  C  LS + 
Sbjct  318   N---MTRLEYMDFSSNGFTGSLPLTMGVLRSVKYMSFSNNKLTGNIPETLMECSELSVIK  374

Query  1098  LSENLFTGTIPESL  1139
             L  N F G +PE L
Sbjct  375   LEGNRFNGRVPEGL  388


 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 110/218 (50%), Gaps = 14/218 (6%)
 Frame = +3

Query  489   NGRV---------SEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlgllt  638
             NGRV          E+DL    L G I  G  KL E L  + L+SN   G    ++GL  
Sbjct  381   NGRVPEGLFELGLEEMDLSKNELIGSIPVGSSKLYEKLTRMDLSSNRLEGNFPAEMGLYR  440

Query  639   nlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSS  818
             NL+ LNLS N     +P  +G   +L  LD+  + L G +   + ++ GSL+ L L G+S
Sbjct  441   NLRYLNLSWNEFKAKIPPEMGLFENLNVLDIRSSDLYGSIPGELCDS-GSLKILQLDGNS  499

Query  819   FEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGAS  998
               GPIP  +  C  L  L+LS+N  SG+      I  L++L  L + +NELSG +P    
Sbjct  500   LVGPIPDEIGNCLSLYLLSLSHNNLSGE--IPKSISKLSKLEILRLESNELSGEIPQELG  557

Query  999   FLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENL  1112
              L NL  +++  N  +G +PV  G+ P L +  L  NL
Sbjct  558   ILQNLLAVNISYNMLTGRLPVG-GIFPSLDQSALQGNL  594


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 67/219 (31%), Positives = 104/219 (47%), Gaps = 7/219 (3%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +D    G +G +   +  L  +  +S ++N  +G I   L   + L  + L  N  
Sbjct  321   RLEYMDFSSNGFTGSLPLTMGVLRSVKYMSFSNNKLTGNIPETLMECSELSVIKLEGNRF  380

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSG--PVSDSMLENLGSLRFLSLAGSSFEGPIPSSLS  848
             +G VP+ L  +  L+ +DLS N L G  PV  S L     L  + L+ +  EG  P+ + 
Sbjct  381   NGRVPEGLFELG-LEEMDLSKNELIGSIPVGSSKLYE--KLTRMDLSSNRLEGNFPAEMG  437

Query  849   KCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSL  1028
                 L +LNLS N F        G++    L  LD+ +++L GS+P       +LK L L
Sbjct  438   LYRNLRYLNLSWNEFKAKIPPEMGLF--ENLNVLDIRSSDLYGSIPGELCDSGSLKILQL  495

Query  1029  GSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
               N   G IP ++G C  L  L LS N  +G IP+S+ +
Sbjct  496   DGNSLVGPIPDEIGNCLSLYLLSLSHNNLSGEIPKSISK  534


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 98/207 (47%), Gaps = 9/207 (4%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L+G I   L +   L+V+ L  N F+G + P+      L+ ++LSKN + G++P     +
Sbjct  356   LTGNIPETLMECSELSVIKLEGNRFNGRV-PEGLFELGLEEMDLSKNELIGSIPVGSSKL  414

Query  708   -SSLQFLDLSGNSLSG--PVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNL  878
                L  +DLS N L G  P    +  NL   R+L+L+ + F+  IP  +     LN L++
Sbjct  415   YEKLTRMDLSSNRLEGNFPAEMGLYRNL---RYLNLSWNEFKAKIPPEMGLFENLNVLDI  471

Query  879   SNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
              ++   G     G +     L+ L +  N L G +P       +L  LSL  N+ SGEIP
Sbjct  472   RSSDLYGS--IPGELCDSGSLKILQLDGNSLVGPIPDEIGNCLSLYLLSLSHNNLSGEIP  529

Query  1059  VDLGLCPHLSRLDLSENLFTGTIPESL  1139
               +     L  L L  N  +G IP+ L
Sbjct  530   KSISKLSKLEILRLESNELSGEIPQEL  556



>ref|XP_010555905.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Tarenaya hassleriana]
Length=1017

 Score =   309 bits (791),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 167/270 (62%), Positives = 215/270 (80%), Gaps = 1/270 (0%)
 Frame = +3

Query  339   GGAESLQL-NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  515
             G   S+QL NDDVLGLIVFK+ ++DP+S+L +W+EDD SPC+W ++KC+P  GR+SEV L
Sbjct  24    GDVGSVQLLNDDVLGLIVFKADIEDPSSNLESWNEDDYSPCSWKYIKCNPVTGRISEVSL  83

Query  516   HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  695
              GL LSGKIGRG++KL++L VLSL+ N+F+G + P++GLL+NLQ LNLS+N +SG +P S
Sbjct  84    DGLALSGKIGRGIQKLQYLKVLSLSDNDFTGNVIPEIGLLSNLQNLNLSQNRLSGIIPAS  143

Query  696   LGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLN  875
             LG++SSL+FLDLS NS SG + D  L N  SLR+LSLA +  +GPIPSSLS+C+LLN L+
Sbjct  144   LGSISSLKFLDLSKNSFSGSLPDDFLTNCSSLRYLSLAKNMLDGPIPSSLSQCSLLNTLD  203

Query  876   LSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEI  1055
             LS+NRFSG+P F   IW L RLR LD+SNN LSGS+P G S LHNLKEL+L  N FSG +
Sbjct  204   LSSNRFSGNPGFVSAIWTLQRLRKLDLSNNSLSGSMPSGISSLHNLKELNLQGNQFSGSL  263

Query  1056  PVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             P D+G CPHL+RLDLS NLF+G +P + QR
Sbjct  264   PADVGSCPHLNRLDLSYNLFSGEVPSAFQR  293


 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 87/215 (40%), Positives = 124/215 (58%), Gaps = 5/215 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             + E++L G   SG +   +    HLN L L+ N FSG +      L +L  L+LS N +S
Sbjct  249   LKELNLQGNQFSGSLPADVGSCPHLNRLDLSYNLFSGEVPSAFQRLNSLMFLSLSHNLLS  308

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G  P  +G + SL+ LDLS N+L+G +  SM  NL SL+FL L+ +  +G IPSS+S CT
Sbjct  309   GDFPRWIGTLRSLEHLDLSNNALTGELPSSM-GNLRSLKFLVLSNNQLKGEIPSSVSDCT  367

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFL-HNLKELSLGS  1034
              L+ + L  N F+G  R   G++ L  L  +D+S+N L+GSLP+G+  L  +L+ L L  
Sbjct  368   ELSVIQLKGNSFTG--RIPDGLFDLG-LEEIDISHNGLTGSLPLGSRRLFESLRVLDLSC  424

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             N   G IP ++GL  HL  L+LS N     IP  L
Sbjct  425   NDLGGSIPGEVGLFIHLRYLNLSWNDLQTRIPPEL  459


 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 72/212 (34%), Positives = 107/212 (50%), Gaps = 28/212 (13%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + E+D+   GL+G +  G  +L E L VL L+ N+  G I  ++GL  +L+ LNLS N +
Sbjct  392   LEEIDISHNGLTGSLPLGSRRLFESLRVLDLSCNDLGGSIPGEVGLFIHLRYLNLSWNDL  451

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
                +P  LG + +L  LDL  +SLSG +  ++ E+  SL  L L G+S  GPIP  +  C
Sbjct  452   QTRIPPELGFLQNLTVLDLRHSSLSGSIPANICES-RSLEILQLDGNSLIGPIPEGIGNC  510

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
                                         L  L +S++ L+G +P   S LH L+ L L S
Sbjct  511   L--------------------------SLNLLSLSHDHLTGPIPKSLSNLHQLRILKLES  544

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             N  SGEIP +LG   +L  +++S N   G +P
Sbjct  545   NELSGEIPPELGKLQNLLAVNISYNRLVGKLP  576


 Score = 68.6 bits (166),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 103/214 (48%), Gaps = 3/214 (1%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +  +DL    L+G++   +  L  L  L L++N   G I   +   T L  + L  NS +
Sbjct  321   LEHLDLSNNALTGELPSSMGNLRSLKFLVLSNNQLKGEIPSSVSDCTELSVIQLKGNSFT  380

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G +PD L ++  L+ +D+S N L+G +         SLR L L+ +   G IP  +    
Sbjct  381   GRIPDGLFDLG-LEEIDISHNGLTGSLPLGSRRLFESLRVLDLSCNDLGGSIPGEVGLFI  439

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSN  1037
              L +LNLS N      R    +  L  L  LD+ ++ LSGS+P       +L+ L L  N
Sbjct  440   HLRYLNLSWNDLQT--RIPPELGFLQNLTVLDLRHSSLSGSIPANICESRSLEILQLDGN  497

Query  1038  HFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
                G IP  +G C  L+ L LS +  TG IP+SL
Sbjct  498   SLIGPIPEGIGNCLSLNLLSLSHDHLTGPIPKSL  531



>ref|XP_003518672.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=1007

 Score =   307 bits (787),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 165/262 (63%), Positives = 205/262 (78%), Gaps = 1/262 (0%)
 Frame = +3

Query  354   LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
             +QLNDDVLGLIVFKS + DP+S+LA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLS
Sbjct  31    VQLNDDVLGLIVFKSDLDDPSSYLASWNEDDANPCSWQFVQCNPESGRVSEVSLDGLGLS  90

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  713
             GKIGRGLEKL+HL VLSL+ N+ SG ISP L L  +L+ LNLS N++SG++P S  NM+S
Sbjct  91    GKIGRGLEKLQHLTVLSLSHNSLSGSISPSLTLSNSLERLNLSHNALSGSIPTSFVNMNS  150

Query  714   LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRF  893
             ++FLDLS NS SGPV +S  E+  SL  +SLA + F+GPIP SLS+C+ LN +NLSNNRF
Sbjct  151   IRFLDLSENSFSGPVPESFFESCSSLHHISLARNIFDGPIPGSLSRCSSLNSINLSNNRF  210

Query  894   SGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGL  1073
             SG+  FS GIW L RLRTLD+SNN LSGSLP G S +HN KE+ L  N FSG +  D+G 
Sbjct  211   SGNVDFS-GIWSLNRLRTLDLSNNALSGSLPNGISSIHNFKEILLQGNQFSGPLSTDIGF  269

Query  1074  CPHLSRLDLSENLFTGTIPESL  1139
             C HLSRLD S+N  +G +PESL
Sbjct  270   CLHLSRLDFSDNQLSGELPESL  291


 Score = 97.8 bits (242),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 83/237 (35%), Positives = 121/237 (51%), Gaps = 29/237 (12%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL    LSG +  G+  + +   + L  N FSG +S  +G   +L  L+ S N +
Sbjct  224   RLRTLDLSNNALSGSLPNGISSIHNFKEILLQGNQFSGPLSTDIGFCLHLSRLDFSDNQL  283

Query  675   SGTVPDSLG------------------------NMSSLQFLDLSGNSLSGPVSDSMLENL  782
             SG +P+SLG                        NM++L++L+LS N  +G +  S+ E L
Sbjct  284   SGELPESLGMLSSLSYFKASNNHFNSEFPQWIGNMTNLEYLELSNNQFTGSIPQSIGE-L  342

Query  783   GSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSN  962
              SL  LS++ +   G IPSSLS CT L+ + L  N F+G       ++GL  L  +D+S+
Sbjct  343   RSLTHLSISNNKLVGTIPSSLSSCTKLSVVQLRGNGFNGT--IPEALFGLG-LEDIDLSH  399

Query  963   NELSGSLPIGAS-FLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             N LSGS+P G+S  L  L  L L  NH  G IP + GL   L  L+LS N     +P
Sbjct  400   NGLSGSIPPGSSRLLETLTNLDLSDNHLQGNIPAETGLLSKLRYLNLSWNDLHSQMP  456


 Score = 87.8 bits (216),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 71/203 (35%), Positives = 112/203 (55%), Gaps = 4/203 (2%)
 Frame = +3

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVIS-PqlglltnlqtlnlSKNSISGTVPDSLGNMS  710
             G I   L +   LN ++L++N FSG +    +  L  L+TL+LS N++SG++P+ + ++ 
Sbjct  188   GPIPGSLSRCSSLNSINLSNNRFSGNVDFSGIWSLNRLRTLDLSNNALSGSLPNGISSIH  247

Query  711   SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNR  890
             + + + L GN  SGP+S  +   L  L  L  + +   G +P SL   + L++   SNN 
Sbjct  248   NFKEILLQGNQFSGPLSTDIGFCL-HLSRLDFSDNQLSGELPESLGMLSSLSYFKASNNH  306

Query  891   FSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLG  1070
             F+ +  F   I  +T L  L++SNN+ +GS+P     L +L  LS+ +N   G IP  L 
Sbjct  307   FNSE--FPQWIGNMTNLEYLELSNNQFTGSIPQSIGELRSLTHLSISNNKLVGTIPSSLS  364

Query  1071  LCPHLSRLDLSENLFTGTIPESL  1139
              C  LS + L  N F GTIPE+L
Sbjct  365   SCTKLSVVQLRGNGFNGTIPEAL  387


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 71/205 (35%), Positives = 104/205 (51%), Gaps = 5/205 (2%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
              +G I + + +L  L  LS+++N   G I   L   T L  + L  N  +GT+P++L  +
Sbjct  331   FTGSIPQSIGELRSLTHLSISNNKLVGTIPSSLSSCTKLSVVQLRGNGFNGTIPEALFGL  390

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLS-N  884
               L+ +DLS N LSG +       L +L  L L+ +  +G IP+     + L +LNLS N
Sbjct  391   G-LEDIDLSHNGLSGSIPPGSSRLLETLTNLDLSDNHLQGNIPAETGLLSKLRYLNLSWN  449

Query  885   NRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVD  1064
             +  S  P   G +  LT    LD+ N+ L GS+P       NL  L L  N F G IP +
Sbjct  450   DLHSQMPPEFGLLQNLT---VLDLRNSALHGSIPADICDSGNLAVLQLDGNSFEGNIPSE  506

Query  1065  LGLCPHLSRLDLSENLFTGTIPESL  1139
             +G C  L  L  S N  TG+IP+S+
Sbjct  507   IGNCSSLYLLSSSHNNLTGSIPKSM  531


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 79/222 (36%), Positives = 111/222 (50%), Gaps = 19/222 (9%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKI-----GRGLEKLEHLNVLSLASNNFSGVISP-qlglltnlqtln  656
             ++S V L G G +G I     G GLE ++      L+ N  SG I P    LL  L  L+
Sbjct  368   KLSVVQLRGNGFNGTIPEALFGLGLEDID------LSHNGLSGSIPPGSSRLLETLTNLD  421

Query  657   lSKNSISGTVPDSLGNMSSLQFLDLSGNSLSG--PVSDSMLENLGSLRFLSLAGSSFEGP  830
             LS N + G +P   G +S L++L+LS N L    P    +L+NL     L L  S+  G 
Sbjct  422   LSDNHLQGNIPAETGLLSKLRYLNLSWNDLHSQMPPEFGLLQNL---TVLDLRNSALHGS  478

Query  831   IPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHN  1010
             IP+ +     L  L L  N F G+      I   + L  L  S+N L+GS+P   + L+ 
Sbjct  479   IPADICDSGNLAVLQLDGNSFEGN--IPSEIGNCSSLYLLSSSHNNLTGSIPKSMAKLNK  536

Query  1011  LKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPES  1136
             LK L L  N  SGEIP++LG+   L  +++S N  TG +P S
Sbjct  537   LKILKLEFNELSGEIPMELGMLQSLLAVNISYNRLTGRLPTS  578



>gb|KHG00472.1| hypothetical protein F383_20103 [Gossypium arboreum]
Length=989

 Score =   307 bits (786),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 159/271 (59%), Positives = 208/271 (77%), Gaps = 0/271 (0%)
 Frame = +3

Query  333   GAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  512
             G   + S+QLNDDVLGLIVFKS ++DP+S+L +W+EDD+SPC+W F+KC+P NGRVSEV 
Sbjct  29    GDDESSSVQLNDDVLGLIVFKSDIKDPSSYLESWNEDDNSPCSWRFIKCNPNNGRVSEVS  88

Query  513   LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  692
             L GLGLSGKIG+GL+KL +L VLSL+ N+FSG I    G+L +L+ L+LS N++SG++P 
Sbjct  89    LDGLGLSGKIGKGLQKLMYLKVLSLSRNDFSGTIGRAFGVLNSLERLDLSYNNLSGSIPS  148

Query  693   SLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHL  872
             +  NM+S++FLDLSGNSLSG + + + +   SLRFLSL+ +SF+G +PS+LSKC+ LN+L
Sbjct  149   TFVNMNSIRFLDLSGNSLSGSIPEELFQTCSSLRFLSLSENSFDGQLPSTLSKCSYLNYL  208

Query  873   NLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGE  1052
             NLS N FSG+  F  GIW + RLR LD+S N  SGS+P G   LH LK+L L  N FSG 
Sbjct  209   NLSKNHFSGNIDFVSGIWSMYRLRALDLSYNSFSGSVPEGVLALHYLKKLHLQFNGFSGP  268

Query  1053  IPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             +P D+GLCPHL  LD S NLF G +P+SLQR
Sbjct  269   MPADIGLCPHLDSLDFSHNLFNGPLPDSLQR  299


 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 109/206 (53%), Gaps = 5/206 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + ++DL    L+G I RG   L E L  L L+ NN  G I  ++GL  NL+ LNLS N +
Sbjct  374   LEDMDLSDNRLNGSIPRGSSSLFESLRNLDLSRNNLEGTIPAEMGLFANLRYLNLSWNKL  433

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
                +P  LG   +L  LDL  N+LSG V+  + E+ G+L  L L G+S  GPIP  +  C
Sbjct  434   ESRIPPELGLFPNLTVLDLRNNALSGDVAGDICES-GTLVILQLDGNSLTGPIPDEIGNC  492

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             + L  L LS+N  +G       I  LT L+ L +  NELSG +P     L NL  +++  
Sbjct  493   SSLYSLTLSHNNLTGS--IPKSISKLTELKILKLEFNELSGEIPKELGLLENLLAVNVSY  550

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENL  1112
             N   G +PV  G+ P L +  L  NL
Sbjct  551   NQLIGRLPVG-GIFPSLDQSALQGNL  575


 Score = 89.4 bits (220),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 80/236 (34%), Positives = 119/236 (50%), Gaps = 29/236 (12%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL     SG +  G+  L +L  L L  N FSG +   +GL  +L +L+ S N  
Sbjct  230   RLRALDLSYNSFSGSVPEGVLALHYLKKLHLQFNGFSGPMPADIGLCPHLDSLDFSHNLF  289

Query  675   SGTVPDSL------------------------GNMSSLQFLDLSGNSLSGPVSDSMLENL  782
             +G +PDSL                         ++SSL+ LD S NSL+G +  S   NL
Sbjct  290   NGPLPDSLQRLNLLVFFSLSNNMFTSEFPPWISSLSSLEHLDFSSNSLTGSLPSST-GNL  348

Query  783   GSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVS  959
              +L++L L+ +   G IP+ L    L   ++LS+NR +G  PR S  ++    LR LD+S
Sbjct  349   KTLKYLRLSNNKLVGSIPAGLFDLGL-EDMDLSDNRLNGSIPRGSSSLF--ESLRNLDLS  405

Query  960   NNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTI  1127
              N L G++P       NL+ L+L  N     IP +LGL P+L+ LDL  N  +G +
Sbjct  406   RNNLEGTIPAEMGLFANLRYLNLSWNKLESRIPPELGLFPNLTVLDLRNNALSGDV  461


 Score = 80.5 bits (197),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 73/229 (32%), Positives = 114/229 (50%), Gaps = 25/229 (11%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
              +G +   L++L  L   SL++N F+    P +  L++L+ L+ S NS++G++P S GN+
Sbjct  289   FNGPLPDSLQRLNLLVFFSLSNNMFTSEFPPWISSLSSLEHLDFSSNSLTGSLPSSTGNL  348

Query  708   SSLQFLDLSGNSLSGPVS----DSMLENLG-------------------SLRFLSLAGSS  818
              +L++L LS N L G +     D  LE++                    SLR L L+ ++
Sbjct  349   KTLKYLRLSNNKLVGSIPAGLFDLGLEDMDLSDNRLNGSIPRGSSSLFESLRNLDLSRNN  408

Query  819   FEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGAS  998
              EG IP+ +     L +LNLS N+   + R    +     L  LD+ NN LSG +     
Sbjct  409   LEGTIPAEMGLFANLRYLNLSWNKL--ESRIPPELGLFPNLTVLDLRNNALSGDVAGDIC  466

Query  999   FLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
                 L  L L  N  +G IP ++G C  L  L LS N  TG+IP+S+ +
Sbjct  467   ESGTLVILQLDGNSLTGPIPDEIGNCSSLYSLTLSHNNLTGSIPKSISK  515



>gb|KHN27185.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=1007

 Score =   306 bits (785),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 164/262 (63%), Positives = 205/262 (78%), Gaps = 1/262 (0%)
 Frame = +3

Query  354   LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
             +QLNDDVLGLIVFKS + DP+S+LA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLS
Sbjct  31    VQLNDDVLGLIVFKSDLDDPSSYLASWNEDDANPCSWQFVQCNPESGRVSEVSLDGLGLS  90

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  713
             GKIGRGLEKL+HL VLSL+ N+ SG ISP L L  +L+ LNLS N++SG++P S  NM+S
Sbjct  91    GKIGRGLEKLQHLTVLSLSHNSLSGSISPSLTLSNSLERLNLSHNALSGSIPTSFVNMNS  150

Query  714   LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRF  893
             ++FLDLS NS SGPV +S  E+  SL  +SLA + F+GP+P SLS+C+ LN +NLSNNRF
Sbjct  151   IRFLDLSENSFSGPVPESFFESCSSLHHISLARNIFDGPVPGSLSRCSSLNSINLSNNRF  210

Query  894   SGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGL  1073
             SG+  FS GIW L RLRTLD+SNN LSGSLP G S +HN KE+ L  N FSG +  D+G 
Sbjct  211   SGNVDFS-GIWSLNRLRTLDLSNNALSGSLPNGISSIHNFKEILLQGNQFSGPLSTDIGF  269

Query  1074  CPHLSRLDLSENLFTGTIPESL  1139
             C HLSRLD S+N  +G +PESL
Sbjct  270   CLHLSRLDFSDNQLSGELPESL  291


 Score = 97.8 bits (242),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 83/237 (35%), Positives = 121/237 (51%), Gaps = 29/237 (12%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL    LSG +  G+  + +   + L  N FSG +S  +G   +L  L+ S N +
Sbjct  224   RLRTLDLSNNALSGSLPNGISSIHNFKEILLQGNQFSGPLSTDIGFCLHLSRLDFSDNQL  283

Query  675   SGTVPDSLG------------------------NMSSLQFLDLSGNSLSGPVSDSMLENL  782
             SG +P+SLG                        NM++L++L+LS N  +G +  S+ E L
Sbjct  284   SGELPESLGMLSSLSYFKASNNHFNSEFPQWIGNMTNLEYLELSNNQFTGSIPQSIGE-L  342

Query  783   GSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSN  962
              SL  LS++ +   G IPSSLS CT L+ + L  N F+G       ++GL  L  +D+S+
Sbjct  343   RSLTHLSISNNKLVGTIPSSLSSCTKLSVVQLRGNGFNGT--IPEALFGLG-LEDIDLSH  399

Query  963   NELSGSLPIGAS-FLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             N LSGS+P G+S  L  L  L L  NH  G IP + GL   L  L+LS N     +P
Sbjct  400   NGLSGSIPPGSSRLLETLTNLDLSDNHLQGNIPAETGLLSKLRYLNLSWNDLHSQMP  456


 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 71/205 (35%), Positives = 104/205 (51%), Gaps = 5/205 (2%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
              +G I + + +L  L  LS+++N   G I   L   T L  + L  N  +GT+P++L  +
Sbjct  331   FTGSIPQSIGELRSLTHLSISNNKLVGTIPSSLSSCTKLSVVQLRGNGFNGTIPEALFGL  390

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLS-N  884
               L+ +DLS N LSG +       L +L  L L+ +  +G IP+     + L +LNLS N
Sbjct  391   G-LEDIDLSHNGLSGSIPPGSSRLLETLTNLDLSDNHLQGNIPAETGLLSKLRYLNLSWN  449

Query  885   NRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVD  1064
             +  S  P   G +  LT    LD+ N+ L GS+P       NL  L L  N F G IP +
Sbjct  450   DLHSQMPPEFGLLQNLT---VLDLRNSALHGSIPADICDSGNLAVLQLDGNSFEGNIPSE  506

Query  1065  LGLCPHLSRLDLSENLFTGTIPESL  1139
             +G C  L  L  S N  TG+IP+S+
Sbjct  507   IGNCSSLYLLSSSHNNLTGSIPKSM  531


 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 79/222 (36%), Positives = 111/222 (50%), Gaps = 19/222 (9%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKI-----GRGLEKLEHLNVLSLASNNFSGVISP-qlglltnlqtln  656
             ++S V L G G +G I     G GLE ++      L+ N  SG I P    LL  L  L+
Sbjct  368   KLSVVQLRGNGFNGTIPEALFGLGLEDID------LSHNGLSGSIPPGSSRLLETLTNLD  421

Query  657   lSKNSISGTVPDSLGNMSSLQFLDLSGNSLSG--PVSDSMLENLGSLRFLSLAGSSFEGP  830
             LS N + G +P   G +S L++L+LS N L    P    +L+NL     L L  S+  G 
Sbjct  422   LSDNHLQGNIPAETGLLSKLRYLNLSWNDLHSQMPPEFGLLQNL---TVLDLRNSALHGS  478

Query  831   IPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHN  1010
             IP+ +     L  L L  N F G+      I   + L  L  S+N L+GS+P   + L+ 
Sbjct  479   IPADICDSGNLAVLQLDGNSFEGN--IPSEIGNCSSLYLLSSSHNNLTGSIPKSMAKLNK  536

Query  1011  LKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPES  1136
             LK L L  N  SGEIP++LG+   L  +++S N  TG +P S
Sbjct  537   LKILKLEFNELSGEIPMELGMLQSLLAVNISYNRLTGRLPTS  578



>gb|KHN13843.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=1007

 Score =   305 bits (782),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 163/262 (62%), Positives = 204/262 (78%), Gaps = 1/262 (0%)
 Frame = +3

Query  354   LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
             +QLNDDVLGLIVFKS + DP+S+LA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLS
Sbjct  31    VQLNDDVLGLIVFKSDLNDPSSYLASWNEDDANPCSWQFVQCNPESGRVSEVSLDGLGLS  90

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  713
             GKIGRGLEKL+HL VLSL+ NN SG ISP L L  +L+ LNLS N +SG++P S  NM+S
Sbjct  91    GKIGRGLEKLQHLTVLSLSHNNLSGSISPSLTLSNSLERLNLSHNVLSGSIPTSFVNMNS  150

Query  714   LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRF  893
             ++FLDLS NS SGP+ +S  E+  SL  +SLA + F+GP+P SLS+C+ LN +NLSNN F
Sbjct  151   IKFLDLSENSFSGPMPESFFESCSSLHHISLARNMFDGPVPGSLSRCSSLNSINLSNNHF  210

Query  894   SGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGL  1073
             SG+  FS GIW L RLRTLD+SNN LSGSLP G S +HN KE+ L  N FSG +  D+G 
Sbjct  211   SGNVDFS-GIWSLNRLRTLDLSNNALSGSLPNGISSIHNFKEILLQGNQFSGPLSTDIGF  269

Query  1074  CPHLSRLDLSENLFTGTIPESL  1139
             C HL+RLD S+N F+G +PESL
Sbjct  270   CLHLNRLDFSDNQFSGELPESL  291


 Score =   107 bits (267),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 83/210 (40%), Positives = 117/210 (56%), Gaps = 5/210 (2%)
 Frame = +3

Query  504   EVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGT  683
             E+ L G   SG +   +    HLN L  + N FSG +   LG+L++L     S N  +  
Sbjct  251   EILLQGNQFSGPLSTDIGFCLHLNRLDFSDNQFSGELPESLGMLSSLSYFKASNNHFNSE  310

Query  684   VPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLL  863
              P  +GNM+SL++L+LS N  +G +  S+ E L SL  LS++ +   G IPSSLS CT L
Sbjct  311   FPQWIGNMTSLEYLELSNNQFTGSIPQSIGE-LRSLTHLSISNNMLVGTIPSSLSFCTKL  369

Query  864   NHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGAS-FLHNLKELSLGSNH  1040
             + + L  N F+G      G++GL  L  +D+S+NELSGS+P G+S  L  L  L L  NH
Sbjct  370   SVVQLRGNGFNG--TIPEGLFGLG-LEEIDLSHNELSGSIPPGSSRLLETLTHLDLSDNH  426

Query  1041  FSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
               G IP + GL   L+ L+LS N     +P
Sbjct  427   LQGNIPAETGLLSKLTHLNLSWNDLHSQMP  456


 Score = 74.7 bits (182),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 101/204 (50%), Gaps = 3/204 (1%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
              +G I + + +L  L  LS+++N   G I   L   T L  + L  N  +GT+P+ L  +
Sbjct  331   FTGSIPQSIGELRSLTHLSISNNMLVGTIPSSLSFCTKLSVVQLRGNGFNGTIPEGLFGL  390

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
               L+ +DLS N LSG +       L +L  L L+ +  +G IP+     + L HLNLS N
Sbjct  391   G-LEEIDLSHNELSGSIPPGSSRLLETLTHLDLSDNHLQGNIPAETGLLSKLTHLNLSWN  449

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDL  1067
                       G+  L  L  LD+ N+ L GS+P       NL  L L  N F G IP ++
Sbjct  450   DLHSQMPPEFGL--LQNLAVLDLRNSALHGSIPADICDSGNLAVLQLDGNSFEGNIPSEI  507

Query  1068  GLCPHLSRLDLSENLFTGTIPESL  1139
             G C  L  L LS N  TG+IP+S+
Sbjct  508   GNCSSLYLLSLSHNNLTGSIPKSM  531


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 80/217 (37%), Positives = 109/217 (50%), Gaps = 9/217 (4%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISP-qlglltnlqtlnlSKNS  671
             ++S V L G G +G I  GL  L  L  + L+ N  SG I P    LL  L  L+LS N 
Sbjct  368   KLSVVQLRGNGFNGTIPEGLFGL-GLEEIDLSHNELSGSIPPGSSRLLETLTHLDLSDNH  426

Query  672   ISGTVPDSLGNMSSLQFLDLSGNSLSG--PVSDSMLENLGSLRFLSLAGSSFEGPIPSSL  845
             + G +P   G +S L  L+LS N L    P    +L+NL     L L  S+  G IP+ +
Sbjct  427   LQGNIPAETGLLSKLTHLNLSWNDLHSQMPPEFGLLQNLA---VLDLRNSALHGSIPADI  483

Query  846   SKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELS  1025
                  L  L L  N F G+      I   + L  L +S+N L+GS+P   S L+ LK L 
Sbjct  484   CDSGNLAVLQLDGNSFEGN--IPSEIGNCSSLYLLSLSHNNLTGSIPKSMSKLNKLKILK  541

Query  1026  LGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPES  1136
             L  N  SGEIP++LG+   L  +++S N  TG +P S
Sbjct  542   LEFNELSGEIPMELGMLQSLLAVNISYNRLTGRLPTS  578



>ref|XP_003552656.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=1007

 Score =   305 bits (782),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 163/262 (62%), Positives = 204/262 (78%), Gaps = 1/262 (0%)
 Frame = +3

Query  354   LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
             +QLNDDVLGLIVFKS + DP+S+LA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLS
Sbjct  31    VQLNDDVLGLIVFKSDLNDPSSYLASWNEDDANPCSWQFVQCNPESGRVSEVSLDGLGLS  90

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  713
             GKIGRGLEKL+HL VLSL+ NN SG ISP L L  +L+ LNLS N +SG++P S  NM+S
Sbjct  91    GKIGRGLEKLQHLTVLSLSHNNLSGSISPSLTLSNSLERLNLSHNVLSGSIPTSFVNMNS  150

Query  714   LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRF  893
             ++FLDLS NS SGP+ +S  E+  SL  +SLA + F+GP+P SLS+C+ LN +NLSNN F
Sbjct  151   IKFLDLSENSFSGPMPESFFESCSSLHHISLARNMFDGPVPGSLSRCSSLNSINLSNNHF  210

Query  894   SGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGL  1073
             SG+  FS GIW L RLRTLD+SNN LSGSLP G S +HN KE+ L  N FSG +  D+G 
Sbjct  211   SGNVDFS-GIWSLNRLRTLDLSNNALSGSLPNGISSVHNFKEILLQGNQFSGPLSTDIGF  269

Query  1074  CPHLSRLDLSENLFTGTIPESL  1139
             C HL+RLD S+N F+G +PESL
Sbjct  270   CLHLNRLDFSDNQFSGELPESL  291


 Score =   107 bits (267),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 83/210 (40%), Positives = 117/210 (56%), Gaps = 5/210 (2%)
 Frame = +3

Query  504   EVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGT  683
             E+ L G   SG +   +    HLN L  + N FSG +   LG+L++L     S N  +  
Sbjct  251   EILLQGNQFSGPLSTDIGFCLHLNRLDFSDNQFSGELPESLGMLSSLSYFKASNNHFNSE  310

Query  684   VPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLL  863
              P  +GNM+SL++L+LS N  +G +  S+ E L SL  LS++ +   G IPSSLS CT L
Sbjct  311   FPQWIGNMTSLEYLELSNNQFTGSIPQSIGE-LRSLTHLSISNNMLVGTIPSSLSFCTKL  369

Query  864   NHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGAS-FLHNLKELSLGSNH  1040
             + + L  N F+G      G++GL  L  +D+S+NELSGS+P G+S  L  L  L L  NH
Sbjct  370   SVVQLRGNGFNG--TIPEGLFGLG-LEEIDLSHNELSGSIPPGSSRLLETLTHLDLSDNH  426

Query  1041  FSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
               G IP + GL   L+ L+LS N     +P
Sbjct  427   LQGNIPAETGLLSKLTHLNLSWNDLHSQMP  456


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 80/217 (37%), Positives = 109/217 (50%), Gaps = 9/217 (4%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISP-qlglltnlqtlnlSKNS  671
             ++S V L G G +G I  GL  L  L  + L+ N  SG I P    LL  L  L+LS N 
Sbjct  368   KLSVVQLRGNGFNGTIPEGLFGL-GLEEIDLSHNELSGSIPPGSSRLLETLTHLDLSDNH  426

Query  672   ISGTVPDSLGNMSSLQFLDLSGNSLSG--PVSDSMLENLGSLRFLSLAGSSFEGPIPSSL  845
             + G +P   G +S L  L+LS N L    P    +L+NL     L L  S+  G IP+ +
Sbjct  427   LQGNIPAETGLLSKLTHLNLSWNDLHSQMPPEFGLLQNLA---VLDLRNSALHGSIPADI  483

Query  846   SKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELS  1025
                  L  L L  N F G+      I   + L  L +S+N L+GS+P   S L+ LK L 
Sbjct  484   CDSGNLAVLQLDGNSFEGN--IPSEIGNCSSLYLLSLSHNNLTGSIPKSMSKLNKLKILK  541

Query  1026  LGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPES  1136
             L  N  SGEIP++LG+   L  +++S N  TG +P S
Sbjct  542   LEFNELSGEIPMELGMLQSLLAVNISYNRLTGRLPTS  578



>gb|KFK33718.1| hypothetical protein AALP_AA5G051000 [Arabis alpina]
Length=1018

 Score =   304 bits (779),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 212/265 (80%), Gaps = 2/265 (1%)
 Frame = +3

Query  351   SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
             S+QLNDDVLGLIVFKS +QDP+SHL++W+EDD+SPC+W++VKC+P   RV+E+ L+GL L
Sbjct  30    SIQLNDDVLGLIVFKSDLQDPSSHLSSWNEDDNSPCSWSYVKCNPKTSRVTELSLNGLSL  89

Query  531   SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  710
             +GKIGRG++KL+HL VLSL++NNF+G I   L    NL+ L+LS N++SG++P S G++S
Sbjct  90    TGKIGRGIQKLQHLKVLSLSNNNFTGNII-ALSKNNNLKKLDLSNNNLSGSIP-SFGSIS  147

Query  711   SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNR  890
             SLQ+LDL+GNS SG +SD    N  SLRFLSL+ ++ +G IPS+L +C++LN LNLS+N 
Sbjct  148   SLQYLDLTGNSFSGTLSDEFFNNCSSLRFLSLSQNNLQGQIPSTLFQCSVLNSLNLSSNG  207

Query  891   FSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLG  1070
             FSG+P F  G+W L RLRTLD+S N LSGS+P+G   LHNLKEL L  N FSG +P D+G
Sbjct  208   FSGNPSFVSGLWTLQRLRTLDLSFNALSGSIPLGILSLHNLKELHLQGNQFSGSLPSDIG  267

Query  1071  LCPHLSRLDLSENLFTGTIPESLQR  1145
             LCPHL+R+DLS N F+G +P +LQ+
Sbjct  268   LCPHLNRVDLSFNRFSGELPRTLQK  292


 Score = 82.0 bits (201),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 107/217 (49%), Gaps = 4/217 (2%)
 Frame = +3

Query  489   NGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKN  668
             NG V  +D    GL+GK+   +  L  L  L L+ NN SG I   L     L+ + L  N
Sbjct  318   NGLV-HLDFSSNGLTGKLPSSVGNLRSLKDLILSKNNISGEIPESLESCKELEIIQLKGN  376

Query  669   SISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLS  848
               +G++PD L ++  LQ +D SGN L+G +         SL  L L+ +S  G IP  + 
Sbjct  377   GFTGSIPDGLFDLG-LQEMDFSGNGLTGLIPRGSSRLFESLTMLDLSRNSLNGNIPGEVG  435

Query  849   KCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSL  1028
                 L +LNLS N F  + R    I  L  L  LD+ N+ L GS+P       +L+ L L
Sbjct  436   LFIHLRYLNLSWNNF--NTRVPPEIEFLQNLTVLDLRNSALIGSIPADICESQSLQILQL  493

Query  1029  GSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
               N  +G IP  +G C  L  L LS N  TG IP+SL
Sbjct  494   DGNSLTGSIPEGIGNCSSLKLLSLSHNNITGPIPKSL  530


 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 67/213 (31%), Positives = 103/213 (48%), Gaps = 28/213 (13%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + E+D  G GL+G I RG  +L E L +L L                        S+NS+
Sbjct  391   LQEMDFSGNGLTGLIPRGSSRLFESLTMLDL------------------------SRNSL  426

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
             +G +P  +G    L++L+LS N+ +  V    +E L +L  L L  S+  G IP+ + + 
Sbjct  427   NGNIPGEVGLFIHLRYLNLSWNNFNTRVPPE-IEFLQNLTVLDLRNSALIGSIPADICES  485

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
               L  L L  N  +G      GI   + L+ L +S+N ++G +P   S L  LK L L  
Sbjct  486   QSLQILQLDGNSLTGS--IPEGIGNCSSLKLLSLSHNNITGPIPKSLSNLEQLKILKLEV  543

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPE  1133
             N  SGEIP +LG   +L  +++S N   G +P+
Sbjct  544   NKLSGEIPKELGELQNLLLVNISFNRLIGRLPD  576



>ref|XP_004152295.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis sativus]
 gb|KGN53091.1| Receptor protein kinase [Cucumis sativus]
Length=1007

 Score =   304 bits (779),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 160/263 (61%), Positives = 202/263 (77%), Gaps = 1/263 (0%)
 Frame = +3

Query  357   QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             QLNDD+LGLIVFKS +QDP+S L++WSEDDDSPC+W F+KC+P NGRVSEV + GLGLSG
Sbjct  31    QLNDDILGLIVFKSDLQDPSSVLSSWSEDDDSPCSWKFIKCNPINGRVSEVSIDGLGLSG  90

Query  537   KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  716
             +IGRGLEKL+HL VLSL+ NNF+G +SPQL L  +L  +N S NS+SG +P SL +MSS+
Sbjct  91    RIGRGLEKLQHLKVLSLSGNNFTGNLSPQLVLPPSLDRVNFSGNSLSGRIPVSLISMSSI  150

Query  717   QFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSL-SKCTLLNHLNLSNNRF  893
             +FLD S N LSGP+ D M  N  SL +LSLA +  +GP+P++L ++C  LN LNLS N+F
Sbjct  151   RFLDFSDNLLSGPLPDEMFVNCSSLHYLSLASNMLQGPVPNTLPTRCLYLNTLNLSTNQF  210

Query  894   SGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGL  1073
             SG   F+ GIW L RLRTLD+S N+ SG LP G S +HNLKEL L +N FSG +P DLGL
Sbjct  211   SGSLNFAPGIWSLARLRTLDLSKNDFSGVLPQGISAIHNLKELKLQNNQFSGPLPSDLGL  270

Query  1074  CPHLSRLDLSENLFTGTIPESLQ  1142
             C HL+ LD+S N  TG +P S++
Sbjct  271   CVHLATLDVSGNRLTGPLPNSMR  293


 Score = 93.6 bits (231),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 76/241 (32%), Positives = 125/241 (52%), Gaps = 29/241 (12%)
 Frame = +3

Query  492   GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  671
              R+  +DL     SG + +G+  + +L  L L +N FSG +   LGL  +L TL++S N 
Sbjct  224   ARLRTLDLSKNDFSGVLPQGISAIHNLKELKLQNNQFSGPLPSDLGLCVHLATLDVSGNR  283

Query  672   ISGTVPDSL------------------------GNMSSLQFLDLSGNSLSGPVSDSMLEN  779
             ++G +P+S+                        GNM  L+++D S N  +G +  +M   
Sbjct  284   LTGPLPNSMRLLTSLTFLNIGFNSFSDELPQWIGNMGRLEYMDFSSNGFTGSLPLTM-GG  342

Query  780   LGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVS  959
             L S++++S + +   G IP +L +C+ L+ + L  N  +G  R   G++ L  L  +D+S
Sbjct  343   LRSVKYMSFSNNKLTGNIPETLMECSELSVIKLEGNSLNG--RVPEGLFELG-LEEMDLS  399

Query  960   NNELSGSLPIGASFLH-NLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPES  1136
              NEL GS+P+G+S L+  L  + L SN   G  P ++GL  +L  L+LS N F   IP  
Sbjct  400   KNELIGSIPVGSSRLYEKLTRMDLSSNRLEGNFPAEMGLYRNLRYLNLSWNEFKAKIPPE  459

Query  1137  L  1139
             +
Sbjct  460   M  460


 Score = 81.6 bits (200),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 116/215 (54%), Gaps = 5/215 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             ++ +D+ G  L+G +   +  L  L  L++  N+FS  +   +G +  L+ ++ S N  +
Sbjct  274   LATLDVSGNRLTGPLPNSMRLLTSLTFLNIGFNSFSDELPQWIGNMGRLEYMDFSSNGFT  333

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G++P ++G + S++++  S N L+G + ++++E    L  + L G+S  G +P  L +  
Sbjct  334   GSLPLTMGGLRSVKYMSFSNNKLTGNIPETLME-CSELSVIKLEGNSLNGRVPEGLFELG  392

Query  858   LLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             L   ++LS N   G  P  S  ++   +L  +D+S+N L G+ P       NL+ L+L  
Sbjct  393   L-EEMDLSKNELIGSIPVGSSRLY--EKLTRMDLSSNRLEGNFPAEMGLYRNLRYLNLSW  449

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             N F  +IP ++GL  +L+ LD+  +   G+IP  L
Sbjct  450   NEFKAKIPPEMGLFENLNVLDIRSSDLYGSIPGEL  484


 Score = 75.9 bits (185),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 76/218 (35%), Positives = 110/218 (50%), Gaps = 14/218 (6%)
 Frame = +3

Query  489   NGRV---------SEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlgllt  638
             NGRV          E+DL    L G I  G  +L E L  + L+SN   G    ++GL  
Sbjct  381   NGRVPEGLFELGLEEMDLSKNELIGSIPVGSSRLYEKLTRMDLSSNRLEGNFPAEMGLYR  440

Query  639   nlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSS  818
             NL+ LNLS N     +P  +G   +L  LD+  + L G +   + ++ GSL+ L L G+S
Sbjct  441   NLRYLNLSWNEFKAKIPPEMGLFENLNVLDIRSSDLYGSIPGELCDS-GSLKILQLDGNS  499

Query  819   FEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGAS  998
               GPIP  +  C  L  L+LS+N  SG+      I  L++L  L + +NELSG +P    
Sbjct  500   LVGPIPDEIGNCLSLYLLSLSHNNLSGE--IPKSISKLSKLEILRLESNELSGEIPQELG  557

Query  999   FLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENL  1112
              L NL  +++  N  +G +PV  G+ P L +  L  NL
Sbjct  558   ILQNLLAVNISYNMLTGRLPVG-GIFPSLDQSALQGNL  594


 Score = 68.6 bits (166),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 107/220 (49%), Gaps = 7/220 (3%)
 Frame = +3

Query  492   GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  671
             GR+  +D    G +G +   +  L  +  +S ++N  +G I   L   + L  + L  NS
Sbjct  320   GRLEYMDFSSNGFTGSLPLTMGGLRSVKYMSFSNNKLTGNIPETLMECSELSVIKLEGNS  379

Query  672   ISGTVPDSLGNMSSLQFLDLSGNSLSG--PVSDSMLENLGSLRFLSLAGSSFEGPIPSSL  845
             ++G VP+ L  +  L+ +DLS N L G  PV  S L     L  + L+ +  EG  P+ +
Sbjct  380   LNGRVPEGLFELG-LEEMDLSKNELIGSIPVGSSRLYE--KLTRMDLSSNRLEGNFPAEM  436

Query  846   SKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELS  1025
                  L +LNLS N F        G++    L  LD+ +++L GS+P       +LK L 
Sbjct  437   GLYRNLRYLNLSWNEFKAKIPPEMGLF--ENLNVLDIRSSDLYGSIPGELCDSGSLKILQ  494

Query  1026  LGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             L  N   G IP ++G C  L  L LS N  +G IP+S+ +
Sbjct  495   LDGNSLVGPIPDEIGNCLSLYLLSLSHNNLSGEIPKSISK  534



>ref|XP_010514517.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   304 bits (778),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 157/269 (58%), Positives = 207/269 (77%), Gaps = 1/269 (0%)
 Frame = +3

Query  339   GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  518
             G  +S+QLNDDVLGLIVFKS + DP+SHL +W+EDD+SPC+W++VKC+P   RV+++ L 
Sbjct  27    GEIDSIQLNDDVLGLIVFKSDLNDPSSHLESWNEDDNSPCSWSYVKCNPKTSRVTDLTLD  86

Query  519   GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  698
             GL L+GKIGRG++KL+HL VLSL++NNF+G I+  L    NL+ L+LS N++SG +P SL
Sbjct  87    GLALTGKIGRGIQKLQHLKVLSLSNNNFTGNIN-ALSTNNNLRKLDLSHNNLSGQIPSSL  145

Query  699   GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNL  878
             G++SSLQ LDL+GNS SG +SD    N  SLR+LSL+ +  EG IPS+L +C++LN LNL
Sbjct  146   GSISSLQHLDLTGNSFSGTLSDDFFNNCSSLRYLSLSHNHLEGQIPSTLFRCSVLNSLNL  205

Query  879   SNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
             S NRF+G+P F  GIW L RLR LD+S N L GS+P+G   LHNLK L L  N F G +P
Sbjct  206   SRNRFTGNPSFVSGIWKLERLRVLDLSFNSLYGSVPLGILSLHNLKWLQLQRNQFQGPLP  265

Query  1059  VDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              D+GLCPHL+R+DLS NLF+G +P +LQR
Sbjct  266   SDIGLCPHLNRVDLSFNLFSGELPRTLQR  294


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 80/260 (31%), Positives = 118/260 (45%), Gaps = 47/260 (18%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             ++ VDL     SG++ R L++L  LN   L++N  SG     +  +T+L  ++ S N ++
Sbjct  274   LNRVDLSFNLFSGELPRTLQRLRSLNHFDLSNNLLSGDFPVWISDMTSLVHVDFSSNELT  333

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G +P ++GN+ SL+ L LS N LSG + +S LE+   L  + L G+ F G IP  L    
Sbjct  334   GELPSTIGNLRSLKDLILSKNKLSGELPES-LESCNELMIVQLKGNGFVGNIPDGLFDLG  392

Query  858   L------------------------LNHLNLSNNRFSGD---------------------  902
             L                        L  L+LS N+ +G+                     
Sbjct  393   LQEMDFSGNGFTGSIPRGSSRLFESLVRLDLSRNKLTGNIPGEVGLFIHMKYLNLSWNHF  452

Query  903   -PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
               R    I  L  L  LD+ N+ L GS+P+      +L+ L L  N  +G IP  +G C 
Sbjct  453   NTRVPPEIEFLQNLTVLDLRNSALIGSVPVDICESQSLQILQLDGNSLTGSIPEGIGNCS  512

Query  1080  HLSRLDLSENLFTGTIPESL  1139
              L  L LS N  TG IP+SL
Sbjct  513   SLKLLSLSHNNLTGPIPKSL  532


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 105/209 (50%), Gaps = 5/209 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISP-qlglltnlqtlnlSKNSISGT  683
             V L G G  G I  GL  L  L  +  + N F+G I      L  +L  L+LS+N ++G 
Sbjct  373   VQLKGNGFVGNIPDGLFDL-GLQEMDFSGNGFTGSIPRGSSRLFESLVRLDLSRNKLTGN  431

Query  684   VPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLL  863
             +P  +G    +++L+LS N  +  V    +E L +L  L L  S+  G +P  + +   L
Sbjct  432   IPGEVGLFIHMKYLNLSWNHFNTRVPPE-IEFLQNLTVLDLRNSALIGSVPVDICESQSL  490

Query  864   NHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHF  1043
               L L  N  +G      GI   + L+ L +S+N L+G +P   S L  LK L L +N  
Sbjct  491   QILQLDGNSLTGS--IPEGIGNCSSLKLLSLSHNNLTGPIPKSLSNLQELKILKLEANKL  548

Query  1044  SGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             +GEIP +LG   +L  +++S N F G +P
Sbjct  549   TGEIPKELGELQNLLLVNVSFNRFIGRLP  577



>ref|NP_189443.2| probably inactive leucine-rich repeat receptor-like protein kinase 
[Arabidopsis thaliana]
 sp|Q9LRT1.1|Y3804_ARATH RecName: Full=Probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB01126.1| receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59324.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE77394.1| probably inactive leucine-rich repeat receptor-like protein kinase 
[Arabidopsis thaliana]
Length=1016

 Score =   304 bits (778),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 156/269 (58%), Positives = 207/269 (77%), Gaps = 1/269 (0%)
 Frame = +3

Query  339   GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  518
             G  +S+QLNDDVLGLIVFKS + DP SHL +W+EDD++PC+W++VKC+P   RV E+ L 
Sbjct  26    GDTDSIQLNDDVLGLIVFKSDLNDPFSHLESWTEDDNTPCSWSYVKCNPKTSRVIELSLD  85

Query  519   GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  698
             GL L+GKI RG++KL+ L VLSL++NNF+G I+  L    +LQ L+LS N++SG +P SL
Sbjct  86    GLALTGKINRGIQKLQRLKVLSLSNNNFTGNIN-ALSNNNHLQKLDLSHNNLSGQIPSSL  144

Query  699   GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNL  878
             G+++SLQ LDL+GNS SG +SD +  N  SLR+LSL+ +  EG IPS+L +C++LN LNL
Sbjct  145   GSITSLQHLDLTGNSFSGTLSDDLFNNCSSLRYLSLSHNHLEGQIPSTLFRCSVLNSLNL  204

Query  879   SNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
             S NRFSG+P F  GIW L RLR LD+S+N LSGS+P+G   LHNLKEL L  N FSG +P
Sbjct  205   SRNRFSGNPSFVSGIWRLERLRALDLSSNSLSGSIPLGILSLHNLKELQLQRNQFSGALP  264

Query  1059  VDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              D+GLCPHL+R+DLS N F+G +P +LQ+
Sbjct  265   SDIGLCPHLNRVDLSSNHFSGELPRTLQK  293


 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 98/204 (48%), Gaps = 3/204 (1%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L+GK+   +  L  L  L+L+ N  SG +   L     L  + L  N  SG +PD   ++
Sbjct  331   LTGKLPSSISNLRSLKDLNLSENKLSGEVPESLESCKELMIVQLKGNDFSGNIPDGFFDL  390

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
               LQ +D SGN L+G +         SL  L L+ +S  G IP  +     + +LNLS N
Sbjct  391   G-LQEMDFSGNGLTGSIPRGSSRLFESLIRLDLSHNSLTGSIPGEVGLFIHMRYLNLSWN  449

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDL  1067
              F  + R    I  L  L  LD+ N+ L GS+P       +L+ L L  N  +G IP  +
Sbjct  450   HF--NTRVPPEIEFLQNLTVLDLRNSALIGSVPADICESQSLQILQLDGNSLTGSIPEGI  507

Query  1068  GLCPHLSRLDLSENLFTGTIPESL  1139
             G C  L  L LS N  TG IP+SL
Sbjct  508   GNCSSLKLLSLSHNNLTGPIPKSL  531



>ref|XP_008337525.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=1009

 Score =   301 bits (772),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 164/264 (62%), Positives = 214/264 (81%), Gaps = 1/264 (0%)
 Frame = +3

Query  357   QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             QLN+DVLGL+VFKS + DP+S+LA+W+ED++SPC+W +V+C+PA GRVS++ L GLGL G
Sbjct  32    QLNNDVLGLLVFKSDIHDPSSYLASWNEDENSPCSWEYVQCNPATGRVSQLSLEGLGLKG  91

Query  537   KIGRGLEKLEHLNVLSLASNNFSGVISPqlgllt-nlqtlnlSKNSISGTVPDSLGNMSS  713
             KIG+GL+ L++L VLSL+SNNFSG ISP+   L  NL+ LNLS NS+SG +P +L NMSS
Sbjct  92    KIGKGLQNLQNLKVLSLSSNNFSGDISPEKLALPPNLEKLNLSHNSLSGLIPTNLFNMSS  151

Query  714   LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRF  893
             ++FLDLS NSLSGP+ D++ +N  SLR+LSL+G+  EGP+PS+L +C+ LN LNLSNN F
Sbjct  152   IKFLDLSENSLSGPLPDNLFDNCFSLRYLSLSGNLLEGPLPSTLPRCSSLNSLNLSNNHF  211

Query  894   SGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGL  1073
             SG+P F+ GIW LTRLRTLD+SNN  SG +  G S +HNLKEL L SNHFSG +P D+GL
Sbjct  212   SGNPDFASGIWSLTRLRTLDLSNNAFSGYVSQGISAVHNLKELLLQSNHFSGSLPADIGL  271

Query  1074  CPHLSRLDLSENLFTGTIPESLQR  1145
             CPHL ++DLS N+FT  + +SLQR
Sbjct  272   CPHLEKIDLSYNMFTDALQDSLQR  295


 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 81/240 (34%), Positives = 122/240 (51%), Gaps = 29/240 (12%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSG----------------------  608
             R+  +DL     SG + +G+  + +L  L L SN+FSG                      
Sbjct  226   RLRTLDLSNNAFSGYVSQGISAVHNLKELLLQSNHFSGSLPADIGLCPHLEKIDLSYNMF  285

Query  609   --VISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENL  782
                +   L  L +L   +LS N  SG  P  +G+MSSL++LD S N  +G +  SM  +L
Sbjct  286   TDALQDSLQRLNSLTFFSLSDNMFSGDFPQWIGSMSSLKYLDFSNNGFTGSLPPSM-SDL  344

Query  783   GSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSN  962
              SL +LSL+ +   G IP+SL+ C  L+ + L  N F+G      G++ L  L  +D S+
Sbjct  345   RSLNYLSLSNNKLVGTIPTSLAYCNDLSVIRLRGNTFTGS--IPEGLFNLG-LEEIDFSH  401

Query  963   NELSGSLPIGASFL-HNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
               L+GS+P G+S L  +L+ L L SN+  G IP ++GL  +L  L+LS N     +P  L
Sbjct  402   MGLTGSIPPGSSKLFESLRMLDLSSNNLKGNIPAEVGLFSNLRYLNLSWNNLQSRMPPEL  461


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 105/211 (50%), Gaps = 3/211 (1%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +D    G +G +   +  L  LN LSL++N   G I   L    +L  + L  N+ +G++
Sbjct  326   LDFSNNGFTGSLPPSMSDLRSLNYLSLSNNKLVGTIPTSLAYCNDLSVIRLRGNTFTGSI  385

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P+ L N+  L+ +D S   L+G +     +   SLR L L+ ++ +G IP+ +   + L 
Sbjct  386   PEGLFNLG-LEEIDFSHMGLTGSIPPGSSKLFESLRMLDLSSNNLKGNIPAEVGLFSNLR  444

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
             +LNLS N      R    +     L  LD+ N+ L GS+P       +L  L L  N  +
Sbjct  445   YLNLSWNNLQS--RMPPELGFFQNLTVLDLRNSALFGSIPEDVCDSASLAILQLDGNSLT  502

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             G IP ++G C  L  + LS N  +GTIP+S+
Sbjct  503   GSIPDEIGNCSSLYLMSLSHNNLSGTIPKSI  533


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 72/212 (34%), Positives = 108/212 (51%), Gaps = 28/212 (13%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + E+D   +GL+G I  G  KL E L +L L+SNN  G I  ++GL +NL+ LNLS N++
Sbjct  394   LEEIDFSHMGLTGSIPPGSSKLFESLRMLDLSSNNLKGNIPAEVGLFSNLRYLNLSWNNL  453

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
                +P  LG   +L  LDL  ++L G + + + ++  SL  L L G+S  G IP  +  C
Sbjct  454   QSRMPPELGFFQNLTVLDLRNSALFGSIPEDVCDS-ASLAILQLDGNSLTGSIPDEIGNC  512

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             +                           L  + +S+N LSG++P   S L+ LK L L  
Sbjct  513   S--------------------------SLYLMSLSHNNLSGTIPKSISKLNKLKILKLEF  546

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             N  SGEIP +LG   +L  +++S N   G +P
Sbjct  547   NELSGEIPQELGKLENLLAVNISYNRLVGRLP  578



>ref|XP_010425587.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   301 bits (771),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 154/269 (57%), Positives = 207/269 (77%), Gaps = 1/269 (0%)
 Frame = +3

Query  339   GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  518
             G  +++QLNDDVLGLIVFKS + DP+SHL +W+EDD+SPC+W++VKC+P   RV+++ L 
Sbjct  27    GEIDTIQLNDDVLGLIVFKSDLDDPSSHLESWNEDDNSPCSWSYVKCNPKTSRVTDLTLD  86

Query  519   GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  698
             GL L+GKIGRG++KL+HL VLSL++NNF+G ++  L    NL+ L+LS N++SG +P SL
Sbjct  87    GLALTGKIGRGIQKLQHLKVLSLSNNNFTGNLN-ALSTNNNLRKLDLSHNNLSGQIPSSL  145

Query  699   GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNL  878
             G++SSLQ LDL+GNS +G +SD    N  SLR+LSL+ +  EG IP +L +C++LN LNL
Sbjct  146   GSISSLQHLDLTGNSFTGTLSDDFFNNCSSLRYLSLSHNHLEGQIPRTLFRCSVLNSLNL  205

Query  879   SNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
             S NRFSG+P F  GIW L RLR LD+S N LSGS+P+G   LHNLK L L  N F G +P
Sbjct  206   SRNRFSGNPSFVSGIWKLERLRVLDLSFNSLSGSIPLGILSLHNLKWLQLQRNQFQGPLP  265

Query  1059  VDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              D+GLCPHL+R+DLS N+F+G +P +LQR
Sbjct  266   SDIGLCPHLNRVDLSFNIFSGELPRTLQR  294


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 116/240 (48%), Gaps = 27/240 (11%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL    LSG I  G+  L +L  L L  N F G +   +GL  +L  ++LS N  
Sbjct  225   RLRVLDLSFNSLSGSIPLGILSLHNLKWLQLQRNQFQGPLPSDIGLCPHLNRVDLSFNIF  284

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGP----VSD-------------------SMLENLG  785
             SG +P +L  + SL   DLS N LSG     +SD                   S + NL 
Sbjct  285   SGELPRTLQRLRSLYHFDLSNNLLSGDFPVWISDMTGLIHMDFSSNDLTGELPSSIGNLR  344

Query  786   SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNN  965
             SL+ L L+ +   G +P SL  C  L  + L  N F G      G++ L  L+ +D+S N
Sbjct  345   SLKHLILSKNKLSGELPESLESCNELMVVQLKGNGFVGS--IPDGLFDLG-LQEMDISGN  401

Query  966   ELSGSLPIGASFL-HNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
               +G +P G+S L  +L  L L  N  +G IP ++GL  H+  L+LS N F   +P  ++
Sbjct  402   GFTGPIPRGSSRLFESLVRLDLSRNKLTGNIPGEVGLFIHMKYLNLSWNHFNTRVPPEIE  461


 Score = 75.1 bits (183),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 101/211 (48%), Gaps = 3/211 (1%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +D     L+G++   +  L  L  L L+ N  SG +   L     L  + L  N   G++
Sbjct  325   MDFSSNDLTGELPSSIGNLRSLKHLILSKNKLSGELPESLESCNELMVVQLKGNGFVGSI  384

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             PD L ++  LQ +D+SGN  +GP+         SL  L L+ +   G IP  +     + 
Sbjct  385   PDGLFDLG-LQEMDISGNGFTGPIPRGSSRLFESLVRLDLSRNKLTGNIPGEVGLFIHMK  443

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
             +LNLS N F  + R    I  L +L  LD+ N+ L GS+P       +L+ L L  N  +
Sbjct  444   YLNLSWNHF--NTRVPPEIEFLQKLTVLDLRNSALIGSVPADICESQSLQILQLDGNSLT  501

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             G IP  +G C  L  L LS N  TG IP+SL
Sbjct  502   GSIPEGIGNCSSLKLLSLSHNNLTGPIPKSL  532


 Score = 65.9 bits (159),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 68/209 (33%), Positives = 105/209 (50%), Gaps = 5/209 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISP-qlglltnlqtlnlSKNSISGT  683
             V L G G  G I  GL  L  L  + ++ N F+G I      L  +L  L+LS+N ++G 
Sbjct  373   VQLKGNGFVGSIPDGLFDL-GLQEMDISGNGFTGPIPRGSSRLFESLVRLDLSRNKLTGN  431

Query  684   VPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLL  863
             +P  +G    +++L+LS N  +  V    +E L  L  L L  S+  G +P+ + +   L
Sbjct  432   IPGEVGLFIHMKYLNLSWNHFNTRVPPE-IEFLQKLTVLDLRNSALIGSVPADICESQSL  490

Query  864   NHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHF  1043
               L L  N  +G      GI   + L+ L +S+N L+G +P   S L  LK L L +N  
Sbjct  491   QILQLDGNSLTGS--IPEGIGNCSSLKLLSLSHNNLTGPIPKSLSNLQELKILKLEANKL  548

Query  1044  SGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             +GEIP +LG   +L  +++S N   G +P
Sbjct  549   TGEIPKELGELQNLLLVNVSFNRLIGRLP  577



>gb|EPS70115.1| hypothetical protein M569_04636, partial [Genlisea aurea]
Length=976

 Score =   298 bits (764),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 166/262 (63%), Positives = 204/262 (78%), Gaps = 3/262 (1%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLIVFKS V D  + LA+W+EDD+SPCAW FV+C P +GRV+ V L G+GLSGK
Sbjct  1     FNDDVLGLIVFKSAVVDARNRLASWNEDDESPCAWRFVECDPGSGRVTAVSLDGVGLSGK  60

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGLEKL++L  LSL+ NNFSG +SP+L LL NLQ LNLS N ++G++P S+  +S LQ
Sbjct  61    IGRGLEKLQYLRTLSLSGNNFSGSVSPELLLLPNLQKLNLSGNGLAGSLPPSV--VSKLQ  118

Query  720   FLDLSGNSLSGPVSDS-MLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFS  896
             FLDLSGN+LSGP+ D+  + N  SLR LSLAG+  +G IP SL +C  LNHL+LS+N FS
Sbjct  119   FLDLSGNALSGPLPDTTFVNNCSSLRHLSLAGNRLQGQIPWSLRQCASLNHLDLSSNLFS  178

Query  897   GDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLC  1076
             G P FSGGIW L RLRT+D+S N LSGS+P G S + +LK+LSL  N FSG +P D+G C
Sbjct  179   GYPDFSGGIWTLARLRTVDLSGNLLSGSIPGGISVVRSLKQLSLHGNQFSGPLPEDIGFC  238

Query  1077  PHLSRLDLSENLFTGTIPESLQ  1142
             PHL+ LDLS+N FTGTIPESLQ
Sbjct  239   PHLTHLDLSKNQFTGTIPESLQ  260


 Score = 95.9 bits (237),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 93/245 (38%), Positives = 127/245 (52%), Gaps = 33/245 (13%)
 Frame = +3

Query  492   GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  671
              R+  VDL G  LSG I  G+  +  L  LSL  N FSG +   +G   +L  L+LSKN 
Sbjct  191   ARLRTVDLSGNLLSGSIPGGISVVRSLKQLSLHGNQFSGPLPEDIGFCPHLTHLDLSKNQ  250

Query  672   ISGTVPDSLGNM-SSLQFLDLSGNSLSG--------------------------PVSDSM  770
              +GT+P+SL N+ ++LQ LDLS N L+G                          P S S 
Sbjct  251   FTGTIPESLQNLTTTLQHLDLSNNFLTGDFPHWIHHISALQRIDVSNNRLTGSLPPSISA  310

Query  771   LENLGSLRFLSLAGSSFEGPIPSSLSK-CTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRT  947
             + N   L F S + +   GPIPSS S   +LL+ L LS N F+G       ++  T L  
Sbjct  311   MMN-SPLTFFSSSNNRLTGPIPSSFSDSASLLSVLRLSQNSFNGS--IPADLFD-TGLDE  366

Query  948   LDVSNNELSGSLPIGASFLHN-LKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGT  1124
             LD+S NEL+GS+P  +S L + L  L L  N+ +G+IP ++GL   L  L+LS N F  +
Sbjct  367   LDLSRNELTGSIPPPSSKLFDTLGVLDLSGNNLTGKIPAEIGLLSKLRYLNLSGNQFESS  426

Query  1125  IPESL  1139
             IP  L
Sbjct  427   IPPEL  431


 Score = 71.2 bits (173),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 90/188 (48%), Gaps = 4/188 (2%)
 Frame = +3

Query  570   LNVLSLASNNFSGVISPqlgll-tnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSL  746
             L+ L L+ N  +G I P    L   L  L+LS N+++G +P  +G +S L++L+LSGN  
Sbjct  364   LDELDLSRNELTGSIPPPSSKLFDTLGVLDLSGNNLTGKIPAEIGLLSKLRYLNLSGNQF  423

Query  747   SGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIW  926
                +    L    +L  L L    F G IP  +     LN L L  N  +G       I 
Sbjct  424   ESSIPPE-LGYFPNLTVLDLHAGGFTGSIPGDICDSGSLNILQLDGNSLTG--AIPDEIG  480

Query  927   GLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSE  1106
               + L  L +SNN LSG++P   S L  L+ L L  N  SGEIP  L    +L   ++S 
Sbjct  481   NCSSLHQLGLSNNNLSGTIPESLSRLSKLEVLELEMNQLSGEIPQRLADLENLRIANVSH  540

Query  1107  NLFTGTIP  1130
             N   G +P
Sbjct  541   NQLIGRLP  548



>ref|XP_010555906.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Tarenaya hassleriana]
Length=993

 Score =   298 bits (763),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 154/270 (57%), Positives = 196/270 (73%), Gaps = 25/270 (9%)
 Frame = +3

Query  339   GGAESLQL-NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  515
             G   S+QL NDDVLGLIVFK+ ++DP+S+L +W+EDD SPC+W ++KC+P  GR+SEV L
Sbjct  24    GDVGSVQLLNDDVLGLIVFKADIEDPSSNLESWNEDDYSPCSWKYIKCNPVTGRISEVSL  83

Query  516   HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  695
              GL LSGKIGRG++KL++L VLSL+ N+F+G+I                        P S
Sbjct  84    DGLALSGKIGRGIQKLQYLKVLSLSDNDFTGII------------------------PAS  119

Query  696   LGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLN  875
             LG++SSL+FLDLS NS SG + D  L N  SLR+LSLA +  +GPIPSSLS+C+LLN L+
Sbjct  120   LGSISSLKFLDLSKNSFSGSLPDDFLTNCSSLRYLSLAKNMLDGPIPSSLSQCSLLNTLD  179

Query  876   LSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEI  1055
             LS+NRFSG+P F   IW L RLR LD+SNN LSGS+P G S LHNLKEL+L  N FSG +
Sbjct  180   LSSNRFSGNPGFVSAIWTLQRLRKLDLSNNSLSGSMPSGISSLHNLKELNLQGNQFSGSL  239

Query  1056  PVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             P D+G CPHL+RLDLS NLF+G +P + QR
Sbjct  240   PADVGSCPHLNRLDLSYNLFSGEVPSAFQR  269


 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 87/215 (40%), Positives = 124/215 (58%), Gaps = 5/215 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             + E++L G   SG +   +    HLN L L+ N FSG +      L +L  L+LS N +S
Sbjct  225   LKELNLQGNQFSGSLPADVGSCPHLNRLDLSYNLFSGEVPSAFQRLNSLMFLSLSHNLLS  284

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G  P  +G + SL+ LDLS N+L+G +  SM  NL SL+FL L+ +  +G IPSS+S CT
Sbjct  285   GDFPRWIGTLRSLEHLDLSNNALTGELPSSM-GNLRSLKFLVLSNNQLKGEIPSSVSDCT  343

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFL-HNLKELSLGS  1034
              L+ + L  N F+G  R   G++ L  L  +D+S+N L+GSLP+G+  L  +L+ L L  
Sbjct  344   ELSVIQLKGNSFTG--RIPDGLFDLG-LEEIDISHNGLTGSLPLGSRRLFESLRVLDLSC  400

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             N   G IP ++GL  HL  L+LS N     IP  L
Sbjct  401   NDLGGSIPGEVGLFIHLRYLNLSWNDLQTRIPPEL  435


 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 72/212 (34%), Positives = 107/212 (50%), Gaps = 28/212 (13%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + E+D+   GL+G +  G  +L E L VL L+ N+  G I  ++GL  +L+ LNLS N +
Sbjct  368   LEEIDISHNGLTGSLPLGSRRLFESLRVLDLSCNDLGGSIPGEVGLFIHLRYLNLSWNDL  427

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
                +P  LG + +L  LDL  +SLSG +  ++ E+  SL  L L G+S  GPIP  +  C
Sbjct  428   QTRIPPELGFLQNLTVLDLRHSSLSGSIPANICES-RSLEILQLDGNSLIGPIPEGIGNC  486

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
                                         L  L +S++ L+G +P   S LH L+ L L S
Sbjct  487   L--------------------------SLNLLSLSHDHLTGPIPKSLSNLHQLRILKLES  520

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             N  SGEIP +LG   +L  +++S N   G +P
Sbjct  521   NELSGEIPPELGKLQNLLAVNISYNRLVGKLP  552


 Score = 68.6 bits (166),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 103/214 (48%), Gaps = 3/214 (1%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +  +DL    L+G++   +  L  L  L L++N   G I   +   T L  + L  NS +
Sbjct  297   LEHLDLSNNALTGELPSSMGNLRSLKFLVLSNNQLKGEIPSSVSDCTELSVIQLKGNSFT  356

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G +PD L ++  L+ +D+S N L+G +         SLR L L+ +   G IP  +    
Sbjct  357   GRIPDGLFDLG-LEEIDISHNGLTGSLPLGSRRLFESLRVLDLSCNDLGGSIPGEVGLFI  415

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSN  1037
              L +LNLS N      R    +  L  L  LD+ ++ LSGS+P       +L+ L L  N
Sbjct  416   HLRYLNLSWNDLQT--RIPPELGFLQNLTVLDLRHSSLSGSIPANICESRSLEILQLDGN  473

Query  1038  HFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
                G IP  +G C  L+ L LS +  TG IP+SL
Sbjct  474   SLIGPIPEGIGNCLSLNLLSLSHDHLTGPIPKSL  507



>ref|XP_006290541.1| hypothetical protein CARUB_v10016623mg [Capsella rubella]
 gb|EOA23439.1| hypothetical protein CARUB_v10016623mg [Capsella rubella]
Length=1017

 Score =   298 bits (763),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 156/269 (58%), Positives = 205/269 (76%), Gaps = 1/269 (0%)
 Frame = +3

Query  339   GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  518
             G  +S+QLNDDVLGLIVFKS + DP+SHL +W+EDD+SPC+W++VKC+P   RV+++ L 
Sbjct  27    GEIDSIQLNDDVLGLIVFKSDLNDPSSHLESWNEDDNSPCSWSYVKCNPKTSRVTDLTLD  86

Query  519   GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  698
             GL L+GKI RG++KL+HL VLSL++NNF+G I+  L    NL+ L+LS N++SG +  SL
Sbjct  87    GLALTGKINRGIQKLQHLKVLSLSNNNFTGNIN-ALSTNNNLRKLDLSHNNLSGQILSSL  145

Query  699   GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNL  878
             G+M+SLQ LDL+GNS SG +SD    N  SLRFLSL+ +  EG IPS+L +C++LN LNL
Sbjct  146   GSMTSLQHLDLTGNSFSGTLSDDFFNNCSSLRFLSLSHNHLEGQIPSTLFQCSVLNSLNL  205

Query  879   SNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
             S N FSG+P F  G+W L RLR LD+S N LSG +P+G   LHNLK L L  N FSG +P
Sbjct  206   SRNDFSGNPSFVSGLWKLERLRVLDLSFNSLSGPIPLGILTLHNLKVLQLQRNQFSGPLP  265

Query  1059  VDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              D+GLCPHL+R+DLS NLF+G +P +LQR
Sbjct  266   SDIGLCPHLNRVDLSFNLFSGELPRTLQR  294


 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 80/241 (33%), Positives = 119/241 (49%), Gaps = 29/241 (12%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL    LSG I  G+  L +L VL L  N FSG +   +GL  +L  ++LS N  
Sbjct  225   RLRVLDLSFNSLSGPIPLGILTLHNLKVLQLQRNQFSGPLPSDIGLCPHLNRVDLSFNLF  284

Query  675   SGTVPDSL------------------------GNMSSLQFLDLSGNSLSGPVSDSMLENL  782
             SG +P +L                        G+MS L  LD S N L+G ++ S + NL
Sbjct  285   SGELPRTLQRVKSLYHFDLSNNLLSGDFPGWIGDMSGLVHLDFSSNELTGELASS-IGNL  343

Query  783   GSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSN  962
              SL+ L L+ +   G +P SL  C  L  + L  N F G      G++ L  L+ +D S 
Sbjct  344   RSLKDLILSENKLIGELPESLESCKELMIVQLKGNGFVGS--IPDGLFDLG-LQEMDFSG  400

Query  963   NELSGSLPIGASFL-HNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             N  +GS+P G+S L  ++  L L  N  +G IP ++GL  ++  L+LS N F   +P  +
Sbjct  401   NGFTGSIPRGSSRLFESVTRLDLSRNKLTGNIPGEVGLFINMRYLNLSWNHFNTRVPPEI  460

Query  1140  Q  1142
             +
Sbjct  461   E  461


 Score = 67.8 bits (164),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 68/209 (33%), Positives = 107/209 (51%), Gaps = 5/209 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISP-qlglltnlqtlnlSKNSISGT  683
             V L G G  G I  GL  L  L  +  + N F+G I      L  ++  L+LS+N ++G 
Sbjct  373   VQLKGNGFVGSIPDGLFDL-GLQEMDFSGNGFTGSIPRGSSRLFESVTRLDLSRNKLTGN  431

Query  684   VPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLL  863
             +P  +G   ++++L+LS N  +  V    +E L +L  L L  S+  G +P+ + +   L
Sbjct  432   IPGEVGLFINMRYLNLSWNHFNTRVPPE-IEFLQNLTILDLRNSALIGSVPADICESQSL  490

Query  864   NHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHF  1043
               L L  N  +G      GI   + L+ L +S+N+L+G +P   S L  LK L L +N  
Sbjct  491   QILQLDGNSLTGS--IPEGIGNCSSLKLLSLSHNKLTGPIPKSLSNLQELKILKLEANKL  548

Query  1044  SGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             SGEIP +LG   +L  +++S N   G +P
Sbjct  549   SGEIPKELGELQNLLLVNVSFNRLIGRLP  577


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 95/204 (47%), Gaps = 3/204 (1%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L+G++   +  L  L  L L+ N   G +   L     L  + L  N   G++PD L ++
Sbjct  332   LTGELASSIGNLRSLKDLILSENKLIGELPESLESCKELMIVQLKGNGFVGSIPDGLFDL  391

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
               LQ +D SGN  +G +         S+  L L+ +   G IP  +     + +LNLS N
Sbjct  392   G-LQEMDFSGNGFTGSIPRGSSRLFESVTRLDLSRNKLTGNIPGEVGLFINMRYLNLSWN  450

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDL  1067
              F  + R    I  L  L  LD+ N+ L GS+P       +L+ L L  N  +G IP  +
Sbjct  451   HF--NTRVPPEIEFLQNLTILDLRNSALIGSVPADICESQSLQILQLDGNSLTGSIPEGI  508

Query  1068  GLCPHLSRLDLSENLFTGTIPESL  1139
             G C  L  L LS N  TG IP+SL
Sbjct  509   GNCSSLKLLSLSHNKLTGPIPKSL  532


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 104/199 (52%), Gaps = 15/199 (8%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             V+ +DL    L+G I   +    ++  L+L+ N+F+  + P++  L NL  L+L  +++ 
Sbjct  418   VTRLDLSRNKLTGNIPGEVGLFINMRYLNLSWNHFNTRVPPEIEFLQNLTILDLRNSALI  477

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G+VP  +    SLQ L L GNSL+G + +  + N  SL+ LSL+ +   GPIP SLS   
Sbjct  478   GSVPADICESQSLQILQLDGNSLTGSIPEG-IGNCSSLKLLSLSHNKLTGPIPKSLSNLQ  536

Query  858   LLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
              L  L L  N+ SG+ P+  G    L  L  ++VS N L G LP+G  F       SL  
Sbjct  537   ELKILKLEANKLSGEIPKELG---ELQNLLLVNVSFNRLIGRLPLGDVF------QSLDQ  587

Query  1035  NHFSGEIPVDLGLCPHLSR  1091
             +   G    +LG+C  L R
Sbjct  588   SAIQG----NLGICSPLLR  602



>ref|XP_009151898.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
 emb|CDX86452.1| BnaA06g31690D [Brassica napus]
Length=1011

 Score =   296 bits (759),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 157/269 (58%), Positives = 203/269 (75%), Gaps = 4/269 (1%)
 Frame = +3

Query  339   GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  518
             G  +S QLNDDVLGLIVFKS + DP+SHL++W+EDD SPC+W +VKC+P   RV+E+ L 
Sbjct  25    GDLDSTQLNDDVLGLIVFKSDLHDPSSHLSSWNEDDISPCSWTYVKCNPKTSRVTELSLS  84

Query  519   GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  698
             GL L+GKIGRG++KL+HL VLSL++NN +G I+  L     LQ L+LS NS+SG +P SL
Sbjct  85    GLSLTGKIGRGIQKLQHLKVLSLSNNNLTGNIA-ALSNNNRLQKLDLSHNSLSGQIPSSL  143

Query  699   GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNL  878
                +SL+ LDL+GNS SG +SD +  N  SLR LSL+ + FEG IPS+L +C++LN LNL
Sbjct  144   ---TSLRHLDLTGNSFSGTLSDDVFTNCSSLRHLSLSRNRFEGQIPSALFRCSVLNSLNL  200

Query  879   SNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
             S+NRFSG P F+ G W L RLRTLD+S N LSGS+P+G  ++HNLK L L  N F G +P
Sbjct  201   SSNRFSGSPSFASGFWKLQRLRTLDLSFNALSGSIPLGMLYVHNLKVLHLQGNQFYGSLP  260

Query  1059  VDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              D+GLCPHL+R+DLS N F+G IP +LQR
Sbjct  261   SDIGLCPHLNRVDLSFNRFSGEIPTTLQR  289


 Score = 77.8 bits (190),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 100/204 (49%), Gaps = 3/204 (1%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L+GK+   +  L  L  L L+ N  SG I   L     L  + L  N  +G++PD L ++
Sbjct  327   LTGKLPSSISNLRSLKALILSDNKLSGEIPESLESCKELMVVQLKGNGFTGSIPDGLFDL  386

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
               LQ +D SGN L+G +         SL  L L+ +S  G IP  +   + L +LNLS N
Sbjct  387   G-LQEMDFSGNGLTGSIPRGSSRLFESLVRLDLSRNSLTGNIPGEVGLFSNLRYLNLSWN  445

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDL  1067
              F  + R    I  L  L  LD+ N+ L GS+P       +L+ L L  N  +G IP  +
Sbjct  446   HF--NTRVPPEIEFLQNLTILDLRNSALIGSVPADICEAQSLQILQLDGNSLTGSIPEGI  503

Query  1068  GLCPHLSRLDLSENLFTGTIPESL  1139
             G C  L  L LS N  +G IP+SL
Sbjct  504   GNCSSLKLLSLSHNNLSGPIPKSL  527


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 69/212 (33%), Positives = 103/212 (49%), Gaps = 28/212 (13%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + E+D  G GL+G I RG  +L E L  L L                        S+NS+
Sbjct  388   LQEMDFSGNGLTGSIPRGSSRLFESLVRLDL------------------------SRNSL  423

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
             +G +P  +G  S+L++L+LS N  +  V    +E L +L  L L  S+  G +P+ + + 
Sbjct  424   TGNIPGEVGLFSNLRYLNLSWNHFNTRVPPE-IEFLQNLTILDLRNSALIGSVPADICEA  482

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
               L  L L  N  +G      GI   + L+ L +S+N LSG +P   S L  LK L L +
Sbjct  483   QSLQILQLDGNSLTGS--IPEGIGNCSSLKLLSLSHNNLSGPIPKSLSNLEELKILKLEA  540

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             N  SGEIP +LG   +L  +++S N   G +P
Sbjct  541   NKLSGEIPKELGKLQNLLLVNISFNRLIGRLP  572



>ref|XP_002875419.1| hypothetical protein ARALYDRAFT_484589 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51678.1| hypothetical protein ARALYDRAFT_484589 [Arabidopsis lyrata subsp. 
lyrata]
Length=1014

 Score =   295 bits (755),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 156/266 (59%), Positives = 205/266 (77%), Gaps = 3/266 (1%)
 Frame = +3

Query  348   ESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLG  527
             +S+QLNDDVLGLIVFKS + DP SHL +W+EDD++PC+W++VKC+P   RV+E+ L+GL 
Sbjct  29    DSIQLNDDVLGLIVFKSDLNDPFSHLQSWNEDDNTPCSWSYVKCNPKTSRVTELSLNGLA  88

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L+GKI RG++KL+ L VLSL++NNF+G I+  L    NLQ L+LS N++SG +P SLG++
Sbjct  89    LTGKINRGIQKLQRLKVLSLSNNNFTGNIN-ALSTNNNLQKLDLSHNNLSGQIPSSLGSI  147

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
             SSLQ LDL+GNS SG +SD    N  SLR+LSL+ +  EG IPS+L +C++LN LNLS N
Sbjct  148   SSLQHLDLTGNSFSGTLSDDFFNNCSSLRYLSLSHNHLEGQIPSTLFQCSVLNSLNLSRN  207

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDL  1067
             RFSG   F  G W L RLR LD+S+N LSGS+P+G   LHNLKEL L  N FSG +P D+
Sbjct  208   RFSGS--FVSGFWRLERLRALDLSSNSLSGSIPLGILSLHNLKELQLQRNQFSGSLPSDI  265

Query  1068  GLCPHLSRLDLSENLFTGTIPESLQR  1145
             GLCPHL+R+DLS NLF+G +P +LQ+
Sbjct  266   GLCPHLNRVDLSFNLFSGELPRTLQK  291


 Score = 93.2 bits (230),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 80/207 (39%), Positives = 112/207 (54%), Gaps = 9/207 (4%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L G+I   L +   LN L+L+ N FSG        L  L+ L+LS NS+SG++P  + ++
Sbjct  185   LEGQIPSTLFQCSVLNSLNLSRNRFSGSFVSGFWRLERLRALDLSSNSLSGSIPLGILSL  244

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLG---SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNL  878
              +L+ L L  N  SG    S+  ++G    L  + L+ + F G +P +L K   LNH +L
Sbjct  245   HNLKELQLQRNQFSG----SLPSDIGLCPHLNRVDLSFNLFSGELPRTLQKLRSLNHFDL  300

Query  879   SNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
             S N  SGD  F   I  +T L  LD S+NEL+G LP     L +LK+L L  N  SGEIP
Sbjct  301   SKNLLSGD--FPAWIGDMTGLVHLDFSSNELTGELPSLIGNLRSLKDLILSENKISGEIP  358

Query  1059  VDLGLCPHLSRLDLSENLFTGTIPESL  1139
               L  C  L  + L  N F+G+IP+ L
Sbjct  359   ESLESCQELMIVQLKGNGFSGSIPDGL  385


 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 83/240 (35%), Positives = 120/240 (50%), Gaps = 27/240 (11%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL    LSG I  G+  L +L  L L  N FSG +   +GL  +L  ++LS N  
Sbjct  222   RLRALDLSSNSLSGSIPLGILSLHNLKELQLQRNQFSGSLPSDIGLCPHLNRVDLSFNLF  281

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGP----VSD-------------------SMLENLG  785
             SG +P +L  + SL   DLS N LSG     + D                   S++ NL 
Sbjct  282   SGELPRTLQKLRSLNHFDLSKNLLSGDFPAWIGDMTGLVHLDFSSNELTGELPSLIGNLR  341

Query  786   SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNN  965
             SL+ L L+ +   G IP SL  C  L  + L  N FSG      G++ L  L+ +D S N
Sbjct  342   SLKDLILSENKISGEIPESLESCQELMIVQLKGNGFSGS--IPDGLFDLG-LQEMDFSGN  398

Query  966   ELSGSLPIGASFL-HNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
               +GS+P G+S L  +LK L L  N+ +G IP ++GL  ++  L+LS N F   +P  ++
Sbjct  399   GFTGSIPRGSSRLFESLKRLDLSRNNLTGSIPGEVGLFINMRYLNLSWNHFNTRVPPEIE  458


 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 80/263 (30%), Positives = 119/263 (45%), Gaps = 53/263 (20%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             ++ VDL     SG++ R L+KL  LN   L+ N  SG     +G +T L  L+ S N ++
Sbjct  271   LNRVDLSFNLFSGELPRTLQKLRSLNHFDLSKNLLSGDFPAWIGDMTGLVHLDFSSNELT  330

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G +P  +GN+ SL+ L LS N +SG + +S LE+   L  + L G+ F G IP  L    
Sbjct  331   GELPSLIGNLRSLKDLILSENKISGEIPES-LESCQELMIVQLKGNGFSGSIPDGLFDLG  389

Query  858   LLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             L   ++ S N F+G  PR S  ++    L+ LD+S N L+GS+P       N++ L+L  
Sbjct  390   L-QEMDFSGNGFTGSIPRGSSRLF--ESLKRLDLSRNNLTGSIPGEVGLFINMRYLNLSW  446

Query  1035  NHFSGEIPVDLGLCPHLSRLDL--------------------------------------  1100
             NHF+  +P ++    +L  LDL                                      
Sbjct  447   NHFNTRVPPEIEFLQNLIVLDLRYSALIGSVPADICESQSLQILQLDGNSLTGSIPEGIG  506

Query  1101  ----------SENLFTGTIPESL  1139
                       S N  TG IP+SL
Sbjct  507   NCSSLKLLSLSHNNLTGPIPKSL  529


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 110/209 (53%), Gaps = 5/209 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISP-qlglltnlqtlnlSKNSISGT  683
             V L G G SG I  GL  L  L  +  + N F+G I      L  +L+ L+LS+N+++G+
Sbjct  370   VQLKGNGFSGSIPDGLFDL-GLQEMDFSGNGFTGSIPRGSSRLFESLKRLDLSRNNLTGS  428

Query  684   VPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLL  863
             +P  +G   ++++L+LS N  +  V    +E L +L  L L  S+  G +P+ + +   L
Sbjct  429   IPGEVGLFINMRYLNLSWNHFNTRVPPE-IEFLQNLIVLDLRYSALIGSVPADICESQSL  487

Query  864   NHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHF  1043
               L L  N  +G      GI   + L+ L +S+N L+G +P   S L  LK L L +N  
Sbjct  488   QILQLDGNSLTGS--IPEGIGNCSSLKLLSLSHNNLTGPIPKSLSNLQELKILKLEANKL  545

Query  1044  SGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             SGEIP +LG   +L  +++S N   G +P
Sbjct  546   SGEIPKELGELQNLLLVNVSFNRLIGRLP  574


 Score = 65.1 bits (157),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 100/189 (53%), Gaps = 4/189 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + E+D  G G +G I RG  +L E L  L L+ NN +G I  ++GL  N++ LNLS N  
Sbjct  390   LQEMDFSGNGFTGSIPRGSSRLFESLKRLDLSRNNLTGSIPGEVGLFINMRYLNLSWNHF  449

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
             +  VP  +  + +L  LDL  ++L G V   + E+  SL+ L L G+S  G IP  +  C
Sbjct  450   NTRVPPEIEFLQNLIVLDLRYSALIGSVPADICES-QSLQILQLDGNSLTGSIPEGIGNC  508

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             + L  L+LS+N  +G       +  L  L+ L +  N+LSG +P     L NL  +++  
Sbjct  509   SSLKLLSLSHNNLTGP--IPKSLSNLQELKILKLEANKLSGEIPKELGELQNLLLVNVSF  566

Query  1035  NHFSGEIPV  1061
             N   G +PV
Sbjct  567   NRLIGRLPV  575



>ref|XP_007225370.1| hypothetical protein PRUPE_ppa000838mg [Prunus persica]
 gb|EMJ26569.1| hypothetical protein PRUPE_ppa000838mg [Prunus persica]
Length=986

 Score =   294 bits (752),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 166/264 (63%), Positives = 215/264 (81%), Gaps = 1/264 (0%)
 Frame = +3

Query  357   QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             QLN+DVLGL+VFKS + DP+S+LA+W+EDDDSPC+W+FV+C+PA GRVS++ L GLGL G
Sbjct  9     QLNNDVLGLLVFKSDLHDPSSYLASWNEDDDSPCSWDFVQCNPATGRVSQLSLEGLGLLG  68

Query  537   KIGRGLEKLEHLNVLSLASNNFSGVISPqlgllt-nlqtlnlSKNSISGTVPDSLGNMSS  713
             +IG+GL+ L+HL VLSL++NNFSG IS +   L  NL++LNLS+NS+SG +P +L NMSS
Sbjct  69    RIGKGLQNLQHLKVLSLSNNNFSGDISTEKLALPPNLESLNLSRNSLSGLLPTALVNMSS  128

Query  714   LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRF  893
             ++FLDLS NSLSGP+ D++ +N  SLR+LSL+G+  +GP+PS+L +C++LN LNLSNN F
Sbjct  129   IKFLDLSENSLSGPLPDNLFDNCFSLRYLSLSGNLLQGPLPSTLPRCSVLNGLNLSNNHF  188

Query  894   SGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGL  1073
             SG+P F+ GIW L RLRTLD SNN  SGS P G S LHNLK L L  N FSG +P D+GL
Sbjct  189   SGNPDFASGIWSLKRLRTLDFSNNAFSGSAPQGISALHNLKVLLLQGNDFSGPVPADIGL  248

Query  1074  CPHLSRLDLSENLFTGTIPESLQR  1145
             CPHL R+D+S NLFTG +P+SLQR
Sbjct  249   CPHLGRVDISYNLFTGALPDSLQR  272


 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 76/240 (32%), Positives = 118/240 (49%), Gaps = 29/240 (12%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +D      SG   +G+  L +L VL L  N+FSG +   +GL  +L  +++S N  
Sbjct  203   RLRTLDFSNNAFSGSAPQGISALHNLKVLLLQGNDFSGPVPADIGLCPHLGRVDISYNLF  262

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPS-----  839
             +G +PDSL  ++SL F  LS N  +G      + N+ SL++L  + + F G +P+     
Sbjct  263   TGALPDSLQRLNSLTFFSLSDNMFTGDFPQ-WIGNMSSLKYLDFSNNGFTGSLPASIGDL  321

Query  840   -------------------SLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSN  962
                                SL+ C  L+ + LS+N FSG      G++ L  L  +  S 
Sbjct  322   KSLSYLSLSNNKLVGAIPLSLAYCNALSVIRLSDNSFSGS--IPEGLFDLG-LEEIHFSQ  378

Query  963   NELSGSLPIGASFL-HNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
               L+GS+P G+S L  +LK L L  N+  G IP ++GL  +L  L+LS N     +P  L
Sbjct  379   MGLTGSIPPGSSRLFESLKMLDLSRNNLKGNIPAEVGLFSNLRYLNLSWNNLQSRMPPEL  438


 Score = 71.6 bits (174),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 104/189 (55%), Gaps = 4/189 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + E+    +GL+G I  G  +L E L +L L+ NN  G I  ++GL +NL+ LNLS N++
Sbjct  371   LEEIHFSQMGLTGSIPPGSSRLFESLKMLDLSRNNLKGNIPAEVGLFSNLRYLNLSWNNL  430

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
                +P  LG   +L  LDL  ++L G +   + ++ GSL  L L G+S  GPIP+ +  C
Sbjct  431   QSRMPPELGFFQNLTVLDLRNSALFGSIPGDICDS-GSLGILQLDGNSLNGPIPNEIGNC  489

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             + L  ++LS+N  SG       I  L +L+ L +  NELSG +P     L NL  +++  
Sbjct  490   SSLYLMSLSHNNLSG--LIPKSISKLNKLKILKLEYNELSGEIPQELGRLENLLAVNISY  547

Query  1035  NHFSGEIPV  1061
             N   G +PV
Sbjct  548   NRLVGRLPV  556


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 106/227 (47%), Gaps = 25/227 (11%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
              +G   + +  +  L  L  ++N F+G +   +G L +L  L+LS N + G +P SL   
Sbjct  286   FTGDFPQWIGNMSSLKYLDFSNNGFTGSLPASIGDLKSLSYLSLSNNKLVGAIPLSLAYC  345

Query  708   SSLQFLDLSGNSLSGPVSDSMLE---------NLG--------------SLRFLSLAGSS  818
             ++L  + LS NS SG + + + +          +G              SL+ L L+ ++
Sbjct  346   NALSVIRLSDNSFSGSIPEGLFDLGLEEIHFSQMGLTGSIPPGSSRLFESLKMLDLSRNN  405

Query  819   FEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGAS  998
              +G IP+ +   + L +LNLS N      R    +     L  LD+ N+ L GS+P    
Sbjct  406   LKGNIPAEVGLFSNLRYLNLSWNNLQS--RMPPELGFFQNLTVLDLRNSALFGSIPGDIC  463

Query  999   FLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
                +L  L L  N  +G IP ++G C  L  + LS N  +G IP+S+
Sbjct  464   DSGSLGILQLDGNSLNGPIPNEIGNCSSLYLMSLSHNNLSGLIPKSI  510



>ref|XP_006395381.1| hypothetical protein EUTSA_v10003580mg [Eutrema salsugineum]
 gb|ESQ32667.1| hypothetical protein EUTSA_v10003580mg [Eutrema salsugineum]
Length=1018

 Score =   294 bits (752),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 160/269 (59%), Positives = 208/269 (77%), Gaps = 1/269 (0%)
 Frame = +3

Query  339   GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  518
             G  +S+QLNDDVLGLIVFKS + DP+SHL +W+EDDDSPC+W++VKC+P   RV+E+ L 
Sbjct  25    GDIDSIQLNDDVLGLIVFKSDLNDPSSHLESWNEDDDSPCSWSYVKCNPKTSRVTELSLD  84

Query  519   GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  698
             GL L+GKIGRG++KL+HL VLSL++NNF+G I   L    +LQ L+LS N++SG +P SL
Sbjct  85    GLALTGKIGRGIQKLQHLKVLSLSNNNFTGSII-DLSNNNDLQKLDLSHNNLSGQIPSSL  143

Query  699   GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNL  878
             G+ SSL++LDL+GNS SG +SD    N  SLR LSL+ ++ EG IPS+L +C++LN LNL
Sbjct  144   GSRSSLRYLDLTGNSFSGRLSDDFFNNCSSLRHLSLSHNNLEGQIPSTLFRCSVLNSLNL  203

Query  879   SNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
             S+NRFSG+P F  G W L RLRTLD+S N LSGS+P+G   LHNLKEL L  N FSG +P
Sbjct  204   SSNRFSGNPNFISGFWRLERLRTLDLSLNTLSGSIPLGILSLHNLKELQLQGNQFSGSLP  263

Query  1059  VDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              D+GLCPHL+R+DLS N F+G  P +LQ+
Sbjct  264   SDIGLCPHLNRVDLSFNRFSGEFPSTLQK  292


 Score = 95.9 bits (237),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 85/211 (40%), Positives = 118/211 (56%), Gaps = 15/211 (7%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlgl----ltnlqtlnlSKNSISGTVPDS  695
             L G+I   L +   LN L+L+SN FSG  +P        L  L+TL+LS N++SG++P  
Sbjct  184   LEGQIPSTLFRCSVLNSLNLSSNRFSG--NPNFISGFWRLERLRTLDLSLNTLSGSIPLG  241

Query  696   LGNMSSLQFLDLSGNSLSGPVSDSMLENLG---SLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             + ++ +L+ L L GN  SG    S+  ++G    L  + L+ + F G  PS+L K   LN
Sbjct  242   ILSLHNLKELQLQGNQFSG----SLPSDIGLCPHLNRVDLSFNRFSGEFPSTLQKLRSLN  297

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
             HL+LSNN  SG+  F   I  +T L  LD S+NEL+G LP     L +LK+L   +N  S
Sbjct  298   HLDLSNNLLSGE--FPAWIGDMTGLVHLDFSSNELTGKLPSSIGNLRSLKDLIFSNNKLS  355

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             GEIP  L  C  L  L L  N F+G IP+ L
Sbjct  356   GEIPESLESCKELMILQLKGNGFSGNIPDGL  386


 Score = 87.4 bits (215),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 87/240 (36%), Positives = 118/240 (49%), Gaps = 27/240 (11%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL    LSG I  G+  L +L  L L  N FSG +   +GL  +L  ++LS N  
Sbjct  223   RLRTLDLSLNTLSGSIPLGILSLHNLKELQLQGNQFSGSLPSDIGLCPHLNRVDLSFNRF  282

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGP----VSD-------------------SMLENLG  785
             SG  P +L  + SL  LDLS N LSG     + D                   S + NL 
Sbjct  283   SGEFPSTLQKLRSLNHLDLSNNLLSGEFPAWIGDMTGLVHLDFSSNELTGKLPSSIGNLR  342

Query  786   SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNN  965
             SL+ L  + +   G IP SL  C  L  L L  N FSG+     G++ L  L+ +D S N
Sbjct  343   SLKDLIFSNNKLSGEIPESLESCKELMILQLKGNGFSGN--IPDGLFDLG-LQEMDFSGN  399

Query  966   ELSGSLPIGASFL-HNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
              L+GS+P G+S L  +L  L L  N  SG IP ++GL  HL  L+LS N F   +P  ++
Sbjct  400   SLTGSVPRGSSRLFESLVRLDLSRNSLSGNIPGEVGLFNHLRYLNLSWNNFNTRVPPEIE  459


 Score = 77.4 bits (189),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 98/204 (48%), Gaps = 3/204 (1%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L+GK+   +  L  L  L  ++N  SG I   L     L  L L  N  SG +PD L ++
Sbjct  330   LTGKLPSSIGNLRSLKDLIFSNNKLSGEIPESLESCKELMILQLKGNGFSGNIPDGLFDL  389

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
               LQ +D SGNSL+G V         SL  L L+ +S  G IP  +     L +LNLS N
Sbjct  390   G-LQEMDFSGNSLTGSVPRGSSRLFESLVRLDLSRNSLSGNIPGEVGLFNHLRYLNLSWN  448

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDL  1067
              F  + R    I  L  L  LD+ N+ L GS+P       +L+ L L  N  +G IP  +
Sbjct  449   NF--NTRVPPEIEFLQNLTVLDLRNSALIGSVPADICASQSLQILQLDGNSLTGSIPEGI  506

Query  1068  GLCPHLSRLDLSENLFTGTIPESL  1139
             G C  L  L LS N  TG IP SL
Sbjct  507   GNCSSLKLLSLSHNNLTGPIPRSL  530


 Score = 68.2 bits (165),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 75/225 (33%), Positives = 105/225 (47%), Gaps = 27/225 (12%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             LSG+I   LE  + L +L L  N FSG I P       LQ ++ S NS++G+VP     +
Sbjct  354   LSGEIPESLESCKELMILQLKGNGFSGNI-PDGLFDLGLQEMDFSGNSLTGSVPRGSSRL  412

Query  708   -SSLQFLDLSGNSLSGPVSDSM-----------------------LENLGSLRFLSLAGS  815
               SL  LDLS NSLSG +   +                       +E L +L  L L  S
Sbjct  413   FESLVRLDLSRNSLSGNIPGEVGLFNHLRYLNLSWNNFNTRVPPEIEFLQNLTVLDLRNS  472

Query  816   SFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGA  995
             +  G +P+ +     L  L L  N  +G      GI   + L+ L +S+N L+G +P   
Sbjct  473   ALIGSVPADICASQSLQILQLDGNSLTGS--IPEGIGNCSSLKLLSLSHNNLTGPIPRSL  530

Query  996   SFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             S L  LK L L  N  SGEIP +LG   +L  +++S N   G +P
Sbjct  531   SNLQQLKILKLEVNKLSGEIPKELGDLQNLLLVNISFNRIIGRLP  575



>ref|XP_003621730.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Medicago truncatula]
 gb|AES77948.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1016

 Score =   293 bits (750),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 162/273 (59%), Positives = 205/273 (75%), Gaps = 1/273 (0%)
 Frame = +3

Query  327   TSGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSE  506
             T  A    ++QLNDDVLGLIVFKS +QDP+S+L++W+EDD +PC+W +VKC+P   RVSE
Sbjct  52    TCFANNDVTIQLNDDVLGLIVFKSDLQDPSSYLSSWNEDDINPCSWQYVKCNPQTQRVSE  111

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             + L GLGLSGK+GR LEKL+HL  LSL+ NNFSG ISP L L   LQ LNLS NS SG +
Sbjct  112   LSLDGLGLSGKLGRSLEKLQHLVTLSLSHNNFSGTISPSLTLSNTLQKLNLSHNSFSGPL  171

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P S  NMSS++F+DLS NS +G + D   EN  SLR +SL+ + FEG IP++LSKC+LLN
Sbjct  172   PLSFVNMSSIRFIDLSHNSFAGQMPDGFFENCFSLRRVSLSMNLFEGQIPTTLSKCSLLN  231

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
              ++LSNN FSG+  FS  +W L RLR+LD+SNN LSG+L  G S LHNLKEL L +N FS
Sbjct  232   SVDLSNNHFSGNVDFS-RVWSLNRLRSLDLSNNALSGNLVNGISSLHNLKELLLENNQFS  290

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             G++P D+G C HL+R+DLS N F+G +PES  R
Sbjct  291   GQLPNDIGFCLHLNRVDLSTNQFSGELPESFGR  323


 Score = 78.2 bits (191),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 102/212 (48%), Gaps = 29/212 (14%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             + E+ L     SG++   +    HLN + L++N FSG +    G L +L  L +S N + 
Sbjct  279   LKELLLENNQFSGQLPNDIGFCLHLNRVDLSTNQFSGELPESFGRLNSLSYLRVSNNLLF  338

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G  P  +GN+ SL+ LDLS N                          F G IP SL  CT
Sbjct  339   GEFPQWIGNLISLEDLDLSHN-------------------------QFYGNIPLSLVSCT  373

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGAS-FLHNLKELSLGS  1034
              L+ + L  N F+G      G++GL  L  +D S+NEL GS+P G++  L  L +L L  
Sbjct  374   KLSKIFLRGNSFNG--TIPEGLFGLG-LEEIDFSHNELIGSIPAGSNRLLETLTKLDLSV  430

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             NH  G IP ++GL   L  L+LS N     IP
Sbjct  431   NHLQGNIPAEIGLLSKLRFLNLSWNDLHSQIP  462


 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 101/189 (53%), Gaps = 4/189 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + E+D     L G I  G  +L E L  L L+ N+  G I  ++GLL+ L+ LNLS N +
Sbjct  398   LEEIDFSHNELIGSIPAGSNRLLETLTKLDLSVNHLQGNIPAEIGLLSKLRFLNLSWNDL  457

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
                +P   G + +L+ LDL  ++L G + +   ++ G+L  L L G+S +G IP  +  C
Sbjct  458   HSQIPPEFGLLQNLEVLDLRNSALFGSIPEDTCDS-GNLAVLQLDGNSLKGSIPEKIGNC  516

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             + L  L LS+N  +G       +  L +L+ L +  NELSG LP+    L NL  +++  
Sbjct  517   SSLYLLGLSHNNLTGP--VPKSMSNLNKLKILKLEFNELSGELPMELGKLQNLLAVNISH  574

Query  1035  NHFSGEIPV  1061
             N  +G +P+
Sbjct  575   NSLTGRLPI  583


 Score = 65.9 bits (159),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 95/204 (47%), Gaps = 3/204 (1%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L G+  + +  L  L  L L+ N F G I   L   T L  + L  NS +GT+P+ L  +
Sbjct  337   LFGEFPQWIGNLISLEDLDLSHNQFYGNIPLSLVSCTKLSKIFLRGNSFNGTIPEGLFGL  396

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
               L+ +D S N L G +       L +L  L L+ +  +G IP+ +   + L  LNLS N
Sbjct  397   G-LEEIDFSHNELIGSIPAGSNRLLETLTKLDLSVNHLQGNIPAEIGLLSKLRFLNLSWN  455

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDL  1067
                       G+  L  L  LD+ N+ L GS+P       NL  L L  N   G IP  +
Sbjct  456   DLHSQIPPEFGL--LQNLEVLDLRNSALFGSIPEDTCDSGNLAVLQLDGNSLKGSIPEKI  513

Query  1068  GLCPHLSRLDLSENLFTGTIPESL  1139
             G C  L  L LS N  TG +P+S+
Sbjct  514   GNCSSLYLLGLSHNNLTGPVPKSM  537



>ref|XP_008244427.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Prunus mume]
Length=1009

 Score =   292 bits (748),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 166/264 (63%), Positives = 214/264 (81%), Gaps = 1/264 (0%)
 Frame = +3

Query  357   QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             QLN+DVLGL+VFKS + DP+S+LA+W+EDDDSPC+W+FV+C+PA GRVS++ L GLGL G
Sbjct  32    QLNNDVLGLLVFKSDLHDPSSYLASWNEDDDSPCSWDFVQCNPATGRVSQLSLEGLGLLG  91

Query  537   KIGRGLEKLEHLNVLSLASNNFSGVISPqlgllt-nlqtlnlSKNSISGTVPDSLGNMSS  713
             +IG+GL+ L+HL VLSL++NNFSG IS +   L  NL++LNLS+NS+SG +P +L NMSS
Sbjct  92    RIGKGLQNLQHLKVLSLSNNNFSGDISTEKLALPPNLESLNLSRNSLSGLLPTALVNMSS  151

Query  714   LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRF  893
             ++FLDLS NSLSGP+ D++ +N  SLR+LSL+G+  +GP PS+L +C++LN LNLSNN F
Sbjct  152   IKFLDLSENSLSGPLPDNLFDNCFSLRYLSLSGNLLQGPFPSTLPRCSVLNGLNLSNNHF  211

Query  894   SGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGL  1073
             SG+P F+ GIW L RLR+LD SNN  SGS P G S LHNLK L L  N FSG +P D+GL
Sbjct  212   SGNPDFASGIWSLKRLRSLDFSNNAFSGSAPQGISALHNLKVLLLQGNDFSGPVPADIGL  271

Query  1074  CPHLSRLDLSENLFTGTIPESLQR  1145
             CPHL R+DLS NLFTG +P+SLQR
Sbjct  272   CPHLGRVDLSYNLFTGALPDSLQR  295


 Score = 83.2 bits (204),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 118/240 (49%), Gaps = 29/240 (12%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +D      SG   +G+  L +L VL L  N+FSG +   +GL  +L  ++LS N  
Sbjct  226   RLRSLDFSNNAFSGSAPQGISALHNLKVLLLQGNDFSGPVPADIGLCPHLGRVDLSYNLF  285

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPS-----  839
             +G +PDSL  ++SL F  LS N  +G      + N+ SL++L  + + F G +P+     
Sbjct  286   TGALPDSLQRLNSLTFFSLSDNMFTGDFPQ-WIGNMSSLKYLDFSNNGFTGSLPASIGDL  344

Query  840   -------------------SLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSN  962
                                SL+ C  L+ + L +N FSG      G++ L  L  +D S 
Sbjct  345   KSLSYLSLSNNRLVGAIPLSLAYCNELSVIRLRDNSFSGS--IPEGLFDLG-LEEIDFSQ  401

Query  963   NELSGSLPIGASFL-HNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
               L+GS+P G+S L  +LK L L  N+  G IP ++GL  +L  L+LS N     +P  L
Sbjct  402   MGLTGSIPPGSSRLFESLKMLDLSRNNLKGNIPAEVGLFSNLRYLNLSWNNLQSRMPPEL  461


 Score = 74.3 bits (181),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 105/189 (56%), Gaps = 4/189 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + E+D   +GL+G I  G  +L E L +L L+ NN  G I  ++GL +NL+ LNLS N++
Sbjct  394   LEEIDFSQMGLTGSIPPGSSRLFESLKMLDLSRNNLKGNIPAEVGLFSNLRYLNLSWNNL  453

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
                +P  LG   +L  LDL  ++L G +   + ++ GSL  L L G+S  GPIP+ +  C
Sbjct  454   QSRMPPELGFFQNLTVLDLRNSALFGSIPGDICDS-GSLGILQLDGNSLNGPIPNEIGNC  512

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             + L  ++LS+N  SG       I  L +L+ L +  NELSG +P     L NL  +++  
Sbjct  513   SSLYLMSLSHNNLSG--LIPKSISKLNKLKILKLEYNELSGEIPQELGRLENLLAVNISY  570

Query  1035  NHFSGEIPV  1061
             N   G +PV
Sbjct  571   NRLVGRLPV  579


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 80/158 (51%), Gaps = 3/158 (2%)
 Frame = +3

Query  666   NSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSL  845
             NS SG++P+ L ++  L+ +D S   L+G +         SL+ L L+ ++ +G IP+ +
Sbjct  379   NSFSGSIPEGLFDLG-LEEIDFSQMGLTGSIPPGSSRLFESLKMLDLSRNNLKGNIPAEV  437

Query  846   SKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELS  1025
                + L +LNLS N      R    +     L  LD+ N+ L GS+P       +L  L 
Sbjct  438   GLFSNLRYLNLSWNNLQS--RMPPELGFFQNLTVLDLRNSALFGSIPGDICDSGSLGILQ  495

Query  1026  LGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             L  N  +G IP ++G C  L  + LS N  +G IP+S+
Sbjct  496   LDGNSLNGPIPNEIGNCSSLYLMSLSHNNLSGLIPKSI  533



>ref|XP_006494521.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=1003

 Score =   292 bits (748),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 161/269 (60%), Positives = 204/269 (76%), Gaps = 5/269 (2%)
 Frame = +3

Query  351   SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
             S++LNDD+LGLIVFKS ++DP+S+L +W EDD+SPC+W F++C+P NGRVS V L GLGL
Sbjct  40    SIELNDDILGLIVFKSELKDPSSNLQSWKEDDNSPCSWKFIQCNPVNGRVSHVSLDGLGL  99

Query  531   SGKIG-RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL--G  701
             SGKIG RGL KL+HL VLSL+ N+F+G I+P+LGL+ +L+ LN S NS+SG +P SL   
Sbjct  100   SGKIGTRGLRKLQHLKVLSLSHNDFTGNINPELGLIASLERLNFSHNSLSGQIPPSLLNL  159

Query  702   NMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLS  881
             NM +++FLDLS N LSGPV   + EN  SLR+LSLAG+  +GPI    + C+ LN LNLS
Sbjct  160   NMMNMKFLDLSNNLLSGPVPYQLFENCASLRYLSLAGNILQGPIGKIFNYCSSLNTLNLS  219

Query  882   NNRFSGDPRFSG--GIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEI  1055
             NN FSGD  F+   GIW L RLRTLD+S+N  SGS+P G + LH LKEL L  N FSG +
Sbjct  220   NNHFSGDLDFASGYGIWSLKRLRTLDLSHNLFSGSIPQGVAALHYLKELLLQGNQFSGPL  279

Query  1056  PVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
             P D+G CPHL+ LDLS NLFTG +P SL+
Sbjct  280   PADIGFCPHLTTLDLSNNLFTGQLPVSLR  308


 Score = 94.0 bits (232),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 115/218 (53%), Gaps = 6/218 (3%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             + E+ L G   SG +   +    HL  L L++N F+G +   L LL ++  +++S N+++
Sbjct  265   LKELLLQGNQFSGPLPADIGFCPHLTTLDLSNNLFTGQLPVSLRLLNSMIFISVSNNTLT  324

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G +P  +GN+S+L+FLD S N L+G +  S+  N   L  + L G+S  G IP  L    
Sbjct  325   GDIPHWIGNISTLEFLDFSNNHLTGSLPLSLF-NCKKLSVIRLRGNSLNGNIPEGLFDLG  383

Query  858   LLNHLNLSNNRFSGD-PRFSGGIWGLT---RLRTLDVSNNELSGSLPIGASFLHNLKELS  1025
             L   ++LS N F G  P  S      T    LR LD+S+N L G +P       NL+ L+
Sbjct  384   L-EEIDLSENGFMGSIPPGSSSSSSSTLFQTLRILDLSSNNLVGDIPAEMGLFANLRYLN  442

Query  1026  LGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             L SNH    IP +LG   +L  LDL  N   G+IP+ +
Sbjct  443   LSSNHLRSRIPPELGYFHNLIHLDLRNNALYGSIPQEV  480


 Score = 79.0 bits (193),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 75/211 (36%), Positives = 105/211 (50%), Gaps = 10/211 (5%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEK------LEHLNVLSLASNNFSGVISPqlglltnlqtlnl  659
             + E+DL   G  G I  G          + L +L L+SNN  G I  ++GL  NL+ LNL
Sbjct  384   LEEIDLSENGFMGSIPPGSSSSSSSTLFQTLRILDLSSNNLVGDIPAEMGLFANLRYLNL  443

Query  660   SKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPS  839
             S N +   +P  LG   +L  LDL  N+L G +   + E+  SL  L L G+S  GPIP 
Sbjct  444   SSNHLRSRIPPELGYFHNLIHLDLRNNALYGSIPQEVCES-RSLGILQLDGNSLTGPIPQ  502

Query  840   SLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKE  1019
              +  CT L  L+LS+N  SG       I  L +L+ L +  NELS  +P     L +L  
Sbjct  503   EIGNCTSLYLLSLSHNHLSGS--IPKSISNLNKLKILKLEFNELSEEIPQELGKLESLLA  560

Query  1020  LSLGSNHFSGEIPVDLGLCPHLSRLDLSENL  1112
             +++  N   G +PV  G+ P L +  L  NL
Sbjct  561   VNVSYNRLIGRLPVG-GVFPTLDQSSLQGNL  590


 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 96/212 (45%), Gaps = 10/212 (5%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN-  704
             L+G +   L   + L+V+ L  N+ +G I P+      L+ ++LS+N   G++P    + 
Sbjct  347   LTGSLPLSLFNCKKLSVIRLRGNSLNGNI-PEGLFDLGLEEIDLSENGFMGSIPPGSSSS  405

Query  705   -----MSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNH  869
                    +L+ LDLS N+L G +   M     +LR+L+L+ +     IP  L     L H
Sbjct  406   SSSTLFQTLRILDLSSNNLVGDIPAEM-GLFANLRYLNLSSNHLRSRIPPELGYFHNLIH  464

Query  870   LNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSG  1049
             L+L NN   G       +     L  L +  N L+G +P       +L  LSL  NH SG
Sbjct  465   LDLRNNALYGS--IPQEVCESRSLGILQLDGNSLTGPIPQEIGNCTSLYLLSLSHNHLSG  522

Query  1050  EIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              IP  +     L  L L  N  +  IP+ L +
Sbjct  523   SIPKSISNLNKLKILKLEFNELSEEIPQELGK  554



>ref|XP_006421080.1| hypothetical protein CICLE_v10004238mg [Citrus clementina]
 gb|ESR34320.1| hypothetical protein CICLE_v10004238mg [Citrus clementina]
Length=1003

 Score =   291 bits (746),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 161/269 (60%), Positives = 204/269 (76%), Gaps = 5/269 (2%)
 Frame = +3

Query  351   SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
             S++LNDD+LGLIVFKS ++DP+S+L +W EDD+SPC+W F++C+P NGRVS V L GLGL
Sbjct  40    SIELNDDILGLIVFKSELKDPSSNLQSWKEDDNSPCSWKFIQCNPINGRVSHVSLDGLGL  99

Query  531   SGKIG-RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL--G  701
             SGKIG RGL KL+HL VLSL+ N+F+G I+P+LGL+ +L+ LN S NS+SG +P SL   
Sbjct  100   SGKIGTRGLRKLQHLKVLSLSHNDFTGNINPELGLIASLERLNFSHNSLSGQIPPSLLNL  159

Query  702   NMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLS  881
             NM +++FLDLS N LSGPV   + EN  SLR+LSLAG+  +GPI    + C+ LN LNLS
Sbjct  160   NMMNMKFLDLSNNLLSGPVPYQLFENCASLRYLSLAGNILQGPIGKIFNYCSSLNTLNLS  219

Query  882   NNRFSGDPRFSG--GIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEI  1055
             NN FSGD  F+   GIW L RLRTLD+S+N  SGS+P G + LH LKEL L  N FSG +
Sbjct  220   NNHFSGDLDFASGYGIWSLKRLRTLDLSHNLFSGSIPQGVAALHYLKELLLQGNKFSGPL  279

Query  1056  PVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
             P D+G CPHL+ LDLS NLFTG +P SL+
Sbjct  280   PADIGFCPHLTTLDLSNNLFTGQLPVSLR  308


 Score = 93.2 bits (230),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 76/218 (35%), Positives = 114/218 (52%), Gaps = 6/218 (3%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             + E+ L G   SG +   +    HL  L L++N F+G +   L LL ++  +++S N+++
Sbjct  265   LKELLLQGNKFSGPLPADIGFCPHLTTLDLSNNLFTGQLPVSLRLLNSMIFISVSNNTLT  324

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G +P  +GN+S+L+FLD S N L+G +  S+  N   L  + L G+S  G IP  L    
Sbjct  325   GDIPHWIGNISTLEFLDFSNNHLTGSLPSSLF-NCKKLSVIRLRGNSLNGNIPEGLFDLG  383

Query  858   LLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTL---DVSNNELSGSLPIGASFLHNLKELS  1025
             L   ++LS N F G  P  S      T  +TL   D+S+N L G +P       NL+ L+
Sbjct  384   L-EEIDLSENGFMGSIPPGSSSSSSSTLFQTLCILDLSSNNLVGDIPAEMGLFANLRYLN  442

Query  1026  LGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             L SNH    IP +LG    L  LDL  N   G+IP+ +
Sbjct  443   LSSNHLRSRIPPELGYFHSLIHLDLRNNALYGSIPQEV  480


 Score = 81.3 bits (199),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 106/211 (50%), Gaps = 10/211 (5%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEK------LEHLNVLSLASNNFSGVISPqlglltnlqtlnl  659
             + E+DL   G  G I  G          + L +L L+SNN  G I  ++GL  NL+ LNL
Sbjct  384   LEEIDLSENGFMGSIPPGSSSSSSSTLFQTLCILDLSSNNLVGDIPAEMGLFANLRYLNL  443

Query  660   SKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPS  839
             S N +   +P  LG   SL  LDL  N+L G +   + E+  SL  L L G+S  GPIP 
Sbjct  444   SSNHLRSRIPPELGYFHSLIHLDLRNNALYGSIPQEVCES-RSLGILQLDGNSLTGPIPQ  502

Query  840   SLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKE  1019
              +  CT L  L+LS+N  SG       I  L +L+ L +  NELSG +P     L +L  
Sbjct  503   VIRNCTSLYLLSLSHNHLSGS--IPKSISNLNKLKILKLEFNELSGEIPQELGKLASLLA  560

Query  1020  LSLGSNHFSGEIPVDLGLCPHLSRLDLSENL  1112
             +++  N   G +PV  G+ P L +  L  NL
Sbjct  561   VNVSYNRLIGRLPVG-GVFPTLDQSSLQGNL  590


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 63/212 (30%), Positives = 96/212 (45%), Gaps = 10/212 (5%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN-  704
             L+G +   L   + L+V+ L  N+ +G I P+      L+ ++LS+N   G++P    + 
Sbjct  347   LTGSLPSSLFNCKKLSVIRLRGNSLNGNI-PEGLFDLGLEEIDLSENGFMGSIPPGSSSS  405

Query  705   -----MSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNH  869
                    +L  LDLS N+L G +   M     +LR+L+L+ +     IP  L     L H
Sbjct  406   SSSTLFQTLCILDLSSNNLVGDIPAEM-GLFANLRYLNLSSNHLRSRIPPELGYFHSLIH  464

Query  870   LNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSG  1049
             L+L NN   G       +     L  L +  N L+G +P       +L  LSL  NH SG
Sbjct  465   LDLRNNALYGS--IPQEVCESRSLGILQLDGNSLTGPIPQVIRNCTSLYLLSLSHNHLSG  522

Query  1050  EIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              IP  +     L  L L  N  +G IP+ L +
Sbjct  523   SIPKSISNLNKLKILKLEFNELSGEIPQELGK  554



>emb|CDY20032.1| BnaA09g02190D [Brassica napus]
Length=1014

 Score =   292 bits (747),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 155/269 (58%), Positives = 204/269 (76%), Gaps = 4/269 (1%)
 Frame = +3

Query  339   GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  518
             G   S+QLNDDVLGLIV KS + DP+SHLA+W+EDD SPC+W++VKC+P   RV+E+ L 
Sbjct  25    GDTNSIQLNDDVLGLIVLKSDLHDPSSHLASWNEDDASPCSWSYVKCNPKTSRVTELSLS  84

Query  519   GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  698
             GLGL+GKIGRG++KL+HL  LSL++NNF+G I   L    NLQ L+LS N++SGT+P SL
Sbjct  85    GLGLTGKIGRGIQKLQHLKTLSLSNNNFTGNIM-SLSNNNNLQKLDLSHNNLSGTIPSSL  143

Query  699   GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNL  878
             G   S ++LDL+GNS SG +SD +  N  SL +LSL+ + FEG +P +L +C++LN LNL
Sbjct  144   G---STKYLDLTGNSFSGTLSDDLFTNCSSLTYLSLSHNRFEGELPVTLFRCSVLNTLNL  200

Query  879   SNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
             S+NRFSG+P F   +W L RLRTLD+S N LSG+LP+G   LH+LK L L  N FSG +P
Sbjct  201   SSNRFSGNPSFVSVLWKLERLRTLDLSFNALSGTLPLGILSLHSLKVLQLQGNRFSGPLP  260

Query  1059  VDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              D+GLCPHL+R+DLS N F+G +P +LQR
Sbjct  261   SDIGLCPHLNRVDLSFNRFSGEVPATLQR  289


 Score = 94.0 bits (232),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 119/241 (49%), Gaps = 26/241 (11%)
 Frame = +3

Query  492   GRVSEVDLHGLGLSGKIGRGL-EKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKN  668
             G    +DL G   SG +   L      L  LSL+ N F G +   L   + L TLNLS N
Sbjct  144   GSTKYLDLTGNSFSGTLSDDLFTNCSSLTYLSLSHNRFEGELPVTLFRCSVLNTLNLSSN  203

Query  669   SISG--TVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSS  842
               SG  +    L  +  L+ LDLS N+LSG +   +L +L SL+ L L G+ F GP+PS 
Sbjct  204   RFSGNPSFVSVLWKLERLRTLDLSFNALSGTLPLGIL-SLHSLKVLQLQGNRFSGPLPSD  262

Query  843   LSKCTLLNHLNLSNNRFSGDPR------------------FSGG--IW--GLTRLRTLDV  956
             +  C  LN ++LS NRFSG+                     SGG  +W   +T L  LDV
Sbjct  263   IGLCPHLNRVDLSFNRFSGEVPATLQRLRSLNHLDLSKNLLSGGFPVWIGDMTGLVHLDV  322

Query  957   SNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPES  1136
             S NEL+G++P     L +LK + L  N  SGEIP  L  C  L  + L  N   G+IP+ 
Sbjct  323   SRNELTGAIPSSVGSLRSLKVIILSENKLSGEIPESLESCKELVSVQLKGNGIVGSIPDG  382

Query  1137  L  1139
             L
Sbjct  383   L  383


 Score = 84.0 bits (206),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 76/206 (37%), Positives = 103/206 (50%), Gaps = 3/206 (1%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L+G I   +  L  L V+ L+ N  SG I   L     L ++ L  N I G++PD L N+
Sbjct  327   LTGAIPSSVGSLRSLKVIILSENKLSGEIPESLESCKELVSVQLKGNGIVGSIPDGLFNL  386

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
               LQ +D SGN L+G +         SL  L L+ +S  G IP  +   + L +LNLS N
Sbjct  387   G-LQEIDFSGNGLTGSIPRGSSRLFESLVTLDLSCNSLTGNIPGEVGLFSNLRYLNLSWN  445

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDL  1067
             +F  + R    I  L  L  LD+ NN L GS+P       +L+ L L  N  +G IP  +
Sbjct  446   KF--NTRVPPEIEFLQNLTVLDLRNNALIGSVPADICEPQSLEILQLDGNSLTGSIPEGI  503

Query  1068  GLCPHLSRLDLSENLFTGTIPESLQR  1145
             G C  L  L LS N  TG IP+SL +
Sbjct  504   GNCSSLKLLSLSHNNLTGPIPKSLSK  529


 Score = 68.6 bits (166),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 67/212 (32%), Positives = 102/212 (48%), Gaps = 28/212 (13%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + E+D  G GL+G I RG  +L E L  L L                        S NS+
Sbjct  388   LQEIDFSGNGLTGSIPRGSSRLFESLVTLDL------------------------SCNSL  423

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
             +G +P  +G  S+L++L+LS N  +  V    +E L +L  L L  ++  G +P+ + + 
Sbjct  424   TGNIPGEVGLFSNLRYLNLSWNKFNTRVPPE-IEFLQNLTVLDLRNNALIGSVPADICEP  482

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
               L  L L  N  +G      GI   + L+ L +S+N L+G +P   S L  LK L L +
Sbjct  483   QSLEILQLDGNSLTGS--IPEGIGNCSSLKLLSLSHNNLTGPIPKSLSKLQQLKILKLEA  540

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             N  SGEIP +LG   +L  +++S N   G +P
Sbjct  541   NKLSGEIPKELGGLHNLLLVNISFNRLIGRLP  572



>ref|XP_009111587.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
Length=1014

 Score =   291 bits (746),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 155/269 (58%), Positives = 205/269 (76%), Gaps = 4/269 (1%)
 Frame = +3

Query  339   GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  518
             G   S+QLNDDVLGLIV KS + DP+SHLA+W+EDD SPC+W++VKC+P   RV+E+ L 
Sbjct  25    GDTNSIQLNDDVLGLIVLKSDLHDPSSHLASWNEDDASPCSWSYVKCNPKTSRVTELSLS  84

Query  519   GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  698
             GLGL+GKIGRG++KL+HL  LSL++NNF+G I   L    NLQ L+LS N++SGT+P SL
Sbjct  85    GLGLTGKIGRGIQKLQHLKTLSLSNNNFTGNIM-SLSNNNNLQKLDLSHNNLSGTIPSSL  143

Query  699   GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNL  878
             G   S+++LDL+GNS SG +S+ +  N  SL +LSL+ + FEG +PS+LS+C++LN LNL
Sbjct  144   G---SIKYLDLTGNSFSGTLSNDLFTNCSSLTYLSLSHNRFEGELPSTLSRCSVLNTLNL  200

Query  879   SNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
             S+NRFSG+P F   +W L RLRTLD+S N LSG+LP+G   LH+LK L L  N FSG +P
Sbjct  201   SSNRFSGNPSFVSVLWKLERLRTLDLSFNALSGTLPLGILSLHSLKVLQLQGNRFSGPLP  260

Query  1059  VDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              D+GLCPHL+ +DLS N F G +P +LQR
Sbjct  261   SDIGLCPHLNTVDLSFNRFYGEVPTTLQR  289


 Score = 95.5 bits (236),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 84/206 (41%), Positives = 117/206 (57%), Gaps = 9/206 (4%)
 Frame = +3

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVIS--PqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             G++   L +   LN L+L+SN FSG  S    L  L  L+TL+LS N++SGT+P  + ++
Sbjct  183   GELPSTLSRCSVLNTLNLSSNRFSGNPSFVSVLWKLERLRTLDLSFNALSGTLPLGILSL  242

Query  708   SSLQFLDLSGNSLSGPV-SDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSN  884
              SL+ L L GN  SGP+ SD  L     L  + L+ + F G +P++L +   LNHL+LS 
Sbjct  243   HSLKVLQLQGNRFSGPLPSDIGL--CPHLNTVDLSFNRFYGEVPTTLQRLKSLNHLDLSK  300

Query  885   NRFS-GDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             N  S G P + G + GL  L   DVS NEL+G++P     L +LK + L  N  SGEIP 
Sbjct  301   NFLSSGFPVWIGDMTGLVHL---DVSRNELTGAIPSSVGSLRSLKVIILSENKLSGEIPE  357

Query  1062  DLGLCPHLSRLDLSENLFTGTIPESL  1139
              L  C  L  + L  N F G+IP+ L
Sbjct  358   SLESCKELVSVQLKGNGFVGSIPDGL  383


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 74/206 (36%), Positives = 101/206 (49%), Gaps = 3/206 (1%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L+G I   +  L  L V+ L+ N  SG I   L     L ++ L  N   G++PD L N+
Sbjct  327   LTGAIPSSVGSLRSLKVIILSENKLSGEIPESLESCKELVSVQLKGNGFVGSIPDGLFNL  386

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
               LQ +D SGN L+  +         SL  L L+ +S  G IP  +   + L +LNLS N
Sbjct  387   G-LQEIDFSGNGLTSSIPRGSSRLFESLVTLDLSCNSLTGNIPGEVGLFSNLRYLNLSWN  445

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDL  1067
             +F  + R    I  L  L  LD+ NN L GS+P       +L+ L L  N  +G IP  +
Sbjct  446   KF--NTRVPPEIEFLQNLTVLDLRNNALIGSVPADICEPQSLEILQLDGNSLTGSIPEGI  503

Query  1068  GLCPHLSRLDLSENLFTGTIPESLQR  1145
             G C  L  L LS N  TG IP+SL +
Sbjct  504   GNCSSLKLLSLSHNNLTGPIPKSLSK  529


 Score = 65.9 bits (159),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 66/212 (31%), Positives = 101/212 (48%), Gaps = 28/212 (13%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + E+D  G GL+  I RG  +L E L  L L                        S NS+
Sbjct  388   LQEIDFSGNGLTSSIPRGSSRLFESLVTLDL------------------------SCNSL  423

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
             +G +P  +G  S+L++L+LS N  +  V    +E L +L  L L  ++  G +P+ + + 
Sbjct  424   TGNIPGEVGLFSNLRYLNLSWNKFNTRVPPE-IEFLQNLTVLDLRNNALIGSVPADICEP  482

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
               L  L L  N  +G      GI   + L+ L +S+N L+G +P   S L  LK L L +
Sbjct  483   QSLEILQLDGNSLTGS--IPEGIGNCSSLKLLSLSHNNLTGPIPKSLSKLQQLKILKLEA  540

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             N  SGEIP +LG   +L  +++S N   G +P
Sbjct  541   NKLSGEIPKELGGLHNLLLVNISFNRLIGRLP  572



>ref|XP_010107246.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXC14270.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=1023

 Score =   290 bits (741),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 151/266 (57%), Positives = 199/266 (75%), Gaps = 2/266 (1%)
 Frame = +3

Query  351   SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
             ++QLNDDVLGLIVFKS +QDP+SHL++W+EDDD+PC+W FV+C+P   RVSE+ L  LGL
Sbjct  34    AVQLNDDVLGLIVFKSDIQDPSSHLSSWNEDDDTPCSWKFVRCNPVTNRVSEISLDNLGL  93

Query  531   SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlgl--ltnlqtlnlSKNSISGTVPDSLGN  704
             SG+IG+GLEKL+HL  LSL+ NNFSG ++P+       +L+ LNLS+N +SG +P SL  
Sbjct  94    SGRIGKGLEKLQHLKALSLSGNNFSGDVTPEKLALPTNSLEILNLSRNRLSGRIPSSLVK  153

Query  705   MSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSN  884
             MS ++ LDLS N LSGPV D++ ++  SL  LSLAG+S EG IPS++S+C  LN+ N+SN
Sbjct  154   MSLIRVLDLSENLLSGPVPDNLFDSCFSLHSLSLAGNSLEGSIPSTISRCLSLNNFNISN  213

Query  885   NRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVD  1064
             NRFSG+  F  G W L R+RTLD+S N LSGS+P G S LH LKE  +  NHFS  +P D
Sbjct  214   NRFSGNLDFVSGFWTLERIRTLDLSRNLLSGSIPQGISSLHYLKEFLVQGNHFSETLPSD  273

Query  1065  LGLCPHLSRLDLSENLFTGTIPESLQ  1142
             LGLC HL+ +D  +N FTG + +S+Q
Sbjct  274   LGLCIHLASIDFGDNHFTGGLSDSIQ  299


 Score = 87.8 bits (216),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 107/213 (50%), Gaps = 23/213 (11%)
 Frame = +3

Query  567   HLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSL  746
             HL  +    N+F+G +S  +  L +L    L+ N +SG  P  +G +  L++LD SGN  
Sbjct  279   HLASIDFGDNHFTGGLSDSIQSLNSLTRFGLANNLLSGDFPHWIGELRKLEYLDFSGNGF  338

Query  747   SGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG---------  899
             +G +  +M  ++ SL FLSL+ +   G IPSSL  CT L+ ++LS N F+G         
Sbjct  339   TGSLPSTM-GDMKSLIFLSLSNNKLSGIIPSSLGYCTKLSVIHLSGNSFNGSIPEDLFDL  397

Query  900   --------DPRFSGGIWG-----LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNH  1040
                       + +G I          L  LD+S+N++ G++P       NLK L+L  N+
Sbjct  398   ALEEADLSKNQITGSIPTGSSKLFESLHVLDLSSNKIKGTIPAEMGLFSNLKYLNLSWNN  457

Query  1041  FSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
                 IP + GL  +L+ LDL  +   G+IP  L
Sbjct  458   LQSRIPPEFGLFRNLTVLDLRSSALYGSIPGDL  490


 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 117/220 (53%), Gaps = 9/220 (4%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             ++  +D  G G +G +   +  ++ L  LSL++N  SG+I   LG  T L  ++LS NS 
Sbjct  327   KLEYLDFSGNGFTGSLPSTMGDMKSLIFLSLSNNKLSGIIPSSLGYCTKLSVIHLSGNSF  386

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
             +G++P+ L +++ L+  DLS N ++G +     +   SL  L L+ +  +G IP+ +   
Sbjct  387   NGSIPEDLFDLA-LEEADLSKNQITGSIPTGSSKLFESLHVLDLSSNKIKGTIPAEMGLF  445

Query  855   TLLNHLNLSNNRFSGD--PRFSGGIWGLTR-LRTLDVSNNELSGSLPIGASFLHNLKELS  1025
             + L +LNLS N       P F     GL R L  LD+ ++ L GS+P       +L  L 
Sbjct  446   SNLKYLNLSWNNLQSRIPPEF-----GLFRNLTVLDLRSSALYGSIPGDLCDSGSLDILQ  500

Query  1026  LGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             L  N  +G+IP ++G C  L  L LS N  TG IP+S+ +
Sbjct  501   LDGNSLTGQIPEEIGNCSSLYLLSLSHNKLTGPIPKSISK  540


 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 103/189 (54%), Gaps = 4/189 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + E DL    ++G I  G  KL E L+VL L+SN   G I  ++GL +NL+ LNLS N++
Sbjct  399   LEEADLSKNQITGSIPTGSSKLFESLHVLDLSSNKIKGTIPAEMGLFSNLKYLNLSWNNL  458

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
                +P   G   +L  LDL  ++L G +   + ++ GSL  L L G+S  G IP  +  C
Sbjct  459   QSRIPPEFGLFRNLTVLDLRSSALYGSIPGDLCDS-GSLDILQLDGNSLTGQIPEEIGNC  517

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             + L  L+LS+N+ +G       I  +++L+ L +  N+LSG +P+    L  L  +++  
Sbjct  518   SSLYLLSLSHNKLTGP--IPKSISKISKLKILKMEFNQLSGEIPMELGKLQYLLAVNVSY  575

Query  1035  NHFSGEIPV  1061
             N   G +PV
Sbjct  576   NRLIGRLPV  584



>ref|XP_007139297.1| hypothetical protein PHAVU_008G017400g [Phaseolus vulgaris]
 gb|ESW11291.1| hypothetical protein PHAVU_008G017400g [Phaseolus vulgaris]
Length=1018

 Score =   287 bits (735),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 165/263 (63%), Positives = 205/263 (78%), Gaps = 1/263 (0%)
 Frame = +3

Query  357   QLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  536
             QLNDDVLGLIVFKS +QDP+SHLA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLSG
Sbjct  43    QLNDDVLGLIVFKSDLQDPSSHLASWNEDDVNPCSWQFVQCNPESGRVSEVSLDGLGLSG  102

Query  537   KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  716
             KIGRGLEKL+HL VLSL+ NN SG ISP L L   LQ LNLS N++SG++P S  NM+S+
Sbjct  103   KIGRGLEKLQHLTVLSLSHNNLSGGISPSLTLSNTLQRLNLSHNALSGSIPTSFVNMNSI  162

Query  717   QFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFS  896
             +FLDLS NS SG + ++  +   SL  +SLA + F+GP+P SLS+C+ LN+LNLSNN  S
Sbjct  163   KFLDLSENSFSGSIPETFFDTCSSLHHISLARNMFDGPVPGSLSRCSSLNNLNLSNNHLS  222

Query  897   GDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLC  1076
             G+  F+ GIW LTRLRTLD+SNN LSGSLP G S +HNLKE+ L  N FSG +  D+G C
Sbjct  223   GNVDFN-GIWSLTRLRTLDLSNNALSGSLPSGISSIHNLKEILLQGNQFSGPLSTDIGFC  281

Query  1077  PHLSRLDLSENLFTGTIPESLQR  1145
              HLSRLD S+N F+G +P+SL R
Sbjct  282   LHLSRLDFSDNQFSGELPDSLGR  304


 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 89/237 (38%), Positives = 124/237 (52%), Gaps = 29/237 (12%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL    LSG +  G+  + +L  + L  N FSG +S  +G   +L  L+ S N  
Sbjct  235   RLRTLDLSNNALSGSLPSGISSIHNLKEILLQGNQFSGPLSTDIGFCLHLSRLDFSDNQF  294

Query  675   SGTVPDSLG------------------------NMSSLQFLDLSGNSLSGPVSDSMLENL  782
             SG +PDSLG                        N++SL++L+LS N  +G + +S+ E L
Sbjct  295   SGELPDSLGRLSSLSYFKASNNFFTSKFPPWIGNLTSLEYLELSNNQFTGSIPESIGE-L  353

Query  783   GSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSN  962
             GSL  LS++ +   G IPSSLS CT L+ +    N FSG      G++GL  L  +D+S 
Sbjct  354   GSLSHLSISSNKLVGTIPSSLSSCTKLSVIQFRGNGFSGT--IPEGLFGLG-LEEIDLSR  410

Query  963   NELSGSLPIGAS-FLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             NELSGS+P G+S  L  L  L L  NH  G IP + GL   LS L+LS N     +P
Sbjct  411   NELSGSVPAGSSRLLETLTNLDLSDNHLQGNIPAETGLLSKLSYLNLSWNDLQSQMP  467


 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 99/204 (49%), Gaps = 3/204 (1%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
              +G I   + +L  L+ LS++SN   G I   L   T L  +    N  SGT+P+ L  +
Sbjct  342   FTGSIPESIGELGSLSHLSISSNKLVGTIPSSLSSCTKLSVIQFRGNGFSGTIPEGLFGL  401

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
               L+ +DLS N LSG V       L +L  L L+ +  +G IP+     + L++LNLS N
Sbjct  402   G-LEEIDLSRNELSGSVPAGSSRLLETLTNLDLSDNHLQGNIPAETGLLSKLSYLNLSWN  460

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDL  1067
                       G+  L  L  LD+ N+ L GS+P       NL  L L  N   G IP  +
Sbjct  461   DLQSQMPPEFGL--LQNLAVLDIRNSALHGSVPADICDSGNLAVLQLDENSLQGNIPEGI  518

Query  1068  GLCPHLSRLDLSENLFTGTIPESL  1139
             G C  L  L LS N  TG+IP+S+
Sbjct  519   GNCSSLYLLSLSHNNLTGSIPKSM  542


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 109/215 (51%), Gaps = 9/215 (4%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSG-VISPqlglltnlqtlnlSKNS  671
             ++S +   G G SG I  GL  L  L  + L+ N  SG V +    LL  L  L+LS N 
Sbjct  379   KLSVIQFRGNGFSGTIPEGLFGL-GLEEIDLSRNELSGSVPAGSSRLLETLTNLDLSDNH  437

Query  672   ISGTVPDSLGNMSSLQFLDLSGNSLSG--PVSDSMLENLGSLRFLSLAGSSFEGPIPSSL  845
             + G +P   G +S L +L+LS N L    P    +L+NL     L +  S+  G +P+ +
Sbjct  438   LQGNIPAETGLLSKLSYLNLSWNDLQSQMPPEFGLLQNLA---VLDIRNSALHGSVPADI  494

Query  846   SKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELS  1025
                  L  L L  N   G+     GI   + L  L +S+N L+GS+P   S L+ LK L 
Sbjct  495   CDSGNLAVLQLDENSLQGN--IPEGIGNCSSLYLLSLSHNNLTGSIPKSMSKLNKLKILK  552

Query  1026  LGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             L SN  SGEIP++LG+   L  +++S N  TG +P
Sbjct  553   LESNELSGEIPMELGMLQSLLAVNISYNRLTGRLP  587



>ref|XP_012072583.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Jatropha curcas]
 gb|KDP37890.1| hypothetical protein JCGZ_05772 [Jatropha curcas]
Length=1001

 Score =   285 bits (730),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 161/272 (59%), Positives = 206/272 (76%), Gaps = 2/272 (1%)
 Frame = +3

Query  330   SGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEV  509
             + A     ++LNDDVLGLIVFK  + DP S L +W+EDDDSPC+W F+ C+P  GRVS V
Sbjct  22    AKANDEVPIKLNDDVLGLIVFKYDLIDPFSSLTSWNEDDDSPCSWKFISCNPVTGRVSHV  81

Query  510   DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP  689
              L  L LSGK+ +GL+KL+HL VLSL+ NNFSG I     ++  L+ LNLS NS+SG +P
Sbjct  82    LLDNLSLSGKLSKGLQKLQHLEVLSLSYNNFSGEIITDFPVIPTLENLNLSHNSLSGQLP  141

Query  690   DSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNH  869
              S+  M+S++FLDLS NSLSGP+ D++ +N  SLR+LSLA +S +GP+PS+LSKC+LLN 
Sbjct  142   LSV--MTSIKFLDLSYNSLSGPLPDNLFQNCLSLRYLSLASNSLQGPLPSTLSKCSLLNT  199

Query  870   LNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSG  1049
             LNLSNN FSG+P FS GIW L RLRTLD+S NE SGS+P G S LHN+K L L  N FSG
Sbjct  200   LNLSNNHFSGNPDFSTGIWSLNRLRTLDLSENEFSGSVPEGISALHNMKVLQLEGNQFSG  259

Query  1050  EIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              +P+D+GLC HL +LD S+NLFTG +PESL++
Sbjct  260   PLPIDIGLCIHLYKLDFSDNLFTGPLPESLRQ  291


 Score =   101 bits (251),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 94/162 (58%), Gaps = 7/162 (4%)
 Frame = +3

Query  660   SKNSISGTVPDSLGNMSSLQFLDLSGNSLSGP--VSDSMLENLGSLRFLSLAGSSFEGPI  833
             S+N  SG+VP+ +  + +++ L L GN  SGP  +   +  +L  L F   + + F GP+
Sbjct  229   SENEFSGSVPEGISALHNMKVLQLEGNQFSGPLPIDIGLCIHLYKLDF---SDNLFTGPL  285

Query  834   PSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNL  1013
             P SL + T L+++NLSNN  S D  F   I  L++L  +D S+N L+GSLP+  S +  L
Sbjct  286   PESLRQLTSLSYINLSNNMLSSD--FPQWIGDLSKLVYIDFSSNSLTGSLPLSISEIKAL  343

Query  1014  KELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
               LSL +N  SG IP+ +  C  LS + L  N F GTIPE L
Sbjct  344   TYLSLSNNKLSGNIPISIVYCSMLSVIRLKGNSFNGTIPEGL  385


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 99/212 (47%), Gaps = 3/212 (1%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             ++  +D     L+G +   + +++ L  LSL++N  SG I   +   + L  + L  NS 
Sbjct  318   KLVYIDFSSNSLTGSLPLSISEIKALTYLSLSNNKLSGNIPISIVYCSMLSVIRLKGNSF  377

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
             +GT+P+ L ++  L+ +D S N L G +          +R L L+ ++  G + + +   
Sbjct  378   NGTIPEGLFDLG-LEVVDFSDNQLVGSIPAGSRRFYEEIRTLDLSRNNLTGNVTAEMGLS  436

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             + L +LNLS N      R    +     L  LD+ N+ + GS+P        L  L L  
Sbjct  437   SNLRYLNLSWNNLQS--RMPAEVGYFQNLMVLDLRNSAIFGSIPADICESGRLSILQLDG  494

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             N   G IP ++G C  L  L LS N  +G IP
Sbjct  495   NSLGGSIPEEIGNCSSLYLLSLSHNNLSGPIP  526



>ref|XP_010502811.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   285 bits (728),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 156/269 (58%), Positives = 207/269 (77%), Gaps = 1/269 (0%)
 Frame = +3

Query  339   GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  518
             G  +S+QLNDDVLGLIVFKS + DP+SHL +W+EDD+SPC+W++VKC+P   RV+++ L 
Sbjct  27    GEIDSIQLNDDVLGLIVFKSDLDDPSSHLESWNEDDNSPCSWSYVKCNPKTSRVTDLTLD  86

Query  519   GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  698
             GL L+GKIGRG++KL+HL VLSL++NNF+G ++  L    NL+ L+LS N++SG +P SL
Sbjct  87    GLALTGKIGRGIQKLQHLKVLSLSNNNFNGNLN-ALSTNNNLRKLDLSHNNLSGQIPSSL  145

Query  699   GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNL  878
             G++SSLQ LDL+GNS SG +SD    N  SLR+LSL+ +  EG IPS+L +C++LN LNL
Sbjct  146   GSISSLQHLDLTGNSFSGTLSDDFFNNCSSLRYLSLSHNHLEGQIPSTLFRCSVLNSLNL  205

Query  879   SNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
             S N F+G+P F  GIW L RLR LD+S N LSGS+P+G   LHNLK L L  N F G +P
Sbjct  206   SRNGFTGNPSFVSGIWKLERLRVLDLSFNSLSGSVPLGILSLHNLKWLQLQRNQFQGPLP  265

Query  1059  VDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              D+GLCPHL+R+DLS NLF+G +P +LQR
Sbjct  266   SDIGLCPHLNRVDLSFNLFSGELPRTLQR  294


 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 96/204 (47%), Gaps = 3/204 (1%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L+G++   +  L  L  L L+ N  SG +   L     L  + L  N   G++PD L ++
Sbjct  332   LTGELPSSIGNLRSLKDLILSKNKLSGELPESLESCNELMIVQLKGNGFVGSIPDGLFDL  391

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
               LQ +D SGN  +G +         SL  L L+ +   G IP  +     + +LNLS N
Sbjct  392   G-LQEMDFSGNGFTGSIPRGSSRLFESLVRLDLSRNKLTGNIPGEVGLFIHMKYLNLSWN  450

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDL  1067
              F  + R    I  L  L  LD+ N+ L GS+P       +L+ L L  N  +G IP  +
Sbjct  451   HF--NTRVPPEIEFLQNLTVLDLRNSALIGSVPADICESQSLQILQLDGNSLTGSIPEGI  508

Query  1068  GLCPHLSRLDLSENLFTGTIPESL  1139
             G C  L  L LS N  TG IP+SL
Sbjct  509   GNCTSLKLLSLSHNNLTGPIPKSL  532


 Score = 74.7 bits (182),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 105/209 (50%), Gaps = 5/209 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISP-qlglltnlqtlnlSKNSISGT  683
             V L G G  G I  GL  L  L  +  + N F+G I      L  +L  L+LS+N ++G 
Sbjct  373   VQLKGNGFVGSIPDGLFDL-GLQEMDFSGNGFTGSIPRGSSRLFESLVRLDLSRNKLTGN  431

Query  684   VPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLL  863
             +P  +G    +++L+LS N  +  V    +E L +L  L L  S+  G +P+ + +   L
Sbjct  432   IPGEVGLFIHMKYLNLSWNHFNTRVPPE-IEFLQNLTVLDLRNSALIGSVPADICESQSL  490

Query  864   NHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHF  1043
               L L  N  +G      GI   T L+ L +S+N L+G +P   S L  LK L L +N  
Sbjct  491   QILQLDGNSLTGS--IPEGIGNCTSLKLLSLSHNNLTGPIPKSLSNLQELKILKLEANKL  548

Query  1044  SGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             +GEIP +LG   +L  +++S N   G +P
Sbjct  549   TGEIPKELGELQNLLLVNVSFNRLIGRLP  577



>emb|CDY00141.1| BnaC09g01600D [Brassica napus]
Length=1013

 Score =   282 bits (722),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 152/269 (57%), Positives = 202/269 (75%), Gaps = 4/269 (1%)
 Frame = +3

Query  339   GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  518
             G   S+QLNDDVLGLIV KS + DP+SHLA+W+EDD SPC+W++VKC+P   RV+++ L 
Sbjct  25    GDNNSIQLNDDVLGLIVLKSDLHDPSSHLASWNEDDASPCSWSYVKCNPKTSRVTDLSLS  84

Query  519   GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  698
             GLGL+G IGRG++KL+HL  LSL++NNF+G I   L    NLQ L+LS N++SGT+P SL
Sbjct  85    GLGLTGTIGRGIQKLQHLKTLSLSNNNFTGNIM-SLSNNNNLQRLDLSHNNLSGTIPFSL  143

Query  699   GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNL  878
             G   S + LDL+GNS SG +S+ +  N  SL +LSL+ +  EG +PS+L +C++LN LNL
Sbjct  144   G---SAKHLDLTGNSFSGSLSNDLFTNCSSLTYLSLSHNLLEGELPSTLFRCSVLNTLNL  200

Query  879   SNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
             S+NRFSG+P F  G+W L RLRTLD+S N LSG+LP+G    H+LK L L  N FSG +P
Sbjct  201   SSNRFSGNPSFVSGLWKLERLRTLDLSFNALSGTLPLGILSQHSLKVLQLQGNRFSGRLP  260

Query  1059  VDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              D+GLCPHL+R+DLS N F+G +P +LQR
Sbjct  261   SDIGLCPHLNRVDLSFNRFSGEVPTTLQR  289


 Score = 93.6 bits (231),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 114/207 (55%), Gaps = 7/207 (3%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVIS--PqlglltnlqtlnlSKNSISGTVPDSLG  701
             L G++   L +   LN L+L+SN FSG  S    L  L  L+TL+LS N++SGT+P  + 
Sbjct  181   LEGELPSTLFRCSVLNTLNLSSNRFSGNPSFVSGLWKLERLRTLDLSFNALSGTLPLGIL  240

Query  702   NMSSLQFLDLSGNSLSGPV-SDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNL  878
             +  SL+ L L GN  SG + SD  L     L  + L+ + F G +P++L +   LNHL+L
Sbjct  241   SQHSLKVLQLQGNRFSGRLPSDIGL--CPHLNRVDLSFNRFSGEVPTTLQRLRSLNHLDL  298

Query  879   SNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
             S N  SG   F   I  +T L  LD S NEL+G+LP     L +LK + L  N  SGEIP
Sbjct  299   SKNLLSGG--FPVWIGDMTGLVHLDFSRNELTGALPFSVGTLRSLKVIILSENKLSGEIP  356

Query  1059  VDLGLCPHLSRLDLSENLFTGTIPESL  1139
               L  C  L  + L  N F G+IPE L
Sbjct  357   ESLESCKELVSVQLKGNGFVGSIPEGL  383


 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 100/204 (49%), Gaps = 3/204 (1%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L+G +   +  L  L V+ L+ N  SG I   L     L ++ L  N   G++P+ L N+
Sbjct  327   LTGALPFSVGTLRSLKVIILSENKLSGEIPESLESCKELVSVQLKGNGFVGSIPEGLFNL  386

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
               LQ +D SGN L+G +         SL  L  + +S  G IP  +   + L +LNLS N
Sbjct  387   G-LQEIDFSGNGLTGSIPRGSSRLFESLVTLDFSCNSLSGNIPGEVGLFSNLRYLNLSWN  445

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDL  1067
             +F  + R    I  L  L  LD+ NN L GS+P       +L+ L L  N  +G IP  +
Sbjct  446   KF--NTRVPPEIEFLQNLTVLDLRNNALIGSVPADICEPQSLEILQLDGNSLTGSIPEGI  503

Query  1068  GLCPHLSRLDLSENLFTGTIPESL  1139
             G C  L  L LS N  TG IP+SL
Sbjct  504   GNCYSLKLLSLSHNNLTGPIPKSL  527


 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 65/211 (31%), Positives = 103/211 (49%), Gaps = 26/211 (12%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             + E+D  G GL+G I RG  +L      SL + +FS                    NS+S
Sbjct  388   LQEIDFSGNGLTGSIPRGSSRLFE----SLVTLDFSC-------------------NSLS  424

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G +P  +G  S+L++L+LS N  +  V    +E L +L  L L  ++  G +P+ + +  
Sbjct  425   GNIPGEVGLFSNLRYLNLSWNKFNTRVPPE-IEFLQNLTVLDLRNNALIGSVPADICEPQ  483

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSN  1037
              L  L L  N  +G      GI     L+ L +S+N L+G +P   S L  LK ++L +N
Sbjct  484   SLEILQLDGNSLTGS--IPEGIGNCYSLKLLSLSHNNLTGPIPKSLSNLQELKIVNLEAN  541

Query  1038  HFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
               SGE+P +LG   +L  +++S N   G +P
Sbjct  542   KLSGEVPKELGGLHNLLLVNISFNRLIGRLP  572


 Score = 69.3 bits (168),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 66/205 (32%), Positives = 99/205 (48%), Gaps = 5/205 (2%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             LSG+I   LE  + L  + L  N F G I P+      LQ ++ S N ++G++P     +
Sbjct  351   LSGEIPESLESCKELVSVQLKGNGFVGSI-PEGLFNLGLQEIDFSGNGLTGSIPRGSSRL  409

Query  708   -SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSN  884
               SL  LD S NSLSG +   +     +LR+L+L+ + F   +P  +     L  L+L N
Sbjct  410   FESLVTLDFSCNSLSGNIPGEV-GLFSNLRYLNLSWNKFNTRVPPEIEFLQNLTVLDLRN  468

Query  885   NRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVD  1064
             N   G       I     L  L +  N L+GS+P G    ++LK LSL  N+ +G IP  
Sbjct  469   NALIGS--VPADICEPQSLEILQLDGNSLTGSIPEGIGNCYSLKLLSLSHNNLTGPIPKS  526

Query  1065  LGLCPHLSRLDLSENLFTGTIPESL  1139
             L     L  ++L  N  +G +P+ L
Sbjct  527   LSNLQELKIVNLEANKLSGEVPKEL  551



>ref|XP_010673272.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=1009

 Score =   276 bits (707),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 153/273 (56%), Positives = 196/273 (72%), Gaps = 3/273 (1%)
 Frame = +3

Query  327   TSGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSE  506
             +  A     + LNDDVLGLIVFKS + DP + L++W+EDD S C+W +++C+P+ GRV  
Sbjct  22    SQAANEDSEVGLNDDVLGLIVFKSDLHDPPA-LSSWTEDDGSSCSWKYIQCNPSTGRVIG  80

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             + L GLGLSG++G+GL+KL+ L VLSLA NN +G ISP+L  L  L TL+LS N  +G +
Sbjct  81    LSLTGLGLSGRLGKGLQKLQELKVLSLAKNNLTGEISPELAQLPKLHTLDLSFNKFTGQI  140

Query  687   PDSLGNM-SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLL  863
             P S  N+ SSL++LDL+ N LSGP+ D + +   SL +LSL+G+SFEGPIPSSLSKC++L
Sbjct  141   PTSFSNLGSSLRYLDLTQNVLSGPLPDDIFQTFQSLNYLSLSGNSFEGPIPSSLSKCSVL  200

Query  864   NHLNLSNNRFSGDP-RFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNH  1040
               LNLSNN FSG+P   + GI+ L RLR LD SNN LSG+ P G   LHNLKEL L  N 
Sbjct  201   TGLNLSNNHFSGNPFAQNSGIFALNRLRLLDFSNNFLSGNFPTGIYTLHNLKELHLQGNQ  260

Query  1041  FSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             FS  IP D+GLCPHL +LDLS N FTG IP + 
Sbjct  261   FSDSIPFDIGLCPHLLKLDLSNNYFTGEIPTTF  293


 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 75/215 (35%), Positives = 112/215 (52%), Gaps = 5/215 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             + E+ L G   S  I   +    HL  L L++N F+G I    G L +L  L+L+ N++S
Sbjct  251   LKELHLQGNQFSDSIPFDIGLCPHLLKLDLSNNYFTGEIPTTFGTLKSLVFLSLAHNTLS  310

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G  P  +GN+ +LQ LD S N L+G +  SM  +L  L+ LSL+ +   G +P+S+  CT
Sbjct  311   GEFPQWVGNLINLQHLDFSKNGLTGVLPMSM-GDLKLLQSLSLSNNKITGNLPTSVVYCT  369

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASF-LHNLKELSLGS  1034
              L  L L  N  +G      G++ +  L+ +D+S N  SGS+P  +     +L  L L  
Sbjct  370   ELKTLQLKGNLLNGS--IPEGLFTMG-LQKIDLSENMFSGSIPPASGRDFESLLVLDLSK  426

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             N   GEIP ++GL   L  L+LS N     IP  +
Sbjct  427   NDLKGEIPPEMGLFSSLRYLNLSWNNLHSRIPPEI  461


 Score = 70.9 bits (172),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 103/199 (52%), Gaps = 4/199 (2%)
 Frame = +3

Query  549   GLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLD  728
             G+  L  L +L  ++N  SG     +  L NL+ L+L  N  S ++P  +G    L  LD
Sbjct  220   GIFALNRLRLLDFSNNFLSGNFPTGIYTLHNLKELHLQGNQFSDSIPFDIGLCPHLLKLD  279

Query  729   LSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPR  908
             LS N  +G +  +    L SL FLSLA ++  G  P  +     L HL+ S N  +G   
Sbjct  280   LSNNYFTGEIP-TTFGTLKSLVFLSLAHNTLSGEFPQWVGNLINLQHLDFSKNGLTGVLP  338

Query  909   FSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLS  1088
              S G   L  L++L +SNN+++G+LP    +   LK L L  N  +G IP  L     L 
Sbjct  339   MSMG--DLKLLQSLSLSNNKITGNLPTSVVYCTELKTLQLKGNLLNGSIPEGL-FTMGLQ  395

Query  1089  RLDLSENLFTGTIPESLQR  1145
             ++DLSEN+F+G+IP +  R
Sbjct  396   KIDLSENMFSGSIPPASGR  414


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 74/231 (32%), Positives = 107/231 (46%), Gaps = 29/231 (13%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPql-glltnlqtlnlSKNS  671
              +  + L G  L+G I  GL  +  L  + L+ N FSG I P       +L  L+LSKN 
Sbjct  370   ELKTLQLKGNLLNGSIPEGLFTM-GLQKIDLSENMFSGSIPPASGRDFESLLVLDLSKND  428

Query  672   ISGTVPDSLGNMSSLQFLDLSGNSLSG--PVSDSMLENLGSL--RFLSLAG---------  812
             + G +P  +G  SSL++L+LS N+L    P     L+NL  L  R  +L G         
Sbjct  429   LKGEIPPEMGLFSSLRYLNLSWNNLHSRIPPEIGYLQNLTVLDIRDSALYGLIPGDLCDS  488

Query  813   -----------SSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVS  959
                        ++  GPIP  +  C+ L  L+LS+N  SG       I  L RL  L + 
Sbjct  489   SSSLSILQLDDNALTGPIPQEIGNCSSLYLLSLSHNSLSG--AIPSSISMLKRLEILRLE  546

Query  960   NNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENL  1112
             +NELSG +P     L +L  +++  N   G +P   G+ P+L    L  NL
Sbjct  547   SNELSGEMPKELGTLQDLLAVNVSYNKLIGRLPPG-GIFPNLDASALQGNL  596



>ref|XP_009589224.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Nicotiana tomentosiformis]
Length=938

 Score =   267 bits (682),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 147/220 (67%), Positives = 181/220 (82%), Gaps = 1/220 (0%)
 Frame = +3

Query  489   NGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKN  668
             NGRVSE++L+GL LSGKIGRGLEKL+ L VLSL++NNF+G ISP+LGLL NL+ LNLS+N
Sbjct  2     NGRVSELNLNGLSLSGKIGRGLEKLQSLQVLSLSNNNFTGPISPELGLLINLENLNLSQN  61

Query  669   SISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLG-SLRFLSLAGSSFEGPIPSSL  845
              +SG +P S+  M+SLQFLDLS NSLSGPVSD++ +N G SLR+LSL+G+  EG  P+++
Sbjct  62    GLSGNIPASISKMTSLQFLDLSENSLSGPVSDTIFDNCGNSLRYLSLSGNFLEGAFPTTV  121

Query  846   SKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELS  1025
             SKC  LNHLN+S N  SGDP FS G+WGLTRLRTLD+S+NELSG +P G S LH LKE  
Sbjct  122   SKCNNLNHLNVSRNHLSGDPGFSEGLWGLTRLRTLDLSHNELSGLVPNGVSLLHQLKEFL  181

Query  1026  LGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             L  N FSGE+P D+G CPHL++LDLSENLFTG IPES+Q+
Sbjct  182   LQGNQFSGELPSDIGFCPHLNKLDLSENLFTGAIPESVQK  221


 Score =   113 bits (282),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 83/213 (39%), Positives = 119/213 (56%), Gaps = 5/213 (2%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             ++ E  L G   SG++   +    HLN L L+ N F+G I   +  L  L  L LS N I
Sbjct  176   QLKEFLLQGNQFSGELPSDIGFCPHLNKLDLSENLFTGAIPESVQKLNALSFLTLSNNMI  235

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
             +G  P  + NMSSL++LD SGNSL G + DS + +L  L++LSL+G+   G IP S+  C
Sbjct  236   NGDFPQWISNMSSLEYLDFSGNSLEGSLPDS-IGDLKMLKYLSLSGNKLSGNIPKSMVYC  294

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGA-SFLHNLKELSLG  1031
             T L+ + L  N  +G      G++G+  L   D S NELSGS+P G+     +L+ L L 
Sbjct  295   TSLSTIRLKENALTGS--IPEGLFGIG-LEEADFSRNELSGSIPPGSGKLFESLQVLDLS  351

Query  1032  SNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
              N+ +G IP ++GL   L  L+LS N F   +P
Sbjct  352   GNNLTGNIPAEVGLFSKLRYLNLSWNNFQSRLP  384


 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 110/213 (52%), Gaps = 5/213 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGV--ISPqlglltnlqtlnlSKNSISG  680
             + L G  L G     + K  +LN L+++ N+ SG    S  L  LT L+TL+LS N +SG
Sbjct  106   LSLSGNFLEGAFPTTVSKCNNLNHLNVSRNHLSGDPGFSEGLWGLTRLRTLDLSHNELSG  165

Query  681   TVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTL  860
              VP+ +  +  L+   L GN  SG +  S +     L  L L+ + F G IP S+ K   
Sbjct  166   LVPNGVSLLHQLKEFLLQGNQFSGELP-SDIGFCPHLNKLDLSENLFTGAIPESVQKLNA  224

Query  861   LNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNH  1040
             L+ L LSNN  +GD  F   I  ++ L  LD S N L GSLP     L  LK LSL  N 
Sbjct  225   LSFLTLSNNMINGD--FPQWISNMSSLEYLDFSGNSLEGSLPDSIGDLKMLKYLSLSGNK  282

Query  1041  FSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              SG IP  +  C  LS + L EN  TG+IPE L
Sbjct  283   LSGNIPKSMVYCTSLSTIRLKENALTGSIPEGL  315


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 74/212 (35%), Positives = 103/212 (49%), Gaps = 28/212 (13%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + E D     LSG I  G  KL E L VL L+ NN +G I  ++GL + L+ LNLS N+ 
Sbjct  320   LEEADFSRNELSGSIPPGSGKLFESLQVLDLSGNNLTGNIPAEVGLFSKLRYLNLSWNNF  379

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
                +P  +G   +L  LDL  ++L G +   + ++ GSL  L L G+S  GPIP  +  C
Sbjct  380   QSRLPPEVGYFQNLTVLDLRYSALVGSIPGDICDS-GSLGILQLDGNSLTGPIPDEIGNC  438

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             +                           L  L +S+N LSGS+P   S L  LK L L  
Sbjct  439   S--------------------------SLYLLSLSHNNLSGSIPRSLSMLRKLKILKLEY  472

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             N  SGEIP +LG   +L  +++S N   G +P
Sbjct  473   NQLSGEIPQELGKLENLLAVNISYNRLVGRLP  504



>ref|XP_004492049.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=1011

 Score =   261 bits (666),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 197/265 (74%), Gaps = 1/265 (0%)
 Frame = +3

Query  351   SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
             ++QLNDDVLGLI+FKS + DP SHL++W+EDD +PC+W ++KC+P N RV EV L GL L
Sbjct  33    AIQLNDDVLGLILFKSDLHDPFSHLSSWNEDDANPCSWQYIKCNPQNTRVIEVSLDGLSL  92

Query  531   SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  710
             SGK+GRG EKL+HL  LSL+ NN SG ISP L L   LQ LNLS NS  G +P S  NMS
Sbjct  93    SGKLGRGFEKLQHLVSLSLSHNNLSGNISPFLTLSNTLQKLNLSHNSFHGEIPISFINMS  152

Query  711   SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNR  890
             S++ LDLS NS +G + ++  EN   L  LSLA + FEG IP SLSKC+LLN LNLSNN 
Sbjct  153   SIRLLDLSHNSFNGQIHETFFENCFMLHQLSLARNLFEGEIPMSLSKCSLLNSLNLSNNL  212

Query  891   FSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLG  1070
             FSG+  F+  +W L RLR +D+SNN LSG+L  G S++HNLKEL L +N FSG +P D+G
Sbjct  213   FSGNVDFN-KLWSLKRLRNIDLSNNGLSGNLNDGISYIHNLKELFLQNNQFSGSLPNDIG  271

Query  1071  LCPHLSRLDLSENLFTGTIPESLQR  1145
             LC HLS+LDLS N F+G +PES++R
Sbjct  272   LCIHLSKLDLSTNHFSGELPESIKR  296


 Score = 93.2 bits (230),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 119/237 (50%), Gaps = 29/237 (12%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLE------------------------HLNVLSLASNNF  602
             R+  +DL   GLSG +  G+  +                         HL+ L L++N+F
Sbjct  227   RLRNIDLSNNGLSGNLNDGISYIHNLKELFLQNNQFSGSLPNDIGLCIHLSKLDLSTNHF  286

Query  603   SGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENL  782
             SG +   +  L++L  L +S N + G  P  +GN++SL+ L++S N  SG +  S+ E L
Sbjct  287   SGELPESIKRLSSLSYLKVSNNVLFGEFPQWIGNLTSLEHLEISNNEFSGLIPYSIGE-L  345

Query  783   GSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSN  962
              SL +LS++ +   G IP S+  CT L  +    N F+G      G++GL  +  +D S 
Sbjct  346   RSLSYLSVSNNKLVGNIPLSIVSCTKLCAMKFRGNGFNG--TIPEGLFGLG-VEEMDFSY  402

Query  963   NELSGSLPIGAS-FLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             NE +G +P G +  L  L +L L  NH  G +P ++GL   L  L+LS N F   +P
Sbjct  403   NEFTGKIPAGFNRLLETLTKLDLSDNHLEGNVPAEIGLLSKLRYLNLSWNDFHSRMP  459


 Score = 77.4 bits (189),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 113/235 (48%), Gaps = 25/235 (11%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGL-EKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGT  683
             +DL     +G+I     E    L+ LSLA N F G I   L   + L +LNLS N  SG 
Sbjct  157   LDLSHNSFNGQIHETFFENCFMLHQLSLARNLFEGEIPMSLSKCSLLNSLNLSNNLFSGN  216

Query  684   VP-DSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTL  860
             V  + L ++  L+ +DLS N LSG ++D  +  + +L+ L L  + F G +P+ +  C  
Sbjct  217   VDFNKLWSLKRLRNIDLSNNGLSGNLNDG-ISYIHNLKELFLQNNQFSGSLPNDIGLCIH  275

Query  861   LNHLNLSNNRFSGD----------------------PRFSGGIWGLTRLRTLDVSNNELS  974
             L+ L+LS N FSG+                        F   I  LT L  L++SNNE S
Sbjct  276   LSKLDLSTNHFSGELPESIKRLSSLSYLKVSNNVLFGEFPQWIGNLTSLEHLEISNNEFS  335

Query  975   GSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             G +P     L +L  LS+ +N   G IP+ +  C  L  +    N F GTIPE L
Sbjct  336   GLIPYSIGELRSLSYLSVSNNKLVGNIPLSIVSCTKLCAMKFRGNGFNGTIPEGL  390


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 67/204 (33%), Positives = 100/204 (49%), Gaps = 3/204 (1%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
              SG I   + +L  L+ LS+++N   G I   +   T L  +    N  +GT+P+ L  +
Sbjct  334   FSGLIPYSIGELRSLSYLSVSNNKLVGNIPLSIVSCTKLCAMKFRGNGFNGTIPEGLFGL  393

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
               ++ +D S N  +G +       L +L  L L+ +  EG +P+ +   + L +LNLS N
Sbjct  394   G-VEEMDFSYNEFTGKIPAGFNRLLETLTKLDLSDNHLEGNVPAEIGLLSKLRYLNLSWN  452

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDL  1067
              F    R       L  LR LD+ N+ L GS+P G     NL  L L  N   G IP ++
Sbjct  453   DFHS--RMPPEFGLLQNLRVLDLRNSALFGSIPEGTCDSGNLDVLQLDGNSLKGPIPEEI  510

Query  1068  GLCPHLSRLDLSENLFTGTIPESL  1139
             G C  L  L LS N  TG+IP+S+
Sbjct  511   GNCSSLYLLSLSHNNLTGSIPKSM  534


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 70/214 (33%), Positives = 109/214 (51%), Gaps = 28/214 (13%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             V E+D      +GKI  G  +L E L  L L+ N+  G +  ++GLL+ L+ LNLS N  
Sbjct  395   VEEMDFSYNEFTGKIPAGFNRLLETLTKLDLSDNHLEGNVPAEIGLLSKLRYLNLSWNDF  454

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
                +P   G + +L+ LDL  ++L G + +   ++ G+L  L L G+S +GPIP  +  C
Sbjct  455   HSRMPPEFGLLQNLRVLDLRNSALFGSIPEGTCDS-GNLDVLQLDGNSLKGPIPEEIGNC  513

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             +                           L  L +S+N L+GS+P   S L+ LK L L  
Sbjct  514   S--------------------------SLYLLSLSHNNLTGSIPKSMSKLNKLKILKLEF  547

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPES  1136
             N  SGE+P++LG+  +L  +++S N  TG +P S
Sbjct  548   NELSGELPMELGMLQNLLAVNISHNNLTGRLPTS  581



>ref|XP_009403616.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1003

 Score =   259 bits (661),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 186/263 (71%), Gaps = 2/263 (1%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LND+VLGLIVFK+ ++DP + LA+W+EDD +PC+W  V+C PA  RVS + L  L LSG 
Sbjct  30    LNDEVLGLIVFKAALEDPTAALASWNEDDSTPCSWAHVECDPATSRVSRLALDSLSLSGP  89

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             + RGL++L  L  LSL++NN SG I P L LL  L++L+LS+N+ SG +PD L  + S++
Sbjct  90    LPRGLDRLPALVALSLSNNNLSGPIPPGLSLLPALRSLDLSRNAFSGGLPDDLARLPSIR  149

Query  720   FLDLSGNSLSGPVSDSMLEN--LGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRF  893
              LDLS N+LSGP+  S+  N   G+LRFLSLA +  EGP+P++LS+C+ L  L+LS NR 
Sbjct  150   SLDLSSNALSGPLLSSIFSNATCGTLRFLSLANNRLEGPLPAALSRCSFLLQLDLSGNRL  209

Query  894   SGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGL  1073
             SG P F+ G+W L+RLR LD+S N  SG +P G + LH LK L L  N FSG IP  +GL
Sbjct  210   SGAPDFATGLWSLSRLRVLDLSLNSFSGGVPEGIARLHTLKSLHLNGNRFSGPIPAGVGL  269

Query  1074  CPHLSRLDLSENLFTGTIPESLQ  1142
             CPHLS LDLS N F G +P S++
Sbjct  270   CPHLSSLDLSYNSFVGALPSSMR  292


 Score = 96.7 bits (239),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 78/231 (34%), Positives = 121/231 (52%), Gaps = 23/231 (10%)
 Frame = +3

Query  513   LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  692
             L+G   SG I  G+    HL+ L L+ N+F G +   +  L +L +L+LS N +SG +P 
Sbjct  254   LNGNRFSGPIPAGVGLCPHLSSLDLSYNSFVGALPSSMRYLHSLTSLSLSNNRLSGDIPS  313

Query  693   SLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHL  872
              +GN++++Q LDLS N L+G +  S L  L  L +LSL  +   G IP S++ CT L  L
Sbjct  314   WIGNLTAIQHLDLSDNKLTGNLPSS-LGGLTDLNYLSLTTNMLTGAIPDSIAGCTKLTEL  372

Query  873   NLSNNRFSGD-PR---------------------FSGGIWGLTRLRTLDVSNNELSGSLP  986
             +L  N   G  P+                      +G  W    L++LD+S+N+L+G++P
Sbjct  373   HLKGNGLDGSIPKGLFDLGLQVLDLSSNGLTGTMPAGSTWISETLQSLDLSDNKLTGTIP  432

Query  987   IGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
                +    L+ L+L  N F  ++P +LG   +LS LDL  +   G+IP  L
Sbjct  433   PEMALYFGLRYLNLSWNDFRTQLPPELGFFRNLSVLDLRRSALYGSIPGDL  483


 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 70/213 (33%), Positives = 100/213 (47%), Gaps = 27/213 (13%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKL------------------------EHLNVLSLASNNF  602
             +++E+ L G GL G I +GL  L                        E L  L L+ N  
Sbjct  368   KLTELHLKGNGLDGSIPKGLFDLGLQVLDLSSNGLTGTMPAGSTWISETLQSLDLSDNKL  427

Query  603   SGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENL  782
             +G I P++ L   L+ LNLS N     +P  LG   +L  LDL  ++L G +   + E+ 
Sbjct  428   TGTIPPEMALYFGLRYLNLSWNDFRTQLPPELGFFRNLSVLDLRRSALYGSIPGDLCES-  486

Query  783   GSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSN  962
             GSL  L L G+S  GPIP  +  C+ L  L+ S+N  +G    S G   L +L  L +  
Sbjct  487   GSLSVLQLDGNSLTGPIPEEIGNCSSLYLLSFSHNSLNGSIPASMG--ELKKLEILKLEF  544

Query  963   NELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             N LSG +P     L NL  +++  N F G +PV
Sbjct  545   NNLSGEIPQQLGRLDNLLAVNISHNQFVGRLPV  577


 Score = 52.0 bits (123),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = +3

Query  933   TRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENL  1112
             +R+  L + +  LSG LP G   L  L  LSL +N+ SG IP  L L P L  LDLS N 
Sbjct  74    SRVSRLALDSLSLSGPLPRGLDRLPALVALSLSNNNLSGPIPPGLSLLPALRSLDLSRNA  133

Query  1113  FTGTIPESLQR  1145
             F+G +P+ L R
Sbjct  134   FSGGLPDDLAR  144



>emb|CBI39439.3| unnamed protein product [Vitis vinifera]
Length=803

 Score =   256 bits (653),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 154/263 (59%), Positives = 196/263 (75%), Gaps = 3/263 (1%)
 Frame = +3

Query  354   LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
             +Q+NDDVLGLIVFKSG+ DP+S L +WSEDDDSPC+W FV+C+P+ GRVSEV + GLGLS
Sbjct  8     IQINDDVLGLIVFKSGLHDPSSRLDSWSEDDDSPCSWEFVQCNPSTGRVSEVSVDGLGLS  67

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  713
             GKIGRGLEKL++L VLSL+ NNFSG ISP+L L+T L+ LNLS NS+SG +P SL NM+S
Sbjct  68    GKIGRGLEKLQNLKVLSLSFNNFSGSISPELALITGLERLNLSHNSLSGRIPSSLSNMTS  127

Query  714   LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRF  893
             ++FLDLS NSL+GP+ D M EN  SLR LSL+ +  EGPIPS+L +CT L++LNLS+N+F
Sbjct  128   IRFLDLSHNSLAGPIPDEMFENYSSLRSLSLSMNFLEGPIPSALLRCTTLSNLNLSSNQF  187

Query  894   S-GDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLG  1070
             S GD  F   I  ++ +  +D S N  +GSLP     L +L+ LSL  N  +G IP  L 
Sbjct  188   SAGD--FPQWIGSMSSVEYVDFSGNGFTGSLPASMGNLKSLQFLSLSDNRLTGSIPGSLF  245

Query  1071  LCPHLSRLDLSENLFTGTIPESL  1139
              CP LS + L  N F+G+IPE L
Sbjct  246   YCPKLSVIRLRGNGFSGSIPEGL  268


 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 70/214 (33%), Positives = 99/214 (46%), Gaps = 3/214 (1%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             V  VD  G G +G +   +  L+ L  LSL+ N  +G I   L     L  + L  N  S
Sbjct  202   VEYVDFSGNGFTGSLPASMGNLKSLQFLSLSDNRLTGSIPGSLFYCPKLSVIRLRGNGFS  261

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G++P+ L ++  L  +DLSGN L GP+         SL  L L+ +   G IP+ +   +
Sbjct  262   GSIPEGLFDLG-LDEVDLSGNELEGPIPPGSSRLFESLHSLDLSRNKLTGSIPAEIGLFS  320

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSN  1037
              L +LNLS N      R    +     L  LD+ N  L GS+P       +L  L L  N
Sbjct  321   SLRYLNLSWNSLRS--RMPPELGYFQNLTVLDLRNTFLFGSIPGDICDSGSLGILQLDGN  378

Query  1038  HFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
               +G IP + G C  L  L +S N   G+IP+S 
Sbjct  379   SLTGPIPDEFGNCSSLYLLSMSHNELNGSIPKSF  412


 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 104/212 (49%), Gaps = 28/212 (13%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             + EVDL G  L G I  G  +L E L+ L L+ N  +G I  ++GL ++L+ LNLS NS+
Sbjct  273   LDEVDLSGNELEGPIPPGSSRLFESLHSLDLSRNKLTGSIPAEIGLFSSLRYLNLSWNSL  332

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
                +P  LG   +L  LDL    L G +   + ++ GSL  L L G+S  GPIP     C
Sbjct  333   RSRMPPELGYFQNLTVLDLRNTFLFGSIPGDICDS-GSLGILQLDGNSLTGPIPDEFGNC  391

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             +                           L  L +S+NEL+GS+P   + L  L+ L L  
Sbjct  392   S--------------------------SLYLLSMSHNELNGSIPKSFAMLKKLEILRLEF  425

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             N  SGEIP +LG   +L  +++S N   G +P
Sbjct  426   NELSGEIPRELGSLENLLAVNVSYNRLIGRLP  457



>ref|XP_010929848.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=1011

 Score =   252 bits (644),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 143/271 (53%), Positives = 185/271 (68%), Gaps = 4/271 (1%)
 Frame = +3

Query  336   AGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  515
             A G     LND+VLGLIVFKS ++DP + LA+WSE D +PC W  V+C PA   V  + L
Sbjct  27    ADGDLPTPLNDEVLGLIVFKSALEDPTAALASWSETDANPCGWAHVECDPATSHVLRLYL  86

Query  516   HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  695
               L LSG + RGL++L +L  LS+++NN SG++   L LL  L +L+LS+N+ SG +P  
Sbjct  87    DSLSLSGPLPRGLDRLPYLETLSISNNNLSGLLPAGLSLLPRLHSLDLSRNAFSGRLPQD  146

Query  696   LGNMSSLQFLDLSGNSLSGPVSDSML--ENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNH  869
             LGN+ SL+ +DLS NSLSGP+ DS+       SLR+LSLA +  EGPIPS+LS+C+ L H
Sbjct  147   LGNIPSLRSVDLSSNSLSGPIPDSLFSAATCSSLRYLSLAENRLEGPIPSTLSRCSFLLH  206

Query  870   LNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSG  1049
             LNLS N+ SG P     +W L+RLR LD+S N  SGSLP   + LHNLK L L SN FSG
Sbjct  207   LNLSGNQLSGSP--PSALWSLSRLRALDLSRNFFSGSLPEAVANLHNLKNLGLSSNCFSG  264

Query  1050  EIPVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
              IPV +GLCPHL+ LDLS N F   +P+S+Q
Sbjct  265   PIPVGVGLCPHLTSLDLSHNSFDAPLPDSIQ  295


 Score = 99.8 bits (247),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 115/206 (56%), Gaps = 7/206 (3%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L G I   L +   L  L+L+ N  SG     L  L+ L+ L+LS+N  SG++P+++ N+
Sbjct  190   LEGPIPSTLSRCSFLLHLNLSGNQLSGSPPSALWSLSRLRALDLSRNFFSGSLPEAVANL  249

Query  708   SSLQFLDLSGNSLSGP--VSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLS  881
              +L+ L LS N  SGP  V   +  +L SL    L+ +SF+ P+P S+     L  LNLS
Sbjct  250   HNLKNLGLSSNCFSGPIPVGVGLCPHLTSL---DLSHNSFDAPLPDSIQWLASLTFLNLS  306

Query  882   NNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             NN+ SGD      I  +T L+ LD+S+N+L+GSLP     L  L  LSL  N  +G IP 
Sbjct  307   NNQLSGD--LPAWISNMTALQHLDLSSNQLTGSLPASLDHLKELNYLSLSDNMLAGPIPD  364

Query  1062  DLGLCPHLSRLDLSENLFTGTIPESL  1139
                 C  LS+L L +N   G+IP++L
Sbjct  365   SAAECRRLSQLWLKKNRLNGSIPQAL  390


 Score = 93.6 bits (231),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 83/237 (35%), Positives = 122/237 (51%), Gaps = 28/237 (12%)
 Frame = +3

Query  510   DLHGLGLS-----GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             +L  LGLS     G I  G+    HL  L L+ N+F   +   +  L +L  LNLS N +
Sbjct  251   NLKNLGLSSNCFSGPIPVGVGLCPHLTSLDLSHNSFDAPLPDSIQWLASLTFLNLSNNQL  310

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
             SG +P  + NM++LQ LDLS N L+G +  S L++L  L +LSL+ +   GPIP S ++C
Sbjct  311   SGDLPAWISNMTALQHLDLSSNQLTGSLPAS-LDHLKELNYLSLSDNMLAGPIPDSAAEC  369

Query  855   TLLNHLNLSNNRFSGD-PR--FSGGIWGL-------------------TRLRTLDVSNNE  968
               L+ L L  NR +G  P+  F  G+  L                     L +LD+SNN 
Sbjct  370   RRLSQLWLKKNRLNGSIPQALFDLGLEVLDLSSNELTGTIPPGSARISETLHSLDLSNNR  429

Query  969   LSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             L+G++P   +   NL+ L+L  N    ++P +LG   +L+ LDL  +   G IP  L
Sbjct  430   LTGTIPPEMALYFNLRYLNLSWNDLRTKLPPELGYFHNLTVLDLRSSALYGPIPGDL  486


 Score = 70.9 bits (172),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 110/213 (52%), Gaps = 5/213 (2%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISP-qlglltnlqtlnlSKNS  671
             R+S++ L    L+G I + L  L  L VL L+SN  +G I P    +   L +L+LS N 
Sbjct  371   RLSQLWLKKNRLNGSIPQALFDL-GLEVLDLSSNELTGTIPPGSARISETLHSLDLSNNR  429

Query  672   ISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSK  851
             ++GT+P  +    +L++L+LS N L   +    L    +L  L L  S+  GPIP  L  
Sbjct  430   LTGTIPPEMALYFNLRYLNLSWNDLRTKLPPE-LGYFHNLTVLDLRSSALYGPIPGDLCD  488

Query  852   CTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLG  1031
                L  L L +N  SG  R    +   + L  L +S+N L+GS+P   + L  L+ L+L 
Sbjct  489   SGGLAVLQLDSNSLSG--RIPEEMGNCSSLYLLSLSHNNLNGSIPASMARLKKLEILNLE  546

Query  1032  SNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
              N+ SGEIP  LG   +L  +++S N   G +P
Sbjct  547   FNNLSGEIPQQLGGLDNLLAVNISHNQLIGRLP  579


 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 66/215 (31%), Positives = 99/215 (46%), Gaps = 38/215 (18%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGT  683
             +DL    L+G I  G  ++ E L+ L L++N  +G I P++ L  NL+ LNLS N +   
Sbjct  398   LDLSSNELTGTIPPGSARISETLHSLDLSNNRLTGTIPPEMALYFNLRYLNLSWNDLRTK  457

Query  684   VPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTL-  860
             +P  LG   +L  LDL  ++L GP+   + ++ G L  L L  +S  G IP  +  C+  
Sbjct  458   LPPELGYFHNLTVLDLRSSALYGPIPGDLCDS-GGLAVLQLDSNSLSGRIPEEMGNCSSL  516

Query  861   -----------------------LNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNEL  971
                                    L  LNL  N  SG+      + GL  L  +++S+N+L
Sbjct  517   YLLSLSHNNLNGSIPASMARLKKLEILNLEFNNLSGE--IPQQLGGLDNLLAVNISHNQL  574

Query  972   SGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLC  1076
              G LP G  F  +L + +L  N         LGLC
Sbjct  575   IGRLPTGGVF-QSLDQSALQGN---------LGLC  599



>ref|XP_009406353.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1025

 Score =   251 bits (642),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 153/277 (55%), Positives = 194/277 (70%), Gaps = 8/277 (3%)
 Frame = +3

Query  336   AGGAE-SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  512
             AGGA+    LND+VLGLIVFKS ++DPA  LATW+E D +PC W+ V+C  A+ RV  +D
Sbjct  31    AGGADLPTPLNDEVLGLIVFKSVLEDPAGALATWNEADATPCNWSHVECGVASSRVVRLD  90

Query  513   LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  692
             L  L LSG + RGL++L  L  LSLA NN SG I P L LL +L++L+LS+N+ SG +PD
Sbjct  91    LASLSLSGPLPRGLDRLPALASLSLADNNLSGPIPPGLSLLPSLRSLDLSRNAFSGRLPD  150

Query  693   SLGNMSSLQFLDLSGNSLSGPVSDSML-------ENLGSLRFLSLAGSSFEGPIPSSLSK  851
              L  +SS++ LDLS NSL+GP+ DS            GSLR+LSLAG+ FEGP+PS+L +
Sbjct  151   DLSLLSSIRSLDLSSNSLAGPIPDSFFSSSHSSATTCGSLRYLSLAGNRFEGPLPSTLPQ  210

Query  852   CTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLG  1031
             C+ L HLNLS+NRFSG P F+ G+W L+RLR LD+S N  SG +P G   LHNLK L L 
Sbjct  211   CSFLLHLNLSDNRFSGAPDFANGLWPLSRLRVLDLSRNSFSGPIPAGIGDLHNLKHLQLN  270

Query  1032  SNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
              N FSG IP  +GLCPHL  LDLS N F G +P+S+Q
Sbjct  271   HNQFSGVIPAGIGLCPHLDTLDLSFNSFDGHLPDSVQ  307


 Score = 95.5 bits (236),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 85/216 (39%), Positives = 116/216 (54%), Gaps = 5/216 (2%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL     SG I  G+  L +L  L L  N FSGVI   +GL  +L TL+LS NS 
Sbjct  239   RLRVLDLSRNSFSGPIPAGIGDLHNLKHLQLNHNQFSGVIPAGIGLCPHLDTLDLSFNSF  298

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
              G +PDS+  +SS+ FL LS N LSG V    + NL S++ L L+ + F G +P SL   
Sbjct  299   DGHLPDSVQYLSSMTFLSLSNNQLSGDVL-PWIGNLTSVQHLDLSNNKFTGSLPPSLGGL  357

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
               L +L+LSNN+ +G       +   ++L  L +  N L+GS+P G  F   L+ L L S
Sbjct  358   KELTYLSLSNNKLTGT--IPDAVAECSKLTELRLKGNRLNGSIPQGL-FNLGLEVLDLSS  414

Query  1035  NHFSGEIPV-DLGLCPHLSRLDLSENLFTGTIPESL  1139
             N  SG +P     +   L  LDLS N  TG IP  +
Sbjct  415   NELSGAMPPGSTRISETLHSLDLSANQLTGAIPPEM  450


 Score = 78.6 bits (192),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 114/216 (53%), Gaps = 11/216 (5%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISP-qlglltnlqtlnlSKNS  671
             +++E+ L G  L+G I +GL  L  L VL L+SN  SG + P    +   L +L+LS N 
Sbjct  383   KLTELRLKGNRLNGSIPQGLFNL-GLEVLDLSSNELSGAMPPGSTRISETLHSLDLSANQ  441

Query  672   ISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLS---LAGSSFEGPIPSS  842
             ++G +P  + +  SL+FL+LS N L  P    +L   G  R+L+   L  S   G IP+ 
Sbjct  442   LTGAIPPEMASYFSLRFLNLSWNELRAP----LLPEFGLFRYLTVLDLRSSKLYGTIPAD  497

Query  843   LSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKEL  1022
             + K   L+ L L  N FSG       I   + L  L +S+N L+GS+P   S L  L+ L
Sbjct  498   MCKSGSLSVLQLDGNSFSGP--IPDEIGNCSSLYLLSLSHNSLNGSIPASLSRLKKLEIL  555

Query  1023  SLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
              L  N+ SGEIP  LG   +L  +++S N   G +P
Sbjct  556   KLEFNNLSGEIPQQLGGLDNLLAVNISHNRLIGRLP  591


 Score = 74.3 bits (181),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 75/219 (34%), Positives = 106/219 (48%), Gaps = 9/219 (4%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             V  +DL     +G +   L  L+ L  LSL++N  +G I   +   + L  L L  N ++
Sbjct  336   VQHLDLSNNKFTGSLPPSLGGLKELTYLSLSNNKLTGTIPDAVAECSKLTELRLKGNRLN  395

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G++P  L N+  L+ LDLS N LSG +         +L  L L+ +   G IP  ++   
Sbjct  396   GSIPQGLFNLG-LEVLDLSSNELSGAMPPGSTRISETLHSLDLSANQLTGAIPPEMASYF  454

Query  858   LLNHLNLSNNRFSGD--PRFSGGIWGLTR-LRTLDVSNNELSGSLPIGASFLHNLKELSL  1028
              L  LNLS N       P F     GL R L  LD+ +++L G++P       +L  L L
Sbjct  455   SLRFLNLSWNELRAPLLPEF-----GLFRYLTVLDLRSSKLYGTIPADMCKSGSLSVLQL  509

Query  1029  GSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
               N FSG IP ++G C  L  L LS N   G+IP SL R
Sbjct  510   DGNSFSGPIPDEIGNCSSLYLLSLSHNSLNGSIPASLSR  548



>ref|XP_002459131.1| hypothetical protein SORBIDRAFT_03g046350 [Sorghum bicolor]
 gb|EES04251.1| hypothetical protein SORBIDRAFT_03g046350 [Sorghum bicolor]
Length=1059

 Score =   249 bits (635),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 134/263 (51%), Positives = 182/263 (69%), Gaps = 4/263 (2%)
 Frame = +3

Query  354   LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
             + +N++VLGL+VFKS + DP   LATW+E D +PC W  V+C PA  RV  + L GL LS
Sbjct  33    MAVNEEVLGLVVFKSALSDPTGALATWTESDATPCGWARVECDPATSRVLRLALDGLALS  92

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  713
             G + RGL++L  L  LSLA NN SG + P L LL +L++L+LS N+ SG +PD +  ++S
Sbjct  93    GSMPRGLDRLPALQDLSLARNNLSGPLPPGLSLLGSLRSLDLSYNAFSGPLPDDVARLAS  152

Query  714   LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSL-SKCTLLNHLNLSNNR  890
             L++LDL+GN+ SGP+  +      +LRFL L+G+ F GP+P  L +K  LL HLN+S N+
Sbjct  153   LRYLDLTGNAFSGPLPPAFPR---TLRFLVLSGNQFSGPVPEGLAAKSPLLLHLNVSGNQ  209

Query  891   FSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLG  1070
              SG P F+G +W L RLRTLD+S N+ SG +  G + LHNLK LSL  N FSG +P D+G
Sbjct  210   LSGSPDFAGALWPLERLRTLDLSRNQFSGPVTDGIARLHNLKTLSLSGNRFSGAVPADIG  269

Query  1071  LCPHLSRLDLSENLFTGTIPESL  1139
             LCPHLS +DLS N F G +P+S+
Sbjct  270   LCPHLSTIDLSSNAFDGHLPDSI  292


 Score =   103 bits (256),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 83/216 (38%), Positives = 120/216 (56%), Gaps = 5/216 (2%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL     SG +  G+ +L +L  LSL+ N FSG +   +GL  +L T++LS N+ 
Sbjct  225   RLRTLDLSRNQFSGPVTDGIARLHNLKTLSLSGNRFSGAVPADIGLCPHLSTIDLSSNAF  284

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
              G +PDS+G + SL +L  SGN LSG V  + L  L +++ L L+ ++F G +P SL   
Sbjct  285   DGHLPDSIGQLGSLVYLSASGNRLSGDVP-AWLGKLAAVQHLDLSDNAFTGSLPDSLGDL  343

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
               L +L+LS N+ SG       + G T+L  L +  N LSGS+P  A F   L+ L + S
Sbjct  344   KALKYLSLSRNQLSG--AVPASMSGCTKLAELHLRGNSLSGSIP-DALFDVGLETLDVSS  400

Query  1035  NHFSGEIPV-DLGLCPHLSRLDLSENLFTGTIPESL  1139
             N  SG +P     L   L  LDLS N+ TG IP  +
Sbjct  401   NALSGVLPSGSTRLAETLQWLDLSGNMLTGGIPTEM  436


 Score = 77.4 bits (189),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 71/205 (35%), Positives = 106/205 (52%), Gaps = 5/205 (2%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             LSG +   L KL  +  L L+ N F+G +   LG L  L+ L+LS+N +SG VP S+   
Sbjct  308   LSGDVPAWLGKLAAVQHLDLSDNAFTGSLPDSLGDLKALKYLSLSRNQLSGAVPASMSGC  367

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSK-CTLLNHLNLSN  884
             + L  L L GNSLSG + D++ +    L  L ++ ++  G +PS  ++    L  L+LS 
Sbjct  368   TKLAELHLRGNSLSGSIPDALFDV--GLETLDVSSNALSGVLPSGSTRLAETLQWLDLSG  425

Query  885   NRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVD  1064
             N  +G       ++   +LR L++S N+L   LP     L NL  L L S    G +P D
Sbjct  426   NMLTGGIPTEMSLF--FKLRYLNLSRNDLRTPLPPELGLLRNLTVLDLRSTGLYGAMPAD  483

Query  1065  LGLCPHLSRLDLSENLFTGTIPESL  1139
             L     L+ L L  N  +G IP+S+
Sbjct  484   LCESGSLAVLQLDGNSLSGPIPDSI  508


 Score = 74.3 bits (181),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 77/259 (30%), Positives = 117/259 (45%), Gaps = 47/259 (18%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             V  +DL     +G +   L  L+ L  LSL+ N  SG +   +   T L  L+L  NS+S
Sbjct  322   VQHLDLSDNAFTGSLPDSLGDLKALKYLSLSRNQLSGAVPASMSGCTKLAELHLRGNSLS  381

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G++PD+L ++  L+ LD+S N+LSG +         +L++L L+G+   G IP+ +S   
Sbjct  382   GSIPDALFDVG-LETLDVSSNALSGVLPSGSTRLAETLQWLDLSGNMLTGGIPTEMSLFF  440

Query  858   LLNHLNLSNN--RFSGDPRF------------SGGIWG----------------------  929
              L +LNLS N  R    P              S G++G                      
Sbjct  441   KLRYLNLSRNDLRTPLPPELGLLRNLTVLDLRSTGLYGAMPADLCESGSLAVLQLDGNSL  500

Query  930   ----------LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                        + L  L + +N L+G +P G S L  L+ L L  N+ SGEIP  LG   
Sbjct  501   SGPIPDSIGNCSSLYLLSLGHNGLTGPIPAGISELKKLEILRLEYNNLSGEIPAQLGGLE  560

Query  1080  HLSRLDLSENLFTGTIPES  1136
             +L  +++S N   G +P S
Sbjct  561   NLLAVNISHNRLVGRLPAS  579



>dbj|BAB92869.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 gb|EAZ14887.1| hypothetical protein OsJ_04818 [Oryza sativa Japonica Group]
Length=1013

 Score =   246 bits (629),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 128/271 (47%), Positives = 185/271 (68%), Gaps = 3/271 (1%)
 Frame = +3

Query  327   TSGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSE  506
              + A     + +N++VLGL+VFKS + DP+  LATW+E D +PC W  V+C PA  RV  
Sbjct  15    AAAADSTMPMPVNEEVLGLVVFKSALSDPSGALATWTESDATPCGWAHVECDPATSRVLR  74

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             + L GLGLSG++ RGL++L  L  LS+A NN SG + P L LL +L++++LS N+ SG +
Sbjct  75    LALDGLGLSGRMPRGLDRLAALQSLSVARNNLSGELPPGLSLLASLRSIDLSYNAFSGPL  134

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P  +  ++SL++LDL+GN+ SGP+  +      ++RFL L+G+ F GP+P  LSK + L 
Sbjct  135   PGDVPLLASLRYLDLTGNAFSGPLPATFP---ATVRFLMLSGNQFSGPLPQGLSKSSFLL  191

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
             HLNLS N+ SG P F+G +W L+RLR LD+S N+ SG++  G + LHNLK + L  N F 
Sbjct  192   HLNLSGNQLSGSPDFAGALWPLSRLRALDLSRNQFSGTVTTGIANLHNLKTIDLSGNRFF  251

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             G +P D+GLCPHLS +D+S N F G +P+S+
Sbjct  252   GAVPSDIGLCPHLSTVDISSNAFDGQLPDSI  282


 Score = 97.4 bits (241),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 123/243 (51%), Gaps = 35/243 (14%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL     SG +  G+  L +L  + L+ N F G +   +GL  +L T+++S N+ 
Sbjct  215   RLRALDLSRNQFSGTVTTGIANLHNLKTIDLSGNRFFGAVPSDIGLCPHLSTVDISSNAF  274

Query  675   SGTVPDS------------------------LGNMSSLQFLDLSGNSLSGPVSDSMLENL  782
              G +PDS                        LG++++LQ LD S N+L+G + DS L  L
Sbjct  275   DGQLPDSIAHLGSLVYFAASGNRFSGDVPAWLGDLAALQHLDFSDNALTGRLPDS-LGKL  333

Query  783   GSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG---DPRFSGGIWGLTRLRTLD  953
               LR+LS++ +   G IP ++S CT L  L+L  N  SG   D  F  G      L TLD
Sbjct  334   KDLRYLSMSENQLSGAIPDAMSGCTKLAELHLRANNLSGSIPDALFDVG------LETLD  387

Query  954   VSNNELSGSLPIGASFL-HNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             +S+N LSG LP G++ L   L+ L L  N  +G IP ++ L  +L  L+LS N     +P
Sbjct  388   MSSNALSGVLPSGSTKLAETLQWLDLSVNQITGGIPAEMALFMNLRYLNLSRNDLRTQLP  447

Query  1131  ESL  1139
               L
Sbjct  448   PEL  450


 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 72/214 (34%), Positives = 113/214 (53%), Gaps = 3/214 (1%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +S VD+      G++   +  L  L   + + N FSG +   LG L  LQ L+ S N+++
Sbjct  264   LSTVDISSNAFDGQLPDSIAHLGSLVYFAASGNRFSGDVPAWLGDLAALQHLDFSDNALT  323

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G +PDSLG +  L++L +S N LSG + D+M      L  L L  ++  G IP +L    
Sbjct  324   GRLPDSLGKLKDLRYLSMSENQLSGAIPDAM-SGCTKLAELHLRANNLSGSIPDALFDVG  382

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSN  1037
              L  L++S+N  SG    SG       L+ LD+S N+++G +P   +   NL+ L+L  N
Sbjct  383   -LETLDMSSNALSGV-LPSGSTKLAETLQWLDLSVNQITGGIPAEMALFMNLRYLNLSRN  440

Query  1038  HFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
                 ++P +LGL  +L+ LDL  +   GT+P  L
Sbjct  441   DLRTQLPPELGLLRNLTVLDLRSSGLYGTMPSDL  474


 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 72/236 (31%), Positives = 113/236 (48%), Gaps = 23/236 (10%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +  +D     L+G++   L KL+ L  LS++ N  SG I   +   T L  L+L  N++S
Sbjct  312   LQHLDFSDNALTGRLPDSLGKLKDLRYLSMSENQLSGAIPDAMSGCTKLAELHLRANNLS  371

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G++PD+L ++  L+ LD+S N+LSG +     +   +L++L L+ +   G IP+ ++   
Sbjct  372   GSIPDALFDVG-LETLDMSSNALSGVLPSGSTKLAETLQWLDLSVNQITGGIPAEMALFM  430

Query  858   LLNHLNLSNN--RFSGDPRF------------SGGIWGLT--------RLRTLDVSNNEL  971
              L +LNLS N  R    P              S G++G           L  L +  N L
Sbjct  431   NLRYLNLSRNDLRTQLPPELGLLRNLTVLDLRSSGLYGTMPSDLCEAGSLAVLQLDGNSL  490

Query  972   SGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +G +P       +L  LSLG N  +G IPV +     L  L L  N  +G IP+ L
Sbjct  491   AGPIPDNIGNCSSLYLLSLGHNSLTGPIPVGMSELKKLEILRLEYNNLSGEIPQQL  546



>gb|EAY77289.1| hypothetical protein OsI_05265 [Oryza sativa Indica Group]
Length=1013

 Score =   246 bits (627),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 128/271 (47%), Positives = 185/271 (68%), Gaps = 3/271 (1%)
 Frame = +3

Query  327   TSGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSE  506
              + A     + +N++VLGL+VFKS + DP+  LATW+E D +PC W  V+C PA  RV  
Sbjct  15    AAAADSTMPMPVNEEVLGLVVFKSALSDPSGALATWTESDATPCGWAHVECDPATSRVLR  74

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             + L GLGLSG++ RGL++L  L  LS+A NN SG + P L LL +L++++LS N+ SG +
Sbjct  75    LALDGLGLSGRMPRGLDRLAALQSLSVARNNLSGELPPGLSLLASLRSIDLSYNAFSGPL  134

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P  +  ++SL++LDL+GN+ SGP+  +      ++RFL L+G+ F GP+P  LSK + L 
Sbjct  135   PGDVPLLASLRYLDLTGNAFSGPLPATFP---ATVRFLMLSGNQFSGPLPQGLSKSSFLL  191

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
             HLNLS N+ SG P F+G +W L+RLR LD+S N+ SG++  G + LHNLK + L  N F 
Sbjct  192   HLNLSGNQLSGSPDFAGELWPLSRLRALDLSRNQFSGTVTTGIANLHNLKTIDLSGNRFF  251

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             G +P D+GLCPHLS +D+S N F G +P+S+
Sbjct  252   GAVPSDIGLCPHLSTVDISSNAFDGQLPDSI  282


 Score = 97.4 bits (241),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 123/243 (51%), Gaps = 35/243 (14%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL     SG +  G+  L +L  + L+ N F G +   +GL  +L T+++S N+ 
Sbjct  215   RLRALDLSRNQFSGTVTTGIANLHNLKTIDLSGNRFFGAVPSDIGLCPHLSTVDISSNAF  274

Query  675   SGTVPDS------------------------LGNMSSLQFLDLSGNSLSGPVSDSMLENL  782
              G +PDS                        LG++++LQ LD S N+L+G + DS L  L
Sbjct  275   DGQLPDSIAHLGSLVYFAASGNRFSGDVPAWLGDLAALQHLDFSDNALTGRLPDS-LGKL  333

Query  783   GSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG---DPRFSGGIWGLTRLRTLD  953
               LR+LS++ +   G IP ++S CT L  L+L  N  SG   D  F  G      L TLD
Sbjct  334   KDLRYLSMSENQLSGAIPDAMSGCTKLAELHLRANNLSGSIPDALFDVG------LETLD  387

Query  954   VSNNELSGSLPIGASFL-HNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             +S+N LSG LP G++ L   L+ L L  N  +G IP ++ L  +L  L+LS N     +P
Sbjct  388   MSSNALSGVLPSGSTKLAETLQWLDLSVNQITGGIPAEMALFMNLRYLNLSRNDLRTQLP  447

Query  1131  ESL  1139
               L
Sbjct  448   PEL  450


 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 72/214 (34%), Positives = 113/214 (53%), Gaps = 3/214 (1%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +S VD+      G++   +  L  L   + + N FSG +   LG L  LQ L+ S N+++
Sbjct  264   LSTVDISSNAFDGQLPDSIAHLGSLVYFAASGNRFSGDVPAWLGDLAALQHLDFSDNALT  323

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G +PDSLG +  L++L +S N LSG + D+M      L  L L  ++  G IP +L    
Sbjct  324   GRLPDSLGKLKDLRYLSMSENQLSGAIPDAM-SGCTKLAELHLRANNLSGSIPDALFDVG  382

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSN  1037
              L  L++S+N  SG    SG       L+ LD+S N+++G +P   +   NL+ L+L  N
Sbjct  383   -LETLDMSSNALSG-VLPSGSTKLAETLQWLDLSVNQITGGIPAEMALFMNLRYLNLSRN  440

Query  1038  HFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
                 ++P +LGL  +L+ LDL  +   GT+P  L
Sbjct  441   DLRTQLPPELGLLRNLTVLDLRSSGLYGTMPSDL  474


 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 72/236 (31%), Positives = 113/236 (48%), Gaps = 23/236 (10%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +  +D     L+G++   L KL+ L  LS++ N  SG I   +   T L  L+L  N++S
Sbjct  312   LQHLDFSDNALTGRLPDSLGKLKDLRYLSMSENQLSGAIPDAMSGCTKLAELHLRANNLS  371

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G++PD+L ++  L+ LD+S N+LSG +     +   +L++L L+ +   G IP+ ++   
Sbjct  372   GSIPDALFDVG-LETLDMSSNALSGVLPSGSTKLAETLQWLDLSVNQITGGIPAEMALFM  430

Query  858   LLNHLNLSNN--RFSGDPRF------------SGGIWGLT--------RLRTLDVSNNEL  971
              L +LNLS N  R    P              S G++G           L  L +  N L
Sbjct  431   NLRYLNLSRNDLRTQLPPELGLLRNLTVLDLRSSGLYGTMPSDLCEAGSLAVLQLDGNSL  490

Query  972   SGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +G +P       +L  LSLG N  +G IPV +     L  L L  N  +G IP+ L
Sbjct  491   AGPIPDNIGNCSSLYLLSLGHNSLTGPIPVGMSELKKLEILRLEYNNLSGEIPQQL  546



>ref|XP_004971314.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=1029

 Score =   246 bits (627),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 134/264 (51%), Positives = 181/264 (69%), Gaps = 3/264 (1%)
 Frame = +3

Query  354   LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
             + +N++VLGL+VFKS + DP   LATW+E D +PC W  V+C PA  RV  + L GL LS
Sbjct  38    MPVNEEVLGLVVFKSALSDPTGALATWTESDATPCGWRRVECDPATSRVLRLSLDGLALS  97

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  713
             G + RGL++L  L  L+LA NN SG + P L LLT+L++L+LS N+ SG +PD +  ++S
Sbjct  98    GPMPRGLDRLPALQELTLARNNLSGPLPPGLSLLTSLRSLDLSYNAFSGPLPDDVALLAS  157

Query  714   LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRF  893
             L++LDL+GN+ SGP+  +      ++RFL L+ + F GPIP  LSK  LL HLN+S N+ 
Sbjct  158   LRYLDLTGNAFSGPLPPAFPP---TIRFLMLSCNQFSGPIPEGLSKSPLLLHLNVSGNQL  214

Query  894   SGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGL  1073
             SG P F+G +W L RLRTLD+S N+ SG +  G + LHNLK +SL  N F G +P DLGL
Sbjct  215   SGSPDFAGALWPLERLRTLDLSRNQFSGPVTDGIARLHNLKTVSLAGNRFFGAVPQDLGL  274

Query  1074  CPHLSRLDLSENLFTGTIPESLQR  1145
             CPHLS LDLS N F G +P S+ +
Sbjct  275   CPHLSTLDLSSNAFDGHLPGSIAQ  298


 Score = 92.4 bits (228),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 86/236 (36%), Positives = 117/236 (50%), Gaps = 29/236 (12%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL G   SG +         +  L L+ N FSG I   L     L  LN+S N +SG+ 
Sbjct  161   LDLTGNAFSGPLPPAFPP--TIRFLMLSCNQFSGPIPEGLSKSPLLLHLNVSGNQLSGS-  217

Query  687   PD---SLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             PD   +L  +  L+ LDLS N  SGPV+D  +  L +L+ +SLAG+ F G +P  L  C 
Sbjct  218   PDFAGALWPLERLRTLDLSRNQFSGPVTDG-IARLHNLKTVSLAGNRFFGAVPQDLGLCP  276

Query  858   LLNHLNLSNNRFSGD------------------PRFSGGI--W--GLTRLRTLDVSNNEL  971
              L+ L+LS+N F G                    R SG +  W   L  ++ LD+S+N L
Sbjct  277   HLSTLDLSSNAFDGHLPGSIAQLSSLVYLSASGNRLSGDVPAWLGKLAAVQHLDLSDNAL  336

Query  972   SGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +GSLP     L  LK LSL  N  SG +P  L  C  L+ L L  N  +G IP++L
Sbjct  337   TGSLPDSLGDLKALKYLSLSRNQLSGSVPASLSGCAKLAELRLRGNSLSGGIPDAL  392


 Score = 92.0 bits (227),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 86/242 (36%), Positives = 122/242 (50%), Gaps = 33/242 (14%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL     SG +  G+ +L +L  +SLA N F G +   LGL  +L TL+LS N+ 
Sbjct  229   RLRTLDLSRNQFSGPVTDGIARLHNLKTVSLAGNRFFGAVPQDLGLCPHLSTLDLSSNAF  288

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPV---------------SDSMLE--------NLG  785
              G +P S+  +SSL +L  SGN LSG V               SD+ L         +L 
Sbjct  289   DGHLPGSIAQLSSLVYLSASGNRLSGDVPAWLGKLAAVQHLDLSDNALTGSLPDSLGDLK  348

Query  786   SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG---DPRFSGGIWGLTRLRTLDV  956
             +L++LSL+ +   G +P+SLS C  L  L L  N  SG   D  F  G      L TLD+
Sbjct  349   ALKYLSLSRNQLSGSVPASLSGCAKLAELRLRGNSLSGGIPDALFDVG------LETLDM  402

Query  957   SNNELSGSLPIGASFL-HNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPE  1133
             S+N L+G LP G++ +   L+ L L  N  +G IP ++ L   L  L+LS N     +P 
Sbjct  403   SSNALTGVLPSGSTRMAETLQWLDLSGNQLTGGIPTEMLLFFKLRYLNLSSNDLRTQLPP  462

Query  1134  SL  1139
              L
Sbjct  463   EL  464


 Score = 87.8 bits (216),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 82/257 (32%), Positives = 117/257 (46%), Gaps = 47/257 (18%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             V L G    G + + L    HL+ L L+SN F G +   +  L++L  L+ S N +SG V
Sbjct  257   VSLAGNRFFGAVPQDLGLCPHLSTLDLSSNAFDGHLPGSIAQLSSLVYLSASGNRLSGDV  316

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P  LG ++++Q LDLS N+L+G + DS L +L +L++LSL+ +   G +P+SLS C  L 
Sbjct  317   PAWLGKLAAVQHLDLSDNALTGSLPDS-LGDLKALKYLSLSRNQLSGSVPASLSGCAKLA  375

Query  867   HLNLSNNRFSG---DPRFSGGIWGLT----------------------------------  935
              L L  N  SG   D  F  G+  L                                   
Sbjct  376   ELRLRGNSLSGGIPDALFDVGLETLDMSSNALTGVLPSGSTRMAETLQWLDLSGNQLTGG  435

Query  936   ---------RLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLS  1088
                      +LR L++S+N+L   LP     L NL  L L S    G +P DL     L+
Sbjct  436   IPTEMLLFFKLRYLNLSSNDLRTQLPPELGLLRNLTVLDLRSTGLYGAVPADLCESGSLA  495

Query  1089  RLDLSENLFTGTIPESL  1139
              L L  N   G IP+S+
Sbjct  496   VLQLDGNSLAGPIPDSI  512


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 73/236 (31%), Positives = 108/236 (46%), Gaps = 23/236 (10%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             V  +DL    L+G +   L  L+ L  LSL+ N  SG +   L     L  L L  NS+S
Sbjct  326   VQHLDLSDNALTGSLPDSLGDLKALKYLSLSRNQLSGSVPASLSGCAKLAELRLRGNSLS  385

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G +PD+L ++  L+ LD+S N+L+G +         +L++L L+G+   G IP+ +    
Sbjct  386   GGIPDALFDVG-LETLDMSSNALTGVLPSGSTRMAETLQWLDLSGNQLTGGIPTEMLLFF  444

Query  858   LLNHLNLSNN--RFSGDPRF------------SGGIWGLT--------RLRTLDVSNNEL  971
              L +LNLS+N  R    P              S G++G           L  L +  N L
Sbjct  445   KLRYLNLSSNDLRTQLPPELGLLRNLTVLDLRSTGLYGAVPADLCESGSLAVLQLDGNSL  504

Query  972   SGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +G +P       +L  LSLG N  +G IP  +     L  L L  N  +G IP+ L
Sbjct  505   AGPIPDSIGNCSSLYLLSLGHNGLTGPIPAGISELKKLEILRLEYNNLSGEIPQQL  560


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 58/113 (51%), Gaps = 1/113 (1%)
 Frame = +3

Query  561  LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
            L +L VL L S    G +   L    +L  L L  NS++G +PDS+GN SSL  L L  N
Sbjct  467  LRNLTVLDLRSTGLYGAVPADLCESGSLAVLQLDGNSLAGPIPDSIGNCSSLYLLSLGHN  526

Query  741  SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
             L+GP+   + E L  L  L L  ++  G IP  L     L  +N+S+NR  G
Sbjct  527  GLTGPIPAGISE-LKKLEILRLEYNNLSGEIPQQLGALESLLAVNISHNRLVG  578



>dbj|BAJ85468.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1052

 Score =   241 bits (615),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 133/264 (50%), Positives = 179/264 (68%), Gaps = 5/264 (2%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             +N++VLGL+VF+S + DP+  LA W+E D +PC W  V+C PA  RV  + L GLGLS  
Sbjct  30    VNEEVLGLVVFRSALTDPSGALAAWAESDATPCGWPHVECDPATSRVLRLALDGLGLSSD  89

Query  540   IG--RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  713
              G  RGL++L  L  LSLA NN SG + P L LL +L+ L+LS+N++SG +PD L  ++S
Sbjct  90    SGVPRGLDRLPRLQSLSLARNNLSGALRPGLSLLPSLRLLDLSRNALSGALPDDLPLLAS  149

Query  714   LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRF  893
             L++LDLS N+LSGP+  S      +LRFL ++G+   G +P+ LS   LL HLN+S N  
Sbjct  150   LRYLDLSSNALSGPLPMSFPP---ALRFLVISGNRLSGDVPAGLSGSPLLLHLNVSGNEL  206

Query  894   SGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGL  1073
             SG P F+  +W L+RLRTLD+S N LSG +  G   LHNLK L L +N FSG +P D+GL
Sbjct  207   SGAPDFASALWSLSRLRTLDLSRNRLSGPVAAGVGALHNLKTLDLSANRFSGAVPEDIGL  266

Query  1074  CPHLSRLDLSENLFTGTIPESLQR  1145
             CPHL+ +DLS N F G +PES+ R
Sbjct  267   CPHLAAVDLSGNAFDGELPESMAR  290


 Score = 92.8 bits (229),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 81/243 (33%), Positives = 121/243 (50%), Gaps = 35/243 (14%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVI--------------------  614
             R+  +DL    LSG +  G+  L +L  L L++N FSG +                    
Sbjct  221   RLRTLDLSRNRLSGPVAAGVGALHNLKTLDLSANRFSGAVPEDIGLCPHLAAVDLSGNAF  280

Query  615   ----SPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENL  782
                    +  L +L  L+ S N +SG VP  LG +++LQ LDLS N+L+G + DS L +L
Sbjct  281   DGELPESMARLASLVRLSASSNRLSGDVPAWLGGLAALQRLDLSDNALTGALPDS-LGDL  339

Query  783   GSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG---DPRFSGGIWGLTRLRTLD  953
               L +L L+ +     +P ++S CT L  L+L  N+ +G   D  F  G      L TLD
Sbjct  340   KDLSYLGLSKNRLAFSVPEAMSGCTRLAELHLRGNQLTGSIPDALFDVG------LETLD  393

Query  954   VSNNELSGSLPIGASFL-HNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             +S+N L+G LP G++ L   L+ L L  N  +G IP ++ L  +L  L+LS N     +P
Sbjct  394   MSSNALTGVLPSGSTRLAETLQWLDLSGNQLTGGIPAEMALFFNLRYLNLSRNDLRTQLP  453

Query  1131  ESL  1139
               L
Sbjct  454   PEL  456


 Score = 86.3 bits (212),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 115/214 (54%), Gaps = 3/214 (1%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             ++ VDL G    G++   + +L  L  LS +SN  SG +   LG L  LQ L+LS N+++
Sbjct  270   LAAVDLSGNAFDGELPESMARLASLVRLSASSNRLSGDVPAWLGGLAALQRLDLSDNALT  329

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G +PDSLG++  L +L LS N L+  V ++M      L  L L G+   G IP +L    
Sbjct  330   GALPDSLGDLKDLSYLGLSKNRLAFSVPEAM-SGCTRLAELHLRGNQLTGSIPDALFDVG  388

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSN  1037
              L  L++S+N  +G    SG       L+ LD+S N+L+G +P   +   NL+ L+L  N
Sbjct  389   -LETLDMSSNALTGV-LPSGSTRLAETLQWLDLSGNQLTGGIPAEMALFFNLRYLNLSRN  446

Query  1038  HFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
                 ++P +LGL  +L+ LDL  +   G +P  L
Sbjct  447   DLRTQLPPELGLLRNLTVLDLRSSGLYGPVPGDL  480


 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 102/211 (48%), Gaps = 28/211 (13%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGT  683
             +D+    L+G +  G  +L E L  L L+ N  +G I  ++ L  NL+ LNLS+N +   
Sbjct  392   LDMSSNALTGVLPSGSTRLAETLQWLDLSGNQLTGGIPAEMALFFNLRYLNLSRNDLRTQ  451

Query  684   VPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLL  863
             +P  LG + +L  LDL  + L GPV   + ++ GSL  L L G+S  GPIP ++ KC+  
Sbjct  452   LPPELGLLRNLTVLDLRSSGLYGPVPGDLCDS-GSLAVLQLDGNSLAGPIPDNIGKCS--  508

Query  864   NHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHF  1043
                                      L  L + +N L+G +P G   L  L+ L L  N+ 
Sbjct  509   ------------------------SLYLLSMGHNSLTGPIPAGMGELKKLEILRLEDNNL  544

Query  1044  SGEIPVDLGLCPHLSRLDLSENLFTGTIPES  1136
             +GEIP  LG    L  +++S N   G +P S
Sbjct  545   TGEIPQQLGGLESLLAVNISHNRLVGRLPAS  575



>gb|ACN33819.1| unknown [Zea mays]
 tpg|DAA55768.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1043

 Score =   241 bits (614),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 132/263 (50%), Positives = 180/263 (68%), Gaps = 4/263 (2%)
 Frame = +3

Query  354   LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
             + +N++VLGL+VFKS + DP   LATW+E D +PC W  V+C PA  RV  + L GL LS
Sbjct  34    MAVNEEVLGLVVFKSALSDPTGALATWTESDATPCGWARVECDPATSRVLRLALDGLALS  93

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  713
             G++ RGL++L  L  LSLA NN SG + P L LL +L++L+LS N+ SG +PD +  ++S
Sbjct  94    GRMPRGLDRLGALQDLSLARNNLSGPLPPGLSLLGSLRSLDLSYNAFSGPLPDDVARLAS  153

Query  714   LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSL-SKCTLLNHLNLSNNR  890
             L++LDL+GN+ SGP+  +      +LRFL L+G+ F GP+P  L S   LL HLN+S N+
Sbjct  154   LRYLDLTGNAFSGPLPPAFPR---TLRFLVLSGNQFSGPVPEGLASGSPLLLHLNVSGNQ  210

Query  891   FSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLG  1070
              SG P F+G +W L RLRTLD+S+N  SG +  G + LHNLK LSL  N F G +P D+G
Sbjct  211   LSGSPDFAGALWPLERLRTLDLSHNLFSGPVTDGIARLHNLKTLSLSGNRFFGAVPADIG  270

Query  1071  LCPHLSRLDLSENLFTGTIPESL  1139
              CPHLS +DLS N F G +P+S+
Sbjct  271   RCPHLSTIDLSSNAFDGHLPDSI  293


 Score =   103 bits (256),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 87/243 (36%), Positives = 127/243 (52%), Gaps = 35/243 (14%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL     SG +  G+ +L +L  LSL+ N F G +   +G   +L T++LS N+ 
Sbjct  226   RLRTLDLSHNLFSGPVTDGIARLHNLKTLSLSGNRFFGAVPADIGRCPHLSTIDLSSNAF  285

Query  675   SGTVPDSLGNMSSL------------------------QFLDLSGNSLSGPVSDSMLENL  782
              G +PDS+G ++SL                        Q LDLS N+L+G + DS L +L
Sbjct  286   DGHLPDSIGQLASLVYLSASGNRLSGDVPAWLGKLAAVQHLDLSDNALTGSLPDS-LGDL  344

Query  783   GSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG---DPRFSGGIWGLTRLRTLD  953
              +L++LSL+ +   G +P+S+S CT L  L+L +N  SG   D  F  G      L TLD
Sbjct  345   KALKYLSLSRNQLSGAVPASMSGCTKLAELHLRDNNLSGSIPDALFDVG------LETLD  398

Query  954   VSNNELSGSLPIGASFL-HNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             VS+N LSG LP G++ L   L+ L L  N  +G IP ++ L   L  L+LS N     +P
Sbjct  399   VSSNALSGVLPSGSTRLAETLQSLDLSGNQLTGGIPTEMSLFFKLRYLNLSRNDLRAPLP  458

Query  1131  ESL  1139
               L
Sbjct  459   PEL  461


 Score =   101 bits (252),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 78/224 (35%), Positives = 121/224 (54%), Gaps = 23/224 (10%)
 Frame = +3

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  713
             G +   + +  HL+ + L+SN F G +   +G L +L  L+ S N +SG VP  LG +++
Sbjct  263   GAVPADIGRCPHLSTIDLSSNAFDGHLPDSIGQLASLVYLSASGNRLSGDVPAWLGKLAA  322

Query  714   LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRF  893
             +Q LDLS N+L+G + DS L +L +L++LSL+ +   G +P+S+S CT L  L+L +N  
Sbjct  323   VQHLDLSDNALTGSLPDS-LGDLKALKYLSLSRNQLSGAVPASMSGCTKLAELHLRDNNL  381

Query  894   SG---DPRFSGGIW---------------GLTRL----RTLDVSNNELSGSLPIGASFLH  1007
             SG   D  F  G+                G TRL    ++LD+S N+L+G +P   S   
Sbjct  382   SGSIPDALFDVGLETLDVSSNALSGVLPSGSTRLAETLQSLDLSGNQLTGGIPTEMSLFF  441

Query  1008  NLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              L+ L+L  N     +P +LGL  +L+ LDL      G +P  L
Sbjct  442   KLRYLNLSRNDLRAPLPPELGLLRNLTVLDLRSTGLYGAMPADL  485


 Score = 74.3 bits (181),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 75/236 (32%), Positives = 110/236 (47%), Gaps = 23/236 (10%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             V  +DL    L+G +   L  L+ L  LSL+ N  SG +   +   T L  L+L  N++S
Sbjct  323   VQHLDLSDNALTGSLPDSLGDLKALKYLSLSRNQLSGAVPASMSGCTKLAELHLRDNNLS  382

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G++PD+L ++  L+ LD+S N+LSG +         +L+ L L+G+   G IP+ +S   
Sbjct  383   GSIPDALFDVG-LETLDVSSNALSGVLPSGSTRLAETLQSLDLSGNQLTGGIPTEMSLFF  441

Query  858   LLNHLNLSNN--RFSGDPRF------------SGGIWGLT--------RLRTLDVSNNEL  971
              L +LNLS N  R    P              S G++G           L  L +  N L
Sbjct  442   KLRYLNLSRNDLRAPLPPELGLLRNLTVLDLRSTGLYGAMPADLCESGSLAVLQLDGNSL  501

Query  972   SGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             SG +P       +L  LSLG N  +G IP  +     L  L L  N  +G IP+ L
Sbjct  502   SGPIPDSIGNCSSLYLLSLGHNGLTGPIPAGISELKKLEILRLEYNNLSGEIPQQL  557


 Score = 56.2 bits (134),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 58/113 (51%), Gaps = 1/113 (1%)
 Frame = +3

Query  561  LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
            L +L VL L S    G +   L    +L  L L  NS+SG +PDS+GN SSL  L L  N
Sbjct  464  LRNLTVLDLRSTGLYGAMPADLCESGSLAVLQLDGNSLSGPIPDSIGNCSSLYLLSLGHN  523

Query  741  SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
             L+GP+   + E L  L  L L  ++  G IP  L     L  +N+S+NR  G
Sbjct  524  GLTGPIPAGISE-LKKLEILRLEYNNLSGEIPQQLGGLENLLAVNISHNRLVG  575



>ref|NP_001170194.1| uncharacterized protein LOC100384143 precursor [Zea mays]
 gb|ACN36181.1| unknown [Zea mays]
Length=403

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 129/256 (50%), Positives = 174/256 (68%), Gaps = 5/256 (2%)
 Frame = +3

Query  354   LQLNDDVLGLIVFKSGVQDPASHLATWS-EDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
             + +N++VLGL+VFKS + DP S LATW+  D  +PCAW  V+C PA  RV  + L GL L
Sbjct  33    MPVNEEVLGLVVFKSALSDPTSALATWTGSDATTPCAWARVECDPATSRVLRLALDGLAL  92

Query  531   SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  710
             SG++ R L++L  L  LSLA NN SG + P L LL +L++L+LS N+ SG +PD +  ++
Sbjct  93    SGRMPRDLDRLPALQYLSLARNNISGPLPPGLSLLASLRSLDLSYNAFSGPLPDDIARLA  152

Query  711   SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSL-SKCTLLNHLNLSNN  887
             SL+ LDL+GN+ SGP+  +  E   ++RFL L+G+ F GP+P  L S   LL HLN+S N
Sbjct  153   SLRSLDLTGNAFSGPLPPAFPE---TIRFLVLSGNQFSGPVPEGLASGSPLLLHLNVSGN  209

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDL  1067
             + SG P F+G +W L RLRTLD+S N+ SG +  G + LHNLK L L  N F G +P D+
Sbjct  210   QLSGSPDFAGALWPLQRLRTLDLSRNQFSGPVTGGIARLHNLKTLILSGNRFFGAVPADI  269

Query  1068  GLCPHLSRLDLSENLF  1115
             GLCPHLS +DLS N F
Sbjct  270   GLCPHLSAIDLSSNAF  285



>ref|XP_008672259.1| PREDICTED: uncharacterized protein LOC100216746 isoform X1 [Zea 
mays]
Length=1150

 Score =   241 bits (614),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 132/263 (50%), Positives = 180/263 (68%), Gaps = 4/263 (2%)
 Frame = +3

Query  354   LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
             + +N++VLGL+VFKS + DP   LATW+E D +PC W  V+C PA  RV  + L GL LS
Sbjct  141   MAVNEEVLGLVVFKSALSDPTGALATWTESDATPCGWARVECDPATSRVLRLALDGLALS  200

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  713
             G++ RGL++L  L  LSLA NN SG + P L LL +L++L+LS N+ SG +PD +  ++S
Sbjct  201   GRMPRGLDRLGALQDLSLARNNLSGPLPPGLSLLGSLRSLDLSYNAFSGPLPDDVARLAS  260

Query  714   LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSL-SKCTLLNHLNLSNNR  890
             L++LDL+GN+ SGP+  +      +LRFL L+G+ F GP+P  L S   LL HLN+S N+
Sbjct  261   LRYLDLTGNAFSGPLPPAFPR---TLRFLVLSGNQFSGPVPEGLASGSPLLLHLNVSGNQ  317

Query  891   FSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLG  1070
              SG P F+G +W L RLRTLD+S+N  SG +  G + LHNLK LSL  N F G +P D+G
Sbjct  318   LSGSPDFAGALWPLERLRTLDLSHNLFSGPVTDGIARLHNLKTLSLSGNRFFGAVPADIG  377

Query  1071  LCPHLSRLDLSENLFTGTIPESL  1139
              CPHLS +DLS N F G +P+S+
Sbjct  378   RCPHLSTIDLSSNAFDGHLPDSI  400


 Score =   102 bits (255),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 87/243 (36%), Positives = 127/243 (52%), Gaps = 35/243 (14%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL     SG +  G+ +L +L  LSL+ N F G +   +G   +L T++LS N+ 
Sbjct  333   RLRTLDLSHNLFSGPVTDGIARLHNLKTLSLSGNRFFGAVPADIGRCPHLSTIDLSSNAF  392

Query  675   SGTVPDSLGNMSSL------------------------QFLDLSGNSLSGPVSDSMLENL  782
              G +PDS+G ++SL                        Q LDLS N+L+G + DS L +L
Sbjct  393   DGHLPDSIGQLASLVYLSASGNRLSGDVPAWLGKLAAVQHLDLSDNALTGSLPDS-LGDL  451

Query  783   GSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG---DPRFSGGIWGLTRLRTLD  953
              +L++LSL+ +   G +P+S+S CT L  L+L +N  SG   D  F  G      L TLD
Sbjct  452   KALKYLSLSRNQLSGAVPASMSGCTKLAELHLRDNNLSGSIPDALFDVG------LETLD  505

Query  954   VSNNELSGSLPIGASFL-HNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             VS+N LSG LP G++ L   L+ L L  N  +G IP ++ L   L  L+LS N     +P
Sbjct  506   VSSNALSGVLPSGSTRLAETLQSLDLSGNQLTGGIPTEMSLFFKLRYLNLSRNDLRAPLP  565

Query  1131  ESL  1139
               L
Sbjct  566   PEL  568


 Score =   101 bits (251),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 78/224 (35%), Positives = 121/224 (54%), Gaps = 23/224 (10%)
 Frame = +3

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  713
             G +   + +  HL+ + L+SN F G +   +G L +L  L+ S N +SG VP  LG +++
Sbjct  370   GAVPADIGRCPHLSTIDLSSNAFDGHLPDSIGQLASLVYLSASGNRLSGDVPAWLGKLAA  429

Query  714   LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRF  893
             +Q LDLS N+L+G + DS L +L +L++LSL+ +   G +P+S+S CT L  L+L +N  
Sbjct  430   VQHLDLSDNALTGSLPDS-LGDLKALKYLSLSRNQLSGAVPASMSGCTKLAELHLRDNNL  488

Query  894   SG---DPRFSGGIW---------------GLTRL----RTLDVSNNELSGSLPIGASFLH  1007
             SG   D  F  G+                G TRL    ++LD+S N+L+G +P   S   
Sbjct  489   SGSIPDALFDVGLETLDVSSNALSGVLPSGSTRLAETLQSLDLSGNQLTGGIPTEMSLFF  548

Query  1008  NLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              L+ L+L  N     +P +LGL  +L+ LDL      G +P  L
Sbjct  549   KLRYLNLSRNDLRAPLPPELGLLRNLTVLDLRSTGLYGAMPADL  592


 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 75/236 (32%), Positives = 110/236 (47%), Gaps = 23/236 (10%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             V  +DL    L+G +   L  L+ L  LSL+ N  SG +   +   T L  L+L  N++S
Sbjct  430   VQHLDLSDNALTGSLPDSLGDLKALKYLSLSRNQLSGAVPASMSGCTKLAELHLRDNNLS  489

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G++PD+L ++  L+ LD+S N+LSG +         +L+ L L+G+   G IP+ +S   
Sbjct  490   GSIPDALFDVG-LETLDVSSNALSGVLPSGSTRLAETLQSLDLSGNQLTGGIPTEMSLFF  548

Query  858   LLNHLNLSNN--RFSGDPRF------------SGGIWGLT--------RLRTLDVSNNEL  971
              L +LNLS N  R    P              S G++G           L  L +  N L
Sbjct  549   KLRYLNLSRNDLRAPLPPELGLLRNLTVLDLRSTGLYGAMPADLCESGSLAVLQLDGNSL  608

Query  972   SGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             SG +P       +L  LSLG N  +G IP  +     L  L L  N  +G IP+ L
Sbjct  609   SGPIPDSIGNCSSLYLLSLGHNGLTGPIPAGISELKKLEILRLEYNNLSGEIPQQL  664


 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 58/113 (51%), Gaps = 1/113 (1%)
 Frame = +3

Query  561  LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
            L +L VL L S    G +   L    +L  L L  NS+SG +PDS+GN SSL  L L  N
Sbjct  571  LRNLTVLDLRSTGLYGAMPADLCESGSLAVLQLDGNSLSGPIPDSIGNCSSLYLLSLGHN  630

Query  741  SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
             L+GP+   + E L  L  L L  ++  G IP  L     L  +N+S+NR  G
Sbjct  631  GLTGPIPAGISE-LKKLEILRLEYNNLSGEIPQQLGGLENLLAVNISHNRLVG  682



>emb|CDX85183.1| BnaC07g24940D, partial [Brassica napus]
Length=933

 Score =   239 bits (609),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 130/232 (56%), Positives = 173/232 (75%), Gaps = 4/232 (2%)
 Frame = +3

Query  450   SPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlg  629
             SPC+W +VKC+P   RV+E+ L GL L+GKIGRG++KL+HL VLSL++NN +G I+  L 
Sbjct  2     SPCSWTYVKCNPKTSRVTELSLSGLSLTGKIGRGIQKLQHLKVLSLSNNNLTGNIA-ALS  60

Query  630   lltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLA  809
                +LQ L+LS NS+SG +  SL   +SL++LDL+GNS SG +SD +  N  SLR LSL+
Sbjct  61    NNNHLQKLDLSHNSLSGQISSSL---TSLRYLDLTGNSFSGTLSDDVFTNCSSLRHLSLS  117

Query  810   GSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPI  989
              + FEG IPS+L +C++LN LNLS+NRFSG P F+ G   L RLRTLD+S N LSGS+P+
Sbjct  118   HNRFEGQIPSALFRCSVLNSLNLSSNRFSGSPSFASGFLKLERLRTLDLSFNALSGSIPL  177

Query  990   GASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             G  ++HNLK L L  N FSG +P D+GLCPHL+R+D+S N F+G IP +LQR
Sbjct  178   GILYVHNLKVLHLQGNQFSGSLPSDIGLCPHLNRVDVSFNRFSGEIPTTLQR  229


 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 112/203 (55%), Gaps = 15/203 (7%)
 Frame = +3

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVISPqlg----lltnlqtlnlSKNSISGTVPDSLG  701
             G+I   L +   LN L+L+SN FSG  SP        L  L+TL+LS N++SG++P  + 
Sbjct  123   GQIPSALFRCSVLNSLNLSSNRFSG--SPSFASGFLKLERLRTLDLSFNALSGSIPLGIL  180

Query  702   NMSSLQFLDLSGNSLSGPVSDSMLENLG---SLRFLSLAGSSFEGPIPSSLSKCTLLNHL  872
              + +L+ L L GN  SG    S+  ++G    L  + ++ + F G IP++L +   LNHL
Sbjct  181   YVHNLKVLHLQGNQFSG----SLPSDIGLCPHLNRVDVSFNRFSGEIPTTLQRLRYLNHL  236

Query  873   NLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGE  1052
             +LS N  SG   F   I  +T L  LDVS+N L+G LP   S L +LK L L  N  SGE
Sbjct  237   DLSKNMLSGG--FPVWIGDMTGLVHLDVSSNVLTGKLPSSISNLRSLKALILSENKLSGE  294

Query  1053  IPVDLGLCPHLSRLDLSENLFTG  1121
             +P  L  C  L+ + L  N FTG
Sbjct  295   VPESLEACKELTVVQLKGNGFTG  317


 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 84/263 (32%), Positives = 117/263 (44%), Gaps = 57/263 (22%)
 Frame = +3

Query  513   LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  692
             L G   SG +   +    HLN + ++ N FSG I   L  L  L  L+LSKN +SG  P 
Sbjct  190   LQGNQFSGSLPSDIGLCPHLNRVDVSFNRFSGEIPTTLQRLRYLNHLDLSKNMLSGGFPV  249

Query  693   SLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHL  872
              +G+M+ L  LD+S N L+G +  S + NL SL+ L L+ +   G +P SL  C  L  +
Sbjct  250   WIGDMTGLVHLDVSSNVLTGKLPSS-ISNLRSLKALILSENKLSGEVPESLEACKELTVV  308

Query  873   NLSNNRFSGD------PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
              L  N F+G+      PR S  ++    L TLD+S N L+G++P       NL+ L+L  
Sbjct  309   QLKGNGFTGNGLTGSIPRGSSRLF--ESLVTLDLSRNSLTGNIPGEVGLFSNLRYLNLSW  366

Query  1035  NHF------------------------------------------------SGEIPVDLG  1070
             NHF                                                +G IP  +G
Sbjct  367   NHFNTRVPPEIEFLQNLTVLDLRNSALIGSVPADICEAQSLQILQLDGNSLTGSIPEGIG  426

Query  1071  LCPHLSRLDLSENLFTGTIPESL  1139
              C +L  L LS N  TG IP+SL
Sbjct  427   NCSYLKLLSLSHNNLTGPIPKSL  449


 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 110/207 (53%), Gaps = 9/207 (4%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSG------VISPqlglltnlqtlnlSKNSISGTVP  689
             LSG++   LE  + L V+ L  N F+G      +      L  +L TL+LS+NS++G +P
Sbjct  291   LSGEVPESLEACKELTVVQLKGNGFTGNGLTGSIPRGSSRLFESLVTLDLSRNSLTGNIP  350

Query  690   DSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNH  869
               +G  S+L++L+LS N  +  V    +E L +L  L L  S+  G +P+ + +   L  
Sbjct  351   GEVGLFSNLRYLNLSWNHFNTRVPPE-IEFLQNLTVLDLRNSALIGSVPADICEAQSLQI  409

Query  870   LNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSG  1049
             L L  N  +G      GI   + L+ L +S+N L+G +P   S L  LK L L +N FSG
Sbjct  410   LQLDGNSLTGS--IPEGIGNCSYLKLLSLSHNNLTGPIPKSLSNLEELKILKLEANKFSG  467

Query  1050  EIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             EIP +LG   +L  +++S N   G +P
Sbjct  468   EIPKELGKLQNLLLVNISFNRLIGRLP  494



>ref|XP_009415955.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1020

 Score =   239 bits (610),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 139/263 (53%), Positives = 183/263 (70%), Gaps = 2/263 (1%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LND+V+GLIVFK+ ++DP + LA+W+E D +PC W  V+C P   RV  + L  L LSG 
Sbjct  49    LNDEVMGLIVFKAALEDPTAALASWNEADATPCGWAHVRCDPRTSRVVRLALDSLSLSGP  108

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             + RGL++L  L  LSL++NN SG + P L LL  L++L+LS+NS SG++P  L  + S+ 
Sbjct  109   LPRGLDRLPALASLSLSNNNLSGPVPPGLSLLPALRSLDLSRNSFSGSLPGDLAFLPSIV  168

Query  720   FLDLSGNSLSGPVSDSML--ENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRF  893
              LDLS N+LSGP+ DS+      GSLRFLSLAG+  EGP PS+LS+C+ L +LNLSNNRF
Sbjct  169   SLDLSSNALSGPLPDSLFSAATCGSLRFLSLAGNRLEGPFPSALSRCSFLLYLNLSNNRF  228

Query  894   SGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGL  1073
             SG P F  G+W L+RLR LD+S+N  SG +P G + LH L+ L L  N FSG IP  +GL
Sbjct  229   SGSPDFETGLWSLSRLRVLDLSHNSFSGPVPDGIANLHRLRNLQLNGNRFSGTIPAGVGL  288

Query  1074  CPHLSRLDLSENLFTGTIPESLQ  1142
             C HLS LDLS N F G +P S++
Sbjct  289   CRHLSILDLSYNSFEGALPSSMR  311


 Score =   104 bits (260),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 77/216 (36%), Positives = 127/216 (59%), Gaps = 5/216 (2%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  + L+G   SG I  G+    HL++L L+ N+F G +   +  L +L +L LS N +
Sbjct  267   RLRNLQLNGNRFSGTIPAGVGLCRHLSILDLSYNSFEGALPSSMRYLGSLTSLKLSDNQL  326

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
             SG VP  +GN++++Q +DLS N L+G +  S L  L  + +LSL+ +   G IP +++ C
Sbjct  327   SGDVPAWIGNLTTIQQVDLSNNKLAGNLPAS-LGGLKEVNYLSLSNNLLTGAIPDTVAGC  385

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFL-HNLKELSLG  1031
             T L+ L+L  NR +G      G++ L  L+ LD+S+NEL+G++P G++++   L+ L L 
Sbjct  386   TKLSELHLKGNRLNGSVPL--GLFDLG-LQVLDLSSNELTGTVPAGSTWISETLRSLDLS  442

Query  1032  SNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              N  +G IP ++ L   L+ L+LS N     +P  L
Sbjct  443   DNKLNGTIPPEMALFFGLTYLNLSWNDLRTQLPPEL  478


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 73/215 (34%), Positives = 109/215 (51%), Gaps = 9/215 (4%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlg-lltnlqtlnlSKNS  671
             ++SE+ L G  L+G +  GL  L  L VL L+SN  +G +      +   L++L+LS N 
Sbjct  387   KLSELHLKGNRLNGSVPLGLFDL-GLQVLDLSSNELTGTVPAGSTWISETLRSLDLSDNK  445

Query  672   ISGTVPDSLGNMSSLQFLDLSGNSLSG--PVSDSMLENLGSLRFLSLAGSSFEGPIPSSL  845
             ++GT+P  +     L +L+LS N L    P    +  NL     L L  S+  G IP  L
Sbjct  446   LNGTIPPEMALFFGLTYLNLSWNDLRTQLPPELGLFRNLS---VLDLRSSALYGSIPGDL  502

Query  846   SKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELS  1025
              +   L+ L L  N  +G       I   + L  L +S+N L+GS+P   S L NL+ L+
Sbjct  503   CESGSLSVLQLDGNSLTGP--IPEEIGNCSSLYLLSLSHNSLNGSIPASLSQLKNLEILN  560

Query  1026  LGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             L  N+ SGEIP  LG   +L  +++S N   G +P
Sbjct  561   LEFNNLSGEIPEQLGGLDNLLAVNISHNQLIGRLP  595


 Score = 58.9 bits (141),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 72/232 (31%), Positives = 104/232 (45%), Gaps = 42/232 (18%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKL-EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGT  683
             +DL    L+G +  G   + E L  L L+ N  +G I P++ L   L  LNLS N +   
Sbjct  414   LDLSSNELTGTVPAGSTWISETLRSLDLSDNKLNGTIPPEMALFFGLTYLNLSWNDLRTQ  473

Query  684   VPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTL-  860
             +P  LG   +L  LDL  ++L G +   + E+ GSL  L L G+S  GPIP  +  C+  
Sbjct  474   LPPELGLFRNLSVLDLRSSALYGSIPGDLCES-GSLSVLQLDGNSLTGPIPEEIGNCSSL  532

Query  861   -----------------------LNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNEL  971
                                    L  LNL  N  SG+      + GL  L  +++S+N+L
Sbjct  533   YLLSLSHNSLNGSIPASLSQLKNLEILNLEFNNLSGE--IPEQLGGLDNLLAVNISHNQL  590

Query  972   SGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHL----SRLDLSENLF  1115
              G LP+G  F       SL S+   G    +LGLC  L     +LD+ + L 
Sbjct  591   IGRLPMGGIF------QSLDSSALQG----NLGLCTPLVMEPCKLDVPKPLV  632



>ref|XP_008655312.1| PREDICTED: uncharacterized protein LOC100384143 isoform X1 [Zea 
mays]
 gb|AFW83919.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1053

 Score =   237 bits (604),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 132/266 (50%), Positives = 181/266 (68%), Gaps = 5/266 (2%)
 Frame = +3

Query  354   LQLNDDVLGLIVFKSGVQDPASHLATWS-EDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
             + +N++VLGL+VFKS + DP S LATW+  D  +PCAW  V+C PA  RV  + L GL L
Sbjct  33    MPVNEEVLGLVVFKSALSDPTSALATWTGSDATTPCAWARVECDPATSRVLRLALDGLAL  92

Query  531   SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  710
             SG++ R L++L  L  LSLA NN SG + P L LL +L++L+LS N+ SG +PD +  ++
Sbjct  93    SGRMPRDLDRLPALQYLSLARNNISGPLPPGLSLLASLRSLDLSYNAFSGPLPDDIARLA  152

Query  711   SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSL-SKCTLLNHLNLSNN  887
             SL+ LDL+GN+ SGP+  +  E   ++RFL L+G+ F GP+P  L S   LL HLN+S N
Sbjct  153   SLRSLDLTGNAFSGPLPPAFPE---TIRFLVLSGNQFSGPVPEGLASGSPLLLHLNVSGN  209

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDL  1067
             + SG P F+G +W L RLRTLD+S N+ SG +  G + LHNLK L L  N F G +P D+
Sbjct  210   QLSGSPDFAGALWPLQRLRTLDLSRNQFSGPVTGGIARLHNLKTLILSGNRFFGAVPADI  269

Query  1068  GLCPHLSRLDLSENLFTGTIPESLQR  1145
             GLCPHLS +DLS N F G +P+S+ +
Sbjct  270   GLCPHLSAIDLSSNAFDGHLPDSIAQ  295


 Score = 97.1 bits (240),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 85/242 (35%), Positives = 122/242 (50%), Gaps = 33/242 (14%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL     SG +  G+ +L +L  L L+ N F G +   +GL  +L  ++LS N+ 
Sbjct  226   RLRTLDLSRNQFSGPVTGGIARLHNLKTLILSGNRFFGAVPADIGLCPHLSAIDLSSNAF  285

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPV---------------SDSMLE--------NLG  785
              G +PDS+  ++SL +L  SGN LSG V               SD+ L         +L 
Sbjct  286   DGHLPDSIAQLASLVYLSASGNRLSGDVPAWLGKLAAVQHVDLSDNALTGGLPDSLGDLK  345

Query  786   SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG---DPRFSGGIWGLTRLRTLDV  956
             +LR+LSL+ +   G +P+S+S CT L  L+L  N  SG   D     G      L TLDV
Sbjct  346   ALRYLSLSRNQLSGAVPASMSGCTKLAELHLRGNNLSGSIPDALLDVG------LETLDV  399

Query  957   SNNELSGSLPIGASFL-HNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPE  1133
             S+N LSG LP G++ L   L+ L L  N  +G IP ++ L   L  L+LS N     +P 
Sbjct  400   SSNALSGVLPSGSTRLAETLQWLDLSGNQLTGGIPTEMSLFFKLRYLNLSRNDLRAPLPP  459

Query  1134  SL  1139
              L
Sbjct  460   EL  461


 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 110/237 (46%), Gaps = 47/237 (20%)
 Frame = +3

Query  567   HLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSL  746
             HL+ + L+SN F G +   +  L +L  L+ S N +SG VP  LG ++++Q +DLS N+L
Sbjct  274   HLSAIDLSSNAFDGHLPDSIAQLASLVYLSASGNRLSGDVPAWLGKLAAVQHVDLSDNAL  333

Query  747   SGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD--------  902
             +G + DS L +L +LR+LSL+ +   G +P+S+S CT L  L+L  N  SG         
Sbjct  334   TGGLPDS-LGDLKALRYLSLSRNQLSGAVPASMSGCTKLAELHLRGNNLSGSIPDALLDV  392

Query  903   ----------------------------------PRFSGGIWG----LTRLRTLDVSNNE  968
                                                + +GGI        +LR L++S N+
Sbjct  393   GLETLDVSSNALSGVLPSGSTRLAETLQWLDLSGNQLTGGIPTEMSLFFKLRYLNLSRND  452

Query  969   LSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             L   LP     L NL  L L S    G +P D      L+ L L  N  +G IP+S+
Sbjct  453   LRAPLPPELGLLRNLTVLDLRSTGLYGAVPADFCESGSLAVLQLDGNSLSGPIPDSI  509


 Score = 77.4 bits (189),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 111/236 (47%), Gaps = 23/236 (10%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             V  VDL    L+G +   L  L+ L  LSL+ N  SG +   +   T L  L+L  N++S
Sbjct  323   VQHVDLSDNALTGGLPDSLGDLKALRYLSLSRNQLSGAVPASMSGCTKLAELHLRGNNLS  382

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G++PD+L ++  L+ LD+S N+LSG +         +L++L L+G+   G IP+ +S   
Sbjct  383   GSIPDALLDVG-LETLDVSSNALSGVLPSGSTRLAETLQWLDLSGNQLTGGIPTEMSLFF  441

Query  858   LLNHLNLSNN--RFSGDPRF------------SGGIWGLT--------RLRTLDVSNNEL  971
              L +LNLS N  R    P              S G++G           L  L +  N L
Sbjct  442   KLRYLNLSRNDLRAPLPPELGLLRNLTVLDLRSTGLYGAVPADFCESGSLAVLQLDGNSL  501

Query  972   SGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             SG +P       +L  LSLG N  +G IP  +     L  L L  N  +G IP+ L
Sbjct  502   SGPIPDSIGNCSSLYLLSLGHNGLTGPIPAGISELKKLEILRLEYNKLSGEIPQQL  557


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 56/113 (50%), Gaps = 1/113 (1%)
 Frame = +3

Query  561  LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
            L +L VL L S    G +        +L  L L  NS+SG +PDS+GN SSL  L L  N
Sbjct  464  LRNLTVLDLRSTGLYGAVPADFCESGSLAVLQLDGNSLSGPIPDSIGNCSSLYLLSLGHN  523

Query  741  SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
             L+GP+   + E L  L  L L  +   G IP  L     L  +N+S+NR  G
Sbjct  524  GLTGPIPAGISE-LKKLEILRLEYNKLSGEIPQQLGALENLLAVNISHNRLVG  575



>gb|KJB67930.1| hypothetical protein B456_010G218400 [Gossypium raimondii]
Length=698

 Score =   231 bits (589),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 122/262 (47%), Positives = 168/262 (64%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ +QDP   L++W+EDDD+PC W  +KC+P + RV+E++L G  LSG+
Sbjct  38    LNDDVLGLIVFKADIQDPTQKLSSWNEDDDTPCNWKGIKCNPRSNRVTELNLDGFSLSGR  97

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +LE L  LSLA+NN SG ISP                        ++  + SL 
Sbjct  98    IGRGLLQLEFLRKLSLANNNLSGTISP------------------------NMVKLESLI  133

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS NSL+G + D   +  GSLR++SLA + F G IP SL  C  L  +NLS NRFSG
Sbjct  134   AIDLSENSLTGSIPDDFFKQCGSLRYISLANNHFSGKIPGSLGSCATLAAINLSMNRFSG  193

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIWGL+ LRTLD+S N L G +P G   L+NL+ ++L +N F+G++P ++G C 
Sbjct  194   --LLPVGIWGLSGLRTLDLSCNMLEGEIPEGVHALNNLRSINLSNNRFTGQVPDEIGSCL  251

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +D S NLF+G++P+++Q 
Sbjct  252   LLRSIDFSMNLFSGSVPKTMQE  273


 Score = 77.0 bits (188),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 69/219 (32%), Positives = 112/219 (51%), Gaps = 25/219 (11%)
 Frame = +3

Query  558   KLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSG  737
             ++E L  L L+ N FSG +   +G L  L+ LN S NS++G++P S+ N  +L  LD+S 
Sbjct  297   EMESLQTLDLSVNKFSGQVPDSIGKLKFLKVLNFSSNSLNGSLPASMENNMNLLALDISQ  356

Query  738   NSLSGPVSDSMLENLGSLRFLS--LAGSSFEGPIPSSL-SKCTLLNHLNLSNNRFSGDPR  908
             NSL+G +   + ++  +    S    G++ + PI +SL +    +  L+LS N FSG+  
Sbjct  357   NSLTGDLPGWIFKSGPNQVLFSEQKVGANVDNPISASLGAYLQRIQVLDLSQNSFSGELT  416

Query  909   FS----------------------GGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKEL  1022
             F                       G +  L  L  LD+S N+L+GS+P+     ++LK+L
Sbjct  417   FDIGALSSLKLLNLSRNSLIGPVPGTVAELKALEVLDLSQNQLNGSIPMEIGGAYSLKDL  476

Query  1023  SLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              L +N   G+IP  +  C  L  L +S+N  +G IP  +
Sbjct  477   RLKANFIEGKIPSSIENCTLLRTLIISQNNLSGPIPAKI  515


 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 96/190 (51%), Gaps = 27/190 (14%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             L+ + VL L+ N+FSG ++  +G L++L+ LNLS+NS+ G VP ++  + +L+ LDLS N
Sbjct  398   LQRIQVLDLSQNSFSGELTFDIGALSSLKLLNLSRNSLIGPVPGTVAELKALEVLDLSQN  457

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
              L+G +    +    SL+ L L  +  EG IPSS+  CTLL                   
Sbjct  458   QLNGSIPME-IGGAYSLKDLRLKANFIEGKIPSSIENCTLL-------------------  497

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDL  1100
                    RTL +S N LSG +P     L NL+ + L  N   G +P  L   P L   ++
Sbjct  498   -------RTLIISQNNLSGPIPAKIGELSNLEYVDLSFNDLVGRLPKQLANLPRLLSFNI  550

Query  1101  SENLFTGTIP  1130
             S N   G +P
Sbjct  551   SHNNLQGELP  560


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 71/236 (30%), Positives = 115/236 (49%), Gaps = 31/236 (13%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    L G+I  G+  L +L  ++L++N F+G +  ++G    L++++ S N  SG+V
Sbjct  208   LDLSCNMLEGEIPEGVHALNNLRSINLSNNRFTGQVPDEIGSCLLLRSIDFSMNLFSGSV  267

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P ++  +S   +L+LS NS    V + + E + SL+ L L+ + F G +P S+ K   L 
Sbjct  268   PKTMQELSLCTYLNLSVNSFVVEVPEWIGE-MESLQTLDLSVNKFSGQVPDSIGKLKFLK  326

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLP-----------------IGA  995
              LN S+N  +G       +     L  LD+S N L+G LP                 +GA
Sbjct  327   VLNFSSNSLNGS--LPASMENNMNLLALDISQNSLTGDLPGWIFKSGPNQVLFSEQKVGA  384

Query  996   -----------SFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
                        ++L  ++ L L  N FSGE+  D+G    L  L+LS N   G +P
Sbjct  385   NVDNPISASLGAYLQRIQVLDLSQNSFSGELTFDIGALSSLKLLNLSRNSLIGPVP  440



>ref|XP_006435929.1| hypothetical protein CICLE_v10030625mg [Citrus clementina]
 gb|ESR49169.1| hypothetical protein CICLE_v10030625mg [Citrus clementina]
Length=997

 Score =   233 bits (594),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 128/262 (49%), Positives = 168/262 (64%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ +QDP   L++WSEDDD+PC W  VKC P + RV E+ L+GL L+G+
Sbjct  54    LNDDVLGLIVFKADIQDPNGKLSSWSEDDDTPCNWFGVKCSPRSNRVIELTLNGLSLTGR  113

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L  LSL+SNN +G ISP                        +L  + +L+
Sbjct  114   IGRGLLQLQFLRKLSLSSNNLTGSISP------------------------NLAKLQNLR  149

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLSGNSLSG + D   +  GSLR +SLA + F G IPSSLS C+ L  +NLS+NRFS 
Sbjct  150   VIDLSGNSLSGSIPDEFFKQCGSLRVISLAKNRFSGKIPSSLSLCSTLATINLSSNRFSS  209

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIWGL+ LRTLD+S+N L G +P G   L NL+ ++L  N FSG IP  +G C 
Sbjct  210   P--LPLGIWGLSALRTLDLSDNFLEGEIPKGVESLKNLRVINLSKNMFSGSIPDGIGSCS  267

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +D SEN F+G +PE++Q+
Sbjct  268   LLRTIDFSENSFSGNLPETMQK  289


 Score = 89.7 bits (221),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 78/232 (34%), Positives = 115/232 (50%), Gaps = 28/232 (12%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
              SG++ + + +LE L  L L+ N FSG +   +G L  L+ LN S N ++G++PDS+ N 
Sbjct  303   FSGEVPKWIGELESLETLDLSGNKFSGAVPISIGNLQRLKVLNFSANRLTGSLPDSMANC  362

Query  708   SSLQFLDLSGNSLSGPVSD----------SMLEN----------------LGSLRFLSLA  809
              +L  LD S NS++G +            S  EN                  SL+FL L+
Sbjct  363   MNLVALDFSQNSMNGVLPQWIFSSGLNKVSFAENKIREGMNGPFASSGSSFESLQFLDLS  422

Query  810   GSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPI  989
              + F G  P+++   + L  LNLS N   G       I  L  L  LD+S N L+GS+P 
Sbjct  423   HNEFSGETPATIGALSGLQLLNLSRNSLVGP--IPVAIGDLKALNVLDLSENWLNGSIPP  480

Query  990   GASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
                  ++LKEL L  N  +G+IP  +  C  L  L LS+N  TG IP ++ +
Sbjct  481   EIGGAYSLKELRLERNFLAGKIPTSIENCSSLVSLILSKNNLTGPIPIAIAK  532


 Score = 81.3 bits (199),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 73/239 (31%), Positives = 113/239 (47%), Gaps = 32/239 (13%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL G   SG +   +  L+ L VL+ ++N  +G +   +    NL  L+ S+NS++G +
Sbjct  320   LDLSGNKFSGAVPISIGNLQRLKVLNFSANRLTGSLPDSMANCMNLVALDFSQNSMNGVL  379

Query  687   PD---------------------------SLGNMSSLQFLDLSGNSLSGPVSDSMLENLG  785
             P                            S  +  SLQFLDLS N  SG  + + +  L 
Sbjct  380   PQWIFSSGLNKVSFAENKIREGMNGPFASSGSSFESLQFLDLSHNEFSGE-TPATIGALS  438

Query  786   SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSN  962
              L+ L+L+ +S  GPIP ++     LN L+LS N  +G  P   GG + L  LR   +  
Sbjct  439   GLQLLNLSRNSLVGPIPVAIGDLKALNVLDLSENWLNGSIPPEIGGAYSLKELR---LER  495

Query  963   NELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             N L+G +P       +L  L L  N+ +G IP+ +    +L  +DLS N  TG +P+ L
Sbjct  496   NFLAGKIPTSIENCSSLVSLILSKNNLTGPIPIAIAKLTNLQNVDLSFNTLTGGLPKQL  554


 Score = 74.3 bits (181),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 95/179 (53%), Gaps = 3/179 (2%)
 Frame = +3

Query  525   GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  704
             G++G         E L  L L+ N FSG     +G L+ LQ LNLS+NS+ G +P ++G+
Sbjct  401   GMNGPFASSGSSFESLQFLDLSHNEFSGETPATIGALSGLQLLNLSRNSLVGPIPVAIGD  460

Query  705   MSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSN  884
             + +L  LDLS N L+G +    +    SL+ L L  +   G IP+S+  C+ L  L LS 
Sbjct  461   LKALNVLDLSENWLNGSIPPE-IGGAYSLKELRLERNFLAGKIPTSIENCSSLVSLILSK  519

Query  885   NRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             N  +G    +  I  LT L+ +D+S N L+G LP     L +L   ++  NH  GE+P 
Sbjct  520   NNLTGPIPIA--IAKLTNLQNVDLSFNTLTGGLPKQLVNLVHLSSFNISHNHLQGELPA  576



>ref|XP_006486161.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=975

 Score =   233 bits (593),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 128/262 (49%), Positives = 168/262 (64%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ +QDP   L++WSEDDD+PC W  VKC P + RV E+ L+GL L+G+
Sbjct  32    LNDDVLGLIVFKADIQDPNGKLSSWSEDDDTPCNWFGVKCSPRSNRVIELTLNGLSLTGR  91

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L  LSL+SNN +G ISP                        +L  + +L+
Sbjct  92    IGRGLLQLQFLRKLSLSSNNLTGSISP------------------------NLAKLQNLR  127

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLSGNSLSG + D   +  GSLR +SLA + F G IPSSLS C+ L  +NLS+NRFS 
Sbjct  128   VIDLSGNSLSGSIPDEFFKQCGSLRVISLAKNRFSGKIPSSLSLCSTLATINLSSNRFSS  187

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIWGL+ LRTLD+S+N L G +P G   L NL+ ++L  N FSG IP  +G C 
Sbjct  188   P--LPLGIWGLSALRTLDLSDNFLEGEIPKGVESLKNLRVINLSKNMFSGSIPDGIGSCS  245

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +D SEN F+G +PE++Q+
Sbjct  246   LLRTIDFSENSFSGNLPETMQK  267


 Score = 89.7 bits (221),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 78/232 (34%), Positives = 115/232 (50%), Gaps = 28/232 (12%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
              SG++ + + +LE L  L L+ N FSG +   +G L  L+ LN S N ++G++PDS+ N 
Sbjct  281   FSGEVPKWIGELESLETLDLSGNKFSGAVPISIGNLQRLKVLNFSANRLTGSLPDSMANC  340

Query  708   SSLQFLDLSGNSLSGPVSD----------SMLEN----------------LGSLRFLSLA  809
              +L  LD S NS++G +            S  EN                  SL+FL L+
Sbjct  341   MNLVALDFSQNSMNGVLPQWIFSSGLNKVSFAENKIREGMNGPFASSGSSFESLQFLDLS  400

Query  810   GSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPI  989
              + F G  P+++   + L  LNLS N   G       I  L  L  LD+S N L+GS+P 
Sbjct  401   HNEFSGETPATIGALSGLQLLNLSRNSLVGP--IPVAIGDLKALNVLDLSENWLNGSIPP  458

Query  990   GASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
                  ++LKEL L  N  +G+IP  +  C  L  L LS+N  TG IP ++ +
Sbjct  459   EIGGAYSLKELRLERNFLAGKIPTSIENCSSLVSLILSKNNLTGPIPIAIAK  510


 Score = 80.9 bits (198),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 73/239 (31%), Positives = 113/239 (47%), Gaps = 32/239 (13%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL G   SG +   +  L+ L VL+ ++N  +G +   +    NL  L+ S+NS++G +
Sbjct  298   LDLSGNKFSGAVPISIGNLQRLKVLNFSANRLTGSLPDSMANCMNLVALDFSQNSMNGVL  357

Query  687   PD---------------------------SLGNMSSLQFLDLSGNSLSGPVSDSMLENLG  785
             P                            S  +  SLQFLDLS N  SG  + + +  L 
Sbjct  358   PQWIFSSGLNKVSFAENKIREGMNGPFASSGSSFESLQFLDLSHNEFSGE-TPATIGALS  416

Query  786   SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSN  962
              L+ L+L+ +S  GPIP ++     LN L+LS N  +G  P   GG + L  LR   +  
Sbjct  417   GLQLLNLSRNSLVGPIPVAIGDLKALNVLDLSENWLNGSIPPEIGGAYSLKELR---LER  473

Query  963   NELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             N L+G +P       +L  L L  N+ +G IP+ +    +L  +DLS N  TG +P+ L
Sbjct  474   NFLAGKIPTSIENCSSLVSLILSKNNLTGPIPIAIAKLTNLQNVDLSFNTLTGGLPKQL  532


 Score = 74.3 bits (181),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 95/179 (53%), Gaps = 3/179 (2%)
 Frame = +3

Query  525   GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  704
             G++G         E L  L L+ N FSG     +G L+ LQ LNLS+NS+ G +P ++G+
Sbjct  379   GMNGPFASSGSSFESLQFLDLSHNEFSGETPATIGALSGLQLLNLSRNSLVGPIPVAIGD  438

Query  705   MSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSN  884
             + +L  LDLS N L+G +    +    SL+ L L  +   G IP+S+  C+ L  L LS 
Sbjct  439   LKALNVLDLSENWLNGSIPPE-IGGAYSLKELRLERNFLAGKIPTSIENCSSLVSLILSK  497

Query  885   NRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             N  +G    +  I  LT L+ +D+S N L+G LP     L +L   ++  NH  GE+P 
Sbjct  498   NNLTGPIPIA--IAKLTNLQNVDLSFNTLTGGLPKQLVNLVHLSSFNISHNHLQGELPA  554



>gb|KDO67528.1| hypothetical protein CISIN_1g002321mg [Citrus sinensis]
Length=936

 Score =   232 bits (592),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 128/262 (49%), Positives = 168/262 (64%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ +QDP   L++WSEDDD+PC W  VKC P + RV E+ L+GL L+G+
Sbjct  32    LNDDVLGLIVFKADIQDPNGKLSSWSEDDDTPCNWFGVKCSPRSNRVIELTLNGLSLTGR  91

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L  LSL+SNN +G ISP                        +L  + +L+
Sbjct  92    IGRGLLQLQFLRKLSLSSNNLTGSISP------------------------NLAKLQNLR  127

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLSGNSLSG + D   +  GSLR +SLA + F G IPSSLS C+ L  +NLS+NRFS 
Sbjct  128   VIDLSGNSLSGSIPDEFFKQCGSLRVISLAKNRFSGKIPSSLSLCSTLATINLSSNRFSS  187

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIWGL+ LRTLD+S+N L G +P G   L NL+ ++L  N FSG IP  +G C 
Sbjct  188   P--LPLGIWGLSALRTLDLSDNLLEGEIPKGVESLKNLRVINLSKNMFSGSIPDGIGSCS  245

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +D SEN F+G +PE++Q+
Sbjct  246   LLRTIDFSENSFSGNLPETMQK  267


 Score = 90.1 bits (222),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 78/232 (34%), Positives = 115/232 (50%), Gaps = 28/232 (12%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
              SG++ + + +LE L  L L+ N FSG +   +G L  L+ LN S N ++G++PDS+ N 
Sbjct  281   FSGEVPKWIGELESLETLDLSGNKFSGAVPISIGNLQRLKVLNFSANRLTGSLPDSMANC  340

Query  708   SSLQFLDLSGNSLSGPVSD----------SMLEN----------------LGSLRFLSLA  809
              +L  LD S NS++G +            S  EN                  SL+FL L+
Sbjct  341   MNLVALDFSQNSMNGDLPQWIFSSGLNKVSFAENKIREGMNGPFASSGSSFESLQFLDLS  400

Query  810   GSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPI  989
              + F G  P+++   + L  LNLS N   G       I  L  L  LD+S N L+GS+P 
Sbjct  401   HNEFSGETPATIGALSGLQLLNLSRNSLVGP--IPVAIGDLKALNVLDLSENWLNGSIPP  458

Query  990   GASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
                  ++LKEL L  N  +G+IP  +  C  L  L LS+N  TG IP ++ +
Sbjct  459   EIGGAYSLKELRLERNFLAGKIPTSIENCSSLVSLILSKNNLTGPIPIAIAK  510


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 73/239 (31%), Positives = 113/239 (47%), Gaps = 32/239 (13%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL G   SG +   +  L+ L VL+ ++N  +G +   +    NL  L+ S+NS++G +
Sbjct  298   LDLSGNKFSGAVPISIGNLQRLKVLNFSANRLTGSLPDSMANCMNLVALDFSQNSMNGDL  357

Query  687   PD---------------------------SLGNMSSLQFLDLSGNSLSGPVSDSMLENLG  785
             P                            S  +  SLQFLDLS N  SG  + + +  L 
Sbjct  358   PQWIFSSGLNKVSFAENKIREGMNGPFASSGSSFESLQFLDLSHNEFSGE-TPATIGALS  416

Query  786   SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSN  962
              L+ L+L+ +S  GPIP ++     LN L+LS N  +G  P   GG + L  LR   +  
Sbjct  417   GLQLLNLSRNSLVGPIPVAIGDLKALNVLDLSENWLNGSIPPEIGGAYSLKELR---LER  473

Query  963   NELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             N L+G +P       +L  L L  N+ +G IP+ +    +L  +DLS N  TG +P+ L
Sbjct  474   NFLAGKIPTSIENCSSLVSLILSKNNLTGPIPIAIAKLTNLQNVDLSFNSLTGGLPKQL  532


 Score = 73.9 bits (180),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 95/179 (53%), Gaps = 3/179 (2%)
 Frame = +3

Query  525   GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  704
             G++G         E L  L L+ N FSG     +G L+ LQ LNLS+NS+ G +P ++G+
Sbjct  379   GMNGPFASSGSSFESLQFLDLSHNEFSGETPATIGALSGLQLLNLSRNSLVGPIPVAIGD  438

Query  705   MSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSN  884
             + +L  LDLS N L+G +    +    SL+ L L  +   G IP+S+  C+ L  L LS 
Sbjct  439   LKALNVLDLSENWLNGSIPPE-IGGAYSLKELRLERNFLAGKIPTSIENCSSLVSLILSK  497

Query  885   NRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             N  +G    +  I  LT L+ +D+S N L+G LP     L +L   ++  NH  GE+P 
Sbjct  498   NNLTGPIPIA--IAKLTNLQNVDLSFNSLTGGLPKQLVNLVHLSSFNISHNHLQGELPA  554



>ref|XP_003567498.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brachypodium distachyon]
Length=1056

 Score =   232 bits (591),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 132/267 (49%), Positives = 177/267 (66%), Gaps = 8/267 (3%)
 Frame = +3

Query  354   LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
             + +N++VLGL+VF+S + DP+  L+ WSE D +PC W  V+C PA  RV  + L  L LS
Sbjct  35    MPVNEEVLGLVVFRSALADPSGALSAWSESDATPCGWAHVECDPATSRVLRLSLDNLFLS  94

Query  534   -----GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  698
                  G I RGL++L  L  LSLA NNFSG +SP L LL +L++L+LS N+ SG +P+  
Sbjct  95    STSGTGGIPRGLDRLPALQSLSLAGNNFSGNLSPGLSLLASLRSLDLSHNAFSGNLPEDF  154

Query  699   GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNL  878
               + +L++LDL+ NS SG +  S      +LRFL L+G++F GP+P  LS   LL HLN+
Sbjct  155   PFLPALRYLDLTANSFSGSLPTSFPS---TLRFLMLSGNAFSGPVPLGLSNSALLLHLNV  211

Query  879   SNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
             S N+ SG P F   +W L+RLR LD+SNN LSG +  G + LHNLK + L  N FSG IP
Sbjct  212   SGNQLSGTPDFPSALWPLSRLRALDLSNNRLSGPVAAGIASLHNLKTVDLSGNRFSGAIP  271

Query  1059  VDLGLCPHLSRLDLSENLFTGTIPESL  1139
              D+GLCPHLSR+DLS N F G +P S+
Sbjct  272   ADIGLCPHLSRIDLSSNAFDGALPGSI  298


 Score = 93.2 bits (230),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 79/214 (37%), Positives = 113/214 (53%), Gaps = 25/214 (12%)
 Frame = +3

Query  570   LNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGT--VPDSLGNMSSLQFLDLSGNS  743
             L  L L+ N FSG +   L     L  LN+S N +SGT   P +L  +S L+ LDLS N 
Sbjct  182   LRFLMLSGNAFSGPVPLGLSNSALLLHLNVSGNQLSGTPDFPSALWPLSRLRALDLSNNR  241

Query  744   LSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG--------  899
             LSGPV+ + + +L +L+ + L+G+ F G IP+ +  C  L+ ++LS+N F G        
Sbjct  242   LSGPVA-AGIASLHNLKTVDLSGNRFSGAIPADIGLCPHLSRIDLSSNAFDGALPGSIGA  300

Query  900   ----------DPRFSGGI--W--GLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSN  1037
                         R SG +  W  GLT L+ LD+S+N L+G+LP     L +L  LS   N
Sbjct  301   LSSLVFFSASGNRLSGQVPSWFGGLTALQHLDLSDNTLTGTLPESLGQLKDLGFLSFSKN  360

Query  1038  HFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
                G IP  +  C  L+ L L  N+ +G IPE+L
Sbjct  361   KLVGSIPESMSGCTKLAELHLRGNILSGAIPEAL  394


 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 84/251 (33%), Positives = 118/251 (47%), Gaps = 30/251 (12%)
 Frame = +3

Query  453   PCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlgl  632
             P A      H     +  VDL G   SG I   +    HL+ + L+SN F G +   +G 
Sbjct  245   PVAAGIASLH----NLKTVDLSGNRFSGAIPADIGLCPHLSRIDLSSNAFDGALPGSIGA  300

Query  633   ltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAG  812
             L++L   + S N +SG VP   G +++LQ LDLS N+L+G + +S L  L  L FLS + 
Sbjct  301   LSSLVFFSASGNRLSGQVPSWFGGLTALQHLDLSDNTLTGTLPES-LGQLKDLGFLSFSK  359

Query  813   SSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLP--  986
             +   G IP S+S CT L  L+L  N  SG       ++ L  L TLD S N L+G+LP  
Sbjct  360   NKLVGSIPESMSGCTKLAELHLRGNILSG--AIPEALFDLG-LETLDASGNALTGALPPS  416

Query  987   ------------------IGA--SFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSE  1106
                                GA      NL+ ++L  N    ++P +LGL   L+ LDL  
Sbjct  417   PGLAETTLQWLDLSGNQLTGAIRGLFVNLRYMNLSGNPLRAQLPPELGLLRDLTVLDLRG  476

Query  1107  NLFTGTIPESL  1139
                 G +P  L
Sbjct  477   CGLYGPVPAGL  487


 Score = 86.3 bits (212),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 109/212 (51%), Gaps = 5/212 (2%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL    LSG +  G+  L +L  + L+ N FSG I   +GL  +L  ++LS N+ 
Sbjct  231   RLRALDLSNNRLSGPVAAGIASLHNLKTVDLSGNRFSGAIPADIGLCPHLSRIDLSSNAF  290

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
              G +P S+G +SSL F   SGN LSG V  S    L +L+ L L+ ++  G +P SL + 
Sbjct  291   DGALPGSIGALSSLVFFSASGNRLSGQVP-SWFGGLTALQHLDLSDNTLTGTLPESLGQL  349

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
               L  L+ S N+  G       + G T+L  L +  N LSG++P  A F   L+ L    
Sbjct  350   KDLGFLSFSKNKLVGS--IPESMSGCTKLAELHLRGNILSGAIP-EALFDLGLETLDASG  406

Query  1035  NHFSGEIPVDLGLCP-HLSRLDLSENLFTGTI  1127
             N  +G +P   GL    L  LDLS N  TG I
Sbjct  407   NALTGALPPSPGLAETTLQWLDLSGNQLTGAI  438


 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 101/224 (45%), Gaps = 24/224 (11%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG-N  704
             L G I   +     L  L L  N  SG I P+      L+TL+ S N+++G +P S G  
Sbjct  362   LVGSIPESMSGCTKLAELHLRGNILSGAI-PEALFDLGLETLDASGNALTGALPPSPGLA  420

Query  705   MSSLQFLDLSGNSLSG-----------------PVSDSMLENLGSLR---FLSLAGSSFE  824
              ++LQ+LDLSGN L+G                 P+   +   LG LR    L L G    
Sbjct  421   ETTLQWLDLSGNQLTGAIRGLFVNLRYMNLSGNPLRAQLPPELGLLRDLTVLDLRGCGLY  480

Query  825   GPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFL  1004
             GP+P+ L +   L  L L  N  SG       I   + L  L + +N LSG +P G   L
Sbjct  481   GPVPAGLCESGSLAVLQLDGNSLSGP--IPDSIRKCSALYLLSLGHNGLSGQIPAGIGEL  538

Query  1005  HNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPES  1136
               L+ L L  N  SGEIP  LG    L  +++S N   G +P S
Sbjct  539   KKLEILRLEDNKLSGEIPQQLGGLESLLAVNISHNRLVGRLPSS  582



>gb|KJB67929.1| hypothetical protein B456_010G218400 [Gossypium raimondii]
Length=983

 Score =   231 bits (589),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 122/262 (47%), Positives = 168/262 (64%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ +QDP   L++W+EDDD+PC W  +KC+P + RV+E++L G  LSG+
Sbjct  40    LNDDVLGLIVFKADIQDPTQKLSSWNEDDDTPCNWKGIKCNPRSNRVTELNLDGFSLSGR  99

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +LE L  LSLA+NN SG ISP                        ++  + SL 
Sbjct  100   IGRGLLQLEFLRKLSLANNNLSGTISP------------------------NMVKLESLI  135

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS NSL+G + D   +  GSLR++SLA + F G IP SL  C  L  +NLS NRFSG
Sbjct  136   AIDLSENSLTGSIPDDFFKQCGSLRYISLANNHFSGKIPGSLGSCATLAAINLSMNRFSG  195

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIWGL+ LRTLD+S N L G +P G   L+NL+ ++L +N F+G++P ++G C 
Sbjct  196   --LLPVGIWGLSGLRTLDLSCNMLEGEIPEGVHALNNLRSINLSNNRFTGQVPDEIGSCL  253

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +D S NLF+G++P+++Q 
Sbjct  254   LLRSIDFSMNLFSGSVPKTMQE  275


 Score = 78.2 bits (191),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 69/219 (32%), Positives = 112/219 (51%), Gaps = 25/219 (11%)
 Frame = +3

Query  558   KLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSG  737
             ++E L  L L+ N FSG +   +G L  L+ LN S NS++G++P S+ N  +L  LD+S 
Sbjct  299   EMESLQTLDLSVNKFSGQVPDSIGKLKFLKVLNFSSNSLNGSLPASMENNMNLLALDISQ  358

Query  738   NSLSGPVSDSMLENLGSLRFLS--LAGSSFEGPIPSSL-SKCTLLNHLNLSNNRFSGDPR  908
             NSL+G +   + ++  +    S    G++ + PI +SL +    +  L+LS N FSG+  
Sbjct  359   NSLTGDLPGWIFKSGPNQVLFSEQKVGANVDNPISASLGAYLQRIQVLDLSQNSFSGELT  418

Query  909   FS----------------------GGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKEL  1022
             F                       G +  L  L  LD+S N+L+GS+P+     ++LK+L
Sbjct  419   FDIGALSSLKLLNLSRNSLIGPVPGTVAELKALEVLDLSQNQLNGSIPMEIGGAYSLKDL  478

Query  1023  SLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              L +N   G+IP  +  C  L  L +S+N  +G IP  +
Sbjct  479   RLKANFIEGKIPSSIENCTLLRTLIISQNNLSGPIPAKI  517


 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 96/190 (51%), Gaps = 27/190 (14%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             L+ + VL L+ N+FSG ++  +G L++L+ LNLS+NS+ G VP ++  + +L+ LDLS N
Sbjct  400   LQRIQVLDLSQNSFSGELTFDIGALSSLKLLNLSRNSLIGPVPGTVAELKALEVLDLSQN  459

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
              L+G +    +    SL+ L L  +  EG IPSS+  CTLL                   
Sbjct  460   QLNGSIPME-IGGAYSLKDLRLKANFIEGKIPSSIENCTLL-------------------  499

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDL  1100
                    RTL +S N LSG +P     L NL+ + L  N   G +P  L   P L   ++
Sbjct  500   -------RTLIISQNNLSGPIPAKIGELSNLEYVDLSFNDLVGRLPKQLANLPRLLSFNI  552

Query  1101  SENLFTGTIP  1130
             S N   G +P
Sbjct  553   SHNNLQGELP  562


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 71/236 (30%), Positives = 115/236 (49%), Gaps = 31/236 (13%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    L G+I  G+  L +L  ++L++N F+G +  ++G    L++++ S N  SG+V
Sbjct  210   LDLSCNMLEGEIPEGVHALNNLRSINLSNNRFTGQVPDEIGSCLLLRSIDFSMNLFSGSV  269

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P ++  +S   +L+LS NS    V + + E + SL+ L L+ + F G +P S+ K   L 
Sbjct  270   PKTMQELSLCTYLNLSVNSFVVEVPEWIGE-MESLQTLDLSVNKFSGQVPDSIGKLKFLK  328

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLP-----------------IGA  995
              LN S+N  +G       +     L  LD+S N L+G LP                 +GA
Sbjct  329   VLNFSSNSLNGS--LPASMENNMNLLALDISQNSLTGDLPGWIFKSGPNQVLFSEQKVGA  386

Query  996   -----------SFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
                        ++L  ++ L L  N FSGE+  D+G    L  L+LS N   G +P
Sbjct  387   NVDNPISASLGAYLQRIQVLDLSQNSFSGELTFDIGALSSLKLLNLSRNSLIGPVP  442



>gb|KHG03607.1| hypothetical protein F383_26757 [Gossypium arboreum]
Length=987

 Score =   230 bits (587),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 121/262 (46%), Positives = 167/262 (64%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ + DP   L++W+EDDD+PC W  +KC+P + RV+E++L G  LSG+
Sbjct  44    LNDDVLGLIVFKADILDPTQKLSSWNEDDDTPCNWKGIKCNPRSNRVTELNLDGFSLSGR  103

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +LE L  LSLA+NN SG ISP                        ++  + SL 
Sbjct  104   IGRGLLQLEFLRKLSLANNNLSGTISP------------------------NMVKLESLI  139

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS NSL+G + D   +  GSLR++SLA + F G IP SL  C  L  +NLS NRFSG
Sbjct  140   AIDLSENSLTGSIPDEFFKQCGSLRYISLANNQFSGKIPGSLGSCATLAAINLSMNRFSG  199

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIWGL+ LRTLD+S N L G +P G   L+NL+ ++L +N F+G++P ++G C 
Sbjct  200   S--LPVGIWGLSGLRTLDLSCNMLEGEIPKGVQALNNLRSINLSNNRFTGQVPDEIGSCL  257

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +D S NLF+G++P+++Q 
Sbjct  258   LLRSIDFSMNLFSGSVPKTMQE  279


 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 72/255 (28%), Positives = 117/255 (46%), Gaps = 49/255 (19%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
              SG + + +++L     L+L+ N+F G +   +  + +LQTL+LS N  SG VPDS+G +
Sbjct  269   FSGSVPKTMQELSLCTYLNLSVNSFVGEVPEWISEMESLQTLDLSVNKFSGQVPDSIGKL  328

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRF--------------------------LSLA  809
               L+ L+ S NSL+G +  SM  N+  L                                
Sbjct  329   KFLKVLNFSSNSLNGSLPASMENNMNLLALDISQNLLTGDLPGWIFKSGPSQVLFSEQKV  388

Query  810   GSSFEGPIPSSL-SKCTLLNHLNLSNNRFSGDPRFS----------------------GG  920
              ++ + PI +SL +    +  L+LS N FSG+  F                       G 
Sbjct  389   DANVDNPISASLGAYLQRIQVLDLSQNSFSGELTFDIRALSSLKLLNLSRNSLIGPVPGT  448

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDL  1100
             +  L  L  LD+S N+L+GS+P+     ++LK+L L +N   G+IP  +  C  L  L +
Sbjct  449   VAELKALEVLDLSQNQLNGSIPMEIGGAYSLKDLRLKANFIEGKIPSSIENCTLLRTLII  508

Query  1101  SENLFTGTIPESLQR  1145
             S+N  +G IP  + +
Sbjct  509   SQNNLSGPIPAEIGK  523


 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 66/212 (31%), Positives = 111/212 (52%), Gaps = 9/212 (4%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    L G+I +G++ L +L  ++L++N F+G +  ++G    L++++ S N  SG+V
Sbjct  214   LDLSCNMLEGEIPKGVQALNNLRSINLSNNRFTGQVPDEIGSCLLLRSIDFSMNLFSGSV  273

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P ++  +S   +L+LS NS  G V + + E + SL+ L L+ + F G +P S+ K   L 
Sbjct  274   PKTMQELSLCTYLNLSVNSFVGEVPEWISE-MESLQTLDLSVNKFSGQVPDSIGKLKFLK  332

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
              LN S+N  +G       +     L  LD+S N L+G LP G  F     ++        
Sbjct  333   VLNFSSNSLNGS--LPASMENNMNLLALDISQNLLTGDLP-GWIFKSGPSQVLFSEQKVD  389

Query  1047  GEI--PVDLGLCPHLSR---LDLSENLFTGTI  1127
               +  P+   L  +L R   LDLS+N F+G +
Sbjct  390   ANVDNPISASLGAYLQRIQVLDLSQNSFSGEL  421


 Score = 74.7 bits (182),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 95/190 (50%), Gaps = 27/190 (14%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             L+ + VL L+ N+FSG ++  +  L++L+ LNLS+NS+ G VP ++  + +L+ LDLS N
Sbjct  404   LQRIQVLDLSQNSFSGELTFDIRALSSLKLLNLSRNSLIGPVPGTVAELKALEVLDLSQN  463

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
              L+G +    +    SL+ L L  +  EG IPSS+  CTLL                   
Sbjct  464   QLNGSIPME-IGGAYSLKDLRLKANFIEGKIPSSIENCTLL-------------------  503

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDL  1100
                    RTL +S N LSG +P     L +L+ + L  N   G +P  L   P L   ++
Sbjct  504   -------RTLIISQNNLSGPIPAEIGKLSDLEYVDLSFNDLVGRLPKQLANLPRLLSFNI  556

Query  1101  SENLFTGTIP  1130
             S N   G +P
Sbjct  557   SHNNLQGELP  566



>ref|XP_009623562.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana tomentosiformis]
Length=893

 Score =   227 bits (579),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 129/268 (48%), Positives = 168/268 (63%), Gaps = 26/268 (10%)
 Frame = +3

Query  342   GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  521
             GA +  LNDDVLGLIVFKS V+DP   L +W+E+DDSPC WN + C+P + RVS+V L G
Sbjct  19    GALNPSLNDDVLGLIVFKSDVEDPDGKLKSWNEEDDSPCNWNGINCNPRSNRVSDVVLDG  78

Query  522   LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG  701
              GLSG+I RGL +L+ L+ LSLA+NN +G IS                         SL 
Sbjct  79    FGLSGRISRGLLRLKFLHKLSLANNNLTGSISV------------------------SLS  114

Query  702   NMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLS  881
              +++L+ LDLS NSLSGP+     E  G LR +SLA ++F G IP SLS C  L  LNLS
Sbjct  115   QLANLKILDLSQNSLSGPIPGDYFEKCGPLRSISLAKNNFSGEIPESLSSCATLASLNLS  174

Query  882   NNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             +N+FSG      GIW L  LR+LD+SNN L G +P G   L NL+ ++LG NHF GE+P 
Sbjct  175   SNQFSG--LVPSGIWSLNGLRSLDLSNNLLDGEIPAGIEGLSNLRAINLGGNHFKGEVPD  232

Query  1062  DLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              +G C  L  +DLS N F+G +P ++Q+
Sbjct  233   GIGDCWLLRSIDLSGNSFSGELPSTMQK  260


 Score = 89.7 bits (221),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 73/211 (35%), Positives = 119/211 (56%), Gaps = 3/211 (1%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL G   SG++   ++KL   N + L  N F+GV+   +G L +L+ L+ S+NS SG++
Sbjct  243   IDLSGNSFSGELPSTMQKLSLCNEVILRRNAFAGVVPEWIGELKSLEILDFSENSFSGSI  302

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P S+  + SL+ L++S N +SG + +S + +  +L  L ++ ++  G +P ++ +  LLN
Sbjct  303   PTSVEKLESLKLLNVSQNVISGSLPES-ISSCVNLLTLDVSHNNLTGTVPKTVGQLKLLN  361

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
              L+LS NRF G       I G+T L+ L +  N L G +P       +L  LSL  N  +
Sbjct  362   ILDLSENRFYG--TVPAEIGGVTSLKELRLEKNALVGQIPSSIGSCSSLVSLSLSQNSLT  419

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             G +P  L    +L  +DLS N  TGT+P+ L
Sbjct  420   GPVPAALANLTYLQNVDLSFNKLTGTLPKQL  450


 Score = 87.0 bits (214),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 72/212 (34%), Positives = 115/212 (54%), Gaps = 5/212 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             ++L G    G++  G+     L  + L+ N+FSG +   +  L+    + L +N+ +G V
Sbjct  219   INLGGNHFKGEVPDGIGDCWLLRSIDLSGNSFSGELPSTMQKLSLCNEVILRRNAFAGVV  278

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P+ +G + SL+ LD S NS SG +  S+ E L SL+ L+++ +   G +P S+S C  L 
Sbjct  279   PEWIGELKSLEILDFSENSFSGSIPTSV-EKLESLKLLNVSQNVISGSLPESISSCVNLL  337

Query  867   HLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHF  1043
              L++S+N  +G  P+  G    L  L  LD+S N   G++P     + +LKEL L  N  
Sbjct  338   TLDVSHNNLTGTVPKTVGQ---LKLLNILDLSENRFYGTVPAEIGGVTSLKELRLEKNAL  394

Query  1044  SGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              G+IP  +G C  L  L LS+N  TG +P +L
Sbjct  395   VGQIPSSIGSCSSLVSLSLSQNSLTGPVPAAL  426



>ref|XP_009757206.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=894

 Score =   227 bits (578),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 131/268 (49%), Positives = 165/268 (62%), Gaps = 25/268 (9%)
 Frame = +3

Query  342   GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  521
             GA +  LNDDVLGLIVFKS VQDP   L +W+E+DDSPC WN + C+P + RVS+V L G
Sbjct  19    GALNPSLNDDVLGLIVFKSDVQDPDGKLKSWNEEDDSPCNWNGINCNPRSNRVSDVVLDG  78

Query  522   LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG  701
              GLSG+I RGL +L+ L  LSLA+NN +G IS                         SL 
Sbjct  79    FGLSGRISRGLLRLQFLYKLSLANNNLTGSISVV-----------------------SLS  115

Query  702   NMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLS  881
              +++L+ LDLS NSLSGP+     E  G LR +SLA + F G IP SLS C  L  LNLS
Sbjct  116   QLANLKILDLSENSLSGPIPGDYFEKCGPLRSISLAKNKFSGEIPESLSSCATLASLNLS  175

Query  882   NNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             +N+FSG      GIW L  LR+LD+SNN L G +P G   L NL+ ++LG NHF GEIP 
Sbjct  176   SNQFSG--LVPSGIWSLNGLRSLDLSNNLLDGEIPAGIEGLSNLRAINLGGNHFKGEIPD  233

Query  1062  DLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              +G C  L  +DLS N F+G  P ++Q+
Sbjct  234   GIGGCWLLRSIDLSGNSFSGEPPSTMQK  261


 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 118/211 (56%), Gaps = 3/211 (1%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL G   SG+    ++KL   N + L  N F+G++   +G + +L+ L+ S+N++SGT+
Sbjct  244   IDLSGNSFSGEPPSTMQKLSLCNEVILRRNAFAGIVPEWIGEMKSLEILDFSENNLSGTI  303

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P SL  + SL+ L+LS N++SG + +S + +  +L  L ++ ++  G +P ++ +  LL 
Sbjct  304   PTSLEKLESLKVLNLSQNAISGSLPES-ISSCVNLLTLDVSHNNLTGTVPKTVGQLKLLG  362

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
              L+LS NR  G       I  +T L+ L +  N L+G +P       +L  LSL  N  +
Sbjct  363   ILDLSENRLYG--TVPAEIGEVTSLKELRLEKNALTGQIPSSIGSCSSLVSLSLSHNSLT  420

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             G +P  L    +L  +DLS N  TGT+P+ L
Sbjct  421   GPVPAALANLTYLQNVDLSFNKLTGTLPKQL  451


 Score = 70.9 bits (172),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 113/210 (54%), Gaps = 3/210 (1%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             +EV L     +G +   + +++ L +L  + NN SG I   L  L +L+ LNLS+N+ISG
Sbjct  266   NEVILRRNAFAGIVPEWIGEMKSLEILDFSENNLSGTIPTSLEKLESLKVLNLSQNAISG  325

Query  681   TVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTL  860
             ++P+S+ +  +L  LD+S N+L+G V  ++ + L  L  L L+ +   G +P+ + + T 
Sbjct  326   SLPESISSCVNLLTLDVSHNNLTGTVPKTVGQ-LKLLGILDLSENRLYGTVPAEIGEVTS  384

Query  861   LNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNH  1040
             L  L L  N  +G  +    I   + L +L +S+N L+G +P   + L  L+ + L  N 
Sbjct  385   LKELRLEKNALTG--QIPSSIGSCSSLVSLSLSHNSLTGPVPAALANLTYLQNVDLSFNK  442

Query  1041  FSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
              +G +P  LG   HL   ++S N   G +P
Sbjct  443   LTGTLPKQLGNLGHLLSFNISHNQLQGELP  472



>gb|EYU32740.1| hypothetical protein MIMGU_mgv1a000860mg [Erythranthe guttata]
Length=957

 Score =   227 bits (578),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 139/273 (51%), Positives = 166/273 (61%), Gaps = 52/273 (19%)
 Frame = +3

Query  336   AGGAES-LQLNDDVLGLIVFKSGVQ-DPASHLATWSEDDDSPCAWNFVKCHPANGRVSEV  509
             AGGA + LQLNDDVLGLIVFKSG   DP   L +W+EDDDSPCAW FVKC+  N RVSEV
Sbjct  22    AGGATTTLQLNDDVLGLIVFKSGFHSDPLKSLDSWNEDDDSPCAWRFVKCNAGNSRVSEV  81

Query  510   DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP  689
              L GL LSGKIGRGLEKL+ L VLSL                        S N+++G V 
Sbjct  82    SLDGLSLSGKIGRGLEKLQSLKVLSL------------------------SNNNLTGAVN  117

Query  690   DSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSL-SKCTLLN  866
               L  + +L+ L+LS NSLSG V  S   +  SL+FL L+ +   GP+P ++   C+ L 
Sbjct  118   PGLALIPNLERLNLSRNSLSGDVPSS-FSDASSLQFLDLSQNLLSGPLPDNIFQNCSSL-  175

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
                                    RLRTLD+SNN  SGS+PIG S +HNLKEL L  N FS
Sbjct  176   -----------------------RLRTLDLSNNAFSGSVPIGMSAVHNLKELLLNRNQFS  212

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             G +P D+GLCPHLSR+D S NLFTGTIP SLQ+
Sbjct  213   GSVPPDIGLCPHLSRIDFSNNLFTGTIPASLQK  245


 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 83/266 (31%), Positives = 123/266 (46%), Gaps = 55/266 (21%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASN----NFSGVISPqlglltnlqtlnlSK  665
             +S +D      +G I   L+KL  LN L+L+ N    +F   I  Q       + ++ S 
Sbjct  225   LSRIDFSNNLFTGTIPASLQKLNSLNFLNLSFNFLTGDFPQWIGSQTTTAAAFEYIDFSN  284

Query  666   NSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSL  845
             N+++GT+P ++G++ SL+FL LS N LSGP+ +S L  L SL  + L G++F G IP+ L
Sbjct  285   NALTGTLPATIGDLKSLKFLSLSENKLSGPLPNS-LSGLASLSVIRLKGNAFNGTIPNGL  343

Query  846   SKCTL------------------------LNHLNLSNNRFSGDPRFSGGIWGLTRLRTLD  953
                 L                        L  L+LS N  +GD     G++G  +L  L+
Sbjct  344   FDMKLDEIDLSRNNLAGPIPPASSKLFETLQVLDLSENNLAGDIPAEMGLFG--KLTYLN  401

Query  954   VSNNELSGSLPIGASFLHNLKELSLGS------------------------NHFSGEIPV  1061
             +S N+L   LP    +  NL  L L S                        N  +G+IP 
Sbjct  402   LSWNQLESRLPPEIGYFQNLTVLDLRSSGLIGSIPGDICDSSSLAILQLDGNSLTGQIPY  461

Query  1062  DLGLCPHLSRLDLSENLFTGTIPESL  1139
             ++G C  L  L LS N  +GTIPES+
Sbjct  462   EIGNCSSLYLLSLSHNNLSGTIPESM  487


 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 71/214 (33%), Positives = 104/214 (49%), Gaps = 9/214 (4%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlgll-tnlqtlnlSKNSI  674
             +S + L G   +G I  GL  ++ L+ + L+ NN +G I P    L   LQ L+LS+N++
Sbjct  325   LSVIRLKGNAFNGTIPNGLFDMK-LDEIDLSRNNLAGPIPPASSKLFETLQVLDLSENNL  383

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSG--PVSDSMLENLGSLRFLSLAGSSFEGPIPSSLS  848
             +G +P  +G    L +L+LS N L    P      +NL     L L  S   G IP  + 
Sbjct  384   AGDIPAEMGLFGKLTYLNLSWNQLESRLPPEIGYFQNL---TVLDLRSSGLIGSIPGDIC  440

Query  849   KCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSL  1028
               + L  L L  N  +G   +   I   + L  L +S+N LSG++P   S L  LK L L
Sbjct  441   DSSSLAILQLDGNSLTGQIPYE--IGNCSSLYLLSLSHNNLSGTIPESMSLLTKLKILKL  498

Query  1029  GSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
               N  +GEIP  LG   +L   ++S N   G +P
Sbjct  499   EVNQLTGEIPQQLGKLENLLIANVSYNRLVGRLP  532



>ref|XP_008776998.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=1008

 Score =   227 bits (578),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 139/271 (51%), Positives = 185/271 (68%), Gaps = 4/271 (1%)
 Frame = +3

Query  336   AGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  515
             A G     LND+VLGLIVFKS ++DP + LA+WSE D + C W  V+C PA   V  + L
Sbjct  25    ADGDLPTPLNDEVLGLIVFKSALEDPTAALASWSETDATACGWAHVECDPATSHVLRLYL  84

Query  516   HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  695
               L LSG + RGL++L +L  LS+++NN SG++   L LL  L +L+LS+N+ SG +P  
Sbjct  85    DSLSLSGPLPRGLDRLPYLESLSISNNNLSGLLPAGLSLLPRLHSLDLSRNAFSGRLPQD  144

Query  696   LGNMSSLQFLDLSGNSLSGPVSDSML--ENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNH  869
             LGN+++L+ LDLS NSLSGP+ DS+       SLR+LSLA +  EGPIPS+LS+C  L H
Sbjct  145   LGNITNLRSLDLSSNSLSGPIPDSLFSAATCSSLRYLSLAENRLEGPIPSTLSRCFFLLH  204

Query  870   LNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSG  1049
             LNLS+N+ SG P     +W L+RLR LD+S N  SGSL    + LHNLK L L SN+FSG
Sbjct  205   LNLSDNQLSGSP--XSVLWSLSRLRALDLSRNYFSGSLHEAVANLHNLKNLDLSSNYFSG  262

Query  1050  EIPVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
              IPV +GLCPHL+ LD+S N F   +P+S++
Sbjct  263   PIPVGIGLCPHLTSLDMSHNSFDAPLPDSIK  293


 Score =   102 bits (254),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 118/215 (55%), Gaps = 5/215 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +  +DL     SG I  G+    HL  L ++ N+F   +   +  L +L  L+LS N +S
Sbjct  250   LKNLDLSSNYFSGPIPVGIGLCPHLTSLDMSHNSFDAPLPDSIKWLASLTFLSLSNNQLS  309

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G +P  +GNM++LQ LDLS N L+G +  S L++L  L +LS A +   GPIP S ++CT
Sbjct  310   GDLPAWIGNMTALQHLDLSSNQLTGSLPAS-LDHLKELNYLSFADNMLAGPIPDSAAECT  368

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFL-HNLKELSLGS  1034
              L+ L L  NR +G       ++ L  L  LD+S+NEL+G +P G++ +   L  L L  
Sbjct  369   KLSQLWLKKNRLTGS--IPQALFDLG-LEVLDLSSNELTGIIPPGSARMSETLHSLDLSD  425

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             N  SG IP ++ L  +L  L+LS N     +P  L
Sbjct  426   NRLSGTIPPEMALYFNLRYLNLSWNDLRTQLPPEL  460


 Score = 97.1 bits (240),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 78/206 (38%), Positives = 115/206 (56%), Gaps = 7/206 (3%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L G I   L +   L  L+L+ N  SG     L  L+ L+ L+LS+N  SG++ +++ N+
Sbjct  188   LEGPIPSTLSRCFFLLHLNLSDNQLSGSPXSVLWSLSRLRALDLSRNYFSGSLHEAVANL  247

Query  708   SSLQFLDLSGNSLSGP--VSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLS  881
              +L+ LDLS N  SGP  V   +  +L SL    ++ +SF+ P+P S+     L  L+LS
Sbjct  248   HNLKNLDLSSNYFSGPIPVGIGLCPHLTSL---DMSHNSFDAPLPDSIKWLASLTFLSLS  304

Query  882   NNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             NN+ SGD      I  +T L+ LD+S+N+L+GSLP     L  L  LS   N  +G IP 
Sbjct  305   NNQLSGD--LPAWIGNMTALQHLDLSSNQLTGSLPASLDHLKELNYLSFADNMLAGPIPD  362

Query  1062  DLGLCPHLSRLDLSENLFTGTIPESL  1139
                 C  LS+L L +N  TG+IP++L
Sbjct  363   SAAECTKLSQLWLKKNRLTGSIPQAL  388


 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 79/260 (30%), Positives = 113/260 (43%), Gaps = 53/260 (20%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +  +DL    L+G +   L+ L+ LN LS A N  +G I       T L  L L KN ++
Sbjct  322   LQHLDLSSNQLTGSLPASLDHLKELNYLSFADNMLAGPIPDSAAECTKLSQLWLKKNRLT  381

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSG---PVSDSMLENLGSLRFLSLAGSSFEGPIPSSLS  848
             G++P +L ++  L+ LDLS N L+G   P S  M E L SL    L+ +   G IP  ++
Sbjct  382   GSIPQALFDLG-LEVLDLSSNELTGIIPPGSARMSETLHSL---DLSDNRLSGTIPPEMA  437

Query  849   KCTLLNHLNLSNN--RFSGDPRF------------SGGIWGLTR--------LRTLDVSN  962
                 L +LNLS N  R    P              S  ++G           L  L + +
Sbjct  438   LYFNLRYLNLSWNDLRTQLPPELGYFHNLTVLDLRSSALYGPVPGELCDSGGLAVLQLDS  497

Query  963   NELSGSLP----------------------IGASF--LHNLKELSLGSNHFSGEIPVDLG  1070
             N LSG +P                      I AS   L  L+ L+L  N+ SGEIP  LG
Sbjct  498   NSLSGPIPEEIGNCSSLYLLSLSHNSLNSSIPASMARLKKLEILNLEFNNLSGEIPQLLG  557

Query  1071  LCPHLSRLDLSENLFTGTIP  1130
                +L  +++S N   G +P
Sbjct  558   GLDNLLAVNISHNRLIGRLP  577



>ref|XP_007011288.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY20098.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=982

 Score =   225 bits (574),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 121/262 (46%), Positives = 165/262 (63%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ + DP   L++W+EDDD+PC W  VKC+P   RV+E++L G  LSG+
Sbjct  38    LNDDVLGLIVFKADILDPNQKLSSWNEDDDTPCNWFGVKCNPRLNRVTELNLDGFSLSGR  97

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +LE L  LSLA NN +G ISP                        +L  + SL+
Sbjct  98    IGRGLLQLEFLRKLSLAKNNLTGSISP------------------------NLAKLESLR  133

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS NSLSG + D   +  GS+R +SLA + F G IP SL  C  L  +NLS N+FSG
Sbjct  134   IIDLSENSLSGSIPDDFFKQCGSVRSISLANNRFSGKIPGSLGSCATLAAINLSRNQFSG  193

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                  GGIW L+ LR+LD+S N L G +P G   L+NL+ ++LG N FSG++P  +G C 
Sbjct  194   S--LPGGIWALSGLRSLDLSENLLEGEIPKGIEALNNLRSINLGKNRFSGQVPDGVGSCL  251

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLS NL +G++P+++++
Sbjct  252   LLRSIDLSMNLLSGSVPQTMRK  273


 Score = 87.4 bits (215),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 73/231 (32%), Positives = 116/231 (50%), Gaps = 29/231 (13%)
 Frame = +3

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  713
             G++   + +++ L  L  + N FSG +   +G L  L+ LN S N +SG++P S+GN  +
Sbjct  289   GEVPEWIGEMKSLETLDFSMNKFSGQVPNSIGNLKFLKVLNFSANGLSGSLPASMGNNVN  348

Query  714   LQFLDLSGNSLSG---------------------------PVSDSMLENLGSLRFLSLAG  812
             L  LD S N ++G                           P+S S   +L  ++ L L+ 
Sbjct  349   LLALDFSQNLMTGDLPAWIFKSGLNQVSLSEKKLGANVDNPISTSPGTSLQKIQVLDLSH  408

Query  813   SSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIG  992
             +SF G I S +   + L  LNLS N   G  R  G +  L  L  LD+S N+L+GS+P+ 
Sbjct  409   NSFSGEITSDVGALSGLQLLNLSRNSIIG--RIPGTVGELKALAVLDLSQNQLNGSIPME  466

Query  993   ASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
                 ++LK+L L  N   G+IP+ +  C  L  L +S+N  +GTIP ++ +
Sbjct  467   IGGAYSLKDLRLNENFLEGKIPMSIENCTLLMSLIISQNNLSGTIPAAIGK  517


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 110/229 (48%), Gaps = 31/229 (14%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L G+I +G+E L +L  ++L  N FSG +   +G    L++++LS N +SG+VP ++  +
Sbjct  215   LEGEIPKGIEALNNLRSINLGKNRFSGQVPDGVGSCLLLRSIDLSMNLLSGSVPQTMRKL  274

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
             S   +L+LS NS  G V + + E + SL  L  + + F G +P+S+     L  LN S N
Sbjct  275   SLCSYLNLSMNSFVGEVPEWIGE-MKSLETLDFSMNKFSGQVPNSIGNLKFLKVLNFSAN  333

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLP-----------------IGASF-----  1001
               SG    S G      L  LD S N ++G LP                 +GA+      
Sbjct  334   GLSGSLPASMG--NNVNLLALDFSQNLMTGDLPAWIFKSGLNQVSLSEKKLGANVDNPIS  391

Query  1002  ------LHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
                   L  ++ L L  N FSGEI  D+G    L  L+LS N   G IP
Sbjct  392   TSPGTSLQKIQVLDLSHNSFSGEITSDVGALSGLQLLNLSRNSIIGRIP  440


 Score = 74.7 bits (182),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 95/190 (50%), Gaps = 27/190 (14%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             L+ + VL L+ N+FSG I+  +G L+ LQ LNLS+NSI G +P ++G + +L  LDLS N
Sbjct  398   LQKIQVLDLSHNSFSGEITSDVGALSGLQLLNLSRNSIIGRIPGTVGELKALAVLDLSQN  457

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
              L+G +    +    SL+ L L  +  EG IP S+  CTLL                   
Sbjct  458   QLNGSIPME-IGGAYSLKDLRLNENFLEGKIPMSIENCTLL-------------------  497

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDL  1100
                     +L +S N LSG++P     L NL+ + L  N   G +P  L   P+L   ++
Sbjct  498   -------MSLIISQNNLSGTIPAAIGKLSNLQNVDLSVNGLVGTLPKQLANLPNLLSFNI  550

Query  1101  SENLFTGTIP  1130
             S N   G +P
Sbjct  551   SHNNLQGELP  560



>ref|XP_008456960.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=925

 Score =   224 bits (571),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 125/265 (47%), Positives = 167/265 (63%), Gaps = 26/265 (10%)
 Frame = +3

Query  351   SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
             +L LN DVLGLIVFK+ VQDP   LA+W+EDDDSPC W  V+C P + RV E++L+G  L
Sbjct  28    NLSLNGDVLGLIVFKAAVQDPKLKLASWNEDDDSPCNWTGVQCSPRSKRVIELNLNGFSL  87

Query  531   SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  710
             SG++GRGL +LE L  LSL++NN SG ISP                        +   + 
Sbjct  88    SGRLGRGLFQLEFLQRLSLSNNNLSGNISP------------------------NFARVE  123

Query  711   SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNR  890
             +LQ +DLSGN+ SG VSD       SLR +SLA ++F G IP SLS C  L  +N S+NR
Sbjct  124   NLQMIDLSGNNFSGAVSDDFFRQCRSLRVISLANNNFSGKIPDSLSFCGSLISVNFSSNR  183

Query  891   FSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLG  1070
             FSG      GIW ++ LR+LD+S+N LSG +P     L+NL+ L+L  N FSG+IP  +G
Sbjct  184   FSGS--LPSGIWSISGLRSLDLSDNALSGEIPKVIENLYNLRTLNLSKNRFSGDIPDGIG  241

Query  1071  LCPHLSRLDLSENLFTGTIPESLQR  1145
              C  L  +DLSEN F+G +P+++Q+
Sbjct  242   SCLLLRSIDLSENSFSGNLPQTMQK  266


 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 82/258 (32%), Positives = 123/258 (48%), Gaps = 46/258 (18%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    LSG+I + +E L +L  L+L+ N FSG I   +G    L++++LS+NS SG +
Sbjct  201   LDLSDNALSGEIPKVIENLYNLRTLNLSKNRFSGDIPDGIGSCLLLRSIDLSENSFSGNL  260

Query  687   PDSL------------------------GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  794
             P ++                        G M SL+ +D SGN+ +G +  +M ENL  L+
Sbjct  261   PQTMQKLVLCSNLILGRNLFDGDIPEWIGEMKSLETIDFSGNNFTGRIPATM-ENLQYLK  319

Query  795   FLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PR----------------FSGGI  923
              L+L+ + F    P S+ KC  L  L+ S+N   G+ P                 F G I
Sbjct  320   VLNLSSNGFTDSFPESVMKCQSLLALDFSHNLIMGNLPEIGSLRKLQILSLSGNYFVGSI  379

Query  924   ----WGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSR  1091
                   L  L  LD+S N+L+ ++P+      +L EL L  N   GEIP  +  C  L+ 
Sbjct  380   PETIGDLKALSILDLSGNQLNETIPVAIGGAVSLIELKLDGNFLGGEIPFSIAHCSSLTT  439

Query  1092  LDLSENLFTGTIPESLQR  1145
             L  S N  TG IP +L +
Sbjct  440   LFASHNNLTGPIPAALAK  457


 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 66/207 (32%), Positives = 107/207 (52%), Gaps = 26/207 (13%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVIS-----------------------  617
             +D  G   +G+I   +E L++L VL+L+SN F+                           
Sbjct  297   IDFSGNNFTGRIPATMENLQYLKVLNLSSNGFTDSFPESVMKCQSLLALDFSHNLIMGNL  356

Query  618   PqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRF  797
             P++G L  LQ L+LS N   G++P+++G++ +L  LDLSGN L+  +  ++   + SL  
Sbjct  357   PEIGSLRKLQILSLSGNYFVGSIPETIGDLKALSILDLSGNQLNETIPVAIGGAV-SLIE  415

Query  798   LSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSG  977
             L L G+   G IP S++ C+ L  L  S+N  +G       +  L+ L+ +D+S N L+G
Sbjct  416   LKLDGNFLGGEIPFSIAHCSSLTTLFASHNNLTGP--IPAALAKLSYLQNVDLSFNNLNG  473

Query  978   SLPIGASFLHNLKELSLGSNHFSGEIP  1058
             +LP   S L NL   ++  N F GE+P
Sbjct  474   TLPKQLSNLPNLLVFNISHNDFKGELP  500



>ref|XP_007207150.1| hypothetical protein PRUPE_ppa000904mg [Prunus persica]
 gb|EMJ08349.1| hypothetical protein PRUPE_ppa000904mg [Prunus persica]
Length=965

 Score =   224 bits (570),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/262 (47%), Positives = 164/262 (63%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLIVFK+G++DP + L +WSEDD++PC+W  VKC P   RVSE+ L G  LSG 
Sbjct  23    FNDDVLGLIVFKAGLRDPKAKLTSWSEDDNNPCSWVGVKCDPRTNRVSELVLDGFSLSGH  82

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             +GRGL +L+ L +LSLA+NNF+G I+P                         L ++ SLQ
Sbjct  83    VGRGLLRLQFLQILSLANNNFTGTINP------------------------DLPHLGSLQ  118

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS NSLSGP+ D      GSLR +S A ++  G IP SLS C  L  +N S+N+ SG
Sbjct  119   VIDLSQNSLSGPIPDEFFMQCGSLRVVSFARNNLTGQIPQSLSICQTLVAVNFSSNQLSG  178

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
               +   GIW L  L+ LD+S+N L G +P G   L++L+ ++   N FSG++P D+G C 
Sbjct  179   --KLPSGIWYLRGLQALDLSDNLLEGEVPEGMENLYDLRVINFRKNWFSGKLPWDIGSCL  236

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LD SEN F+G+IPES+QR
Sbjct  237   LLKLLDFSENFFSGSIPESIQR  258


 Score = 86.7 bits (213),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 114/235 (49%), Gaps = 29/235 (12%)
 Frame = +3

Query  516   HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  695
              G   +G+I   L  L  L +L ++ NNFSG I    G L  L+ LNLS+N  +G++P+S
Sbjct  268   QGNSFAGQIPNWLGDLRSLEMLDISGNNFSGGIPSSFGNLELLEKLNLSRNEFTGSLPES  327

Query  696   LGNMSSLQFLD-----------------------LSGNSLSGPVSDSMLENL----GSLR  794
             L N   L  +D                       LSGN LSG    S L ++    G L+
Sbjct  328   LTNCIKLLAIDVSHNLLAGKLPSWIFKLGIQSVSLSGNRLSGSAEYSSLTSMEASNGGLQ  387

Query  795   FLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELS  974
              L L+ + F   +PS +   + L  LN+S N   G       I  L     +D+S+N+L+
Sbjct  388   VLDLSSNEFSDVLPSDIGVLSRLQFLNMSGNHLLGS--IPASIGKLKTASVVDLSDNQLN  445

Query  975   GSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             GS+P     + +LKEL L  N  +G+IP  +  C  L+ L LS+N  TG IP ++
Sbjct  446   GSIPSEIGGVVSLKELRLQKNFLTGKIPSQIEKCSSLTSLMLSQNNLTGPIPAAI  500


 Score = 77.8 bits (190),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 95/164 (58%), Gaps = 3/164 (2%)
 Frame = +3

Query  570   LNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLS  749
             L VL L+SN FS V+   +G+L+ LQ LN+S N + G++P S+G + +   +DLS N L+
Sbjct  386   LQVLDLSSNEFSDVLPSDIGVLSRLQFLNMSGNHLLGSIPASIGKLKTASVVDLSDNQLN  445

Query  750   GPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWG  929
             G +  S +  + SL+ L L  +   G IPS + KC+ L  L LS N  +G       I  
Sbjct  446   GSIP-SEIGGVVSLKELRLQKNFLTGKIPSQIEKCSSLTSLMLSQNNLTGP--IPAAIAN  502

Query  930   LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             L+ L+ +D+S N+ SGSLP   + L +L   ++  NH  G++P+
Sbjct  503   LSNLQYVDLSLNKFSGSLPKELTNLSHLLYFNVSHNHLQGDLPL  546


 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 113/236 (48%), Gaps = 39/236 (17%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
              SGK+   +     L +L  + N FSG I   +  L++  +L+L  NS +G +P+ LG++
Sbjct  224   FSGKLPWDIGSCLLLKLLDFSENFFSGSIPESIQRLSSCSSLSLQGNSFAGQIPNWLGDL  283

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLL--------  863
              SL+ LD+SGN+ SG +  S   NL  L  L+L+ + F G +P SL+ C  L        
Sbjct  284   RSLEMLDISGNNFSGGIPSS-FGNLELLEKLNLSRNEFTGSLPESLTNCIKLLAIDVSHN  342

Query  864   ---------------NHLNLSNNRFSGDPRFS---------GGIWGLTRLRTLDVSNNEL  971
                              ++LS NR SG   +S         GG      L+ LD+S+NE 
Sbjct  343   LLAGKLPSWIFKLGIQSVSLSGNRLSGSAEYSSLTSMEASNGG------LQVLDLSSNEF  396

Query  972   SGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             S  LP     L  L+ L++  NH  G IP  +G     S +DLS+N   G+IP  +
Sbjct  397   SDVLPSDIGVLSRLQFLNMSGNHLLGSIPASIGKLKTASVVDLSDNQLNGSIPSEI  452


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 80/136 (59%), Gaps = 1/136 (1%)
 Frame = +3

Query  495  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
            R+  +++ G  L G I   + KL+  +V+ L+ N  +G I  ++G + +L+ L L KN +
Sbjct  409  RLQFLNMSGNHLLGSIPASIGKLKTASVVDLSDNQLNGSIPSEIGGVVSLKELRLQKNFL  468

Query  675  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
            +G +P  +   SSL  L LS N+L+GP+  + + NL +L+++ L+ + F G +P  L+  
Sbjct  469  TGKIPSQIEKCSSLTSLMLSQNNLTGPIP-AAIANLSNLQYVDLSLNKFSGSLPKELTNL  527

Query  855  TLLNHLNLSNNRFSGD  902
            + L + N+S+N   GD
Sbjct  528  SHLLYFNVSHNHLQGD  543



>ref|XP_008244834.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Prunus mume]
Length=965

 Score =   223 bits (568),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/262 (47%), Positives = 164/262 (63%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLIVFK+G++DP + L +WSEDD++PC+W  VKC P   RVSE+ L G  LSG 
Sbjct  23    FNDDVLGLIVFKAGLRDPKAKLTSWSEDDNNPCSWVGVKCDPRTNRVSELVLDGFSLSGH  82

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             +GRGL +L+ L +LSLA+NNF+G I+P                         L ++ SLQ
Sbjct  83    VGRGLLRLQFLQILSLANNNFTGTINP------------------------DLPHLGSLQ  118

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS NSLSGP+ D      GSLR +S A ++  G IP SLS C  L  +N S+N+ SG
Sbjct  119   VIDLSQNSLSGPIPDEFFMQCGSLRVVSFARNNLTGQIPHSLSLCQTLVAVNFSSNQLSG  178

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
               +   GIW L  L+ LD+S+N L G +P G   L++L+ ++   N FSG++P D+G C 
Sbjct  179   --KLPSGIWYLRGLQALDLSDNLLEGEVPEGMENLYDLRVINFRKNWFSGKLPWDIGSCL  236

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LD SEN F+G+IPES+QR
Sbjct  237   LLKLLDFSENFFSGSIPESIQR  258


 Score = 86.3 bits (212),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 79/235 (34%), Positives = 113/235 (48%), Gaps = 29/235 (12%)
 Frame = +3

Query  516   HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  695
              G   +G+I   L  L  L +L ++ NNFSG I    G L  L+ LNLS+N  +G++P+S
Sbjct  268   QGNSFAGQIPNWLGDLRSLEILDISGNNFSGGIPSSFGNLELLEKLNLSRNEFTGSLPES  327

Query  696   LGNMSSLQFLD-----------------------LSGNSLSGPVSDSMLENL----GSLR  794
             L N   L  +D                       LSGN LSG    S L ++    G L+
Sbjct  328   LTNCIKLLAIDVSHNLLAGKLPKWIFKLGIQSVSLSGNRLSGSAEYSSLTSMEASNGGLQ  387

Query  795   FLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELS  974
              L L+ + F   +PS +   + L  LN+S N   G       I  L     +D+S+N L+
Sbjct  388   VLDLSSNEFSDVLPSDIGVLSSLQFLNMSGNHLLGS--IPASIGKLKTASVVDLSDNRLN  445

Query  975   GSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             GS+P     + +LKEL L  N  +G+IP  +  C  L+ L LS+N  TG IP S+
Sbjct  446   GSIPSEIGGVVSLKELRLQKNFLTGKIPSQIVKCSSLTSLMLSQNNLTGPIPASI  500


 Score = 78.2 bits (191),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 96/164 (59%), Gaps = 3/164 (2%)
 Frame = +3

Query  570   LNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLS  749
             L VL L+SN FS V+   +G+L++LQ LN+S N + G++P S+G + +   +DLS N L+
Sbjct  386   LQVLDLSSNEFSDVLPSDIGVLSSLQFLNMSGNHLLGSIPASIGKLKTASVVDLSDNRLN  445

Query  750   GPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWG  929
             G +  S +  + SL+ L L  +   G IPS + KC+ L  L LS N  +G       I  
Sbjct  446   GSIP-SEIGGVVSLKELRLQKNFLTGKIPSQIVKCSSLTSLMLSQNNLTGP--IPASIAN  502

Query  930   LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             LT L+ +D+S N+ SGSLP   + L +L   ++  NH  G++P+
Sbjct  503   LTNLQYVDLSFNKFSGSLPKELTNLSHLLYFNVSHNHLQGDLPL  546


 Score = 77.4 bits (189),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 74/230 (32%), Positives = 117/230 (51%), Gaps = 27/230 (12%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
              SGK+   +     L +L  + N FSG I   +  L++  +L+L  NS +G +P+ LG++
Sbjct  224   FSGKLPWDIGSCLLLKLLDFSENFFSGSIPESIQRLSSCSSLSLQGNSFAGQIPNWLGDL  283

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
              SL+ LD+SGN+ SG +  S   NL  L  L+L+ + F G +P SL+ C  L  +++S+N
Sbjct  284   RSLEILDISGNNFSGGIPSS-FGNLELLEKLNLSRNEFTGSLPESLTNCIKLLAIDVSHN  342

Query  888   RFSGD-PR--FSGGIWGLTR-----------------------LRTLDVSNNELSGSLPI  989
               +G  P+  F  GI  ++                        L+ LD+S+NE S  LP 
Sbjct  343   LLAGKLPKWIFKLGIQSVSLSGNRLSGSAEYSSLTSMEASNGGLQVLDLSSNEFSDVLPS  402

Query  990   GASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
                 L +L+ L++  NH  G IP  +G     S +DLS+N   G+IP  +
Sbjct  403   DIGVLSSLQFLNMSGNHLLGSIPASIGKLKTASVVDLSDNRLNGSIPSEI  452



>gb|KJB73018.1| hypothetical protein B456_011G209800 [Gossypium raimondii]
Length=975

 Score =   223 bits (567),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 121/262 (46%), Positives = 164/262 (63%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ +QDP+  L++W+EDDD+PC W  VKC+P + RV+E++L G  LSG+
Sbjct  31    LNDDVLGLIVFKADIQDPSQKLSSWNEDDDTPCNWFGVKCNPRSSRVTELNLDGFTLSGR  90

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L  LSLA NN SG ISP                        +L  + SL+
Sbjct  91    IGRGLLQLKFLRKLSLARNNLSGTISP------------------------NLAKLESLR  126

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS NSLSG + D   +  GSLR +SLA + F G IP SL  C  L  +NLS N+ SG
Sbjct  127   IIDLSENSLSGFIPDDFFKQCGSLRSISLANNRFSGKIPVSLGSCATLADINLSWNQLSG  186

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIWGL  LR+LD+S N L G +P G   L+NL+ ++L  N F+G++P  +G C 
Sbjct  187   S--LPAGIWGLNGLRSLDLSGNLLEGEIPKGIEALNNLRSINLSKNRFTGQVPDGIGSCL  244

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLS NL +G++P ++Q+
Sbjct  245   LLRSIDLSMNLLSGSVPNTIQK  266


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 73/236 (31%), Positives = 115/236 (49%), Gaps = 31/236 (13%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL G  L G+I +G+E L +L  ++L+ N F+G +   +G    L++++LS N +SG+V
Sbjct  201   LDLSGNLLEGEIPKGIEALNNLRSINLSKNRFTGQVPDGIGSCLLLRSIDLSMNLLSGSV  260

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P+++  +S   +L+LS NS  G V + + E + +L  L  + + F G +P S+    LL 
Sbjct  261   PNTIQKLSLCSYLNLSMNSFVGEVPEWIGE-MKNLETLDFSMNKFSGQVPESIGSLNLLK  319

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSL---------------------  983
              LN S N  +G       +     L  LD S N ++G L                     
Sbjct  320   VLNFSANGLNGS--LPASMENNVNLLALDFSQNLMTGDLPGWIFKSGLNEVSLSENKLGV  377

Query  984   ----PIGAS---FLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
                 PI AS    L  ++ L L  N FSGE+  D+G+   L  L+LS N   G +P
Sbjct  378   NSSNPISASPRTSLQKIQVLDLSHNSFSGELTYDIGVLSSLQFLNLSRNSLIGPVP  433


 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 112/231 (48%), Gaps = 29/231 (13%)
 Frame = +3

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  713
             G++   + ++++L  L  + N FSG +   +G L  L+ LN S N ++G++P S+ N  +
Sbjct  282   GEVPEWIGEMKNLETLDFSMNKFSGQVPESIGSLNLLKVLNFSANGLNGSLPASMENNVN  341

Query  714   LQFLDLSGNSLSG---------------------------PVSDSMLENLGSLRFLSLAG  812
             L  LD S N ++G                           P+S S   +L  ++ L L+ 
Sbjct  342   LLALDFSQNLMTGDLPGWIFKSGLNEVSLSENKLGVNSSNPISASPRTSLQKIQVLDLSH  401

Query  813   SSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIG  992
             +SF G +   +   + L  LNLS N   G     G +  L  L  LD+S+N+L+GS+P+ 
Sbjct  402   NSFSGELTYDIGVLSSLQFLNLSRNSLIGP--VPGTVGELKALDVLDLSHNQLNGSIPME  459

Query  993   ASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
                  +LK+L L +N   G+IP  +  C  L  L +S+N  +G IP  + +
Sbjct  460   IGGAFSLKDLRLNANFLGGKIPTSIENCTSLYTLIISQNNLSGPIPAEIGK  510


 Score = 74.7 bits (182),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 89/161 (55%), Gaps = 8/161 (5%)
 Frame = +3

Query  660   SKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPS  839
             S N IS +   SL     +Q LDLS NS SG ++   +  L SL+FL+L+ +S  GP+P 
Sbjct  379   SSNPISASPRTSL---QKIQVLDLSHNSFSGELTYD-IGVLSSLQFLNLSRNSLIGPVPG  434

Query  840   SLSKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLK  1016
             ++ +   L+ L+LS+N+ +G  P   GG + L  LR   ++ N L G +P       +L 
Sbjct  435   TVGELKALDVLDLSHNQLNGSIPMEIGGAFSLKDLR---LNANFLGGKIPTSIENCTSLY  491

Query  1017  ELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              L +  N+ SG IP ++G   +L  +DLS N   GT+P+ L
Sbjct  492   TLIISQNNLSGPIPAEIGKLNNLENVDLSYNNLAGTLPKQL  532


 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 64/169 (38%), Positives = 98/169 (58%), Gaps = 7/169 (4%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             L+ + VL L+ N+FSG ++  +G+L++LQ LNLS+NS+ G VP ++G + +L  LDLS N
Sbjct  391   LQKIQVLDLSHNSFSGELTYDIGVLSSLQFLNLSRNSLIGPVPGTVGELKALDVLDLSHN  450

Query  741   SLSGPVSDSMLENLG--SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFS  914
              L+G +    +E  G  SL+ L L  +   G IP+S+  CT L  L +S N  SG     
Sbjct  451   QLNGSIP---MEIGGAFSLKDLRLNANFLGGKIPTSIENCTSLYTLIISQNNLSGP--IP  505

Query  915   GGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
               I  L  L  +D+S N L+G+LP   + L +L   ++  N+  GE+P 
Sbjct  506   AEIGKLNNLENVDLSYNNLAGTLPKQLANLPHLLSFNISHNNLQGELPA  554



>gb|KHG09451.1| hypothetical protein F383_09289 [Gossypium arboreum]
Length=975

 Score =   222 bits (565),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 121/262 (46%), Positives = 164/262 (63%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ +QDP+  L++W+EDDD+PC W  VKC+P + RV+E++L G  LSG+
Sbjct  31    LNDDVLGLIVFKADIQDPSQKLSSWNEDDDTPCNWFGVKCNPRSSRVTELNLDGFTLSGR  90

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L  LSLA NN SG ISP                        +L  + SL+
Sbjct  91    IGRGLLQLKFLRKLSLARNNLSGTISP------------------------NLAKLESLR  126

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS NSLSG + D   +  GSLR +SLA + F G IP SL  C  L  +NLS N+ SG
Sbjct  127   IIDLSENSLSGFIPDDFFKQCGSLRSISLANNRFSGKIPGSLGSCATLADINLSWNQLSG  186

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIWGL  LR+LD+S N L G +P G   L+NL+ ++L  N F+G++P  +G C 
Sbjct  187   S--LPAGIWGLNGLRSLDLSGNLLEGEIPKGIEALNNLRSINLSKNRFTGQVPDGIGSCL  244

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLS NL +G++P ++Q+
Sbjct  245   LLRSIDLSLNLLSGSVPSTIQK  266


 Score = 80.9 bits (198),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 82/157 (52%), Gaps = 3/157 (2%)
 Frame = +3

Query  660   SKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPS  839
             S NS SG +   +G +SSLQFL+LS NSL GPV  ++ E L +L  L L+ +   G IP 
Sbjct  400   SHNSFSGELTYDIGVLSSLQFLNLSRNSLIGPVPGTVGE-LKALDVLDLSHNQLNGSIPM  458

Query  840   SLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKE  1019
              +     L  L L+ N   G  +    I   T L TL +S N LSG +P     L+NL+ 
Sbjct  459   EIGGALSLKDLRLNANFLGG--KIPTSIENCTLLSTLIISQNNLSGPIPAEIGKLNNLEN  516

Query  1020  LSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             + L  N+ +G +P  L   PHL   ++S N   G +P
Sbjct  517   VDLSYNNLAGTLPKQLANLPHLLSFNISHNNLQGELP  553


 Score = 77.4 bits (189),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 73/236 (31%), Positives = 114/236 (48%), Gaps = 31/236 (13%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL G  L G+I +G+E L +L  ++L+ N F+G +   +G    L++++LS N +SG+V
Sbjct  201   LDLSGNLLEGEIPKGIEALNNLRSINLSKNRFTGQVPDGIGSCLLLRSIDLSLNLLSGSV  260

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P ++  +S   +L+LS NS  G V + + E + +L  L  + + F G +P S+    LL 
Sbjct  261   PSTIQKLSLCSYLNLSMNSFVGEVPEWIGE-MKNLETLDFSMNKFSGQVPESIGSLKLLK  319

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSL---------------------  983
              LN S N  +G       +     L  LD S N ++G L                     
Sbjct  320   VLNFSANGLNGS--LPASMENNVNLLALDFSQNLMNGDLPGWIFKSGLNEVSLSENKLGV  377

Query  984   ----PIGAS---FLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
                 PI AS    L  ++ L L  N FSGE+  D+G+   L  L+LS N   G +P
Sbjct  378   NLSNPISASPRTPLQKIQVLDLSHNSFSGELTYDIGVLSSLQFLNLSRNSLIGPVP  433


 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 69/231 (30%), Positives = 112/231 (48%), Gaps = 29/231 (13%)
 Frame = +3

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  713
             G++   + ++++L  L  + N FSG +   +G L  L+ LN S N ++G++P S+ N  +
Sbjct  282   GEVPEWIGEMKNLETLDFSMNKFSGQVPESIGSLKLLKVLNFSANGLNGSLPASMENNVN  341

Query  714   LQFLDLSGN---------------------------SLSGPVSDSMLENLGSLRFLSLAG  812
             L  LD S N                           +LS P+S S    L  ++ L L+ 
Sbjct  342   LLALDFSQNLMNGDLPGWIFKSGLNEVSLSENKLGVNLSNPISASPRTPLQKIQVLDLSH  401

Query  813   SSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIG  992
             +SF G +   +   + L  LNLS N   G     G +  L  L  LD+S+N+L+GS+P+ 
Sbjct  402   NSFSGELTYDIGVLSSLQFLNLSRNSLIGP--VPGTVGELKALDVLDLSHNQLNGSIPME  459

Query  993   ASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
                  +LK+L L +N   G+IP  +  C  LS L +S+N  +G IP  + +
Sbjct  460   IGGALSLKDLRLNANFLGGKIPTSIENCTLLSTLIISQNNLSGPIPAEIGK  510


 Score = 71.6 bits (174),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 81/146 (55%), Gaps = 5/146 (3%)
 Frame = +3

Query  705   MSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSN  884
             +  +Q LDLS NS SG ++   +  L SL+FL+L+ +S  GP+P ++ +   L+ L+LS+
Sbjct  391   LQKIQVLDLSHNSFSGELTYD-IGVLSSLQFLNLSRNSLIGPVPGTVGELKALDVLDLSH  449

Query  885   NRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             N+ +G  P   GG   L  LR   ++ N L G +P        L  L +  N+ SG IP 
Sbjct  450   NQLNGSIPMEIGGALSLKDLR---LNANFLGGKIPTSIENCTLLSTLIISQNNLSGPIPA  506

Query  1062  DLGLCPHLSRLDLSENLFTGTIPESL  1139
             ++G   +L  +DLS N   GT+P+ L
Sbjct  507   EIGKLNNLENVDLSYNNLAGTLPKQL  532



>ref|XP_008788529.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Phoenix dactylifera]
Length=968

 Score =   222 bits (565),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 124/262 (47%), Positives = 163/262 (62%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIV K+ ++DPAS LA+W+EDDD PC W  V C P   RV+E++L G  LSGK
Sbjct  24    LNDDVLGLIVLKADLEDPASKLASWNEDDDDPCGWVGVTCSPRTNRVTELNLDGFSLSGK  83

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L  LSL+ NNFSG ++P                        +L  + SL 
Sbjct  84    IGRGLLQLQSLRKLSLSKNNFSGSLNP------------------------NLSQLESLS  119

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N+LSG + D       SL  +SLA ++F G IP S+  C+ L  LNLS+NR SG
Sbjct  120   SVDLSENNLSGSIPDEFFRQCRSLSSISLANNAFSGEIPPSVGSCSTLAELNLSSNRLSG  179

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
               R   G+W L  LR+LD+S N LSG +P+G S L+NL+ +SL  N  SG +P D+G C 
Sbjct  180   --RLPSGLWSLYGLRSLDLSGNSLSGDIPMGISRLYNLRAISLRGNRLSGGLPDDIGGCL  237

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LDLSENL TG +PE++++
Sbjct  238   LLKSLDLSENLLTGKLPETMRK  259


 Score = 97.1 bits (240),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 77/209 (37%), Positives = 113/209 (54%), Gaps = 4/209 (2%)
 Frame = +3

Query  504   EVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGT  683
             EVD     L+G +   + +L  L  +S++ N  SG I   +     L+TL+LS N  SG 
Sbjct  337   EVDFSQNSLTGDLPTWIFEL-GLQSISMSGNKMSGSIQIPVTTDQTLKTLDLSSNGFSGG  395

Query  684   VPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLL  863
             +P  +GN+  LQFL+LS NSLSG +  S+ E L SL+ L L+G+   G IP  + +   L
Sbjct  396   IPVDIGNIHGLQFLNLSWNSLSGSMPASLGE-LKSLQVLDLSGNRLNGSIPPEIGEAVSL  454

Query  864   NHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHF  1043
             N LNL  N  +G       I   + L +L +S N L+G +P   S + NL+ + L  N  
Sbjct  455   NELNLHKNSLTGG--IPTQIGNCSSLASLILSQNNLTGPVPSTFSNITNLQTIDLSHNRL  512

Query  1044  SGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             +G +P  L   PHL   ++S NLF+G +P
Sbjct  513   TGTLPKQLSNLPHLLSFNISHNLFSGDLP  541


 Score = 87.4 bits (215),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 114/204 (56%), Gaps = 4/204 (2%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L+GK+   + KL   + LSL SN+FSG +   +G +  L+TLNLS N  SG VPDS+GN+
Sbjct  249   LTGKLPETMRKLSLCSYLSLGSNSFSGEVLTWVGEMKGLETLNLSSNGFSGQVPDSIGNL  308

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
               ++ LD S N+ +G +  S +    SL  +  + +S  G +P+ + +  L   +++S N
Sbjct  309   QLVKRLDFSQNNFTGSLPQS-IGICKSLLEVDFSQNSLTGDLPTWIFELGL-QSISMSGN  366

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDL  1067
             + SG  +    +     L+TLD+S+N  SG +P+    +H L+ L+L  N  SG +P  L
Sbjct  367   KMSGSIQIP--VTTDQTLKTLDLSSNGFSGGIPVDIGNIHGLQFLNLSWNSLSGSMPASL  424

Query  1068  GLCPHLSRLDLSENLFTGTIPESL  1139
             G    L  LDLS N   G+IP  +
Sbjct  425   GELKSLQVLDLSGNRLNGSIPPEI  448


 Score = 84.3 bits (207),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 109/204 (53%), Gaps = 4/204 (2%)
 Frame = +3

Query  525   GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  704
             G SG++   +  L+ +  L  + NNF+G +   +G+  +L  ++ S+NS++G +P  +  
Sbjct  296   GFSGQVPDSIGNLQLVKRLDFSQNNFTGSLPQSIGICKSLLEVDFSQNSLTGDLPTWIFE  355

Query  705   MSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSN  884
             +  LQ + +SGN +SG +   +  +  +L+ L L+ + F G IP  +     L  LNLS 
Sbjct  356   LG-LQSISMSGNKMSGSIQIPVTTD-QTLKTLDLSSNGFSGGIPVDIGNIHGLQFLNLSW  413

Query  885   NRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVD  1064
             N  SG       +  L  L+ LD+S N L+GS+P       +L EL+L  N  +G IP  
Sbjct  414   NSLSGS--MPASLGELKSLQVLDLSGNRLNGSIPPEIGEAVSLNELNLHKNSLTGGIPTQ  471

Query  1065  LGLCPHLSRLDLSENLFTGTIPES  1136
             +G C  L+ L LS+N  TG +P +
Sbjct  472   IGNCSSLASLILSQNNLTGPVPST  495



>ref|XP_002520879.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF41588.1| ATP binding protein, putative [Ricinus communis]
Length=963

 Score =   221 bits (563),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/268 (45%), Positives = 169/268 (63%), Gaps = 26/268 (10%)
 Frame = +3

Query  342   GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  521
             G+ +  LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P + RV+E+ L  
Sbjct  22    GSLTPSLNDDVLGLIVFKADLQDPKGKLSSWNQDDDTPCNWVGVKCNPRSNRVTELTLDD  81

Query  522   LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG  701
               LSG+IGRGL +L+ L+ LSLA NN SG ISP                        +L 
Sbjct  82    FSLSGRIGRGLLQLQFLHKLSLARNNLSGNISP------------------------NLA  117

Query  702   NMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLS  881
              +++L+ +DLS NSLSGP+ D   +  GSLR +SLA + F G IP+SL  C  L  ++LS
Sbjct  118   RLANLRIIDLSENSLSGPIPDDFFQQCGSLRVISLAKNKFSGKIPASLGSCATLASVDLS  177

Query  882   NNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             +N+FSG      GIWGL+ LR+LD+SNN L G +P G   L+NL+ ++L  N F+G +P 
Sbjct  178   SNQFSGS--LPPGIWGLSGLRSLDLSNNLLEGEIPKGIEVLNNLRGINLSKNQFTGIVPD  235

Query  1062  DLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              +G C  L  +DLS N  +G  PE++Q+
Sbjct  236   GIGSCLLLRSIDLSGNSLSGEFPETIQK  263


 Score = 99.4 bits (246),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 87/254 (34%), Positives = 126/254 (50%), Gaps = 42/254 (17%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL G  LSG+    ++KL   N +SL++N  +G +   +G +  L+TL++S N ISG +
Sbjct  246   IDLSGNSLSGEFPETIQKLSLCNFMSLSNNLLTGEVPNWIGEMKRLETLDISGNKISGQI  305

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPS---------  839
             P S+GN+ SL+ L+ S N LSG + +SM  N GSL  L L+ +S  G +P+         
Sbjct  306   PTSIGNLQSLKVLNFSSNDLSGSLPESM-ANCGSLLALDLSRNSMNGDLPAWVFSPGLEK  364

Query  840   ----------SLSKCTLLNHLNLSNNRFSGDPRFS----------------------GGI  923
                       S +    L  L+LS N FSG    S                      G I
Sbjct  365   VLHLDSKLGGSFNSVPKLQVLDLSENEFSGKIASSIGVLSSLQFLNLSGNSLEGPLPGTI  424

Query  924   WGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLS  1103
               L  L  LD+S N L+GS+P+      +LKEL L  N  SG+IP  +G C  L+ + LS
Sbjct  425   GDLKELDVLDLSGNSLNGSIPLEIGGAFSLKELRLERNLLSGQIPSSVGNCTSLTTMILS  484

Query  1104  ENLFTGTIPESLQR  1145
              N  TG IP ++ +
Sbjct  485   RNNLTGLIPAAIAK  498


 Score = 89.7 bits (221),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 75/249 (30%), Positives = 121/249 (49%), Gaps = 42/249 (17%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    L G+I +G+E L +L  ++L+ N F+G++   +G    L++++LS NS+SG  
Sbjct  198   LDLSNNLLEGEIPKGIEVLNNLRGINLSKNQFTGIVPDGIGSCLLLRSIDLSGNSLSGEF  257

Query  687   PDS------------------------LGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  794
             P++                        +G M  L+ LD+SGN +SG +  S + NL SL+
Sbjct  258   PETIQKLSLCNFMSLSNNLLTGEVPNWIGEMKRLETLDISGNKISGQIPTS-IGNLQSLK  316

Query  795   FLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG-----------------DPRFSGGI  923
              L+ + +   G +P S++ C  L  L+LS N  +G                 D +  G  
Sbjct  317   VLNFSSNDLSGSLPESMANCGSLLALDLSRNSMNGDLPAWVFSPGLEKVLHLDSKLGGSF  376

Query  924   WGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLS  1103
               + +L+ LD+S NE SG +      L +L+ L+L  N   G +P  +G    L  LDLS
Sbjct  377   NSVPKLQVLDLSENEFSGKIASSIGVLSSLQFLNLSGNSLEGPLPGTIGDLKELDVLDLS  436

Query  1104  ENLFTGTIP  1130
              N   G+IP
Sbjct  437   GNSLNGSIP  445


 Score = 87.0 bits (214),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 102/182 (56%), Gaps = 7/182 (4%)
 Frame = +3

Query  522   LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG  701
             L L  K+G     +  L VL L+ N FSG I+  +G+L++LQ LNLS NS+ G +P ++G
Sbjct  366   LHLDSKLGGSFNSVPKLQVLDLSENEFSGKIASSIGVLSSLQFLNLSGNSLEGPLPGTIG  425

Query  702   NMSSLQFLDLSGNSLSGPVSDSMLENLG--SLRFLSLAGSSFEGPIPSSLSKCTLLNHLN  875
             ++  L  LDLSGNSL+G +    LE  G  SL+ L L  +   G IPSS+  CT L  + 
Sbjct  426   DLKELDVLDLSGNSLNGSIP---LEIGGAFSLKELRLERNLLSGQIPSSVGNCTSLTTMI  482

Query  876   LSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEI  1055
             LS N  +G       I  LT L+ +D+S N L+G LP   + L NL   ++  N   GE+
Sbjct  483   LSRNNLTG--LIPAAIAKLTSLKDVDLSFNSLTGGLPKQLANLPNLSSFNISHNQLQGEL  540

Query  1056  PV  1061
             P 
Sbjct  541   PA  542



>ref|XP_010931370.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=968

 Score =   221 bits (563),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 127/266 (48%), Positives = 163/266 (61%), Gaps = 26/266 (10%)
 Frame = +3

Query  345   AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  524
             A S  LNDDVLGLIVFK+ +QDPAS LA+W+EDDD PC W  VKC P   RV+E++L G 
Sbjct  19    ATSGALNDDVLGLIVFKADLQDPASKLASWNEDDDDPCGWTGVKCSPRTNRVTELNLDGF  78

Query  525   GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  704
              LSGKIGRGL +L+ L  LSL+ NNFSG ++P                        +L +
Sbjct  79    SLSGKIGRGLLQLQSLRKLSLSRNNFSGSLNP------------------------NLSH  114

Query  705   MSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSN  884
             + SL  +DLS N LSG + D       SLR +SLA + F G IP S+  C+ L  LNLS+
Sbjct  115   LESLWSVDLSENHLSGSIPDEFFRQCRSLRSVSLANNDFSGEIPLSVGSCSTLAALNLSS  174

Query  885   NRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVD  1064
             NR SG  R   G+W L  LR+LD+S N LSG +P+G S L+NL+ +S   N  SG +P D
Sbjct  175   NRLSG--RLPSGLWSLYGLRSLDLSGNSLSGDIPMGISRLYNLRAISFHGNRLSGRLPDD  232

Query  1065  LGLCPHLSRLDLSENLFTGTIPESLQ  1142
             +G C  L  LD S NL TG +PE+++
Sbjct  233   IGGCLLLKSLDSSGNLLTGNLPETMR  258


 Score = 94.0 bits (232),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 112/211 (53%), Gaps = 4/211 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +SEVD     L+G +   + +L  L  +S++ NN SG I   +     L+ L+LS N  S
Sbjct  335   LSEVDFSQNSLTGNLPTWIFEL-GLQSISISGNNMSGSIQIPISTDETLKVLDLSSNGFS  393

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G +P  + N+  LQFL+LS NSLSG +  S+ E+  S++ L L+G+   G IP  +    
Sbjct  394   GGIPVDIRNIHGLQFLNLSWNSLSGSIPTSIGES-KSMQVLDLSGNRLNGSIPPEIGGAV  452

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSN  1037
              LN L L  N  +G       I   + L +L +S N L+G +P   + L NL+ + L  N
Sbjct  453   SLNELRLQKNSLTGG--IPTQIANCSSLTSLILSQNNLTGPIPPTLANLTNLQTIDLSHN  510

Query  1038  HFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
               +G +P  L   PHL   ++S NLF+G +P
Sbjct  511   RLTGTLPKQLSNLPHLISFNISHNLFSGDLP  541


 Score = 89.7 bits (221),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 79/232 (34%), Positives = 118/232 (51%), Gaps = 22/232 (9%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL G  LSG I  G+ +L +L  +S   N  SG +   +G    L++L+ S N ++G +
Sbjct  194   LDLSGNSLSGDIPMGISRLYNLRAISFHGNRLSGRLPDDIGGCLLLKSLDSSGNLLTGNL  253

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P+++ N+S   +L L  NS SG V   + E + SL  L L+ + F G IP S+ K  L+ 
Sbjct  254   PETMRNLSMCSYLSLGSNSFSGEVPVWIGE-MKSLETLDLSSNGFSGQIPDSIGKLQLVK  312

Query  867   HLNLSNNRFSGD-PRFSGGIWGLTR--------------------LRTLDVSNNELSGSL  983
              L+ S+N  +G  P   G    L+                     L+++ +S N +SGS+
Sbjct  313   SLDFSHNGLTGSLPESIGACKSLSEVDFSQNSLTGNLPTWIFELGLQSISISGNNMSGSI  372

Query  984   PIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              I  S    LK L L SN FSG IPVD+     L  L+LS N  +G+IP S+
Sbjct  373   QIPISTDETLKVLDLSSNGFSGGIPVDIRNIHGLQFLNLSWNSLSGSIPTSI  424


 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 69/217 (32%), Positives = 114/217 (53%), Gaps = 10/217 (5%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             V  +D    GL+G +   +   + L+ +  + N+ +G + P       LQ++++S N++S
Sbjct  311   VKSLDFSHNGLTGSLPESIGACKSLSEVDFSQNSLTGNL-PTWIFELGLQSISISGNNMS  369

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSG--PVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSK  851
             G++   +    +L+ LDLS N  SG  PV    + N+  L+FL+L+ +S  G IP+S+ +
Sbjct  370   GSIQIPISTDETLKVLDLSSNGFSGGIPVD---IRNIHGLQFLNLSWNSLSGSIPTSIGE  426

Query  852   CTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSL  1028
                +  L+LS NR +G  P   GG   L  LR   +  N L+G +P   +   +L  L L
Sbjct  427   SKSMQVLDLSGNRLNGSIPPEIGGAVSLNELR---LQKNSLTGGIPTQIANCSSLTSLIL  483

Query  1029  GSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
               N+ +G IP  L    +L  +DLS N  TGT+P+ L
Sbjct  484   SQNNLTGPIPPTLANLTNLQTIDLSHNRLTGTLPKQL  520


 Score = 82.0 bits (201),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 72/217 (33%), Positives = 118/217 (54%), Gaps = 10/217 (5%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +  +D  G  L+G +   +  L   + LSL SN+FSG +   +G + +L+TL+LS N  S
Sbjct  239   LKSLDSSGNLLTGNLPETMRNLSMCSYLSLGSNSFSGEVPVWIGEMKSLETLDLSSNGFS  298

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLS---LAGSSFEGPIPSSLS  848
             G +PDS+G +  ++ LD S N L+G    S+ E++G+ + LS    + +S  G +P+ + 
Sbjct  299   GQIPDSIGKLQLVKSLDFSHNGLTG----SLPESIGACKSLSEVDFSQNSLTGNLPTWIF  354

Query  849   KCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSL  1028
             +  L   +++S N  SG  +    I     L+ LD+S+N  SG +P+    +H L+ L+L
Sbjct  355   ELGL-QSISISGNNMSGSIQIP--ISTDETLKVLDLSSNGFSGGIPVDIRNIHGLQFLNL  411

Query  1029  GSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
               N  SG IP  +G    +  LDLS N   G+IP  +
Sbjct  412   SWNSLSGSIPTSIGESKSMQVLDLSGNRLNGSIPPEI  448



>ref|XP_010922754.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=968

 Score =   221 bits (563),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 123/267 (46%), Positives = 164/267 (61%), Gaps = 26/267 (10%)
 Frame = +3

Query  345   AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  524
             A S  LNDDVLGLIVFK+ +QDP S L +W+EDD+ PC W  + C+P   RV+E++L G 
Sbjct  19    AMSGALNDDVLGLIVFKADLQDPTSKLTSWNEDDNDPCGWMGITCNPTTNRVTELNLDGF  78

Query  525   GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  704
              LSGKIGRGL +L+ L  LSL+ NNFSG ++P                        +L  
Sbjct  79    SLSGKIGRGLLQLQSLRKLSLSKNNFSGSLNP------------------------NLSR  114

Query  705   MSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSN  884
             + SL  +DLS N+LSG + D   +   SLR + LA ++F G IP  +  C+ L  LN+S+
Sbjct  115   LESLWTVDLSENNLSGSIPDEFFQQCRSLRTILLANNAFSGEIPPGVGSCSTLAELNISS  174

Query  885   NRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVD  1064
             NR SG  R   G+W L  LR+LD+S N LSG +P+G S L+NL+ + L  N  SG +P D
Sbjct  175   NRLSG--RLPSGLWSLYGLRSLDLSGNSLSGDIPMGISRLYNLRAIDLRGNRLSGGLPDD  232

Query  1065  LGLCPHLSRLDLSENLFTGTIPESLQR  1145
             +G C  L  LDLSENL TG +PE+LQ+
Sbjct  233   IGGCLLLKSLDLSENLLTGKLPETLQK  259


 Score = 96.7 bits (239),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 80/213 (38%), Positives = 116/213 (54%), Gaps = 4/213 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL G  LSG +   +     L  L L+ N  +G +   L  L+    L+L  NS SG V
Sbjct  218   IDLRGNRLSGGLPDDIGGCLLLKSLDLSENLLTGKLPETLQKLSICSYLSLGSNSFSGEV  277

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P  +G M SL+ L+LSGN  SG V DS + NL  ++ L  + ++F G +P S+  C  L 
Sbjct  278   PTWIGEMKSLETLNLSGNGFSGQVPDS-IGNLQVVKRLDFSQNNFTGSLPESIGICKSLL  336

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
              ++ S N   GD      I+ L  L+++ VS N++SGS+ I  +    LK L L +N FS
Sbjct  337   EVDFSQNSLIGD--LPTWIFELG-LQSISVSGNKMSGSIQIPITTDQTLKILDLSNNGFS  393

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             G IPVD+G    L  L+LS N  +G+IP S++ 
Sbjct  394   GRIPVDIGNIHGLQFLNLSWNSLSGSIPASVRE  426


 Score = 96.3 bits (238),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 101/187 (54%), Gaps = 3/187 (2%)
 Frame = +3

Query  570   LNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLS  749
             L  +S++ N  SG I   +     L+ L+LS N  SG +P  +GN+  LQFL+LS NSLS
Sbjct  358   LQSISVSGNKMSGSIQIPITTDQTLKILDLSNNGFSGRIPVDIGNIHGLQFLNLSWNSLS  417

Query  750   GPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWG  929
             G +  S+ E L SL+ L L G+   G IP  + +   LN LNL  N  +G       I  
Sbjct  418   GSIPASVRE-LKSLQVLDLNGNRLNGSIPLEIGEAVSLNELNLHKNSLTGG--IPTQIGN  474

Query  930   LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSEN  1109
              + L +L +S N L+G +P   + L NL+ + L  N  +G +P  L   PHL   ++S N
Sbjct  475   CSSLTSLILSQNNLTGPIPPTLANLTNLQTIDLSHNRLTGTLPKQLSNLPHLLSFNISHN  534

Query  1110  LFTGTIP  1130
             LF+G +P
Sbjct  535   LFSGDLP  541


 Score = 92.4 bits (228),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 82/227 (36%), Positives = 123/227 (54%), Gaps = 26/227 (11%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L+GK+   L+KL   + LSL SN+FSG +   +G + +L+TLNLS N  SG VPDS+GN+
Sbjct  249   LTGKLPETLQKLSICSYLSLGSNSFSGEVPTWIGEMKSLETLNLSGNGFSGQVPDSIGNL  308

Query  708   SSLQFLDLSGNSLSGP------VSDSMLE-----------------NLGSLRFLSLAGSS  818
               ++ LD S N+ +G       +  S+LE                  LG L+ +S++G+ 
Sbjct  309   QVVKRLDFSQNNFTGSLPESIGICKSLLEVDFSQNSLIGDLPTWIFELG-LQSISVSGNK  367

Query  819   FEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGAS  998
               G I   ++    L  L+LSNN FSG  R    I  +  L+ L++S N LSGS+P    
Sbjct  368   MSGSIQIPITTDQTLKILDLSNNGFSG--RIPVDIGNIHGLQFLNLSWNSLSGSIPASVR  425

Query  999   FLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              L +L+ L L  N  +G IP+++G    L+ L+L +N  TG IP  +
Sbjct  426   ELKSLQVLDLNGNRLNGSIPLEIGEAVSLNELNLHKNSLTGGIPTQI  472



>ref|XP_004240861.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=894

 Score =   220 bits (561),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 123/262 (47%), Positives = 162/262 (62%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFKS +QDP   L +W+E+DD+PC W+ + C+P + RV+EV L G GLSG+
Sbjct  26    LNDDVLGLIVFKSDIQDPYKKLKSWNEEDDTPCNWDGINCNPRSNRVTEVVLDGFGLSGR  85

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             I RGL +L+ L+ LSLA NN +G IS                         SL  ++ L+
Sbjct  86    ISRGLLRLQFLHRLSLAKNNLTGSISV------------------------SLAQLAYLK  121

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
             FLDLS N+LSG +     +  G LR +SLA +   G IP SLS C  L  LNLS+N+FSG
Sbjct  122   FLDLSENNLSGNIPGDYFQQCGPLRSISLANNKISGQIPESLSSCVTLASLNLSSNQFSG  181

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIW L  LR+LD+SNN L+G +P+    L NL+ LSLG N F GEIP ++G C 
Sbjct  182   --MVPSGIWSLNGLRSLDLSNNLLNGEIPVDIQGLSNLRALSLGRNKFMGEIPDEIGGCL  239

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLSEN  +G +P ++Q+
Sbjct  240   LLRSIDLSENSLSGELPSTMQK  261


 Score = 92.8 bits (229),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 73/193 (38%), Positives = 105/193 (54%), Gaps = 5/193 (3%)
 Frame = +3

Query  570   LNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLS  749
             L  + L+ N+ SG +   +  L+      L +N+  G VP+ +G M SLQ LDLS N+ S
Sbjct  241   LRSIDLSENSLSGELPSTMQKLSLCSEFILRRNAFVGIVPEWIGEMKSLQILDLSENNFS  300

Query  750   GPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PRFSGGIW  926
             G +  S+ E L SL+ L ++ +   G +P SLS C  L  L++S+N  +G  P+  G   
Sbjct  301   GHIPTSIGE-LESLKVLKVSRNRISGSLPESLSSCVKLLELDVSHNSLAGTIPKTVGQ--  357

Query  927   GLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSE  1106
              L  L  LD+S N L G +P+      +L ELSL  N  +GEIP  +G C  L  L LS 
Sbjct  358   -LKSLNILDLSENLLYGIVPVEIGGATSLMELSLDKNSLTGEIPSSVGYCSSLVSLSLSH  416

Query  1107  NLFTGTIPESLQR  1145
             N  TG +PE+L +
Sbjct  417   NSLTGPVPEALAK  429


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 114/212 (54%), Gaps = 3/212 (1%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             SE  L      G +   + +++ L +L L+ NNFSG I   +G L +L+ L +S+N ISG
Sbjct  266   SEFILRRNAFVGIVPEWIGEMKSLQILDLSENNFSGHIPTSIGELESLKVLKVSRNRISG  325

Query  681   TVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTL  860
             ++P+SL +   L  LD+S NSL+G +  ++ + L SL  L L+ +   G +P  +   T 
Sbjct  326   SLPESLSSCVKLLELDVSHNSLAGTIPKTVGQ-LKSLNILDLSENLLYGIVPVEIGGATS  384

Query  861   LNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNH  1040
             L  L+L  N  +G+   S G    + L +L +S+N L+G +P   + L  L+ + L  N 
Sbjct  385   LMELSLDKNSLTGEIPSSVGYC--SSLVSLSLSHNSLTGPVPEALAKLTYLQSVDLSFNK  442

Query  1041  FSGEIPVDLGLCPHLSRLDLSENLFTGTIPES  1136
              +G +P  LG   HLS  ++S N   G +P S
Sbjct  443   LTGVLPKQLGDLGHLSFFNISHNQLQGELPSS  474



>ref|XP_006290555.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
 gb|EOA23453.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
Length=939

 Score =   220 bits (561),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/262 (47%), Positives = 165/262 (63%), Gaps = 25/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ ++DP   LA+W+EDD +PC+W  VKCHP   RV+E++L G  LSG+
Sbjct  27    LNDDVLGLIVFKADLRDPQQKLASWNEDDYTPCSWTGVKCHPRTNRVTELNLDGFSLSGR  86

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +LE L+ LSL++NN +G+I+P                       + L ++ +L+
Sbjct  87    IGRGLLQLEFLHKLSLSNNNLTGIINP-----------------------NLLLSLVNLK  123

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N+LSG +SD      GSLR LSLA +   G IP S+S C+ L  LNLS+NRFSG
Sbjct  124   VVDLSSNALSGSLSDGFFRQCGSLRVLSLAKNKLTGKIPVSISSCSSLAALNLSSNRFSG  183

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIW L  LR+LD+S NEL G  P     L+NL+ L L  N  SG IP ++G C 
Sbjct  184   S--MPSGIWSLNTLRSLDLSWNELEGEFPEKIDRLNNLRSLDLSRNRLSGPIPSEIGSCM  241

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLS+N  +GT+P++ Q+
Sbjct  242   LLKTIDLSDNSLSGTLPDTFQQ  263


 Score = 91.7 bits (226),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 78/224 (35%), Positives = 112/224 (50%), Gaps = 16/224 (7%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    LSG I   +     L  + L+ N+ SG +      L+   +LNL KN++ G V
Sbjct  222   LDLSRNRLSGPIPSEIGSCMLLKTIDLSDNSLSGTLPDTFQQLSLCYSLNLGKNALEGEV  281

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P  +G M SL+ LDLS N  SG V +S + NL +L+ L+ +G+   G +P S + C  L 
Sbjct  282   PKWIGEMRSLETLDLSMNKFSGQVPES-IGNLLALKVLNFSGNGLIGSLPDSTANCINLL  340

Query  867   HLNLSNNRFSGD-PR--FSGG------------IWGLTRLRTLDVSNNELSGSLPIGASF  1001
              L+ S N  +G  P   F  G              G+ +++ LD+S+N  SG +  G   
Sbjct  341   ALDFSGNSLTGKLPMWIFQDGSRDVSALQNDNSTGGIKKIQVLDLSHNSFSGEIGAGLGD  400

Query  1002  LHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPE  1133
             L +L+ L L  N  +G IP  +G   HL  LDLS N   GTIP 
Sbjct  401   LRDLEGLHLSRNSLTGPIPSAIGDLKHLGVLDLSHNQLNGTIPR  444


 Score = 83.6 bits (205),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 111/229 (48%), Gaps = 22/229 (10%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL     SG++   +  L  L VL+ + N   G +        NL  L+ S NS++G +
Sbjct  294   LDLSMNKFSGQVPESIGNLLALKVLNFSGNGLIGSLPDSTANCINLLALDFSGNSLTGKL  353

Query  687   P-----------------DSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGS  815
             P                 +S G +  +Q LDLS NS SG +  + L +L  L  L L+ +
Sbjct  354   PMWIFQDGSRDVSALQNDNSTGGIKKIQVLDLSHNSFSGEIG-AGLGDLRDLEGLHLSRN  412

Query  816   SFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIG  992
             S  GPIPS++     L  L+LS+N+ +G  PR +GG   L  LR   + NN L G++P  
Sbjct  413   SLTGPIPSAIGDLKHLGVLDLSHNQLNGTIPRETGGAVSLEELR---LDNNLLEGNIPSS  469

Query  993   ASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
                  +L+ L L  N   G IP +L     L  +D+S N  TGT+P+ L
Sbjct  470   IKTCSSLRSLILSHNKLVGTIPPELAKLTKLEEVDISFNELTGTLPKQL  518


 Score = 80.9 bits (198),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 97/167 (58%), Gaps = 3/167 (2%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             ++ + VL L+ N+FSG I   LG L +L+ L+LS+NS++G +P ++G++  L  LDLS N
Sbjct  377   IKKIQVLDLSHNSFSGEIGAGLGDLRDLEGLHLSRNSLTGPIPSAIGDLKHLGVLDLSHN  436

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
              L+G +       + SL  L L  +  EG IPSS+  C+ L  L LS+N+  G       
Sbjct  437   QLNGTIPRETGGAV-SLEELRLDNNLLEGNIPSSIKTCSSLRSLILSHNKLVG--TIPPE  493

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             +  LT+L  +D+S NEL+G+LP   + L  L   ++  NH  GE+P 
Sbjct  494   LAKLTKLEEVDISFNELTGTLPKQLANLGYLHTFNMSHNHLFGELPA  540



>ref|XP_009372024.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=965

 Score =   220 bits (561),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 121/261 (46%), Positives = 164/261 (63%), Gaps = 26/261 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLIVFK+G+ DP + LA+WSEDD SPC W  VKC P  GRV+EV L G  LSG 
Sbjct  23    FNDDVLGLIVFKAGLSDPEAKLASWSEDDGSPCNWAGVKCDPTTGRVAEVVLDGFSLSGH  82

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L++L  LSL+ NNF+G I+P                         L ++ SL+
Sbjct  83    IGRGLLRLQNLQKLSLSDNNFTGFINP------------------------DLPHLGSLR  118

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS NSLSG + +   +  GSLR +S AG++  G IP SLS C  L  +N S+N  SG
Sbjct  119   VIDLSRNSLSGSIPEEFFKQCGSLRVVSFAGNNLTGRIPESLSLCQTLVEVNFSSNWLSG  178

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
               +   GIW L  L+++D+S+N L G +P G   L++L+ ++LG N FSG++P ++G C 
Sbjct  179   --KLPPGIWYLRMLQSIDLSDNLLEGQVPEGMENLYDLRVINLGENRFSGQLPRNIGSCL  236

Query  1080  HLSRLDLSENLFTGTIPESLQ  1142
              L  LD S+NLF+G IP+S+Q
Sbjct  237   QLKLLDFSDNLFSGRIPDSIQ  257


 Score = 83.6 bits (205),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 119/240 (50%), Gaps = 29/240 (12%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             + + L G  L+G++   L  L++L +L ++ NN SG I   LG L  L+ LNLS+N  +G
Sbjct  263   TSLSLQGNFLAGQVPNWLGDLKNLVMLDVSGNNLSGEIPSSLGNLEVLEKLNLSRNGFTG  322

Query  681   TVPDSLGNMSSLQFLDLSGNSLSGPVSD---------------------------SMLEN  779
             ++PD+L N  +L  +D+S N L+G +                             SM  +
Sbjct  323   SLPDALANCINLLAIDVSHNLLAGKLPSWIFKLGLRSVLLSGNRLGGSEEYSSLASMAAS  382

Query  780   LGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVS  959
              G L+ L L+ ++F   +PS +   + L  LN+S N   G       I  L     LD+S
Sbjct  383   NGGLQVLDLSSNAFSDVLPSDIGVLSNLQFLNMSGNHLLG--WIPASIGKLKAAYVLDLS  440

Query  960   NNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +N LSGS+P       +LKEL L  N  +G++P ++  C  L+ L LS N  TG IP ++
Sbjct  441   DNWLSGSIPDEIGGAISLKELRLQKNFLTGKVPAEIVKCSSLTNLILSRNNLTGPIPTAI  500


 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 95/164 (58%), Gaps = 3/164 (2%)
 Frame = +3

Query  570   LNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLS  749
             L VL L+SN FS V+   +G+L+NLQ LN+S N + G +P S+G + +   LDLS N LS
Sbjct  386   LQVLDLSSNAFSDVLPSDIGVLSNLQFLNMSGNHLLGWIPASIGKLKAAYVLDLSDNWLS  445

Query  750   GPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWG  929
             G + D +   + SL+ L L  +   G +P+ + KC+ L +L LS N  +G       I  
Sbjct  446   GSIPDEIGGAI-SLKELRLQKNFLTGKVPAEIVKCSSLTNLILSRNNLTGP--IPTAIAN  502

Query  930   LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             LT L+ +D+S N+ SG +P   + L +L   ++  NH  GE+P+
Sbjct  503   LTNLQYVDLSLNKFSGGIPKELTNLSHLLYFNVSHNHLEGELPL  546


 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 94/172 (55%), Gaps = 3/172 (2%)
 Frame = +3

Query  486   ANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSK  665
             +NG +  +DL     S  +   +  L +L  L+++ N+  G I   +G L     L+LS 
Sbjct  382   SNGGLQVLDLSSNAFSDVLPSDIGVLSNLQFLNMSGNHLLGWIPASIGKLKAAYVLDLSD  441

Query  666   NSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSL  845
             N +SG++PD +G   SL+ L L  N L+G V   +++   SL  L L+ ++  GPIP+++
Sbjct  442   NWLSGSIPDEIGGAISLKELRLQKNFLTGKVPAEIVK-CSSLTNLILSRNNLTGPIPTAI  500

Query  846   SKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASF  1001
             +  T L +++LS N+FSG       +  L+ L   +VS+N L G LP+G  F
Sbjct  501   ANLTNLQYVDLSLNKFSGG--IPKELTNLSHLLYFNVSHNHLEGELPLGGFF  550



>ref|XP_006290556.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
 gb|EOA23454.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
Length=966

 Score =   220 bits (560),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 122/262 (47%), Positives = 165/262 (63%), Gaps = 25/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ ++DP   LA+W+EDD +PC+W  VKCHP   RV+E++L G  LSG+
Sbjct  27    LNDDVLGLIVFKADLRDPQQKLASWNEDDYTPCSWTGVKCHPRTNRVTELNLDGFSLSGR  86

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +LE L+ LSL++NN +G+I+P                       + L ++ +L+
Sbjct  87    IGRGLLQLEFLHKLSLSNNNLTGIINP-----------------------NLLLSLVNLK  123

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N+LSG +SD      GSLR LSLA +   G IP S+S C+ L  LNLS+NRFSG
Sbjct  124   VVDLSSNALSGSLSDGFFRQCGSLRVLSLAKNKLTGKIPVSISSCSSLAALNLSSNRFSG  183

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIW L  LR+LD+S NEL G  P     L+NL+ L L  N  SG IP ++G C 
Sbjct  184   S--MPSGIWSLNTLRSLDLSWNELEGEFPEKIDRLNNLRSLDLSRNRLSGPIPSEIGSCM  241

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLS+N  +GT+P++ Q+
Sbjct  242   LLKTIDLSDNSLSGTLPDTFQQ  263


 Score = 91.7 bits (226),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 78/224 (35%), Positives = 112/224 (50%), Gaps = 16/224 (7%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    LSG I   +     L  + L+ N+ SG +      L+   +LNL KN++ G V
Sbjct  222   LDLSRNRLSGPIPSEIGSCMLLKTIDLSDNSLSGTLPDTFQQLSLCYSLNLGKNALEGEV  281

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P  +G M SL+ LDLS N  SG V +S + NL +L+ L+ +G+   G +P S + C  L 
Sbjct  282   PKWIGEMRSLETLDLSMNKFSGQVPES-IGNLLALKVLNFSGNGLIGSLPDSTANCINLL  340

Query  867   HLNLSNNRFSGD-PR--FSGG------------IWGLTRLRTLDVSNNELSGSLPIGASF  1001
              L+ S N  +G  P   F  G              G+ +++ LD+S+N  SG +  G   
Sbjct  341   ALDFSGNSLTGKLPMWIFQDGSRDVSALQNDNSTGGIKKIQVLDLSHNSFSGEIGAGLGD  400

Query  1002  LHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPE  1133
             L +L+ L L  N  +G IP  +G   HL  LDLS N   GTIP 
Sbjct  401   LRDLEGLHLSRNSLTGPIPSAIGDLKHLGVLDLSHNQLNGTIPR  444


 Score = 83.6 bits (205),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 111/229 (48%), Gaps = 22/229 (10%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL     SG++   +  L  L VL+ + N   G +        NL  L+ S NS++G +
Sbjct  294   LDLSMNKFSGQVPESIGNLLALKVLNFSGNGLIGSLPDSTANCINLLALDFSGNSLTGKL  353

Query  687   P-----------------DSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGS  815
             P                 +S G +  +Q LDLS NS SG +  + L +L  L  L L+ +
Sbjct  354   PMWIFQDGSRDVSALQNDNSTGGIKKIQVLDLSHNSFSGEIG-AGLGDLRDLEGLHLSRN  412

Query  816   SFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIG  992
             S  GPIPS++     L  L+LS+N+ +G  PR +GG   L  LR   + NN L G++P  
Sbjct  413   SLTGPIPSAIGDLKHLGVLDLSHNQLNGTIPRETGGAVSLEELR---LDNNLLEGNIPSS  469

Query  993   ASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
                  +L+ L L  N   G IP +L     L  +D+S N  TGT+P+ L
Sbjct  470   IKTCSSLRSLILSHNKLVGTIPPELAKLTKLEEVDISFNELTGTLPKQL  518


 Score = 80.9 bits (198),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 97/167 (58%), Gaps = 3/167 (2%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             ++ + VL L+ N+FSG I   LG L +L+ L+LS+NS++G +P ++G++  L  LDLS N
Sbjct  377   IKKIQVLDLSHNSFSGEIGAGLGDLRDLEGLHLSRNSLTGPIPSAIGDLKHLGVLDLSHN  436

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
              L+G +       + SL  L L  +  EG IPSS+  C+ L  L LS+N+  G       
Sbjct  437   QLNGTIPRETGGAV-SLEELRLDNNLLEGNIPSSIKTCSSLRSLILSHNKLVG--TIPPE  493

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             +  LT+L  +D+S NEL+G+LP   + L  L   ++  NH  GE+P 
Sbjct  494   LAKLTKLEEVDISFNELTGTLPKQLANLGYLHTFNMSHNHLFGELPA  540



>ref|XP_008350571.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=485

 Score =   213 bits (543),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 120/260 (46%), Positives = 162/260 (62%), Gaps = 26/260 (10%)
 Frame = +3

Query  363   NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
             NDDVLGLIVFK+G+ DP + LA+WSEDD SPC W  VKC P  GRV+EV L G  LSG I
Sbjct  24    NDDVLGLIVFKAGLSDPEAKLASWSEDDGSPCNWAGVKCDPTTGRVAEVVLDGFSLSGHI  83

Query  543   GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  722
             GRGL +L++L  LSL+ NNF+G I+P                         L ++ SLQ 
Sbjct  84    GRGLLRLQNLKKLSLSDNNFTGFINP------------------------DLPHLGSLQV  119

Query  723   LDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD  902
             +DLS NSLSG + +   +  GSL  +S AG++  G IP SLS C  L  +N S+N  SG 
Sbjct  120   IDLSRNSLSGSIPEEFFKQCGSLGVVSFAGNNLTGRIPESLSLCQTLVEVNFSSNWLSG-  178

Query  903   PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPH  1082
              +   GIW L  L+++D+S+N L G +P G   L++L+ ++LG N FSG++P ++G C  
Sbjct  179   -KLPPGIWYLRMLQSIDLSDNLLEGEVPKGMENLYDLRVINLGKNRFSGQLPGNIGSCLK  237

Query  1083  LSRLDLSENLFTGTIPESLQ  1142
             L  LD S NLF+G IP+S++
Sbjct  238   LKLLDFSGNLFSGRIPDSIR  257


 Score = 80.1 bits (196),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 120/268 (45%), Gaps = 63/268 (24%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +  +DL    L G++ +G+E L  L V++L  N FSG +   +G    L+ L+ S N  S
Sbjct  190   LQSIDLSDNLLEGEVPKGMENLYDLRVINLGKNRFSGQLPGNIGSCLKLKLLDFSGNLFS  249

Query  678   GTVPDS------------------------LGNMSSLQFLDLSGNSLSGPVSDSMLENLG  785
             G +PDS                        LG++ +L  LD+SGN+LSG +  S L NL 
Sbjct  250   GRIPDSIRSLDSCTSLSLQGNFLAGQVPNWLGDLKNLVMLDVSGNNLSGEIPSS-LGNLE  308

Query  786   SLRFLSLAGSSFEGPIPSSLSKCTLLNHLN-----------------------LSNNRFS  896
              L  L+L+ + F G +P +L+ C  L  ++                       LS NR  
Sbjct  309   VLEKLNLSRNGFTGSLPDALANCINLLAIDVSHNLLAGKLPLWIFKLGLRSVLLSGNRLG  368

Query  897   GDPRFS---------GGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSG  1049
             G   +S         GG      L+ LD+S+N  S  LP     L +L+ L++  NH  G
Sbjct  369   GSDEYSSLASMAASNGG------LQVLDLSSNAFSDVLPSDIGVLSSLQFLNMSGNHLLG  422

Query  1050  EIPVDLGLCPHLSRLDLSENLFTGTIPE  1133
              IP  +G       LDLS+N   G+IP+
Sbjct  423   WIPASIGELXAAYVLDLSDNWLNGSIPD  450


 Score = 70.9 bits (172),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 71/225 (32%), Positives = 112/225 (50%), Gaps = 29/225 (13%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             + + L G  L+G++   L  L++L +L ++ NN SG I   LG L  L+ LNLS+N  +G
Sbjct  263   TSLSLQGNFLAGQVPNWLGDLKNLVMLDVSGNNLSGEIPSSLGNLEVLEKLNLSRNGFTG  322

Query  681   TVPDSLGNMSSLQFLDLSGNSLSGPV---------------------SD------SMLEN  779
             ++PD+L N  +L  +D+S N L+G +                     SD      SM  +
Sbjct  323   SLPDALANCINLLAIDVSHNLLAGKLPLWIFKLGLRSVLLSGNRLGGSDEYSSLASMAAS  382

Query  780   LGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVS  959
              G L+ L L+ ++F   +PS +   + L  LN+S N   G       I  L     LD+S
Sbjct  383   NGGLQVLDLSSNAFSDVLPSDIGVLSSLQFLNMSGNHLLG--WIPASIGELXAAYVLDLS  440

Query  960   NNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRL  1094
             +N L+GS+P       +LKEL L  N  +G++P ++  C  L+ L
Sbjct  441   DNWLNGSIPDEXGGAVSLKELRLQKNXLTGKVPAEIVKCSSLTNL  485



>ref|XP_004241084.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=971

 Score =   219 bits (559),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 118/266 (44%), Positives = 163/266 (61%), Gaps = 26/266 (10%)
 Frame = +3

Query  345   AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  524
             A +L  NDD+LGL+VFK+ VQDP   L +W+E+DDSPC W+ + C+P + RVS++ L G 
Sbjct  23    ALNLSFNDDILGLMVFKADVQDPQGKLVSWNEEDDSPCGWDGIHCNPRSNRVSQIVLDGF  82

Query  525   GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  704
             GLSGKI RGL +L+ L  LSLA NNF+G IS                         S+  
Sbjct  83    GLSGKISRGLMRLQFLRKLSLAKNNFTGSIS------------------------SSVVQ  118

Query  705   MSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSN  884
             ++ L+ LDLS N+L G +     E  G LR +SLA + F G +P SL+ C  L  LNLS+
Sbjct  119   LAYLRILDLSENNLFGTIPGDFFEQCGPLRSISLAKNKFSGKVPESLNSCVALGSLNLSS  178

Query  885   NRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVD  1064
             N+FSG      GIW L  LR+LD+S+N L G +P+G   ++NL+ ++L  NH  GE+P  
Sbjct  179   NQFSG--LLPSGIWSLNGLRSLDLSDNLLDGEIPVGIEGMYNLRAINLRKNHLKGEVPDG  236

Query  1065  LGLCPHLSRLDLSENLFTGTIPESLQ  1142
             +G C  L  +DLSEN FTG +P+++Q
Sbjct  237   IGSCLLLRSIDLSENYFTGELPKTMQ  262


 Score = 81.3 bits (199),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 71/214 (33%), Positives = 114/214 (53%), Gaps = 5/214 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL     +G++ + ++ L   N L L  N   G +   +G + +L+ L+LS N+ SG +
Sbjct  246   IDLSENYFTGELPKTMQMLSLCNELILKHNALVGTVPEWIGEMKSLEMLDLSGNNFSGQL  305

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P+S G + SL+ L++S N +SG +  SM  +  +L  L ++ +S  G +P  + K  L  
Sbjct  306   PNSAGKLQSLKLLNVSRNGISGDLPKSM-SSCVNLMALDVSHNSLTGDLPPWVFKLGLRQ  364

Query  867   HLNLSNNRFSGDPR--FSGGI-WGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSN  1037
              L  S N+ SG  +  F+  +     +L  LD+S NEL+G +P+     H+L+ L+L  N
Sbjct  365   VL-FSENKLSGGLKNAFASSLDNSRQKLLALDISRNELAGEIPLAIGDFHSLQSLNLSRN  423

Query  1038  HFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
                G IP  +G    L  LDLSEN   G+IP  L
Sbjct  424   SLVGNIPETVGHLKSLDVLDLSENQLNGSIPLEL  457


 Score = 78.2 bits (191),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 77/243 (32%), Positives = 120/243 (49%), Gaps = 31/243 (13%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             +E+ L    L G +   + +++ L +L L+ NNFSG +    G L +L+ LN+S+N ISG
Sbjct  268   NELILKHNALVGTVPEWIGEMKSLEMLDLSGNNFSGQLPNSAGKLQSLKLLNVSRNGISG  327

Query  681   TVPDSLGNMSSLQFLDLSGNSLSGPV---------------------------SDSMLEN  779
              +P S+ +  +L  LD+S NSL+G +                           + S+  +
Sbjct  328   DLPKSMSSCVNLMALDVSHNSLTGDLPPWVFKLGLRQVLFSENKLSGGLKNAFASSLDNS  387

Query  780   LGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDV  956
                L  L ++ +   G IP ++     L  LNLS N   G+ P   G    L  L  LD+
Sbjct  388   RQKLLALDISRNELAGEIPLAIGDFHSLQSLNLSRNSLVGNIPETVGH---LKSLDVLDL  444

Query  957   SNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPES  1136
             S N+L+GS+P+     ++L+EL L  N  +GEIP  +G C  L  L LS N  TG +P +
Sbjct  445   SENQLNGSIPLELGGAYSLRELKLEKNALTGEIPTSIGNCSALLSLSLSHNGLTGPLPAT  504

Query  1137  LQR  1145
             L +
Sbjct  505   LAK  507


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 96/170 (56%), Gaps = 4/170 (2%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L+G+I   +     L  L+L+ N+  G I   +G L +L  L+LS+N ++G++P  LG  
Sbjct  401   LAGEIPLAIGDFHSLQSLNLSRNSLVGNIPETVGHLKSLDVLDLSENQLNGSIPLELGGA  460

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
              SL+ L L  N+L+G +  S + N  +L  LSL+ +   GP+P++L+K + L +++LS N
Sbjct  461   YSLRELKLEKNALTGEIPTS-IGNCSALLSLSLSHNGLTGPLPATLAKLSKLQNVDLSFN  519

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSN  1037
             + +G       +  L  L   ++S+N+L G LP G  F + +   S+ +N
Sbjct  520   KLTG--ILPKQLVNLGHLELFNISHNQLKGELPSGG-FFNTISPYSVSAN  566



>ref|XP_006358746.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=894

 Score =   219 bits (558),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 123/262 (47%), Positives = 162/262 (62%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFKS VQDP   L +W+E+DDSPC W+ + C+P + RV+EV L G GLSG+
Sbjct  26    LNDDVLGLIVFKSDVQDPYGKLKSWNEEDDSPCNWDGINCNPRSNRVTEVVLDGFGLSGR  85

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             I RGL +L+ L+ LSLA NN +G IS                         SL  ++ L+
Sbjct  86    ISRGLLRLQFLHRLSLAKNNLTGSISV------------------------SLAQLAYLK  121

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
             FLDLS N+LSG +     +  G LR +SLA +   G IP SLS C  L  LN+S+N+FSG
Sbjct  122   FLDLSENNLSGNIPGDYFQQCGPLRSISLANNKISGQIPESLSSCVTLASLNVSSNQFSG  181

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIW L  LR+LD+SNN L G +P+    L NL+ L+LG N+F GEIP ++G C 
Sbjct  182   --LVPSGIWSLNGLRSLDLSNNLLDGEIPVDIQGLSNLRALNLGRNNFKGEIPDEIGGCL  239

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLSEN  +G +P ++Q+
Sbjct  240   LLRSIDLSENSLSGELPSTMQK  261


 Score = 96.3 bits (238),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 84/238 (35%), Positives = 124/238 (52%), Gaps = 29/238 (12%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    L G+I   ++ L +L  L+L  NNF G I  ++G    L++++LS+NS+SG +
Sbjct  196   LDLSNNLLDGEIPVDIQGLSNLRALNLGRNNFKGEIPDEIGGCLLLRSIDLSENSLSGEL  255

Query  687   PDSL------------------------GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  794
             P ++                        G M SLQ LD+S N+ SG +  S+ E L SL+
Sbjct  256   PSTMQKLSLCSEFILRRNAFVGIVPKWIGEMKSLQILDVSENNFSGIIPTSIGE-LESLK  314

Query  795   FLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNEL  971
              L ++ +   G +P SLS C  L  L++S+N  +G  P+  G    L  L  LD+S N L
Sbjct  315   VLKVSRNGISGSLPESLSSCVKLLELDVSHNSLAGTIPKTVGQ---LKSLNILDLSENRL  371

Query  972   SGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              G +P+      +L ELSL  N  +GEIP  +G C  L  L LS N  TG +PE+L +
Sbjct  372   YGIVPVEIGGAKSLMELSLEKNSLTGEIPSSIGYCSSLVSLSLSHNGLTGPVPEALAK  429


 Score = 77.8 bits (190),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 67/210 (32%), Positives = 113/210 (54%), Gaps = 3/210 (1%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             SE  L      G + + + +++ L +L ++ NNFSG+I   +G L +L+ L +S+N ISG
Sbjct  266   SEFILRRNAFVGIVPKWIGEMKSLQILDVSENNFSGIIPTSIGELESLKVLKVSRNGISG  325

Query  681   TVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTL  860
             ++P+SL +   L  LD+S NSL+G +  ++ + L SL  L L+ +   G +P  +     
Sbjct  326   SLPESLSSCVKLLELDVSHNSLAGTIPKTVGQ-LKSLNILDLSENRLYGIVPVEIGGAKS  384

Query  861   LNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNH  1040
             L  L+L  N  +G+      I   + L +L +S+N L+G +P   + L  L+ + L  N 
Sbjct  385   LMELSLEKNSLTGE--IPSSIGYCSSLVSLSLSHNGLTGPVPEALAKLTYLQSVDLSFNK  442

Query  1041  FSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
              +G +P  LG   HLS  ++S N   G +P
Sbjct  443   LTGVLPKQLGDLGHLSLFNISHNQLQGELP  472


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 80/136 (59%), Gaps = 1/136 (1%)
 Frame = +3

Query  495  RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
            ++ E+D+    L+G I + + +L+ LN+L L+ N   G++  ++G   +L  L+L KNS+
Sbjct  336  KLLELDVSHNSLAGTIPKTVGQLKSLNILDLSENRLYGIVPVEIGGAKSLMELSLEKNSL  395

Query  675  SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
            +G +P S+G  SSL  L LS N L+GPV ++ L  L  L+ + L+ +   G +P  L   
Sbjct  396  TGEIPSSIGYCSSLVSLSLSHNGLTGPVPEA-LAKLTYLQSVDLSFNKLTGVLPKQLGDL  454

Query  855  TLLNHLNLSNNRFSGD  902
              L+  N+S+N+  G+
Sbjct  455  GHLSLFNISHNQLQGE  470



>ref|XP_011002596.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score =   219 bits (558),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 123/262 (47%), Positives = 164/262 (63%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             +NDDVLGLIVFK+G+QDP S L++W+EDDDSPC W  VKC P   RV+E+ L G  LSG 
Sbjct  23    INDDVLGLIVFKAGLQDPESKLSSWNEDDDSPCNWVGVKCDPNTHRVTELVLDGFSLSGH  82

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L VLSLA+NNF+G I+P                         L  +  LQ
Sbjct  83    IGRGLLRLQFLQVLSLANNNFNGTINP------------------------DLPRLGGLQ  118

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS NSLSG + D   +  GSLR +S A +   G IP SLS CT L+ +N S+N  SG
Sbjct  119   VIDLSENSLSGSIPDGFFQQCGSLRSVSFARNDLTGMIPGSLSFCTSLSVVNFSSNGLSG  178

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
             +     G+W L  +++LD+S+N L G +P G + L+ L+ ++L  N F+G++PVD+G C 
Sbjct  179   E--LPSGLWYLRGIQSLDLSDNLLEGEIPEGIANLYALRAINLRRNRFTGQLPVDIGGCQ  236

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LD SEN  +G +PESLQR
Sbjct  237   VLKLLDFSENALSGGLPESLQR  258


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 78/240 (33%), Positives = 118/240 (49%), Gaps = 29/240 (12%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             + V L G   +G++   + +L  L  L L+ N FSG I   +G L  L+ LNLS N ++G
Sbjct  263   ATVRLGGNSFTGEVPGWIGQLTSLESLDLSVNRFSGRIPVSIGNLNVLKELNLSMNQLAG  322

Query  681   TVPDSLGNMSSLQFLDLSGNSLSG---------------------------PVSDSMLEN  779
              +P+S+ N   L  +D+S N L+G                           P   S+  +
Sbjct  323   GLPESMENCVDLLAIDVSHNRLTGNLPSWIFKTGLKSVSLSGNKLDESIEHPSGVSLAAS  382

Query  780   LGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVS  959
             L SL+ L L+ + F G IPS +   + L   N+S N+  G    S G   LT ++ LD+S
Sbjct  383   LQSLQVLDLSSNVFSGEIPSDIGVLSSLQLFNVSRNQLFGSIPPSVG--ELTMIQALDLS  440

Query  960   NNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +N L+GS+P       +LKEL L  N  SG+IP  +  C  L+ L +S N  +G IP ++
Sbjct  441   DNRLTGSIPSEIGGAVSLKELRLEMNFLSGKIPTLIKKCSSLTSLIISGNNLSGPIPVAI  500


 Score = 75.9 bits (185),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 99/190 (52%), Gaps = 27/190 (14%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             L+ L VL L+SN FSG I   +G+L++LQ  N+S+N + G++P S+G ++ +Q LDLS N
Sbjct  383   LQSLQVLDLSSNVFSGEIPSDIGVLSSLQLFNVSRNQLFGSIPPSVGELTMIQALDLSDN  442

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
              L+G +  S +    SL+ L L  +   G IP+ + KC+                     
Sbjct  443   RLTGSIP-SEIGGAVSLKELRLEMNFLSGKIPTLIKKCS---------------------  480

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDL  1100
                   L +L +S N LSG +P+  + L NL+ + L  N FSG +P +L    HL   ++
Sbjct  481   -----SLTSLIISGNNLSGPIPVAIANLTNLQYVDLSFNRFSGSLPKELVNLSHLLSFNI  535

Query  1101  SENLFTGTIP  1130
             S N   G +P
Sbjct  536   SHNNLKGDLP  545



>ref|XP_002267737.3| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=993

 Score =   219 bits (558),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 125/262 (48%), Positives = 164/262 (63%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLIVFK+G+QDP S L +W+EDD++PC W  VKC     RVSE+ L    LSG+
Sbjct  50    FNDDVLGLIVFKAGLQDPESKLISWNEDDNNPCNWAGVKCDRQTNRVSELLLDNFSLSGR  109

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L +LSL+ NNF+G I+P                        SL  ++SL+
Sbjct  110   IGRGLLRLQFLRILSLSKNNFTGTINP------------------------SLARIASLR  145

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N+LSGP+ D      GSL  +SLAG+   G IP +LS C  L  +N S+N+ SG
Sbjct  146   VIDLSENNLSGPIPDEFFRQCGSLIVVSLAGNKLSGQIPDTLSLCKTLRGVNFSSNQLSG  205

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
               +   GIW L  LR+LD+SNN L G +P G   L++L+ ++LG N FSG IP  +G C 
Sbjct  206   --QLPDGIWSLYGLRSLDLSNNFLEGEIPEGIGSLYSLRAINLGKNKFSGRIPDSIGSCL  263

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LDLSENLF+G +PES+QR
Sbjct  264   LLRLLDLSENLFSGGLPESMQR  285


 Score = 83.2 bits (204),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 78/238 (33%), Positives = 120/238 (50%), Gaps = 29/238 (12%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             + L G  L+G++   +  + +L  L L++N FSG I   +G L  L+ LNLS N   G++
Sbjct  292   LSLRGNLLTGEVPAWIWGMRNLGTLDLSANVFSGQIPNSIGNLLLLKELNLSSNQFGGSL  351

Query  687   PDSL-----------------GNMSS------LQFLDLSGNSLSGPVSDSMLENLGS---  788
             P+S+                 GN+ +      LQ + L+GN L+G V  S L ++ +   
Sbjct  352   PESMTKCTNLVAMDVSHNLLTGNLPAWIFSLGLQTISLAGNKLNGSVEYSPLTSMAASYQ  411

Query  789   -LRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNN  965
              L+ L L+ ++  G I S ++  + L  LN+S N   G       I  L  L  LD+SNN
Sbjct  412   RLQVLDLSSNALSGEILSGIAAFSSLQFLNMSRNSLIGS--IPESIGELKTLHVLDLSNN  469

Query  966   ELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +L+GS+P        LKEL L  N  +G+IP  +  C  L+ L LS+N  TG IP ++
Sbjct  470   QLNGSIPFEIRGAVLLKELKLEKNFLTGKIPTQIEKCKSLTSLILSQNHLTGPIPAAI  527


 Score = 80.9 bits (198),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 93/167 (56%), Gaps = 7/167 (4%)
 Frame = +3

Query  564   EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNS  743
             + L VL L+SN  SG I   +   ++LQ LN+S+NS+ G++P+S+G + +L  LDLS N 
Sbjct  411   QRLQVLDLSSNALSGEILSGIAAFSSLQFLNMSRNSLIGSIPESIGELKTLHVLDLSNNQ  470

Query  744   LSGPVSDSMLENLGS--LRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSG  917
             L+G +     E  G+  L+ L L  +   G IP+ + KC  L  L LS N  +G      
Sbjct  471   LNGSIP---FEIRGAVLLKELKLEKNFLTGKIPTQIEKCKSLTSLILSQNHLTGP--IPA  525

Query  918   GIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
              I  LT +  +D+S N LSGSLP   + L +L   ++  N+  GE+P
Sbjct  526   AIANLTSIENVDLSFNNLSGSLPKELTNLSHLLSFNISHNNIQGELP  572


 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 90/163 (55%), Gaps = 8/163 (5%)
 Frame = +3

Query  666   NSISGTVPDS-LGNMSS----LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGP  830
             N ++G+V  S L +M++    LQ LDLS N+LSG +  S +    SL+FL+++ +S  G 
Sbjct  392   NKLNGSVEYSPLTSMAASYQRLQVLDLSSNALSGEIL-SGIAAFSSLQFLNMSRNSLIGS  450

Query  831   IPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHN  1010
             IP S+ +   L+ L+LSNN+ +G   F   I G   L+ L +  N L+G +P       +
Sbjct  451   IPESIGELKTLHVLDLSNNQLNGSIPFE--IRGAVLLKELKLEKNFLTGKIPTQIEKCKS  508

Query  1011  LKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             L  L L  NH +G IP  +     +  +DLS N  +G++P+ L
Sbjct  509   LTSLILSQNHLTGPIPAAIANLTSIENVDLSFNNLSGSLPKEL  551



>ref|XP_008233886.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Prunus mume]
Length=975

 Score =   219 bits (558),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 161/262 (61%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ +QDP   LATWSEDDDSPC W+ VKCHP + RV E+ L    LSG 
Sbjct  31    LNDDVLGLIVFKADIQDPKGKLATWSEDDDSPCKWDGVKCHPRSNRVIELSLDDFSLSGH  90

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             +GRGL +L+ L  LSL+ NN +G ++P                        ++ ++ +L+
Sbjct  91    VGRGLLQLQSLRKLSLSKNNLTGSLTP------------------------NIAHIDNLR  126

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              LDLS NS SGPV +      GSLR +SLA +   G IP SL  C  L  ++LS N+FSG
Sbjct  127   ALDLSENSFSGPVPEDFFRQCGSLRTISLAKNKISGKIPESLGSCASLAAIDLSLNQFSG  186

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIW L  +R+LD+SNN L G +P     L+NL+ ++LG N F+G++P  +G C 
Sbjct  187   S--VPVGIWSLNGIRSLDLSNNLLEGEIPKAIGGLNNLRAVNLGKNRFTGQVPDGIGSCL  244

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLSEN F+G +P+++Q+
Sbjct  245   LLRSIDLSENSFSGNLPQTMQK  266


 Score = 79.0 bits (193),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 77/242 (32%), Positives = 120/242 (50%), Gaps = 29/242 (12%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             S ++LH    +G+I   + +L+ L  L L+ N F G +   +G L  L+ LN S N  +G
Sbjct  271   SYLNLHQNSFAGEIPEWIGELKSLETLDLSGNRFLGEVPSSIGNLQALKVLNFSANGFTG  330

Query  681   TVPDSLGNMSSLQFLDLSGNSLSGP----VSDSMLENLGSLRFLSLAGSSFEGPIPSSLS  848
              +P S+   +SL  LD S NS++G     +  + LE + SL    L+GS+   P+ SS+ 
Sbjct  331   NLPKSMAYCTSLVALDFSKNSVAGELPAWIFKAGLEEV-SLSEKKLSGSA-NSPVSSSIG  388

Query  849   KCTL-LNHLNLSNNRFSGDPRFSGG----------------------IWGLTRLRTLDVS  959
                  L  ++LS N+FSG+     G                      I  L  L  +D+S
Sbjct  389   NAPQNLQVVDLSXNQFSGEIASDIGVLSSLLSLNLSGNSLVGPIPVTIGELKALDNVDLS  448

Query  960   NNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              N LSGS+P+      +LKEL L +N  +G+IP  +G C  L+ L  S+N  TG +P ++
Sbjct  449   ENRLSGSIPLEIGGAFSLKELRLENNLLTGKIPTSIGNCSSLTTLIASQNRLTGPVPAAM  508

Query  1140  QR  1145
              +
Sbjct  509   AK  510



>ref|XP_006357297.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=971

 Score =   219 bits (557),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 118/266 (44%), Positives = 163/266 (61%), Gaps = 26/266 (10%)
 Frame = +3

Query  345   AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  524
             A +L  NDD+LGL+VFK+ VQDP   L +W+E+DDSPC WN + C+P + RVS++ L G 
Sbjct  23    ALNLSFNDDILGLMVFKADVQDPQGKLVSWNEEDDSPCGWNGIHCNPRSNRVSQIVLDGF  82

Query  525   GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  704
             GLSGKI RGL +L+ L  LSLA NNF+G IS                         S+  
Sbjct  83    GLSGKISRGLMRLQFLRKLSLAKNNFTGSIS------------------------SSVVQ  118

Query  705   MSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSN  884
             ++ L+ LDLS N+L G +     E  G LR +SLA + F G +P SL+ C  L  LNLS+
Sbjct  119   LAYLRILDLSENNLFGTIPGDFFEQCGPLRSISLAKNKFSGKVPESLNSCVALGSLNLSS  178

Query  885   NRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVD  1064
             N+FSG      GIW L  LR+LD+S+N L G +P+G   ++NL+ ++L  NH  GE+P  
Sbjct  179   NQFSG--LLPSGIWSLNGLRSLDLSDNLLDGEIPVGIEGMYNLRAINLRKNHLKGEVPDG  236

Query  1065  LGLCPHLSRLDLSENLFTGTIPESLQ  1142
             +G C  L  +DLSEN F+G +P+++Q
Sbjct  237   IGSCLLLRSIDLSENSFSGELPKTMQ  262


 Score = 80.9 bits (198),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 73/234 (31%), Positives = 114/234 (49%), Gaps = 29/234 (12%)
 Frame = +3

Query  525   GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  704
              L G +   + +++ L +L L+ NNFSG     +G L +L+ LN+S+N+ISG  P S+ +
Sbjct  276   ALVGSVPEWIGEMKSLEMLDLSGNNFSGQFPNSVGKLQSLKLLNVSRNAISGDFPKSMSS  335

Query  705   MSSLQFLDLSGNSLSG---------------------------PVSDSMLENLGSLRFLS  803
               +L  LD+S NSL+G                            ++ S+  +   L  L 
Sbjct  336   CVNLMTLDVSHNSLTGDLPPWVFKLGLRHVLFSENKLSRGLKNAIASSLENSRQKLLVLD  395

Query  804   LAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSL  983
             ++ +   G IP ++     L  LNLS N   G  +    +  L  L  LD+S N+L+GS+
Sbjct  396   ISCNELAGEIPFAIGDFNSLQSLNLSRNSLVG--KIPETVGHLKSLDVLDLSENQLNGSI  453

Query  984   PIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             P+     + L+EL L  N  +GEIP  +G C  L  L LS N  TG +P +L +
Sbjct  454   PLELGGAYALRELKLEKNALTGEIPTSIGNCSALLSLSLSHNGLTGPVPATLAK  507



>ref|XP_008681357.1| PREDICTED: uncharacterized protein LOC100304322 isoform X1 [Zea 
mays]
 tpg|DAA45233.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=972

 Score =   218 bits (555),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 122/260 (47%), Positives = 154/260 (59%), Gaps = 26/260 (10%)
 Frame = +3

Query  366   DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  545
             DDVLGLIVFK+ V DP   LATWSEDD+ PCAW+ V C    GRVS + L G GLSGK+G
Sbjct  32    DDVLGLIVFKADVSDPDGRLATWSEDDERPCAWDGVTCDARTGRVSALSLAGFGLSGKLG  91

Query  546   RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFL  725
             RGL +LE L  LSLA NN                        +SG VP  L  + +LQ L
Sbjct  92    RGLLRLEALQSLSLARNN------------------------LSGDVPADLARLPALQTL  127

Query  726   DLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDP  905
             DLS N+ +G V + +     SLR +SLA ++F G IP  ++ C  L  LNLS+NR  G  
Sbjct  128   DLSANAFAGAVPEGLFGRCRSLRDVSLANNAFSGGIPRDVAACATLASLNLSSNRLDG--  185

Query  906   RFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHL  1085
                  IW L  LRTLD+S N ++G LPIG S + NL+EL+L  N  +G +P D+G CP L
Sbjct  186   ALPSDIWSLNALRTLDISGNAVTGDLPIGVSRMFNLRELNLRGNRLTGSLPDDIGDCPLL  245

Query  1086  SRLDLSENLFTGTIPESLQR  1145
               +DL  N  +G +PESL+R
Sbjct  246   RSVDLGSNSLSGNLPESLRR  265


 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 84/257 (33%), Positives = 118/257 (46%), Gaps = 49/257 (19%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             VDL    LSG +   L +L     L L+SN F+G +    G +T+L+ L+LS N +SG +
Sbjct  248   VDLGSNSLSGNLPESLRRLSTCTYLDLSSNEFTGSVPTWFGEMTSLEMLDLSGNRLSGEI  307

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDS---------------------------------  767
             P S+G + SL+ L LSGN  +G + +S                                 
Sbjct  308   PGSIGELMSLRELRLSGNGFTGALPESIGGCKSLMHVDVSWNSLTGALPTWVLSSSVQWV  367

Query  768   ------------MLENLGS-LRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPR  908
                         +  N  S L+ + L+ ++F G IPS +SK   L  LN+S N   G   
Sbjct  368   SVSQNTLSGDLKVPANASSVLQGVDLSNNAFSGVIPSEISKLQNLQSLNMSWNSMYGS--  425

Query  909   FSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLS  1088
                 I  +  L  LD + N L+G +P       +LKEL LG N  +G IP  +G C  L+
Sbjct  426   IPASILEMKSLEVLDFTANRLNGCIPASKGG-ESLKELRLGKNFLTGNIPAQIGNCSALA  484

Query  1089  RLDLSENLFTGTIPESL  1139
              LDLS N  TG IPE+L
Sbjct  485   SLDLSHNSLTGVIPEAL  501



>gb|KFK34877.1| Leucine-rich repeat protein kinase family protein [Arabis alpina]
Length=964

 Score =   218 bits (555),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 121/262 (46%), Positives = 161/262 (61%), Gaps = 25/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ ++DP   LA+WSEDD SPC+WN VKCHP   RV+E+ L G  LSG+
Sbjct  26    LNDDVLGLIVFKADLRDPEQKLASWSEDDYSPCSWNGVKCHPRTNRVTELTLDGFSLSGR  85

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L+ LS+++NN +G+I+P                       + L ++ +L+
Sbjct  86    IGRGLLQLQFLHKLSMSNNNLTGIINP-----------------------NLLLSLVNLK  122

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N LSG + D      GSLR  SLA +   G IP S+S C+ L  LNLS+NRFSG
Sbjct  123   VVDLSSNGLSGSLPDGFFRQCGSLRVFSLAKNELMGKIPVSISSCSSLAALNLSSNRFSG  182

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIW +  LR+LD+S NEL G  P     L+NL+ L L  N  SG IP ++G C 
Sbjct  183   SMPL--GIWSMNTLRSLDLSRNELEGEFPEKIDRLNNLRALDLSRNRLSGPIPSEIGSCL  240

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLSEN  +G +PE+ Q+
Sbjct  241   LLKSVDLSENSLSGNLPETFQQ  262


 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 79/248 (32%), Positives = 118/248 (48%), Gaps = 40/248 (16%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    L G+    +++L +L  L L+ N  SG I  ++G    L++++LS+NS+SG +
Sbjct  197   LDLSRNELEGEFPEKIDRLNNLRALDLSRNRLSGPIPSEIGSCLLLKSVDLSENSLSGNL  256

Query  687   PDS------------------------LGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  794
             P++                        +G M SL+ LDLS N  SG V  S + NL +L+
Sbjct  257   PETFQQLTLCYYLNLGENELEGEVPKWIGEMRSLETLDLSMNKFSGHVPGS-IGNLLALK  315

Query  795   FLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PR--FSGG------------IWG  929
              L+ +G+   G +P S + C  L  L+ S N   G  P   F  G              G
Sbjct  316   VLNFSGNGLIGSLPDSTANCINLLALDFSGNSLIGKLPSWIFQDGSHEVSALKNDNSTGG  375

Query  930   LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSEN  1109
             + +++ LD S N  SG +  G   L +L+ L+L  N  +G IP  +G    LS LDLS N
Sbjct  376   IKKIQVLDFSGNSFSGEIGAGLGDLRDLQGLNLSRNALTGSIPSTIGDLKRLSLLDLSHN  435

Query  1110  LFTGTIPE  1133
                GTIP 
Sbjct  436   QLNGTIPR  443


 Score = 80.5 bits (197),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 100/169 (59%), Gaps = 7/169 (4%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             ++ + VL  + N+FSG I   LG L +LQ LNLS+N+++G++P ++G++  L  LDLS N
Sbjct  376   IKKIQVLDFSGNSFSGEIGAGLGDLRDLQGLNLSRNALTGSIPSTIGDLKRLSLLDLSHN  435

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG--DPRFS  914
              L+G +       + SL  L L  +  +G IPSS+  C+ L  L LS+N+  G   P  +
Sbjct  436   QLNGTIPRETGGAV-SLEELRLENNGLQGNIPSSIKNCSSLRSLILSHNKLIGVIPPEMA  494

Query  915   GGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
                  LT L+ +D+S N+L+G+LP   + L  L+  ++  NH SGE+P 
Sbjct  495   K----LTNLQEVDLSFNDLNGTLPKPLANLGYLRTFNISHNHLSGELPA  539


 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 72/229 (31%), Positives = 111/229 (48%), Gaps = 22/229 (10%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL     SG +   +  L  L VL+ + N   G +        NL  L+ S NS+ G +
Sbjct  293   LDLSMNKFSGHVPGSIGNLLALKVLNFSGNGLIGSLPDSTANCINLLALDFSGNSLIGKL  352

Query  687   P-----------------DSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGS  815
             P                 +S G +  +Q LD SGNS SG +  + L +L  L+ L+L+ +
Sbjct  353   PSWIFQDGSHEVSALKNDNSTGGIKKIQVLDFSGNSFSGEIG-AGLGDLRDLQGLNLSRN  411

Query  816   SFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIG  992
             +  G IPS++     L+ L+LS+N+ +G  PR +GG   L  LR   + NN L G++P  
Sbjct  412   ALTGSIPSTIGDLKRLSLLDLSHNQLNGTIPRETGGAVSLEELR---LENNGLQGNIPSS  468

Query  993   ASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
                  +L+ L L  N   G IP ++    +L  +DLS N   GT+P+ L
Sbjct  469   IKNCSSLRSLILSHNKLIGVIPPEMAKLTNLQEVDLSFNDLNGTLPKPL  517



>ref|XP_004146470.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis sativus]
 gb|KGN50740.1| hypothetical protein Csa_5G222990 [Cucumis sativus]
Length=925

 Score =   217 bits (552),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 122/265 (46%), Positives = 163/265 (62%), Gaps = 26/265 (10%)
 Frame = +3

Query  351   SLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  530
             +L LN DVLGLIVFK+ VQDP   LA+W+EDDDSPC W  V+C P + RV E++L+G  L
Sbjct  28    NLSLNGDVLGLIVFKAAVQDPKLKLASWNEDDDSPCNWTGVQCSPRSKRVIELNLNGFSL  87

Query  531   SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  710
             SG++GRGL +LE L  LSL++NN +G ISP                        +   + 
Sbjct  88    SGRLGRGLFQLEFLQRLSLSNNNLTGNISP------------------------NFARVD  123

Query  711   SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNR  890
             +LQ +DLSGN+ SG VSD       SLR +SLA + F G IP SLS C  L  +N S+N+
Sbjct  124   NLQVIDLSGNNFSGVVSDDFFRQCRSLRVVSLANNKFSGKIPDSLSLCGSLISVNFSSNQ  183

Query  891   FSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLG  1070
             FSG      GIW  + LR+LD+S+N L G +P     L+NL+ L+L  N FSG IP  +G
Sbjct  184   FSGS--LPSGIWSFSGLRSLDLSDNALLGEIPKVIENLYNLRTLNLSKNQFSGHIPDGIG  241

Query  1071  LCPHLSRLDLSENLFTGTIPESLQR  1145
              C  L  +DLSEN F+G +P+++Q+
Sbjct  242   SCLLLRSIDLSENSFSGNLPQTMQK  266


 Score = 87.0 bits (214),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 81/258 (31%), Positives = 123/258 (48%), Gaps = 46/258 (18%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    L G+I + +E L +L  L+L+ N FSG I   +G    L++++LS+NS SG +
Sbjct  201   LDLSDNALLGEIPKVIENLYNLRTLNLSKNQFSGHIPDGIGSCLLLRSIDLSENSFSGNL  260

Query  687   PDSL------------------------GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  794
             P ++                        G M SL+ LD S N+ +G +  + +ENL  L+
Sbjct  261   PQTMQKLVLCSNLILGRNLFDGDVPEWVGEMKSLETLDFSRNNFTGRIP-TTIENLQYLK  319

Query  795   FLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PR----------------FSGG-  920
              L+L+ + F    P S+ KC  L  L+LS+N   G+ P                 F G  
Sbjct  320   VLNLSSNGFTDSFPESVMKCQSLLALDLSHNLIMGNLPEIGSLRKLQILSLSGNYFVGSL  379

Query  921   ---IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSR  1091
                I  L  L  LD+S N+L+ ++P+      +L EL L  N   GEIP  +  C  L+ 
Sbjct  380   PKTIGDLKALSILDLSGNQLNETIPVAIGGAVSLIELKLDGNFLRGEIPFSIAHCSSLTT  439

Query  1092  LDLSENLFTGTIPESLQR  1145
             L +S N  TG IP +L +
Sbjct  440   LFISHNNITGPIPAALAK  457


 Score = 70.9 bits (172),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 105/200 (53%), Gaps = 26/200 (13%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVIS-----------------------Pqlgllt  638
              +G+I   +E L++L VL+L+SN F+                           P++G L 
Sbjct  304   FTGRIPTTIENLQYLKVLNLSSNGFTDSFPESVMKCQSLLALDLSHNLIMGNLPEIGSLR  363

Query  639   nlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSS  818
              LQ L+LS N   G++P ++G++ +L  LDLSGN L+  +  ++   + SL  L L G+ 
Sbjct  364   KLQILSLSGNYFVGSLPKTIGDLKALSILDLSGNQLNETIPVAIGGAV-SLIELKLDGNF  422

Query  819   FEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGAS  998
               G IP S++ C+ L  L +S+N  +G       +  L+ L+ +D+S N L+G+LP   S
Sbjct  423   LRGEIPFSIAHCSSLTTLFISHNNITGP--IPAALAKLSYLQNVDLSFNNLNGTLPKQLS  480

Query  999   FLHNLKELSLGSNHFSGEIP  1058
              L NL   ++  N+F GE+P
Sbjct  481   NLPNLLVFNISHNNFKGELP  500



>ref|XP_002878081.1| hypothetical protein ARALYDRAFT_907079 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54340.1| hypothetical protein ARALYDRAFT_907079 [Arabidopsis lyrata subsp. 
lyrata]
Length=964

 Score =   217 bits (552),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 120/262 (46%), Positives = 163/262 (62%), Gaps = 25/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ ++DP   LA+W+EDD +PC+WN VKCHP   RV+E++L G  LSG+
Sbjct  25    LNDDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWNGVKCHPRTNRVTELNLDGFSLSGR  84

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L+ LSL++NN +G+I+P                       + L ++ +L+
Sbjct  85    IGRGLLQLQFLHKLSLSNNNLTGIINP-----------------------NLLLSLVNLK  121

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N LSG + D      GSLR LSLA +   G IP S+S C+ L  LNLS+N FSG
Sbjct  122   VVDLSSNGLSGSLPDGFFRQCGSLRVLSLAKNKLTGKIPVSISSCSSLAALNLSSNSFSG  181

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIW L  LR+LD+S NEL G  P     L+NL+ L L  N  SG IP ++G C 
Sbjct  182   SMPL--GIWSLNTLRSLDLSRNELEGEFPEKIDRLNNLRSLDLSRNRLSGTIPSEIGSCM  239

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLSEN  +G++P++ Q+
Sbjct  240   LLKTIDLSENSLSGSVPDTFQQ  261


 Score = 95.1 bits (235),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 80/248 (32%), Positives = 122/248 (49%), Gaps = 40/248 (16%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    L G+    +++L +L  L L+ N  SG I  ++G    L+T++LS+NS+SG+V
Sbjct  196   LDLSRNELEGEFPEKIDRLNNLRSLDLSRNRLSGTIPSEIGSCMLLKTIDLSENSLSGSV  255

Query  687   PDS------------------------LGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  794
             PD+                        +G M SL++LDLS N  SG V DS + NL +L+
Sbjct  256   PDTFQQLSLCYSLNLGKNGLEGEVPKWIGEMRSLEYLDLSMNKFSGHVPDS-IGNLLALK  314

Query  795   FLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDP---------------RFSGGIWG  929
              L+ +G+   G +P S + C  L  L+ S N  +G+                +      G
Sbjct  315   VLNFSGNGLIGSLPDSTANCINLLALDFSGNSLTGNLPMWIFQDDSRDVSAFKSDNSTGG  374

Query  930   LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSEN  1109
             + ++  LD+S+N  SG +  G   L +L+ L L  N  +G IP  +G   HL  LDLS N
Sbjct  375   IKKILVLDLSHNSFSGEIGAGLGDLRDLEALHLSRNSLTGHIPSTIGELKHLGVLDLSHN  434

Query  1110  LFTGTIPE  1133
               +GTIP 
Sbjct  435   ELSGTIPR  442


 Score = 81.6 bits (200),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 75/223 (34%), Positives = 109/223 (49%), Gaps = 18/223 (8%)
 Frame = +3

Query  525   GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  704
             GL G++ + + ++  L  L L+ N FSG +   +G L  L+ LN S N + G++PDS  N
Sbjct  274   GLEGEVPKWIGEMRSLEYLDLSMNKFSGHVPDSIGNLLALKVLNFSGNGLIGSLPDSTAN  333

Query  705   MSSLQFLDLSGNSLSGPV----------------SDSMLENLGSLRFLSLAGSSFEGPIP  836
               +L  LD SGNSL+G +                SD+    +  +  L L+ +SF G I 
Sbjct  334   CINLLALDFSGNSLTGNLPMWIFQDDSRDVSAFKSDNSTGGIKKILVLDLSHNSFSGEIG  393

Query  837   SSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLK  1016
             + L     L  L+LS N  +G       I  L  L  LD+S+NELSG++P       +L+
Sbjct  394   AGLGDLRDLEALHLSRNSLTG--HIPSTIGELKHLGVLDLSHNELSGTIPRETGGAVSLE  451

Query  1017  ELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              L L +N   G IP  +  C  L  L LS N   G+IP  L +
Sbjct  452   GLRLENNLLEGNIPSSIKNCSSLRSLILSHNKLIGSIPPELAK  494


 Score = 80.1 bits (196),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 97/167 (58%), Gaps = 3/167 (2%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             ++ + VL L+ N+FSG I   LG L +L+ L+LS+NS++G +P ++G +  L  LDLS N
Sbjct  375   IKKILVLDLSHNSFSGEIGAGLGDLRDLEALHLSRNSLTGHIPSTIGELKHLGVLDLSHN  434

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
              LSG +       + SL  L L  +  EG IPSS+  C+ L  L LS+N+  G       
Sbjct  435   ELSGTIPRETGGAV-SLEGLRLENNLLEGNIPSSIKNCSSLRSLILSHNKLIGS--IPPE  491

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             +  LT+L  +D+S NEL+G+LP   + L  L+  ++  NH  GE+P 
Sbjct  492   LAKLTKLEEVDLSFNELTGTLPKQLANLGYLQTFNISHNHLFGELPA  538


 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 70/196 (36%), Positives = 99/196 (51%), Gaps = 5/196 (3%)
 Frame = +3

Query  420   HLATWSEDDDSPCAWNFVKCHPANG--RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLAS  593
             +L  W   DDS     F   +   G  ++  +DL     SG+IG GL  L  L  L L+ 
Sbjct  350   NLPMWIFQDDSRDVSAFKSDNSTGGIKKILVLDLSHNSFSGEIGAGLGDLRDLEALHLSR  409

Query  594   NNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSML  773
             N+ +G I   +G L +L  L+LS N +SGT+P   G   SL+ L L  N L G +  S +
Sbjct  410   NSLTGHIPSTIGELKHLGVLDLSHNELSGTIPRETGGAVSLEGLRLENNLLEGNIPSS-I  468

Query  774   ENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLD  953
             +N  SLR L L+ +   G IP  L+K T L  ++LS N  +G       +  L  L+T +
Sbjct  469   KNCSSLRSLILSHNKLIGSIPPELAKLTKLEEVDLSFNELTG--TLPKQLANLGYLQTFN  526

Query  954   VSNNELSGSLPIGASF  1001
             +S+N L G LP G  F
Sbjct  527   ISHNHLFGELPAGGIF  542



>ref|XP_010253073.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=970

 Score =   216 bits (551),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 117/262 (45%), Positives = 162/262 (62%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ +QDP S L +W+EDDDSPC W  VKC P   RVSE+ L G  LSG+
Sbjct  25    LNDDVLGLIVFKADLQDPDSKLISWNEDDDSPCNWVGVKCDPKTNRVSELVLEGFSLSGR  84

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRG+ +L+ L  LSL++NNF+G I+P                        +L  +  L+
Sbjct  85    IGRGVLQLKFLRKLSLSNNNFTGTINP------------------------NLARLEGLR  120

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N LSGP+ D      GSLR +S A ++  G IP +L  C+ L  LN S+N+ SG
Sbjct  121   VIDLSDNRLSGPIPDDFFRQCGSLREMSFARNNLSGQIPQNLGSCSTLATLNFSSNQLSG  180

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIW L  LR+LD+S+N L G +P G + L+NL+ ++L  N FSG++P D+G C 
Sbjct  181   P--LPSGIWSLNGLRSLDLSDNLLEGVIPKGMAGLYNLRSINLQKNRFSGQLPDDIGGCS  238

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +D SEN  +G++P+S+++
Sbjct  239   LLKLIDFSENSLSGSLPDSMRK  260


 Score = 88.6 bits (218),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 77/221 (35%), Positives = 115/221 (52%), Gaps = 19/221 (9%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +D     LSG +   + KL   + LSL  N FSG +   +G +  L+TL+LS+N  SG +
Sbjct  243   IDFSENSLSGSLPDSMRKLTMCSSLSLHGNLFSGELPAMIGEMRGLETLDLSRNIFSGGI  302

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             PDSLGN+ SL+ L+LS N  +G V DS+  N  +L  +  + +S  G +P+ +     L 
Sbjct  303   PDSLGNLQSLKLLNLSSNGFTGVVPDSLC-NCKNLLIMDFSRNSLTGNLPAWIYGLG-LQ  360

Query  867   HLNLSNNRFSG----------DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLK  1016
              + LS NR SG          +P +S        L+ LD+S+N  SG +P       NL+
Sbjct  361   KVFLSENRLSGVIKNPFPLSVEPSYS-------ILQVLDLSDNAFSGEIPRNIGTFSNLQ  413

Query  1017  ELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              L++  N   G IP  +G    ++ LDLSEN   G+IP  +
Sbjct  414   ILNVSRNSLIGLIPASIGDLKAVTILDLSENRLNGSIPSEI  454


 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 81/240 (34%), Positives = 118/240 (49%), Gaps = 29/240 (12%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             S + LHG   SG++   + ++  L  L L+ N FSG I   LG L +L+ LNLS N  +G
Sbjct  265   SSLSLHGNLFSGELPAMIGEMRGLETLDLSRNIFSGGIPDSLGNLQSLKLLNLSSNGFTG  324

Query  681   TVPDSLGNMSSLQFLDLSGNSLSG---------------------------PVSDSMLEN  779
              VPDSL N  +L  +D S NSL+G                           P   S+  +
Sbjct  325   VVPDSLCNCKNLLIMDFSRNSLTGNLPAWIYGLGLQKVFLSENRLSGVIKNPFPLSVEPS  384

Query  780   LGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVS  959
                L+ L L+ ++F G IP ++   + L  LN+S N   G       I  L  +  LD+S
Sbjct  385   YSILQVLDLSDNAFSGEIPRNIGTFSNLQILNVSRNSLIG--LIPASIGDLKAVTILDLS  442

Query  960   NNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              N L+GS+P       +LKEL L  N  +G+IP+ +  C  L+ L LS+N  +G+IP +L
Sbjct  443   ENRLNGSIPSEIWDAVSLKELRLEKNFLAGKIPLQIEKCLSLTYLILSQNNISGSIPATL  502


 Score = 74.7 bits (182),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 81/157 (52%), Gaps = 3/157 (2%)
 Frame = +3

Query  660   SKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPS  839
             S N+ SG +P ++G  S+LQ L++S NSL G +  S + +L ++  L L+ +   G IPS
Sbjct  394   SDNAFSGEIPRNIGTFSNLQILNVSRNSLIGLIPAS-IGDLKAVTILDLSENRLNGSIPS  452

Query  840   SLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKE  1019
              +     L  L L  N  +G  +    I     L  L +S N +SGS+P   + L NL+ 
Sbjct  453   EIWDAVSLKELRLEKNFLAG--KIPLQIEKCLSLTYLILSQNNISGSIPATLANLTNLQT  510

Query  1020  LSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             + L  N+ SG +P  L   PHL   ++S N   G +P
Sbjct  511   VDLSMNNLSGSLPKQLANLPHLLSFNISHNNLQGELP  547



>ref|XP_012091046.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Jatropha curcas]
Length=973

 Score =   216 bits (551),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 120/261 (46%), Positives = 164/261 (63%), Gaps = 26/261 (10%)
 Frame = +3

Query  363   NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
             NDDVLGLIVFK+G+QDP S L +W+E+D++PC W  VKC P   RV+E+ L G  LSG I
Sbjct  32    NDDVLGLIVFKAGLQDPESKLTSWNEEDENPCNWVGVKCDPKTQRVTELVLDGFSLSGHI  91

Query  543   GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  722
             GRGL +L+ L +LSL++NNF+G I+P                         L  +  LQ 
Sbjct  92    GRGLIRLQFLEILSLSNNNFTGNINP------------------------DLAQLGGLQV  127

Query  723   LDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD  902
             +DLS N+LSG + D   +  GSLR +S A ++  G IP SLS CT L  +NLS+N+ SG+
Sbjct  128   IDLSHNNLSGIIPDGFFKQCGSLRSVSFARNNLSGQIPESLSWCTTLAAINLSSNKLSGE  187

Query  903   PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPH  1082
                  G+W L  L++LD+S+N L G +P G + L++L  ++L  N FSGE+PVD+G C  
Sbjct  188   --LPSGLWFLRGLQSLDLSDNLLEGEIPEGIANLYDLIAINLQKNKFSGELPVDIGGCVL  245

Query  1083  LSRLDLSENLFTGTIPESLQR  1145
             L  LD SEN  +G +PESL+R
Sbjct  246   LKILDFSENSLSGNLPESLRR  266


 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 90/166 (54%), Gaps = 3/166 (2%)
 Frame = +3

Query  564   EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNS  743
             E L VL L+SN  SG I   +G L++L  LN+S+N + G++P S+G +  LQ LDLS N 
Sbjct  392   EGLKVLDLSSNVLSGEIPFDIGNLSSLLVLNVSRNRLFGSIPSSIGELKMLQVLDLSDNK  451

Query  744   LSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGI  923
             L+G +   +   +G L  L L  +   G IP  +   + L  L LS+N  +G       I
Sbjct  452   LNGRIPSEIGGAVG-LVELRLENNCITGKIPIQIQNFSSLTSLILSHNNLTGP--VPAAI  508

Query  924   WGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
               LT L+  D+S N LS SLP   + L NL   ++  N+  GE+PV
Sbjct  509   ANLTNLQYADLSFNNLSQSLPKELTNLSNLVSFNISHNNLQGELPV  554


 Score = 68.2 bits (165),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 103/210 (49%), Gaps = 11/210 (5%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGT-----VPD  692
             L+G +   +    +L VL ++ N  +G + P +           S NS+S +     V  
Sbjct  328   LTGGLPESMANCPNLLVLDVSQNRLTGNLPPWVVKTGLKSISL-SGNSLSKSMQYPSVTS  386

Query  693   SLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHL  872
                +   L+ LDLS N LSG +    + NL SL  L+++ +   G IPSS+ +  +L  L
Sbjct  387   LEASTEGLKVLDLSSNVLSGEIPFD-IGNLSSLLVLNVSRNRLFGSIPSSIGELKMLQVL  445

Query  873   NLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSG  1049
             +LS+N+ +G  P   GG  GL  LR   + NN ++G +PI      +L  L L  N+ +G
Sbjct  446   DLSDNKLNGRIPSEIGGAVGLVELR---LENNCITGKIPIQIQNFSSLTSLILSHNNLTG  502

Query  1050  EIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              +P  +    +L   DLS N  + ++P+ L
Sbjct  503   PVPAAIANLTNLQYADLSFNNLSQSLPKEL  532


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 73/261 (28%), Positives = 113/261 (43%), Gaps = 51/261 (20%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    L G+I  G+  L  L  ++L  N FSG +   +G    L+ L+ S+NS+SG +
Sbjct  201   LDLSDNLLEGEIPEGIANLYDLIAINLQKNKFSGELPVDIGGCVLLKILDFSENSLSGNL  260

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSS--------  842
             P+SL  + S   L L GN  +G V  + +  L +L  L L+ ++F G +P+S        
Sbjct  261   PESLRRLRSCTSLRLRGNLFAGEVP-AWIGELTNLERLDLSANNFLGRVPASIGNLNLLK  319

Query  843   ----------------LSKCTLLNHLNLSNNRFSGD------------------------  902
                             ++ C  L  L++S NR +G+                        
Sbjct  320   ELNLSVNHLTGGLPESMANCPNLLVLDVSQNRLTGNLPPWVVKTGLKSISLSGNSLSKSM  379

Query  903   --PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLC  1076
               P  +        L+ LD+S+N LSG +P     L +L  L++  N   G IP  +G  
Sbjct  380   QYPSVTSLEASTEGLKVLDLSSNVLSGEIPFDIGNLSSLLVLNVSRNRLFGSIPSSIGEL  439

Query  1077  PHLSRLDLSENLFTGTIPESL  1139
               L  LDLS+N   G IP  +
Sbjct  440   KMLQVLDLSDNKLNGRIPSEI  460


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 68/125 (54%), Gaps = 1/125 (1%)
 Frame = +3

Query  528  LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
            L G I   + +L+ L VL L+ N  +G I  ++G    L  L L  N I+G +P  + N 
Sbjct  428  LFGSIPSSIGELKMLQVLDLSDNKLNGRIPSEIGGAVGLVELRLENNCITGKIPIQIQNF  487

Query  708  SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
            SSL  L LS N+L+GPV  + + NL +L++  L+ ++    +P  L+  + L   N+S+N
Sbjct  488  SSLTSLILSHNNLTGPVP-AAIANLTNLQYADLSFNNLSQSLPKELTNLSNLVSFNISHN  546

Query  888  RFSGD  902
               G+
Sbjct  547  NLQGE  551



>ref|XP_010921155.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Elaeis guineensis]
Length=945

 Score =   216 bits (550),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 119/262 (45%), Positives = 162/262 (62%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ ++DP S L +W+EDDD PC W  +KC P   RV+E+ L+G  LSGK
Sbjct  26    LNDDVLGLIVFKADLRDPDSKLVSWNEDDDDPCCWTGIKCDPKTNRVTELSLNGFSLSGK  85

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L  LSL+ NNFSG +S                          L  + SL+
Sbjct  86    IGRGLLQLQSLRTLSLSKNNFSGTLS------------------------SDLLRLESLR  121

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              LDLS N LSGP+ D       S+R +SLA ++F G IPS++  C+ L  LNLS+NR SG
Sbjct  122   NLDLSENKLSGPIPDDFFGQCRSIRAISLAKNAFFGAIPSNVGFCSTLAALNLSSNRLSG  181

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   G+W L  LR+LD+S+N L G +P+G S ++NL+ +SL  N  SG +P D+G C 
Sbjct  182   S--LPWGLWSLNALRSLDLSDNTLVGEIPVGISKMYNLRSISLHGNRLSGHLPDDIGDCL  239

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LDL+ N  +G++PES+++
Sbjct  240   LLKSLDLAGNSLSGSLPESMRK  261


 Score = 92.4 bits (228),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 109/209 (52%), Gaps = 6/209 (3%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             + LHG  LSG +   +     L  L LA N+ SG +   +  L+    L+LS N  SG V
Sbjct  220   ISLHGNRLSGHLPDDIGDCLLLKSLDLAGNSLSGSLPESMRKLSTCSYLSLSSNFFSGEV  279

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P  +G M SL+ LDLS N   G +  S L +L  L+ L L+ + F G  P SL  C  L 
Sbjct  280   PTWIGEMKSLETLDLSRNGFFGQLPGS-LGDLQLLKALKLSRNGFTGSFPESLCSCKSLV  338

Query  867   HLNLSNNRFSGDPRFSGGIWGL-TRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHF  1043
              ++LS N  +G       +W   + L+ + VS N+L+GS+ I +S   NL+ L L SN F
Sbjct  339   DVDLSQNSLTGKLP----LWVFESGLQQVLVSENKLNGSIVIPSSSASNLQVLVLSSNAF  394

Query  1044  SGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             SG IP  LG    L  LDLS N   G+IP
Sbjct  395   SGSIPEGLGKLKSLEVLDLSGNRLNGSIP  423


 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 84/237 (35%), Positives = 122/237 (51%), Gaps = 26/237 (11%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +  +DL G  LSG +   + KL   + LSL+SN FSG +   +G + +L+TL+LS+N   
Sbjct  241   LKSLDLAGNSLSGSLPESMRKLSTCSYLSLSSNFFSGEVPTWIGEMKSLETLDLSRNGFF  300

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIP-----SS  842
             G +P SLG++  L+ L LS N  +G   +S+  +  SL  + L+ +S  G +P     S 
Sbjct  301   GQLPGSLGDLQLLKALKLSRNGFTGSFPESLC-SCKSLVDVDLSQNSLTGKLPLWVFESG  359

Query  843   LSKCTL------------------LNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNE  968
             L +  +                  L  L LS+N FSG      G+  L  L  LD+S N 
Sbjct  360   LQQVLVSENKLNGSIVIPSSSASNLQVLVLSSNAFSGS--IPEGLGKLKSLEVLDLSGNR  417

Query  969   LSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             L+GS+P+      +LKEL L  N   G IP  +G C  L+ LDLS+N  TG IP +L
Sbjct  418   LNGSIPLEIGGAVSLKELRLEKNSLKGAIPTQIGNCASLTSLDLSQNNLTGPIPPTL  474



>ref|XP_012091138.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Jatropha curcas]
 gb|KDP21644.1| hypothetical protein JCGZ_03315 [Jatropha curcas]
Length=960

 Score =   216 bits (550),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 119/262 (45%), Positives = 160/262 (61%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P + RV+EV L G  LSG+
Sbjct  25    LNDDVLGLIVFKADLQDPKGKLSSWNQDDDTPCNWVGVKCNPRSNRVTEVMLDGFSLSGR  84

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L+ LSLA NN +G IS                         +L  + +L+
Sbjct  85    IGRGLLQLQFLHKLSLARNNLTGSISL------------------------NLSRLENLR  120

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS NSLSG + D      GSLR +SLA + F G IP SLS C  L  +N S+N+FSG
Sbjct  121   IIDLSDNSLSGSIQDDFFAQCGSLRAISLAKNKFSGTIPGSLSSCATLASINFSSNQFSG  180

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIWGL  LR LD+SNN L G +P G   L+NL+ ++   N FSG+ P  +G C 
Sbjct  181   S--LPSGIWGLNGLRLLDLSNNLLKGEIPKGIEGLNNLRAINFSKNQFSGKFPDGIGSCL  238

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              +  +D SEN  +G +PE++Q+
Sbjct  239   LIRAIDFSENSISGYLPETMQK  260


 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 88/257 (34%), Positives = 125/257 (49%), Gaps = 42/257 (16%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +  +D     +SG +   ++KL   N LSL++N  +G +   +G +  L+TL+LS N  S
Sbjct  240   IRAIDFSENSISGYLPETMQKLSLCNYLSLSNNMLAGEVPNWIGEMKQLETLDLSGNKFS  299

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIP-----SS  842
             G VP+S+GN+ SL+ L+LS N LSG + +SM  N G L  L  + +S  G +P     S 
Sbjct  300   GQVPNSIGNLQSLKVLNLSANGLSGNLPESM-ANCGGLVALDFSRNSIRGDLPAWIFGSG  358

Query  843   LSKCTLLNH--------------LNLSNNRFSGDPR----------------------FS  914
             L K   L +              L+LS N FSG                           
Sbjct  359   LGKVIHLENKLSGNFNSVPKLQVLDLSENEFSGKISSPIGVLSSLQLLNLSGNSLVGPIP  418

Query  915   GGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRL  1094
             G I  L  L  LD+S N L+GS+P+      +LKEL L  N  SG+IP  +G C  L+ L
Sbjct  419   GTIGELKELSVLDLSENRLNGSIPVEIGGAFSLKELRLDRNSISGQIPSSVGNCSSLTSL  478

Query  1095  DLSENLFTGTIPESLQR  1145
              LS+N  TG IP +L +
Sbjct  479   ILSQNNLTGPIPAALAK  495


 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 82/251 (33%), Positives = 119/251 (47%), Gaps = 46/251 (18%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    L G+I +G+E L +L  ++ + N FSG     +G    ++ ++ S+NSISG +
Sbjct  195   LDLSNNLLKGEIPKGIEGLNNLRAINFSKNQFSGKFPDGIGSCLLIRAIDFSENSISGYL  254

Query  687   PDSL------------------------GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  794
             P+++                        G M  L+ LDLSGN  SG V +S + NL SL+
Sbjct  255   PETMQKLSLCNYLSLSNNMLAGEVPNWIGEMKQLETLDLSGNKFSGQVPNS-IGNLQSLK  313

Query  795   FLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD-----------------PRFSGGI  923
              L+L+ +   G +P S++ C  L  L+ S N   GD                  + SG  
Sbjct  314   VLNLSANGLSGNLPESMANCGGLVALDFSRNSIRGDLPAWIFGSGLGKVIHLENKLSGNF  373

Query  924   WGLTRLRTLDVSNNELSGSL--PIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLD  1097
               + +L+ LD+S NE SG +  PIG      L  LS   N   G IP  +G    LS LD
Sbjct  374   NSVPKLQVLDLSENEFSGKISSPIGVLSSLQLLNLS--GNSLVGPIPGTIGELKELSVLD  431

Query  1098  LSENLFTGTIP  1130
             LSEN   G+IP
Sbjct  432   LSENRLNGSIP  442


 Score = 77.8 bits (190),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 95/178 (53%), Gaps = 3/178 (2%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L  K+      +  L VL L+ N FSG IS  +G+L++LQ LNLS NS+ G +P ++G +
Sbjct  365   LENKLSGNFNSVPKLQVLDLSENEFSGKISSPIGVLSSLQLLNLSGNSLVGPIPGTIGEL  424

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
               L  LDLS N L+G +   +     SL+ L L  +S  G IPSS+  C+ L  L LS N
Sbjct  425   KELSVLDLSENRLNGSIPVEIGGAF-SLKELRLDRNSISGQIPSSVGNCSSLTSLILSQN  483

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
               +G       +  +T L+ +D S N LSG LP   + L NL   ++  N   GE+P 
Sbjct  484   NLTGP--IPAALAKITTLKDVDFSFNSLSGGLPKQLANLPNLSSFNISHNQLQGELPA  539



>ref|XP_002323672.2| hypothetical protein POPTR_0016s14410g [Populus trichocarpa]
 gb|EEF05433.2| hypothetical protein POPTR_0016s14410g [Populus trichocarpa]
Length=965

 Score =   216 bits (550),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 122/262 (47%), Positives = 162/262 (62%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             +NDDVLGLIVFK+G+QDP S L++W+EDDDSPC W  VKC P   RV+E+ L G  LSG 
Sbjct  23    INDDVLGLIVFKAGLQDPESKLSSWNEDDDSPCNWVGVKCDPNTHRVTELVLDGFSLSGH  82

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L VLSLA+NNF+G I+P                         L  +  LQ
Sbjct  83    IGRGLLRLQFLQVLSLANNNFNGTINP------------------------DLPRLGGLQ  118

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N LSG + D   +  GSLR +S A +   G IP SLS C  L+ +N S+N  SG
Sbjct  119   VIDLSENGLSGSIPDGFFQQCGSLRSVSFARNDLTGMIPGSLSFCMSLSVVNFSSNGLSG  178

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
             +     G+W L  L++LD+S+N L G +P G + L+ L+ ++L  N F+G++PVD+G C 
Sbjct  179   E--LPSGLWYLRGLQSLDLSDNLLEGEIPEGIANLYALRAINLRRNRFTGQLPVDIGGCQ  236

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LD SEN  +G +PESLQR
Sbjct  237   VLKLLDFSENALSGGLPESLQR  258


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 99/190 (52%), Gaps = 27/190 (14%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             LE L VL L+SN FSG I   +G+L++LQ  N+S+N + G++P S+G ++ +Q LDLS N
Sbjct  383   LESLQVLDLSSNVFSGEIPSDIGVLSSLQLFNVSRNQLFGSIPPSVGELTMIQALDLSDN  442

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
              L+G +  S +    SL+ L L  +   G IP+ + KC+                     
Sbjct  443   RLTGSIP-SEIGGAVSLKELRLEMNFLTGKIPTQIKKCS---------------------  480

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDL  1100
                   L +L +S N LSG +P+  + L NL+ + L  N FSG +P +L    HL   ++
Sbjct  481   -----SLTSLIISGNNLSGPIPVAIANLTNLQYVDLSFNRFSGSLPKELANLSHLLSFNI  535

Query  1101  SENLFTGTIP  1130
             S N   G +P
Sbjct  536   SHNNLKGDLP  545


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 76/240 (32%), Positives = 118/240 (49%), Gaps = 29/240 (12%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             + V L G   +G++   + +L  L  L L+ N  SG I   +G L  L+ LNLS N ++G
Sbjct  263   ATVRLGGNSFTGEVPGWIGELTSLESLDLSVNRLSGRIPVSIGNLNVLKELNLSMNQLTG  322

Query  681   TVPDSLGNMSSLQFLDLSGNSLSG---------------------------PVSDSMLEN  779
              +P+S+ N  +L  +D+S N L+G                           P   S+  +
Sbjct  323   GLPESMANCVNLLAIDVSHNRLTGNLPSWIFKTGLKSVSLSGNKLDESIEHPSGVSLAAS  382

Query  780   LGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVS  959
             L SL+ L L+ + F G IPS +   + L   N+S N+  G    S G   LT ++ LD+S
Sbjct  383   LESLQVLDLSSNVFSGEIPSDIGVLSSLQLFNVSRNQLFGSIPPSVG--ELTMIQALDLS  440

Query  960   NNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +N L+GS+P       +LKEL L  N  +G+IP  +  C  L+ L +S N  +G IP ++
Sbjct  441   DNRLTGSIPSEIGGAVSLKELRLEMNFLTGKIPTQIKKCSSLTSLIISGNNLSGPIPVAI  500


 Score = 77.8 bits (190),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 77/234 (33%), Positives = 122/234 (52%), Gaps = 29/234 (12%)
 Frame = +3

Query  525   GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  704
              LSG +   L++L     + L  N+F+G +   +G LT+L++L+LS N +SG +P S+GN
Sbjct  247   ALSGGLPESLQRLSSCATVRLGGNSFTGEVPGWIGELTSLESLDLSVNRLSGRIPVSIGN  306

Query  705   MSSLQFLDLSGNSLSGPVSDSMLE----------------NLGS------LRFLSLAGSS  818
             ++ L+ L+LS N L+G + +SM                  NL S      L+ +SL+G+ 
Sbjct  307   LNVLKELNLSMNQLTGGLPESMANCVNLLAIDVSHNRLTGNLPSWIFKTGLKSVSLSGNK  366

Query  819   FEGPI--PSSLSKCTLLNHL---NLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSL  983
              +  I  PS +S    L  L   +LS+N FSG+     G+  L+ L+  +VS N+L GS+
Sbjct  367   LDESIEHPSGVSLAASLESLQVLDLSSNVFSGEIPSDIGV--LSSLQLFNVSRNQLFGSI  424

Query  984   PIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             P     L  ++ L L  N  +G IP ++G    L  L L  N  TG IP  +++
Sbjct  425   PPSVGELTMIQALDLSDNRLTGSIPSEIGGAVSLKELRLEMNFLTGKIPTQIKK  478


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 70/125 (56%), Gaps = 1/125 (1%)
 Frame = +3

Query  528  LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
            L G I   + +L  +  L L+ N  +G I  ++G   +L+ L L  N ++G +P  +   
Sbjct  420  LFGSIPPSVGELTMIQALDLSDNRLTGSIPSEIGGAVSLKELRLEMNFLTGKIPTQIKKC  479

Query  708  SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
            SSL  L +SGN+LSGP+  + + NL +L+++ L+ + F G +P  L+  + L   N+S+N
Sbjct  480  SSLTSLIISGNNLSGPIPVA-IANLTNLQYVDLSFNRFSGSLPKELANLSHLLSFNISHN  538

Query  888  RFSGD  902
               GD
Sbjct  539  NLKGD  543



>ref|XP_010921154.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Elaeis guineensis]
Length=969

 Score =   216 bits (550),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 119/262 (45%), Positives = 162/262 (62%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ ++DP S L +W+EDDD PC W  +KC P   RV+E+ L+G  LSGK
Sbjct  26    LNDDVLGLIVFKADLRDPDSKLVSWNEDDDDPCCWTGIKCDPKTNRVTELSLNGFSLSGK  85

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L  LSL+ NNFSG +S                          L  + SL+
Sbjct  86    IGRGLLQLQSLRTLSLSKNNFSGTLS------------------------SDLLRLESLR  121

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              LDLS N LSGP+ D       S+R +SLA ++F G IPS++  C+ L  LNLS+NR SG
Sbjct  122   NLDLSENKLSGPIPDDFFGQCRSIRAISLAKNAFFGAIPSNVGFCSTLAALNLSSNRLSG  181

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   G+W L  LR+LD+S+N L G +P+G S ++NL+ +SL  N  SG +P D+G C 
Sbjct  182   S--LPWGLWSLNALRSLDLSDNTLVGEIPVGISKMYNLRSISLHGNRLSGHLPDDIGDCL  239

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LDL+ N  +G++PES+++
Sbjct  240   LLKSLDLAGNSLSGSLPESMRK  261


 Score = 95.9 bits (237),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 82/225 (36%), Positives = 117/225 (52%), Gaps = 24/225 (11%)
 Frame = +3

Query  531   SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  710
             SG++   + +++ L  L L+ N F G +   LG L  L+ L LS+N  +G+ P+SL +  
Sbjct  276   SGEVPTWIGEMKSLETLDLSRNGFFGQLPGSLGDLQLLKALKLSRNGFTGSFPESLCSCK  335

Query  711   SLQFLDLSGNSLSGP----VSDSMLENL------------------GSLRFLSLAGSSFE  824
             SL  +DLS NSL+G     V +S L+ +                   +L+ L L+ ++F 
Sbjct  336   SLVDVDLSQNSLTGKLPLWVFESGLQQVLVSENKLNGSIVIPSSSASNLQVLVLSSNAFS  395

Query  825   GPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFL  1004
             G IP  +S    L  LNLS N FSG      G+  L  L  LD+S N L+GS+P+     
Sbjct  396   GKIPPPVSNVRSLQFLNLSWNSFSGS--IPEGLGKLKSLEVLDLSGNRLNGSIPLEIGGA  453

Query  1005  HNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              +LKEL L  N   G IP  +G C  L+ LDLS+N  TG IP +L
Sbjct  454   VSLKELRLEKNSLKGAIPTQIGNCASLTSLDLSQNNLTGPIPPTL  498


 Score = 92.0 bits (227),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 114/214 (53%), Gaps = 6/214 (3%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             + LHG  LSG +   +     L  L LA N+ SG +   +  L+    L+LS N  SG V
Sbjct  220   ISLHGNRLSGHLPDDIGDCLLLKSLDLAGNSLSGSLPESMRKLSTCSYLSLSSNFFSGEV  279

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P  +G M SL+ LDLS N   G +  S L +L  L+ L L+ + F G  P SL  C  L 
Sbjct  280   PTWIGEMKSLETLDLSRNGFFGQLPGS-LGDLQLLKALKLSRNGFTGSFPESLCSCKSLV  338

Query  867   HLNLSNNRFSGDPRFSGGIWGL-TRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHF  1043
              ++LS N  +G       +W   + L+ + VS N+L+GS+ I +S   NL+ L L SN F
Sbjct  339   DVDLSQNSLTGKLP----LWVFESGLQQVLVSENKLNGSIVIPSSSASNLQVLVLSSNAF  394

Query  1044  SGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             SG+IP  +     L  L+LS N F+G+IPE L +
Sbjct  395   SGKIPPPVSNVRSLQFLNLSWNSFSGSIPEGLGK  428


 Score = 87.4 bits (215),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 98/166 (59%), Gaps = 7/166 (4%)
 Frame = +3

Query  567   HLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSL  746
             +L VL L+SN FSG I P +  + +LQ LNLS NS SG++P+ LG + SL+ LDLSGN L
Sbjct  383   NLQVLVLSSNAFSGKIPPPVSNVRSLQFLNLSWNSFSGSIPEGLGKLKSLEVLDLSGNRL  442

Query  747   SGPVSDSMLENLG--SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
             +G +    LE  G  SL+ L L  +S +G IP+ +  C  L  L+LS N  +G       
Sbjct  443   NGSIP---LEIGGAVSLKELRLEKNSLKGAIPTQIGNCASLTSLDLSQNNLTGP--IPPT  497

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
             +  LT L+ ++ S N L+G++P   S L +L   ++  N  SG+IP
Sbjct  498   LANLTNLQIINFSRNRLTGTIPKQLSNLPHLLSFNIAHNVLSGDIP  543



>ref|NP_191196.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
 emb|CAB88040.1| putative protein [Arabidopsis thaliana]
 dbj|BAB85646.1| inflorescence and root apices receptor-like kinase [Arabidopsis 
thaliana]
 dbj|BAB85647.1| inflorescence and root apices receptor-like kinase [Arabidopsis 
thaliana]
 gb|ACN59335.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE79514.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
Length=964

 Score =   216 bits (549),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 120/262 (46%), Positives = 162/262 (62%), Gaps = 25/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ ++DP   LA+W+EDD +PC+WN VKCHP   RV+E++L G  LSG+
Sbjct  25    LNDDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWNGVKCHPRTNRVTELNLDGFSLSGR  84

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L+ LSL++NN +G+I+P                       + L ++ +L+
Sbjct  85    IGRGLLQLQFLHKLSLSNNNLTGIINP-----------------------NMLLSLVNLK  121

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N LSG + D      GSLR LSLA +   G IP S+S C+ L  LNLS+N FSG
Sbjct  122   VVDLSSNGLSGSLPDEFFRQCGSLRVLSLAKNKLTGKIPVSISSCSSLAALNLSSNGFSG  181

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIW L  LR+LD+S NEL G  P     L+NL+ L L  N  SG IP ++G C 
Sbjct  182   SMPL--GIWSLNTLRSLDLSRNELEGEFPEKIDRLNNLRALDLSRNRLSGPIPSEIGSCM  239

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLSEN  +G++P + Q+
Sbjct  240   LLKTIDLSENSLSGSLPNTFQQ  261


 Score = 84.0 bits (206),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 111/211 (53%), Gaps = 14/211 (7%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    LSG +    ++L     L+L  N   G +   +G + +L+TL+LS N  SG V
Sbjct  244   IDLSENSLSGSLPNTFQQLSLCYSLNLGKNALEGEVPKWIGEMRSLETLDLSMNKFSGQV  303

Query  687   PDSLGNMSSLQFLDLSGNSLSG--PVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTL  860
             PDS+GN+ +L+ L+ SGN L G  PVS +   N  +L  L L+G+S  G +P  L +   
Sbjct  304   PDSIGNLLALKVLNFSGNGLIGSLPVSTA---NCINLLALDLSGNSLTGKLPMWLFQDGS  360

Query  861   LNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNH  1040
              +   L N+  +G         G+ +++ LD+S+N  SG +  G   L +L+ L L  N 
Sbjct  361   RDVSALKNDNSTG---------GIKKIQVLDLSHNAFSGEIGAGLGDLRDLEGLHLSRNS  411

Query  1041  FSGEIPVDLGLCPHLSRLDLSENLFTGTIPE  1133
              +G IP  +G   HLS LD+S N   G IP 
Sbjct  412   LTGPIPSTIGELKHLSVLDVSHNQLNGMIPR  442


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 113/229 (49%), Gaps = 22/229 (10%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL     SG++   +  L  L VL+ + N   G +        NL  L+LS NS++G +
Sbjct  292   LDLSMNKFSGQVPDSIGNLLALKVLNFSGNGLIGSLPVSTANCINLLALDLSGNSLTGKL  351

Query  687   P-----------------DSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGS  815
             P                 +S G +  +Q LDLS N+ SG +  + L +L  L  L L+ +
Sbjct  352   PMWLFQDGSRDVSALKNDNSTGGIKKIQVLDLSHNAFSGEIG-AGLGDLRDLEGLHLSRN  410

Query  816   SFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIG  992
             S  GPIPS++ +   L+ L++S+N+ +G  PR +GG   L  LR   + NN L G++P  
Sbjct  411   SLTGPIPSTIGELKHLSVLDVSHNQLNGMIPRETGGAVSLEELR---LENNLLEGNIPSS  467

Query  993   ASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
                  +L+ L L  N   G IP +L     L  +DLS N   GT+P+ L
Sbjct  468   IKNCSSLRSLILSHNKLLGSIPPELAKLTRLEEVDLSFNELAGTLPKQL  516


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 95/167 (57%), Gaps = 3/167 (2%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             ++ + VL L+ N FSG I   LG L +L+ L+LS+NS++G +P ++G +  L  LD+S N
Sbjct  375   IKKIQVLDLSHNAFSGEIGAGLGDLRDLEGLHLSRNSLTGPIPSTIGELKHLSVLDVSHN  434

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
              L+G +       + SL  L L  +  EG IPSS+  C+ L  L LS+N+  G       
Sbjct  435   QLNGMIPRETGGAV-SLEELRLENNLLEGNIPSSIKNCSSLRSLILSHNKLLGS--IPPE  491

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             +  LTRL  +D+S NEL+G+LP   + L  L   ++  NH  GE+P 
Sbjct  492   LAKLTRLEEVDLSFNELAGTLPKQLANLGYLHTFNISHNHLFGELPA  538


 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 109/223 (49%), Gaps = 18/223 (8%)
 Frame = +3

Query  525   GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  704
              L G++ + + ++  L  L L+ N FSG +   +G L  L+ LN S N + G++P S  N
Sbjct  274   ALEGEVPKWIGEMRSLETLDLSMNKFSGQVPDSIGNLLALKVLNFSGNGLIGSLPVSTAN  333

Query  705   MSSLQFLDLSGNSLSGPV----------------SDSMLENLGSLRFLSLAGSSFEGPIP  836
               +L  LDLSGNSL+G +                +D+    +  ++ L L+ ++F G I 
Sbjct  334   CINLLALDLSGNSLTGKLPMWLFQDGSRDVSALKNDNSTGGIKKIQVLDLSHNAFSGEIG  393

Query  837   SSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLK  1016
             + L     L  L+LS N  +G       I  L  L  LDVS+N+L+G +P       +L+
Sbjct  394   AGLGDLRDLEGLHLSRNSLTGP--IPSTIGELKHLSVLDVSHNQLNGMIPRETGGAVSLE  451

Query  1017  ELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             EL L +N   G IP  +  C  L  L LS N   G+IP  L +
Sbjct  452   ELRLENNLLEGNIPSSIKNCSSLRSLILSHNKLLGSIPPELAK  494



>ref|XP_008792235.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=968

 Score =   216 bits (549),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 124/261 (48%), Positives = 160/261 (61%), Gaps = 26/261 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIV K+ +QDP S L +WSEDDD PC W  VKC+P   RV+E++L G  LSGK
Sbjct  24    LNDDVLGLIVLKADLQDPTSKLLSWSEDDDDPCGWIGVKCNPRTNRVTELNLDGFSLSGK  83

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L  LSL+ NNFSG ++P                        +L  + SL 
Sbjct  84    IGRGLLQLQSLRKLSLSRNNFSGSLNP------------------------NLSQLESLW  119

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N+LSG + D       SLR +SLA + F G IP S+  C+ L  LN S+N+ SG
Sbjct  120   SVDLSENNLSGSIPDVFFRQCRSLRSISLANNDFSGEIPPSVGSCSTLAVLNFSSNQLSG  179

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
               R   G+W L  LR+LD+S N LSG +P+G S L+NL+ +SL  N  SG +P D+G C 
Sbjct  180   --RLPSGLWSLYGLRSLDLSGNSLSGDIPMGISRLYNLRAISLHGNRLSGWLPDDIGGCL  237

Query  1080  HLSRLDLSENLFTGTIPESLQ  1142
              L  LDL  NL TG++PE+LQ
Sbjct  238   LLKSLDLGGNLLTGSLPETLQ  258


 Score = 96.3 bits (238),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 100/187 (53%), Gaps = 3/187 (2%)
 Frame = +3

Query  570   LNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLS  749
             L V+S++ N  SG I   +     L+ L+LS N  SG +P  + NM  LQFL+LS NSLS
Sbjct  358   LQVISISGNKMSGFIQIPIATDETLKALDLSSNGFSGGIPVDIRNMHGLQFLNLSWNSLS  417

Query  750   GPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWG  929
             G +  S+ E L S++ L L+G+   G IP  +     LN L L  N  +G       I  
Sbjct  418   GSIPASIGE-LKSMQVLDLSGNRLNGSIPPEIGGAVSLNELRLQKNSLTGG--IPSQIAN  474

Query  930   LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSEN  1109
              + L +L +S N L+GS+P   + L NL+ + L  N  +G +P      PHL   ++S N
Sbjct  475   CSSLTSLILSQNNLTGSIPPTLANLTNLQTIDLSRNRLTGTLPKQFSNLPHLISFNISHN  534

Query  1110  LFTGTIP  1130
             LF+G +P
Sbjct  535   LFSGDLP  541


 Score = 85.1 bits (209),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 113/212 (53%), Gaps = 4/212 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL G  LSG I  G+ +L +L  +SL  N  SG +   +G    L++L+L  N ++G++
Sbjct  194   LDLSGNSLSGDIPMGISRLYNLRAISLHGNRLSGWLPDDIGGCLLLKSLDLGGNLLTGSL  253

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P++L N+S   +L +  NS SG V   + E + SL  L+L+ + F G IP S+ K  L+ 
Sbjct  254   PETLQNLSMCSYLSMGSNSFSGDVPVWIGE-MRSLETLNLSSNWFSGQIPDSIGKLQLVK  312

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
              L+ S+N  +G       I     L  +D S N L+G+LP    F   L+ +S+  N  S
Sbjct  313   RLDFSHNGLTGS--LPESIGTCKSLLEVDFSQNSLTGNLPTWI-FESGLQVISISGNKMS  369

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
             G I + +     L  LDLS N F+G IP  ++
Sbjct  370   GFIQIPIATDETLKALDLSSNGFSGGIPVDIR  401


 Score = 83.6 bits (205),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 77/242 (32%), Positives = 125/242 (52%), Gaps = 15/242 (6%)
 Frame = +3

Query  414   ASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLAS  593
              + L+ W  DD   C             +  +DL G  L+G +   L+ L   + LS+ S
Sbjct  222   GNRLSGWLPDDIGGCLL-----------LKSLDLGGNLLTGSLPETLQNLSMCSYLSMGS  270

Query  594   NNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSML  773
             N+FSG +   +G + +L+TLNLS N  SG +PDS+G +  ++ LD S N L+G + +S +
Sbjct  271   NSFSGDVPVWIGEMRSLETLNLSSNWFSGQIPDSIGKLQLVKRLDFSHNGLTGSLPES-I  329

Query  774   ENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLD  953
                 SL  +  + +S  G +P+ + +  L   +++S N+ SG  +    I     L+ LD
Sbjct  330   GTCKSLLEVDFSQNSLTGNLPTWIFESGL-QVISISGNKMSGFIQIP--IATDETLKALD  386

Query  954   VSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPE  1133
             +S+N  SG +P+    +H L+ L+L  N  SG IP  +G    +  LDLS N   G+IP 
Sbjct  387   LSSNGFSGGIPVDIRNMHGLQFLNLSWNSLSGSIPASIGELKSMQVLDLSGNRLNGSIPP  446

Query  1134  SL  1139
              +
Sbjct  447   EI  448


 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 117/226 (52%), Gaps = 24/226 (11%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
              SG +   + ++  L  L+L+SN FSG I   +G L  ++ L+ S N ++G++P+S+G  
Sbjct  273   FSGDVPVWIGEMRSLETLNLSSNWFSGQIPDSIGKLQLVKRLDFSHNGLTGSLPESIGTC  332

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
              SL  +D S NSL+G +   + E+   L+ +S++G+   G I   ++    L  L+LS+N
Sbjct  333   KSLLEVDFSQNSLTGNLPTWIFES--GLQVISISGNKMSGFIQIPIATDETLKALDLSSN  390

Query  888   RFSG----DPRFSGGI------WG------------LTRLRTLDVSNNELSGSLPIGASF  1001
              FSG    D R   G+      W             L  ++ LD+S N L+GS+P     
Sbjct  391   GFSGGIPVDIRNMHGLQFLNLSWNSLSGSIPASIGELKSMQVLDLSGNRLNGSIPPEIGG  450

Query  1002  LHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
               +L EL L  N  +G IP  +  C  L+ L LS+N  TG+IP +L
Sbjct  451   AVSLNELRLQKNSLTGGIPSQIANCSSLTSLILSQNNLTGSIPPTL  496


 Score = 78.6 bits (192),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 68/217 (31%), Positives = 110/217 (51%), Gaps = 10/217 (5%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             V  +D    GL+G +   +   + L  +  + N+ +G + P     + LQ +++S N +S
Sbjct  311   VKRLDFSHNGLTGSLPESIGTCKSLLEVDFSQNSLTGNL-PTWIFESGLQVISISGNKMS  369

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSG--PVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSK  851
             G +   +    +L+ LDLS N  SG  PV    + N+  L+FL+L+ +S  G IP+S+ +
Sbjct  370   GFIQIPIATDETLKALDLSSNGFSGGIPVD---IRNMHGLQFLNLSWNSLSGSIPASIGE  426

Query  852   CTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSL  1028
                +  L+LS NR +G  P   GG   L  LR   +  N L+G +P   +   +L  L L
Sbjct  427   LKSMQVLDLSGNRLNGSIPPEIGGAVSLNELR---LQKNSLTGGIPSQIANCSSLTSLIL  483

Query  1029  GSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
               N+ +G IP  L    +L  +DLS N  TGT+P+  
Sbjct  484   SQNNLTGSIPPTLANLTNLQTIDLSRNRLTGTLPKQF  520



>ref|XP_007220278.1| hypothetical protein PRUPE_ppa000889mg [Prunus persica]
 gb|EMJ21477.1| hypothetical protein PRUPE_ppa000889mg [Prunus persica]
Length=969

 Score =   216 bits (549),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 160/262 (61%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ +QDP   LATWSEDDDSPC W+ VKCHP + RV E+ L    LSG 
Sbjct  25    LNDDVLGLIVFKADIQDPKGKLATWSEDDDSPCKWDGVKCHPRSNRVIELSLDDFSLSGH  84

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L  LSL+ NN +G ++P                        ++ ++ +L+
Sbjct  85    IGRGLLQLQSLRKLSLSKNNLTGSLTP------------------------NIAHIDNLR  120

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              LDLS NS SGPV +      GSLR +SLA +   G IP SL  C  L  ++LS N+FSG
Sbjct  121   ALDLSENSFSGPVPEDFFRQCGSLRTISLAKNKISGKIPESLGSCASLAAIDLSLNQFSG  180

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIW L  +R+LD+SNN L G +      L+NL+ ++LG N F+G++P  +G C 
Sbjct  181   S--VPVGIWSLNGIRSLDLSNNLLEGEISKAIGGLNNLRAVNLGKNRFTGQVPDGIGSCL  238

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLSEN F+G +P+++Q+
Sbjct  239   LLRSIDLSENSFSGNLPQTMQK  260


 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 76/242 (31%), Positives = 120/242 (50%), Gaps = 29/242 (12%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             S ++LH    +G+I   + +L+ L  L L+ N F G +   +G L  L+ LN S N  +G
Sbjct  265   SYLNLHQNSFAGEIPEWIGELKSLETLDLSGNRFLGEVPSSIGNLQALKVLNFSANGFTG  324

Query  681   TVPDSLGNMSSLQFLDLSGNSLSGP----VSDSMLENLGSLRFLSLAGSSFEGPIPSSLS  848
             ++P S+   +SL  LD S NS++G     +  + LE + SL    L+GS+   P+ SS+ 
Sbjct  325   SLPKSMAYCTSLVALDFSKNSMAGELPAWIFKAGLEEV-SLSEKKLSGSA-NSPVSSSIG  382

Query  849   KCTL-LNHLNLSNNRFSGDPRFSGG----------------------IWGLTRLRTLDVS  959
                  L  ++LS N+FSG+     G                      I  L  L  +D+S
Sbjct  383   NAPQNLQVVDLSLNQFSGEIASDIGVLSSLRSLNLSGNSLVGPIPVTIGELKALDNVDLS  442

Query  960   NNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              N LSGS+P+      +LKEL L +N  +G+IP  +G C  L+ L  S+N   G +P ++
Sbjct  443   ENRLSGSIPLEIGGAFSLKELRLENNLLTGKIPTSIGNCSSLTTLIASQNRLNGPVPAAM  502

Query  1140  QR  1145
              +
Sbjct  503   AK  504



>ref|XP_006842493.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Amborella trichopoda]
 gb|ERN04168.1| hypothetical protein AMTR_s00077p00091370 [Amborella trichopoda]
Length=981

 Score =   216 bits (549),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 163/262 (62%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK  + DP + L++WSEDD+SPC W  ++C+P   RV+E+ L+ L LSGK
Sbjct  29    LNDDVLGLIVFKFDLHDPKNVLSSWSEDDNSPCNWFGIQCNPRTQRVTEILLNDLSLSGK  88

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L  LSL++N FSG ISP                         L  + SL+
Sbjct  89    IGRGLVRLQFLRKLSLSNNYFSGTISP------------------------DLATIQSLR  124

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +D SGN+L+G + D   +  GSLR++S A ++F GP+P SL+ C+ ++ LN S+N  SG
Sbjct  125   AVDFSGNNLTGEIPDQFFKQCGSLRYVSFARNNFYGPVPRSLTSCSSISVLNFSSNHLSG  184

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                    IW L  LR LD+S NEL+G++P+G     NL+ ++L  N  SG +P D+G C 
Sbjct  185   S--LPEDIWSLNTLRDLDLSGNELTGNIPVGIGSSFNLRTVNLRKNQISGNLPEDIGKCL  242

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L+ +D SEN  TGT+P SLQR
Sbjct  243   LLNSMDFSENSLTGTVPVSLQR  264


 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 72/213 (34%), Positives = 115/213 (54%), Gaps = 5/213 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL G   SG++   + +L+ L  LSL+ N F+G I   L +  +L  ++LS+N + G +
Sbjct  295   LDLSGNMFSGEVPTSIGELKMLKSLSLSGNKFTGQIPDSLTMCVHLSEVDLSQNGLIGII  354

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENL--GSLRFLSLAGSSFEGPIPSSLSKCTL  860
             P+ +   SS++ L+LS N  +G + D    N+   S++ + L+ +   G IP + +  + 
Sbjct  355   PEGI-LASSIERLNLSQNGFTGSIPDITGSNVFYQSVKVIDLSENGLSGKIPEAFALSSQ  413

Query  861   LNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNH  1040
             L  LNLS N  S +     GI  L  L  LD+S N L+GS+P+       L +L L  N 
Sbjct  414   LVVLNLSRNFLSSE--IPAGIGELKELEVLDLSQNRLNGSIPLKIGAAIALTDLRLDRNF  471

Query  1041  FSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              SG IP+++G    L  L LS+N  +G +P SL
Sbjct  472   LSGGIPLEIGKLRSLGTLSLSKNNLSGPLPASL  504


 Score = 86.7 bits (213),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 107/202 (53%), Gaps = 3/202 (1%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L+G +   L++L  L  L L  N+ +G+I   + +L NL+ L+LS N  SG VP S+G +
Sbjct  254   LTGTVPVSLQRLSLLTSLKLGKNSITGLIPSWISMLKNLEVLDLSGNMFSGEVPTSIGEL  313

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
               L+ L LSGN  +G + DS+   +  L  + L+ +   G IP  +   + +  LNLS N
Sbjct  314   KMLKSLSLSGNKFTGQIPDSLTMCV-HLSEVDLSQNGLIGIIPEGILASS-IERLNLSQN  371

Query  888   RFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVD  1064
              F+G  P  +G       ++ +D+S N LSG +P   +    L  L+L  N  S EIP  
Sbjct  372   GFTGSIPDITGSNVFYQSVKVIDLSENGLSGKIPEAFALSSQLVVLNLSRNFLSSEIPAG  431

Query  1065  LGLCPHLSRLDLSENLFTGTIP  1130
             +G    L  LDLS+N   G+IP
Sbjct  432   IGELKELEVLDLSQNRLNGSIP  453


 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 106/216 (49%), Gaps = 11/216 (5%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGL--EKLEHLNVLSLASNNFSGVI---SPqlglltnlqtlnlS  662
             +SEVDL   GL G I  G+    +E LN   L+ N F+G I   +       +++ ++LS
Sbjct  340   LSEVDLSQNGLIGIIPEGILASSIERLN---LSQNGFTGSIPDITGSNVFYQSVKVIDLS  396

Query  663   KNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSS  842
             +N +SG +P++    S L  L+LS N LS  +   + E L  L  L L+ +   G IP  
Sbjct  397   ENGLSGKIPEAFALSSQLVVLNLSRNFLSSEIPAGIGE-LKELEVLDLSQNRLNGSIPLK  455

Query  843   LSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKEL  1022
             +     L  L L  N  SG       I  L  L TL +S N LSG LP   + L +L  L
Sbjct  456   IGAAIALTDLRLDRNFLSGGIPLE--IGKLRSLGTLSLSKNNLSGPLPASLANLTSLHTL  513

Query  1023  SLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
              L  N+ +G +P  LG  PHL  L+LS N   G +P
Sbjct  514   DLSFNNLTGTLPHQLGNLPHLLFLNLSHNNLAGELP  549



>ref|XP_004984462.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=972

 Score =   215 bits (548),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 119/260 (46%), Positives = 154/260 (59%), Gaps = 26/260 (10%)
 Frame = +3

Query  366   DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  545
             DDVLGLIVFK+ V DP   LATWSEDD+  CAW+ V C P  GRVS + L G GLSGK+G
Sbjct  32    DDVLGLIVFKADVSDPEGRLATWSEDDERACAWDGVTCEPRTGRVSALSLAGFGLSGKLG  91

Query  546   RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFL  725
             RGL +LE L  L+LA NN                        +SG VP  L  + +LQ L
Sbjct  92    RGLLRLEALQSLNLAHNN------------------------LSGDVPAELARLPALQTL  127

Query  726   DLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDP  905
             DLS N+ +G + + +     +LR +SLAG++F G IP  +  C  L  LNLS+N  +G  
Sbjct  128   DLSANAFAGAIPEGLFGRCRALRDVSLAGNAFSGDIPRDVGACATLASLNLSSNLLAG--  185

Query  906   RFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHL  1085
                  IW L  LRTLD+S N ++G LPIG S + NL+EL+L  N  +G +P D+G CP L
Sbjct  186   ALPSDIWSLNALRTLDISGNAVTGDLPIGISRMFNLRELNLRGNRLTGSLPDDIGDCPLL  245

Query  1086  SRLDLSENLFTGTIPESLQR  1145
               +DL  N  +G +PESL+R
Sbjct  246   RSVDLGSNSLSGNLPESLRR  265


 Score = 99.4 bits (246),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 121/212 (57%), Gaps = 7/212 (3%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL G  LSG+I   +  L  L  L L+ N F+G +   +G   +L  +++S NS++G +
Sbjct  296   LDLSGNKLSGEIPGSIGGLMSLRELRLSGNGFTGALPESIGGCKSLMHVDVSWNSLTGGL  355

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGS-LRFLSLAGSSFEGPIPSSLSKCTLL  863
             P  +   S +Q++ +S N+LSG V+  M  N+ S L+ + L+ ++F G IPS +SK   L
Sbjct  356   PTWV-FASGVQWVSVSQNTLSGEVAMPM--NVSSVLQGVDLSNNAFSGVIPSEISKLQNL  412

Query  864   NHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHF  1043
               LN+S N  SG       I  +  L  LD++ N L+GS+P  A    +LKEL LG N  
Sbjct  413   QSLNMSWNSMSGS--IPASILEVKSLEVLDLTANRLNGSIP-AAIGGESLKELRLGKNSL  469

Query  1044  SGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +G IP  +G C  L+ LDLS N  TG IPE++
Sbjct  470   TGNIPAQIGNCSALASLDLSHNNLTGAIPETI  501


 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 113/213 (53%), Gaps = 4/213 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +D+ G  ++G +  G+ ++ +L  L+L  N  +G +   +G    L++++L  NS+SG +
Sbjct  200   LDISGNAVTGDLPIGISRMFNLRELNLRGNRLTGSLPDDIGDCPLLRSVDLGSNSLSGNL  259

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P+SL  +S+  +LDLS N  +G V  +    + SL  L L+G+   G IP S+     L 
Sbjct  260   PESLRRLSTCTYLDLSSNEFTGSVP-TWFGEMASLEVLDLSGNKLSGEIPGSIGGLMSLR  318

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
              L LS N F+G       I G   L  +DVS N L+G LP    F   ++ +S+  N  S
Sbjct  319   ELRLSGNGFTG--ALPESIGGCKSLMHVDVSWNSLTGGLPTWV-FASGVQWVSVSQNTLS  375

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             GE+ + + +   L  +DLS N F+G IP  + +
Sbjct  376   GEVAMPMNVSSVLQGVDLSNNAFSGVIPSEISK  408



>ref|XP_004137674.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis sativus]
 gb|KGN58686.1| hypothetical protein Csa_3G728030 [Cucumis sativus]
Length=959

 Score =   215 bits (547),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 120/272 (44%), Positives = 165/272 (61%), Gaps = 28/272 (10%)
 Frame = +3

Query  333   GAGGAESLQ--LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSE  506
              A G  ++    NDDVLGLIVFK+G+QDP   L TW+EDD++PC W  VKC+P   RVSE
Sbjct  12    AAAGVSAVDTAFNDDVLGLIVFKAGLQDPMGKLVTWNEDDETPCNWFGVKCNPKTNRVSE  71

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             + L G  LSG IGRGL +L+ L +LSLA+NNF+G                        T+
Sbjct  72    LVLDGFSLSGHIGRGLLRLQFLQILSLANNNFTG------------------------TI  107

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
               +L ++ +LQ +DLS NSLSGP+ + +    GS+R LS A ++  G IP SL+ C  L 
Sbjct  108   NSALSHLGNLQVIDLSDNSLSGPIPEQLFLQCGSIRVLSFARNNLIGNIPQSLTSCFSLE  167

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
              LN S+N  SG      G+W L  L++LD+S+N L G +P G   L++L+ +SL  N  S
Sbjct  168   LLNFSSNHLSG--TLPSGLWYLRELQSLDLSDNLLEGQIPTGIQNLYDLRFVSLHKNRLS  225

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
             G++P D+G C  L  LD SEN+ +G +PES+Q
Sbjct  226   GKLPEDIGGCLLLKSLDFSENILSGGLPESMQ  257


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 86/233 (37%), Positives = 128/233 (55%), Gaps = 25/233 (11%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             ++L G  L+G++ R + +L++L+ L L++NNFSG +   +G L  L+  N+S N ++  +
Sbjct  265   LNLRGNFLTGEVPRWIGELKNLDTLDLSANNFSGQLPSSIGNLQFLKKFNVSTNYLTRNL  324

Query  687   PDSLGNMSSLQFLDLSGNSLSG--------------PVSDSMLE-NLGS------LRFLS  803
             P+S+ N ++L  +D S N L+G              P S   LE NL S      L+ L 
Sbjct  325   PESMENCNNLLSIDASHNRLTGNLPIWIFKAAMPSVPFSSYRLEENLSSPASFQGLQVLD  384

Query  804   LAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGS  980
             L+ + F G IPS++ +   L  LN+S N   G  PR    I  L     LD S+N+LSGS
Sbjct  385   LSSNIFSGHIPSNVGELGNLQLLNISRNHLVGSIPR---SIGELKSAYALDFSDNQLSGS  441

Query  981   LPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +P       +LKEL L  N  +GEIPV +G CP L+ L LS N  TG+IP ++
Sbjct  442   IPAEIGGAISLKELRLEKNFLTGEIPVKIGKCPLLTSLILSHNNLTGSIPAAV  494


 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 100/180 (56%), Gaps = 4/180 (2%)
 Frame = +3

Query  570   LNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLS  749
             L VL L+SN FSG I   +G L NLQ LN+S+N + G++P S+G + S   LD S N LS
Sbjct  380   LQVLDLSSNIFSGHIPSNVGELGNLQLLNISRNHLVGSIPRSIGELKSAYALDFSDNQLS  439

Query  750   GPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWG  929
             G +   +   + SL+ L L  +   G IP  + KC LL  L LS+N  +G       +  
Sbjct  440   GSIPAEIGGAI-SLKELRLEKNFLTGEIPVKIGKCPLLTSLILSHNNLTGS--IPAAVAN  496

Query  930   LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSEN  1109
             L+ L  +D+S N+LSGSLP   + L +L   ++  NH  GE+PV  G    +S L +S N
Sbjct  497   LSNLVDVDLSFNKLSGSLPKELTNLSHLLSFNISHNHLEGELPVG-GFFNAISPLSISHN  555



>ref|XP_002275275.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=969

 Score =   215 bits (547),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 162/262 (62%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ +QDP S LA+W+EDDDSPC W  VKC+P + RV+++ L G  LSGK
Sbjct  26    LNDDVLGLIVFKADIQDPNSKLASWNEDDDSPCNWVGVKCNPRSNRVTDLVLDGFSLSGK  85

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L  LSLA NN +G I P                        +L  + +L+
Sbjct  86    IGRGLLQLQFLRKLSLAKNNITGSIGP------------------------NLARLQNLR  121

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
             F+DLS NSLSG + D   +  GSL  +SLA + F G IP S+  C+ L  ++ S+N+FSG
Sbjct  122   FIDLSENSLSGTIPDDFFKQCGSLHAISLAKNKFSGKIPESVGSCSTLAAIDFSSNQFSG  181

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIW L  LR+LD+S+N L G +P G   L+NL+ ++L  N FSG +P  +G C 
Sbjct  182   P--LPSGIWSLNGLRSLDLSDNLLEGDIPKGIDSLYNLRAINLSKNRFSGPLPDGIGGCL  239

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +D SEN  +G++P ++Q+
Sbjct  240   LLRLIDFSENSLSGSLPGTMQK  261


 Score = 87.0 bits (214),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 113/211 (54%), Gaps = 5/211 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +D     LSG +   ++KL   N ++L  N+F G +   +G + +L+TL+LS N  SG V
Sbjct  244   IDFSENSLSGSLPGTMQKLTLCNYMNLHGNSFEGEVPEWIGEMKSLETLDLSANKFSGRV  303

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P S+GN+ SL+ L+ S N  SG + +SM+ N   L  L ++ +S  G +P+ + K  L  
Sbjct  304   PTSIGNLKSLKVLNFSVNVFSGSLPESMI-NCEQLLVLDVSQNSLLGDLPAWIFKLGLQK  362

Query  867   HLNLSNNRFSG--DPRFSGGIWGLTR-LRTLDVSNNELSGSLPIGASFLHNLKELSLGSN  1037
              L LS N  SG  D  FS  +    + L+ LD+S NELSG          +L+ L++  N
Sbjct  363   VL-LSKNSLSGNMDSPFSSSVEKSRQGLQVLDLSYNELSGDFTSSIGVFRSLQFLNISRN  421

Query  1038  HFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
                G IP  +G    L  LDLSEN   G+IP
Sbjct  422   SLVGAIPASIGDLKALDVLDLSENQLNGSIP  452


 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 76/240 (32%), Positives = 117/240 (49%), Gaps = 29/240 (12%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             ++LHG    G++   + +++ L  L L++N FSG +   +G L +L+ LN S N  SG++
Sbjct  268   MNLHGNSFEGEVPEWIGEMKSLETLDLSANKFSGRVPTSIGNLKSLKVLNFSVNVFSGSL  327

Query  687   PDSLGNMSSLQFLDLSGNSLSG---------------------------PVSDSMLENLG  785
             P+S+ N   L  LD+S NSL G                           P S S+ ++  
Sbjct  328   PESMINCEQLLVLDVSQNSLLGDLPAWIFKLGLQKVLLSKNSLSGNMDSPFSSSVEKSRQ  387

Query  786   SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNN  965
              L+ L L+ +   G   SS+     L  LN+S N   G       I  L  L  LD+S N
Sbjct  388   GLQVLDLSYNELSGDFTSSIGVFRSLQFLNISRNSLVG--AIPASIGDLKALDVLDLSEN  445

Query  966   ELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             +L+GS+P+      +LK+L L +N  +G+IPV L  C  L+ L LS N  +G IP  + +
Sbjct  446   QLNGSIPLEIGGAFSLKDLRLKNNFLAGKIPVSLENCSSLTTLILSHNNLSGPIPMGISK  505


 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 79/240 (33%), Positives = 121/240 (50%), Gaps = 33/240 (14%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL     SG++   +  L+ L VL+ + N FSG +   +     L  L++S+NS+ G +
Sbjct  292   LDLSANKFSGRVPTSIGNLKSLKVLNFSVNVFSGSLPESMINCEQLLVLDVSQNSLLGDL  351

Query  687   P---------------DSL-GNMSS------------LQFLDLSGNSLSGPVSDSMLENL  782
             P               +SL GNM S            LQ LDLS N LSG  + S +   
Sbjct  352   PAWIFKLGLQKVLLSKNSLSGNMDSPFSSSVEKSRQGLQVLDLSYNELSGDFTSS-IGVF  410

Query  783   GSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVS  959
              SL+FL+++ +S  G IP+S+     L+ L+LS N+ +G  P   GG + L  LR   + 
Sbjct  411   RSLQFLNISRNSLVGAIPASIGDLKALDVLDLSENQLNGSIPLEIGGAFSLKDLR---LK  467

Query  960   NNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             NN L+G +P+      +L  L L  N+ SG IP+ +    +L  +DLS N  TG++P+ L
Sbjct  468   NNFLAGKIPVSLENCSSLTTLILSHNNLSGPIPMGISKLSNLENVDLSLNKLTGSLPKQL  527


 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 95/168 (57%), Gaps = 7/168 (4%)
 Frame = +3

Query  564   EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNS  743
             + L VL L+ N  SG  +  +G+  +LQ LN+S+NS+ G +P S+G++ +L  LDLS N 
Sbjct  387   QGLQVLDLSYNELSGDFTSSIGVFRSLQFLNISRNSLVGAIPASIGDLKALDVLDLSENQ  446

Query  744   LSGPVSDSMLENLG--SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSG  917
             L+G +    LE  G  SL+ L L  +   G IP SL  C+ L  L LS+N  SG      
Sbjct  447   LNGSIP---LEIGGAFSLKDLRLKNNFLAGKIPVSLENCSSLTTLILSHNNLSGP--IPM  501

Query  918   GIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             GI  L+ L  +D+S N+L+GSLP   + L +L   ++  N   GE+P 
Sbjct  502   GISKLSNLENVDLSLNKLTGSLPKQLANLPHLISFNISHNQLQGELPA  549


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 105/205 (51%), Gaps = 6/205 (3%)
 Frame = +3

Query  387   VFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLE  566
             +FK G+Q       + S + DSP + +  K       +  +DL    LSG     +    
Sbjct  355   IFKLGLQKVLLSKNSLSGNMDSPFSSSVEKSRQG---LQVLDLSYNELSGDFTSSIGVFR  411

Query  567   HLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSL  746
              L  L+++ N+  G I   +G L  L  L+LS+N ++G++P  +G   SL+ L L  N L
Sbjct  412   SLQFLNISRNSLVGAIPASIGDLKALDVLDLSENQLNGSIPLEIGGAFSLKDLRLKNNFL  471

Query  747   SGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIW  926
             +G +  S LEN  SL  L L+ ++  GPIP  +SK + L +++LS N+ +G       + 
Sbjct  472   AGKIPVS-LENCSSLTTLILSHNNLSGPIPMGISKLSNLENVDLSLNKLTGS--LPKQLA  528

Query  927   GLTRLRTLDVSNNELSGSLPIGASF  1001
              L  L + ++S+N+L G LP G  F
Sbjct  529   NLPHLISFNISHNQLQGELPAGGFF  553



>ref|XP_002467905.1| hypothetical protein SORBIDRAFT_01g036160 [Sorghum bicolor]
 gb|EER94903.1| hypothetical protein SORBIDRAFT_01g036160 [Sorghum bicolor]
Length=972

 Score =   214 bits (546),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 121/260 (47%), Positives = 153/260 (59%), Gaps = 26/260 (10%)
 Frame = +3

Query  366   DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  545
             DDVLGLIVFK+ V DP   LATWSEDD+ PCAW  V C    GRVS + L G GLSGK+G
Sbjct  32    DDVLGLIVFKADVSDPDGRLATWSEDDERPCAWGGVTCDARTGRVSALSLAGFGLSGKLG  91

Query  546   RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFL  725
             RGL +LE L  LSLA NN                        +SG VP  L  + +LQ L
Sbjct  92    RGLLRLEALQSLSLARNN------------------------LSGDVPAELARLPALQTL  127

Query  726   DLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDP  905
             DLS N+ +G + + +     SLR +SLAG++F G IP  ++ C  L  LNLS+N  +G  
Sbjct  128   DLSANAFAGAIPEGLFGRCRSLRDVSLAGNAFSGGIPRDVAACATLASLNLSSNLLAG--  185

Query  906   RFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHL  1085
                  IW L  LRTLD+S N ++G LPIG S + NL+ L+L  N  +G +P D+G CP L
Sbjct  186   ALPSDIWSLNALRTLDISGNAVTGDLPIGISRMFNLRALNLRGNRLTGSLPDDIGDCPLL  245

Query  1086  SRLDLSENLFTGTIPESLQR  1145
               LDL  N  +G +PESL+R
Sbjct  246   RSLDLGSNSLSGDLPESLRR  265


 Score = 93.6 bits (231),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 122/218 (56%), Gaps = 9/218 (4%)
 Frame = +3

Query  492   GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  671
             G +  +DL G   SG+I   +  L  L  L L+ N F+G +   +G   +L  +++S NS
Sbjct  291   GSLEILDLSGNKFSGEIPGSIGGLMSLRELRLSGNGFTGALPESIGGCKSLMHVDVSWNS  350

Query  672   ISGTVPD-SLGNMSSLQFLDLSGNSLSGPVSDSMLENLGS-LRFLSLAGSSFEGPIPSSL  845
             ++G +P   LG  S +Q++ +S N+LSG V   +  N  S L+ + L+ ++F G IPS +
Sbjct  351   LTGALPSWVLG--SGVQWVSVSQNTLSGEVK--VPANASSVLQGVDLSNNAFSGVIPSEI  406

Query  846   SKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELS  1025
             SK   L+ LN+S N  SG       I  +  L  LD++ N L+G +P  ++   +L+EL 
Sbjct  407   SKLQNLHSLNMSWNSMSGS--IPASILEMKSLEVLDLTANRLNGCIP-ASTGGESLQELR  463

Query  1026  LGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             LG N  +G IP  +G C  L+ LDLS N  TG IPE++
Sbjct  464   LGKNFLTGNIPAQIGNCSSLASLDLSHNNLTGGIPETI  501


 Score = 91.7 bits (226),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 73/216 (34%), Positives = 116/216 (54%), Gaps = 10/216 (5%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +D+ G  ++G +  G+ ++ +L  L+L  N  +G +   +G    L++L+L  NS+SG +
Sbjct  200   LDISGNAVTGDLPIGISRMFNLRALNLRGNRLTGSLPDDIGDCPLLRSLDLGSNSLSGDL  259

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P+SL  +S+  +LDLS N  +G V  +    +GSL  L L+G+ F G IP S+     L 
Sbjct  260   PESLRRLSTCTYLDLSSNEFTGSVP-TWFGEMGSLEILDLSGNKFSGEIPGSIGGLMSLR  318

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLP---IGASFLHNLKELSLGSN  1037
              L LS N F+G       I G   L  +DVS N L+G+LP   +G+     ++ +S+  N
Sbjct  319   ELRLSGNGFTG--ALPESIGGCKSLMHVDVSWNSLTGALPSWVLGS----GVQWVSVSQN  372

Query  1038  HFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
               SGE+ V       L  +DLS N F+G IP  + +
Sbjct  373   TLSGEVKVPANASSVLQGVDLSNNAFSGVIPSEISK  408



>ref|NP_001239730.1| probably inactive leucine-rich repeat receptor-like protein kinase 
At3g28040-like precursor [Glycine max]
 gb|ACM89592.1| leucine-rich repeat transmembrane protein kinase [Glycine max]
 gb|KHN25807.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=971

 Score =   214 bits (546),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 117/264 (44%), Positives = 165/264 (63%), Gaps = 28/264 (11%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPC--AWNFVKCHPANGRVSEVDLHGLGLS  533
             LNDDVLGLIVFK+ ++DP   LA+W+EDD+S C  +W  VKC+P + RV EV+L G  LS
Sbjct  25    LNDDVLGLIVFKADIRDPKGKLASWNEDDESACGGSWVGVKCNPRSNRVVEVNLDGFSLS  84

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  713
             G+IGRGL++L+ L  LSLA+NN +G I+P                        ++  + +
Sbjct  85    GRIGRGLQRLQFLRKLSLANNNLTGGINP------------------------NIARIDN  120

Query  714   LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRF  893
             L+ +DLSGNSLSG VSD +    GSLR +SLA + F G IPS+L  C+ L  ++LSNN+F
Sbjct  121   LRVIDLSGNSLSGEVSDDVFRQCGSLRTVSLARNRFSGSIPSTLGACSALASIDLSNNQF  180

Query  894   SGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGL  1073
             SG      G+W L+ LR+LD+S+N L G +P G   + NL+ +S+  N  +G +P   G 
Sbjct  181   SGS--VPSGVWSLSALRSLDLSDNLLEGEIPKGVEAMKNLRSVSMTRNRLTGNVPFGFGS  238

Query  1074  CPHLSRLDLSENLFTGTIPESLQR  1145
             C  L  +DL +N F+G+IP  L+ 
Sbjct  239   CLLLRSIDLGDNSFSGSIPGDLKE  262


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 122/238 (51%), Gaps = 29/238 (12%)
 Frame = +3

Query  513   LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  692
             L G   S ++   + ++  L  L L++N F+G +   +G L  L+ LN S N ++G++P+
Sbjct  271   LRGNAFSREVPEWIGEMRGLETLDLSNNGFTGQVPSSIGNLQLLKMLNFSGNGLTGSLPE  330

Query  693   SLGNMSSLQFLDLSGNSLSG--PV----SDS----MLENLGS-----------------L  791
             S+ N + L  LD+S NS+SG  P+    SD     M EN+ S                 L
Sbjct  331   SIVNCTKLSVLDVSRNSMSGWLPLWVFKSDLDKGLMSENVQSGSKKSPLFALAEVAFQSL  390

Query  792   RFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNEL  971
             + L L+ ++F G I S++   + L  LNL+NN   G       I  L    +LD+S N+L
Sbjct  391   QVLDLSHNAFSGEITSAVGGLSSLQVLNLANNSLGGP--IPAAIGELKTCSSLDLSYNKL  448

Query  972   SGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             +GS+P       +LKEL L  N  +G+IP  +  C  L+ L LS+N  +G IP ++ +
Sbjct  449   NGSIPWEIGRAVSLKELVLEKNFLNGKIPSSIENCSLLTTLILSQNKLSGPIPAAVAK  506


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 81/157 (52%), Gaps = 3/157 (2%)
 Frame = +3

Query  660   SKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPS  839
             S N+ SG +  ++G +SSLQ L+L+ NSL GP+  ++ E L +   L L+ +   G IP 
Sbjct  396   SHNAFSGEITSAVGGLSSLQVLNLANNSLGGPIPAAIGE-LKTCSSLDLSYNKLNGSIPW  454

Query  840   SLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKE  1019
              + +   L  L L  N  +G  +    I   + L TL +S N+LSG +P   + L NL+ 
Sbjct  455   EIGRAVSLKELVLEKNFLNG--KIPSSIENCSLLTTLILSQNKLSGPIPAAVAKLTNLRT  512

Query  1020  LSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             + +  N  +G +P  L    +L   +LS N   G +P
Sbjct  513   VDVSFNSLTGNLPKQLANLANLLTFNLSHNNLQGELP  549



>ref|XP_008370260.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=965

 Score =   214 bits (546),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 124/262 (47%), Positives = 163/262 (62%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLIVFK+G+ DP + LA+W+EDDDSPC+W  VKC P  GRV+EV L G  LSG 
Sbjct  23    FNDDVLGLIVFKAGLSDPEAKLASWNEDDDSPCSWVGVKCDPTTGRVAEVVLDGFSLSGH  82

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L++L  LSL+ NNF+G I+P                         L ++ SLQ
Sbjct  83    IGRGLLRLQNLQRLSLSDNNFTGFINP------------------------DLPHLGSLQ  118

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS NSLSG V +      GSLR +S A ++  G IP SLS C  L  +N S+NR SG
Sbjct  119   VIDLSRNSLSGSVPEEFFMQCGSLRVVSFARNNLTGRIPESLSLCQTLVDVNFSSNRMSG  178

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
               +   GIW L  L++LD+++N + G +P G   L++L+ ++L  N FSG++P D G C 
Sbjct  179   --KLPSGIWYLRMLQSLDLADNLVEGEVPEGIENLYDLRVINLAKNRFSGQLPGDFGSCL  236

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LD SENLF+G IP S+QR
Sbjct  237   QLKLLDFSENLFSGRIPXSIQR  258


 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 79/240 (33%), Positives = 122/240 (51%), Gaps = 29/240 (12%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             + + L G  L+G++   L  L++L VL ++ NNFSG I   LG L  L+ LNLS+N  +G
Sbjct  263   TSLSLQGNLLAGQVPNWLGDLKNLEVLDVSGNNFSGEIPSSLGNLELLEXLNLSRNGFTG  322

Query  681   TVPDSLGNMSSLQFLDLSGNSLSGPVSD---------------------------SMLEN  779
             ++PD+L N ++L  +D+S N L+G +                             SM  +
Sbjct  323   SLPDTLANCNNLLAIDVSHNLLAGKLPSWIFKLGLRSVSLYGNRLGGSEEYSSLASMAAS  382

Query  780   LGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVS  959
              G L+ L L+ ++F   +PS +   + L  LN+S N   G       I  L     LD+S
Sbjct  383   NGGLQVLDLSSNAFSDVLPSDIGVLSSLQFLNMSGNHLLG--WIPASIGELKAAYVLDLS  440

Query  960   NNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +N L+GS+P       +LKE+ L  N  SG++P ++  C  L+ L LS+N  TG IP +L
Sbjct  441   DNWLNGSIPDEIGGAVSLKEIRLQKNFLSGKVPAEIAKCSSLTNLILSQNNLTGPIPTAL  500


 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 96/164 (59%), Gaps = 3/164 (2%)
 Frame = +3

Query  570   LNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLS  749
             L VL L+SN FS V+   +G+L++LQ LN+S N + G +P S+G + +   LDLS N L+
Sbjct  386   LQVLDLSSNAFSDVLPSDIGVLSSLQFLNMSGNHLLGWIPASIGELKAAYVLDLSDNWLN  445

Query  750   GPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWG  929
             G + D +   + SL+ + L  +   G +P+ ++KC+ L +L LS N  +G       +  
Sbjct  446   GSIPDEIGGAV-SLKEIRLQKNFLSGKVPAEIAKCSSLTNLILSQNNLTGP--IPTALAN  502

Query  930   LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             LT L+ +D+S N+ SG +P   + L +L   ++  NH  GE+P+
Sbjct  503   LTNLQYVDLSLNKFSGGIPKELTNLSHLLYFNVSHNHLEGELPL  546


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 92/172 (53%), Gaps = 3/172 (2%)
 Frame = +3

Query  486   ANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSK  665
             +NG +  +DL     S  +   +  L  L  L+++ N+  G I   +G L     L+LS 
Sbjct  382   SNGGLQVLDLSSNAFSDVLPSDIGVLSSLQFLNMSGNHLLGWIPASIGELKAAYVLDLSD  441

Query  666   NSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSL  845
             N ++G++PD +G   SL+ + L  N LSG V  + +    SL  L L+ ++  GPIP++L
Sbjct  442   NWLNGSIPDEIGGAVSLKEIRLQKNFLSGKVP-AEIAKCSSLTNLILSQNNLTGPIPTAL  500

Query  846   SKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASF  1001
             +  T L +++LS N+FSG       +  L+ L   +VS+N L G LP+G  F
Sbjct  501   ANLTNLQYVDLSLNKFSGG--IPKELTNLSHLLYFNVSHNHLEGELPLGGFF  550



>ref|XP_009402208.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=974

 Score =   214 bits (545),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 121/262 (46%), Positives = 157/262 (60%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ + DP S LA+W+ED+D PC W  VKC+    RV+E+ L G  LSGK
Sbjct  32    LNDDVLGLIVFKADILDPLSKLASWNEDEDDPCGWTGVKCNAKTNRVTELSLVGFSLSGK  91

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ +  L L+ NNFSG ++P                         L  + SL+
Sbjct  92    IGRGLLQLQSIQKLYLSKNNFSGSLNP------------------------KLSQLESLR  127

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N+LSG + D       SLR LSLA ++F G IP SL  C  L  LNLS+NR SG
Sbjct  128   VVDLSENNLSGVIPDEFFGQCRSLRSLSLANNAFTGHIPPSLGSCLTLAALNLSSNRLSG  187

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   G+W L  LR+LD+S+N L G +P G S L+NL+ +SL  NH SG +P D+G C 
Sbjct  188   S--LPKGLWSLYGLRSLDLSDNSLVGEIPGGISRLYNLRSISLRQNHLSGRLPDDMGSCL  245

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LD S N  TG++P+S+ R
Sbjct  246   LLKYLDFSVNFLTGSLPDSMHR  267


 Score = 99.8 bits (247),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 80/225 (36%), Positives = 123/225 (55%), Gaps = 24/225 (11%)
 Frame = +3

Query  531   SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  710
             SGK+   + ++++L  L L+ N FSG +   +G L  L++L+LS+N ++G +P+S+G   
Sbjct  282   SGKVPTWIGEMKNLEFLDLSRNWFSGRVPESIGKLQLLKSLDLSRNRLTGGLPESIGACR  341

Query  711   SLQFLDLSGNSLSGPVSDSMLE-----------------NLG-----SLRFLSLAGSSFE  824
             SL  LDLS NSL+G +   + E                 ++G     SL +L L+G++F 
Sbjct  342   SLTDLDLSDNSLTGNLPSWVFELKLQRISVFGNKMSGCISVGVSATRSLSYLDLSGNAFS  401

Query  825   GPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFL  1004
             G IP  L     L  LNLS N  SG       I  L  +  LD+S N ++GS+P+     
Sbjct  402   GAIPLVLGNLLSLRQLNLSWNLLSGS--IPASILALETVEVLDLSRNLINGSIPLEIGKA  459

Query  1005  HNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              +LKEL L  N  +GEIPV +G C  L+ + LS+N  TG +P+++
Sbjct  460   VSLKELRLEKNSLTGEIPVQIGNCSSLTTMMLSQNNLTGPLPQTI  504


 Score = 87.8 bits (216),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 73/211 (35%), Positives = 113/211 (54%), Gaps = 4/211 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             ++++DL    L+G +   + +L+ L  +S+  N  SG IS  +    +L  L+LS N+ S
Sbjct  343   LTDLDLSDNSLTGNLPSWVFELK-LQRISVFGNKMSGCISVGVSATRSLSYLDLSGNAFS  401

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G +P  LGN+ SL+ L+LS N LSG +  S+L  L ++  L L+ +   G IP  + K  
Sbjct  402   GAIPLVLGNLLSLRQLNLSWNLLSGSIPASILA-LETVEVLDLSRNLINGSIPLEIGKAV  460

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSN  1037
              L  L L  N  +G+      I   + L T+ +S N L+G LP   + L NL ++ L  N
Sbjct  461   SLKELRLEKNSLTGE--IPVQIGNCSSLTTMMLSQNNLTGPLPQTIANLTNLHKVDLSFN  518

Query  1038  HFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
               SG +P  L   PHL   ++S NLF+G +P
Sbjct  519   RLSGNLPKQLSNLPHLLSFNISHNLFSGDLP  549


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 93/172 (54%), Gaps = 3/172 (2%)
 Frame = +3

Query  486   ANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSK  665
             A   +S +DL G   SG I   L  L  L  L+L+ N  SG I   +  L  ++ L+LS+
Sbjct  386   ATRSLSYLDLSGNAFSGAIPLVLGNLLSLRQLNLSWNLLSGSIPASILALETVEVLDLSR  445

Query  666   NSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSL  845
             N I+G++P  +G   SL+ L L  NSL+G +    + N  SL  + L+ ++  GP+P ++
Sbjct  446   NLINGSIPLEIGKAVSLKELRLEKNSLTGEIP-VQIGNCSSLTTMMLSQNNLTGPLPQTI  504

Query  846   SKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASF  1001
             +  T L+ ++LS NR SG+      +  L  L + ++S+N  SG LP G  F
Sbjct  505   ANLTNLHKVDLSFNRLSGN--LPKQLSNLPHLLSFNISHNLFSGDLPAGNFF  554



>ref|XP_011010875.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Populus euphratica]
Length=965

 Score =   214 bits (545),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 117/261 (45%), Positives = 164/261 (63%), Gaps = 26/261 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P   RV+E+ L GL LSG+
Sbjct  30    LNDDVLGLIVFKADLQDPKRKLSSWNQDDDTPCNWFGVKCNPRTNRVTELSLDGLSLSGQ  89

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L+ LSL+ N  +G I+P                        +L  + +L 
Sbjct  90    IGRGLMQLQFLDKLSLSRNCLTGSINP------------------------NLTRLENLG  125

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS NSLSG + +   E+ G+LR +SLA + F G IPS+LS C  L  +NLS+N+FSG
Sbjct  126   IIDLSENSLSGTIPEDFFEDCGTLRDISLAKNKFSGKIPSTLSSCASLASINLSSNQFSG  185

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIWGL  L +LD+S N L   +P G   L+NL+ ++L  N F+G IP  +G C 
Sbjct  186   S--LPAGIWGLNGLSSLDLSGNLLDSEIPRGIEVLNNLRNINLSKNRFNGGIPNGIGSCL  243

Query  1080  HLSRLDLSENLFTGTIPESLQ  1142
              LS +D SEN+ +GT+P+++Q
Sbjct  244   LLSSVDFSENMLSGTVPDTMQ  264


 Score = 97.4 bits (241),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 91/258 (35%), Positives = 127/258 (49%), Gaps = 44/258 (17%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +S VD     LSG +   ++ L   N LSL++N F+G +   +G L  L+TL+LS N  S
Sbjct  245   LSSVDFSENMLSGTVPDTMQNLGLCNYLSLSNNMFTGEVPNWIGELNRLETLDLSGNRFS  304

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSM-----------------------------  770
             G VP S+GN+ SL+  +LS NSLSG + +SM                             
Sbjct  305   GQVPTSIGNLQSLKVFNLSANSLSGNLPESMTNCGNLLVLDFSQNLLSGDLPVWIFGSGL  364

Query  771   -----LENLGSLRF--------LSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRF  911
                  LEN  S +F        L L+ + F G I SS+   + L  LNLS N   G    
Sbjct  365   EKVLQLENKLSGKFSSAPKLQVLDLSHNDFSGKIASSIGVSSSLQFLNLSRNSLMGP--I  422

Query  912   SGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSR  1091
              G    L  L  LD+S+N+L+GS+P+       LKEL L  N  SG+IP  +G C  L+ 
Sbjct  423   PGTFGDLKELDVLDLSDNKLNGSIPMEIGGAFALKELRLERNSLSGQIPSSIGTCSSLTT  482

Query  1092  LDLSENLFTGTIPESLQR  1145
             L LS+N  +GTIP ++ +
Sbjct  483   LFLSQNNLSGTIPVAIAK  500


 Score = 92.4 bits (228),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 122/252 (48%), Gaps = 42/252 (17%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +S +DL G  L  +I RG+E L +L  ++L+ N F+G I   +G    L +++ S+N +S
Sbjct  197   LSSLDLSGNLLDSEIPRGIEVLNNLRNINLSKNRFNGGIPNGIGSCLLLSSVDFSENMLS  256

Query  678   GTVPDSL------------------------GNMSSLQFLDLSGNSLSGPVSDSMLENLG  785
             GTVPD++                        G ++ L+ LDLSGN  SG V  S + NL 
Sbjct  257   GTVPDTMQNLGLCNYLSLSNNMFTGEVPNWIGELNRLETLDLSGNRFSGQVPTS-IGNLQ  315

Query  786   SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD-----------------PRFS  914
             SL+  +L+ +S  G +P S++ C  L  L+ S N  SGD                  + S
Sbjct  316   SLKVFNLSANSLSGNLPESMTNCGNLLVLDFSQNLLSGDLPVWIFGSGLEKVLQLENKLS  375

Query  915   GGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRL  1094
             G      +L+ LD+S+N+ SG +        +L+ L+L  N   G IP   G    L  L
Sbjct  376   GKFSSAPKLQVLDLSHNDFSGKIASSIGVSSSLQFLNLSRNSLMGPIPGTFGDLKELDVL  435

Query  1095  DLSENLFTGTIP  1130
             DLS+N   G+IP
Sbjct  436   DLSDNKLNGSIP  447


 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 79/235 (34%), Positives = 121/235 (51%), Gaps = 24/235 (10%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL G   SG++   +  L+ L V +L++N+ SG +   +    NL  L+ S+N +
Sbjct  292   RLETLDLSGNRFSGQVPTSIGNLQSLKVFNLSANSLSGNLPESMTNCGNLLVLDFSQNLL  351

Query  675   SGTVPDSL----------------GNMSS---LQFLDLSGNSLSGPVSDSMLENLGSLRF  797
             SG +P  +                G  SS   LQ LDLS N  SG ++ S+  +  SL+F
Sbjct  352   SGDLPVWIFGSGLEKVLQLENKLSGKFSSAPKLQVLDLSHNDFSGKIASSIGVS-SSLQF  410

Query  798   LSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELS  974
             L+L+ +S  GPIP +      L+ L+LS+N+ +G  P   GG + L  LR   +  N LS
Sbjct  411   LNLSRNSLMGPIPGTFGDLKELDVLDLSDNKLNGSIPMEIGGAFALKELR---LERNSLS  467

Query  975   GSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             G +P       +L  L L  N+ SG IPV +    +L  +D+S N  TGT+P+ L
Sbjct  468   GQIPSSIGTCSSLTTLFLSQNNLSGTIPVAIAKLGNLQDVDVSFNSLTGTLPKQL  522



>ref|XP_007136420.1| hypothetical protein PHAVU_009G043600g [Phaseolus vulgaris]
 gb|ESW08414.1| hypothetical protein PHAVU_009G043600g [Phaseolus vulgaris]
Length=954

 Score =   214 bits (544),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 117/259 (45%), Positives = 161/259 (62%), Gaps = 28/259 (11%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCA--WNFVKCHPANGRVSEVDLHGLGLS  533
             LNDDVLGLIVFK+ ++DP   LA+WSEDD+S C   W  VKC+P + RV E++L G  LS
Sbjct  32    LNDDVLGLIVFKADIRDPKGKLASWSEDDESACGAGWVGVKCNPRSNRVVEINLDGFSLS  91

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  713
             G+IGRGL++L+ L  LSLA+NN +G I+                         ++  + S
Sbjct  92    GRIGRGLQRLQFLRKLSLANNNLTGGIN------------------------SNIARIDS  127

Query  714   LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRF  893
             L+ +DLSGNSLSG VSD +    GSLR +SLA + F G IPS+L  C+ L  ++LSNN+F
Sbjct  128   LRVIDLSGNSLSGQVSDDVFRQCGSLRAVSLARNRFSGSIPSALGACSALAAIDLSNNQF  187

Query  894   SGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGL  1073
             SG      G+W L+ LR+LD+S+N L G +P G   + NL+ +SL  N  +G +P   G 
Sbjct  188   SGS--VPSGVWSLSALRSLDLSDNLLEGEIPKGVEAMKNLRSVSLARNRLTGNVPGGFGS  245

Query  1074  CPHLSRLDLSENLFTGTIP  1130
             C  L  +DL +N F+G+IP
Sbjct  246   CSLLRSIDLGDNSFSGSIP  264


 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 81/241 (34%), Positives = 121/241 (50%), Gaps = 31/241 (13%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL     SG I    ++L     LSL  N FSG +   +G +  L+TL+LS N ++G V
Sbjct  252   IDLGDNSFSGSIPGDFKELALCGYLSLRGNAFSGELPEWIGEMRGLETLDLSNNGLTGQV  311

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIP-----SSLSK  851
             P+S+GN+ SL+ L+ SGNS  G + +SM  N   L  L  + +S  G +P     S L K
Sbjct  312   PNSVGNLQSLKMLNFSGNSFGGSLPESM-ANCTKLLVLDASRNSMSGGLPLWIFKSDLDK  370

Query  852   CTL-----------------------LNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSN  962
               L                       L  L+LS+N FSG+   +  + GL+ L  L+++N
Sbjct  371   VLLSENGASGSKKSPLISLAEVAVQSLQVLDLSHNAFSGE--ITSAVGGLSSLHVLNLAN  428

Query  963   NELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
             N L G +P       +LKEL L  N   G+IP+ +  C  L+ L LS+N  +G IP ++ 
Sbjct  429   NSLIGPIPAAIGGAVSLKELVLKKNFLIGKIPMSIENCTLLTTLSLSQNWLSGPIPAAVA  488

Query  1143  R  1145
             +
Sbjct  489   K  489


 Score = 77.4 bits (189),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 76/134 (57%), Gaps = 3/134 (2%)
 Frame = +3

Query  660   SKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPS  839
             S N+ SG +  ++G +SSL  L+L+ NSL GP+  + +    SL+ L L  +   G IP 
Sbjct  403   SHNAFSGEITSAVGGLSSLHVLNLANNSLIGPIP-AAIGGAVSLKELVLKKNFLIGKIPM  461

Query  840   SLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKE  1019
             S+  CTLL  L+LS N  SG       +  LT L+T+D+S N L+G+LP   + L NL  
Sbjct  462   SIENCTLLTTLSLSQNWLSGP--IPAAVAKLTNLQTVDLSYNNLTGNLPKQLANLANLLA  519

Query  1020  LSLGSNHFSGEIPV  1061
              +L  N+  GE+P 
Sbjct  520   FNLSHNNLQGELPA  533


 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 75/141 (53%), Gaps = 4/141 (3%)
 Frame = +3

Query  723   LDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD  902
             ++L G SLSG +    L+ L  LR LSLA ++  G I S++++   L  ++LS N  SG 
Sbjct  83    INLDGFSLSGRIGRG-LQRLQFLRKLSLANNNLTGGINSNIARIDSLRVIDLSGNSLSG-  140

Query  903   PRFSGGIW-GLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
              + S  ++     LR + ++ N  SGS+P        L  + L +N FSG +P  +    
Sbjct  141   -QVSDDVFRQCGSLRAVSLARNRFSGSIPSALGACSALAAIDLSNNQFSGSVPSGVWSLS  199

Query  1080  HLSRLDLSENLFTGTIPESLQ  1142
              L  LDLS+NL  G IP+ ++
Sbjct  200   ALRSLDLSDNLLEGEIPKGVE  220



>ref|XP_011010876.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Populus euphratica]
Length=941

 Score =   214 bits (544),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 117/261 (45%), Positives = 164/261 (63%), Gaps = 26/261 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P   RV+E+ L GL LSG+
Sbjct  30    LNDDVLGLIVFKADLQDPKRKLSSWNQDDDTPCNWFGVKCNPRTNRVTELSLDGLSLSGQ  89

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L+ LSL+ N  +G I+P                        +L  + +L 
Sbjct  90    IGRGLMQLQFLDKLSLSRNCLTGSINP------------------------NLTRLENLG  125

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS NSLSG + +   E+ G+LR +SLA + F G IPS+LS C  L  +NLS+N+FSG
Sbjct  126   IIDLSENSLSGTIPEDFFEDCGTLRDISLAKNKFSGKIPSTLSSCASLASINLSSNQFSG  185

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIWGL  L +LD+S N L   +P G   L+NL+ ++L  N F+G IP  +G C 
Sbjct  186   S--LPAGIWGLNGLSSLDLSGNLLDSEIPRGIEVLNNLRNINLSKNRFNGGIPNGIGSCL  243

Query  1080  HLSRLDLSENLFTGTIPESLQ  1142
              LS +D SEN+ +GT+P+++Q
Sbjct  244   LLSSVDFSENMLSGTVPDTMQ  264


 Score = 99.0 bits (245),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 92/256 (36%), Positives = 126/256 (49%), Gaps = 44/256 (17%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +S VD     LSG +   ++ L   N LSL++N F+G +   +G L  L+TL+LS N  S
Sbjct  245   LSSVDFSENMLSGTVPDTMQNLGLCNYLSLSNNMFTGEVPNWIGELNRLETLDLSGNRFS  304

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSM-----------------------------  770
             G VP S+GN+ SL+  +LS NSLSG + +SM                             
Sbjct  305   GQVPTSIGNLQSLKVFNLSANSLSGNLPESMTNCGNLLVLDFSQNLLSGDLPVWIFGSGL  364

Query  771   -----LENLGSLRF--------LSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRF  911
                  LEN  S +F        L L+ + F G I SS+   + L  LNLS N   G    
Sbjct  365   EKVLQLENKLSGKFSSAPKLQVLDLSHNDFSGKIASSIGVSSSLQFLNLSRNSLMGP--I  422

Query  912   SGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSR  1091
              G    L  L  LD+S+N+L+GS+P+       LKEL L  N  SG+IP  +G C  L+ 
Sbjct  423   PGTFGDLKELDVLDLSDNKLNGSIPMEIGGAFALKELRLERNSLSGQIPSSIGTCSSLTT  482

Query  1092  LDLSENLFTGTIPESL  1139
             L LS+N  TGT+P+ L
Sbjct  483   LFLSQNSLTGTLPKQL  498


 Score = 92.4 bits (228),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 122/252 (48%), Gaps = 42/252 (17%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +S +DL G  L  +I RG+E L +L  ++L+ N F+G I   +G    L +++ S+N +S
Sbjct  197   LSSLDLSGNLLDSEIPRGIEVLNNLRNINLSKNRFNGGIPNGIGSCLLLSSVDFSENMLS  256

Query  678   GTVPDSL------------------------GNMSSLQFLDLSGNSLSGPVSDSMLENLG  785
             GTVPD++                        G ++ L+ LDLSGN  SG V  S + NL 
Sbjct  257   GTVPDTMQNLGLCNYLSLSNNMFTGEVPNWIGELNRLETLDLSGNRFSGQVPTS-IGNLQ  315

Query  786   SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD-----------------PRFS  914
             SL+  +L+ +S  G +P S++ C  L  L+ S N  SGD                  + S
Sbjct  316   SLKVFNLSANSLSGNLPESMTNCGNLLVLDFSQNLLSGDLPVWIFGSGLEKVLQLENKLS  375

Query  915   GGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRL  1094
             G      +L+ LD+S+N+ SG +        +L+ L+L  N   G IP   G    L  L
Sbjct  376   GKFSSAPKLQVLDLSHNDFSGKIASSIGVSSSLQFLNLSRNSLMGPIPGTFGDLKELDVL  435

Query  1095  DLSENLFTGTIP  1130
             DLS+N   G+IP
Sbjct  436   DLSDNKLNGSIP  447


 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 111/230 (48%), Gaps = 42/230 (18%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL G   SG++   +  L+ L V +L++N+ SG +   +    NL  L+ S+N +
Sbjct  292   RLETLDLSGNRFSGQVPTSIGNLQSLKVFNLSANSLSGNLPESMTNCGNLLVLDFSQNLL  351

Query  675   SGTVPDSL----------------GNMSS---LQFLDLSGNSLSGPVSDSMLENLGSLRF  797
             SG +P  +                G  SS   LQ LDLS N  SG ++ S+  +  SL+F
Sbjct  352   SGDLPVWIFGSGLEKVLQLENKLSGKFSSAPKLQVLDLSHNDFSGKIASSIGVS-SSLQF  410

Query  798   LSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLR----------  944
             L+L+ +S  GPIP +      L+ L+LS+N+ +G  P   GG + L  LR          
Sbjct  411   LNLSRNSLMGPIPGTFGDLKELDVLDLSDNKLNGSIPMEIGGAFALKELRLERNSLSGQI  470

Query  945   -----------TLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
                        TL +S N L+G+LP   + L +L   ++  N+  GE+P 
Sbjct  471   PSSIGTCSSLTTLFLSQNSLTGTLPKQLANLPSLSSFNISHNNLQGELPA  520


 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 88/162 (54%), Gaps = 7/162 (4%)
 Frame = +3

Query  522   LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG  701
             L L  K+         L VL L+ N+FSG I+  +G+ ++LQ LNLS+NS+ G +P + G
Sbjct  368   LQLENKLSGKFSSAPKLQVLDLSHNDFSGKIASSIGVSSSLQFLNLSRNSLMGPIPGTFG  427

Query  702   NMSSLQFLDLSGNSLSGPVSDSMLENLG--SLRFLSLAGSSFEGPIPSSLSKCTLLNHLN  875
             ++  L  LDLS N L+G +    +E  G  +L+ L L  +S  G IPSS+  C+ L  L 
Sbjct  428   DLKELDVLDLSDNKLNGSIP---MEIGGAFALKELRLERNSLSGQIPSSIGTCSSLTTLF  484

Query  876   LSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASF  1001
             LS N  +G       +  L  L + ++S+N L G LP G  F
Sbjct  485   LSQNSLTG--TLPKQLANLPSLSSFNISHNNLQGELPAGGFF  524



>ref|XP_006402993.1| hypothetical protein EUTSA_v10005773mg [Eutrema salsugineum]
 gb|ESQ44446.1| hypothetical protein EUTSA_v10005773mg [Eutrema salsugineum]
Length=967

 Score =   213 bits (543),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 161/262 (61%), Gaps = 25/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ ++DP   LA+W+EDD SPC+WN VKCH    RV+E+ L G  LSG+
Sbjct  28    LNDDVLGLIVFKADLRDPEQKLASWNEDDYSPCSWNGVKCHTRTNRVTELTLDGFSLSGR  87

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L+ LSL++NN +G+I+P                       + L ++ +L+
Sbjct  88    IGRGLLQLQFLHKLSLSNNNLTGIINP-----------------------NLLLSLVNLK  124

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N LSG + D      GSLR  SLA ++  G IP S+S C+ L  LNLS+NRFSG
Sbjct  125   VVDLSSNGLSGSLPDGFFRQCGSLRAFSLAKNTLTGKIPVSISSCSSLAALNLSSNRFSG  184

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIW L  LR+LD+S NEL G  P     L+NL+ L L  N  +G +P ++G C 
Sbjct  185   SMPL--GIWSLNTLRSLDLSRNELEGKFPEKIDRLYNLRALDLSRNRLTGPVPSEIGSCM  242

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLSEN  +G +P++ Q+
Sbjct  243   LLKTIDLSENSLSGNLPDTFQQ  264


 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 78/251 (31%), Positives = 122/251 (49%), Gaps = 46/251 (18%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    L GK    +++L +L  L L+ N  +G +  ++G    L+T++LS+NS+SG +
Sbjct  199   LDLSRNELEGKFPEKIDRLYNLRALDLSRNRLTGPVPSEIGSCMLLKTIDLSENSLSGNL  258

Query  687   PDS------------------------LGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  794
             PD+                        +G M SL+ LDLS N  SG V DS + NL +L+
Sbjct  259   PDTFQQLSLCYYLNLGNNLLEGEVPKWIGEMRSLETLDLSMNKFSGQVPDS-IGNLLALK  317

Query  795   FLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG------------------DPRFSGG  920
              L+ +G+ F G +P S + C  L  L+ S N  +G                  +   +GG
Sbjct  318   VLNFSGNGFIGSLPDSTANCINLLALDFSGNSLTGKLPVWIFEDGSHEVSALKNDNLTGG  377

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDL  1100
             I    R++ LD S+N  +G +  G   L +++ L+L  N  +G IP  +G   HL  LDL
Sbjct  378   I---KRIQVLDFSSNSFTGEIGAGLGDLKDMQSLNLSRNALTGPIPSTIGHLKHLGVLDL  434

Query  1101  SENLFTGTIPE  1133
             S N   G++P 
Sbjct  435   SHNQLNGSVPR  445


 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 109/222 (49%), Gaps = 18/222 (8%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L G++ + + ++  L  L L+ N FSG +   +G L  L+ LN S N   G++PDS  N 
Sbjct  278   LEGEVPKWIGEMRSLETLDLSMNKFSGQVPDSIGNLLALKVLNFSGNGFIGSLPDSTANC  337

Query  708   SSLQFLDLSGNSLSG--PV--------------SDSMLENLGSLRFLSLAGSSFEGPIPS  839
              +L  LD SGNSL+G  PV              +D++   +  ++ L  + +SF G I +
Sbjct  338   INLLALDFSGNSLTGKLPVWIFEDGSHEVSALKNDNLTGGIKRIQVLDFSSNSFTGEIGA  397

Query  840   SLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKE  1019
              L     +  LNLS N  +G       I  L  L  LD+S+N+L+GS+P       +L++
Sbjct  398   GLGDLKDMQSLNLSRNALTGP--IPSTIGHLKHLGVLDLSHNQLNGSVPRETGGAVSLEK  455

Query  1020  LSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             L L +N   G IP  +  C  L  L LS N   G +P  L +
Sbjct  456   LRLENNMLEGSIPSTIKNCSFLQSLILSHNKLIGAVPPELAK  497


 Score = 81.3 bits (199),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 99/167 (59%), Gaps = 3/167 (2%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             ++ + VL  +SN+F+G I   LG L ++Q+LNLS+N+++G +P ++G++  L  LDLS N
Sbjct  378   IKRIQVLDFSSNSFTGEIGAGLGDLKDMQSLNLSRNALTGPIPSTIGHLKHLGVLDLSHN  437

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
              L+G V       + SL  L L  +  EG IPS++  C+ L  L LS+N+  G       
Sbjct  438   QLNGSVPRETGGAV-SLEKLRLENNMLEGSIPSTIKNCSFLQSLILSHNKLIG--AVPPE  494

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             +  LT L+ +D+S N+L+G+LP   + L  L   ++  NH SGE+P 
Sbjct  495   LAKLTNLQEVDLSFNDLNGTLPKQLANLGYLHTFNISHNHLSGELPA  541


 Score = 80.5 bits (197),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 73/229 (32%), Positives = 114/229 (50%), Gaps = 22/229 (10%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL     SG++   +  L  L VL+ + N F G +        NL  L+ S NS++G +
Sbjct  295   LDLSMNKFSGQVPDSIGNLLALKVLNFSGNGFIGSLPDSTANCINLLALDFSGNSLTGKL  354

Query  687   P----------------DSL-GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGS  815
             P                D+L G +  +Q LD S NS +G +  + L +L  ++ L+L+ +
Sbjct  355   PVWIFEDGSHEVSALKNDNLTGGIKRIQVLDFSSNSFTGEIG-AGLGDLKDMQSLNLSRN  413

Query  816   SFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIG  992
             +  GPIPS++     L  L+LS+N+ +G  PR +GG   L +LR   + NN L GS+P  
Sbjct  414   ALTGPIPSTIGHLKHLGVLDLSHNQLNGSVPRETGGAVSLEKLR---LENNMLEGSIPST  470

Query  993   ASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
                   L+ L L  N   G +P +L    +L  +DLS N   GT+P+ L
Sbjct  471   IKNCSFLQSLILSHNKLIGAVPPELAKLTNLQEVDLSFNDLNGTLPKQL  519



>ref|XP_010553156.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Tarenaya hassleriana]
Length=969

 Score =   213 bits (542),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/263 (44%), Positives = 159/263 (60%), Gaps = 27/263 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCA-WNFVKCHPANGRVSEVDLHGLGLSG  536
              NDDVLGLIVFK+G+ DP S LA+W+E+D+ PC  W  V C PA+ RV+E+ L G  LSG
Sbjct  28    FNDDVLGLIVFKAGLHDPGSKLASWNEEDNDPCINWVGVSCDPASNRVTELRLDGFSLSG  87

Query  537   KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  716
              IGRGL +L+ L  L L++NN SG ++P                           +M SL
Sbjct  88    HIGRGLLRLQSLQTLVLSNNNLSGALNP------------------------EFPHMGSL  123

Query  717   QFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFS  896
             Q +D SGNSLSG + D   E  GSLR +S A +   GPIP SLS C+ L  +N S+N+ S
Sbjct  124   QVVDFSGNSLSGRIPDGFFEQCGSLRSVSFARNRLTGPIPVSLSYCSTLTRVNFSSNQLS  183

Query  897   GDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLC  1076
             G  R    IW L  L++LD+S+N L G +P G   L++L+E++   N FSG+IP D+G C
Sbjct  184   G--RLPQEIWYLKSLKSLDLSDNFLQGEIPDGIGSLYDLREINFSKNWFSGDIPADIGSC  241

Query  1077  PHLSRLDLSENLFTGTIPESLQR  1145
               L  +D SEN F+G +P+ +++
Sbjct  242   SSLKSVDFSENYFSGYLPDPMRK  264


 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 120/243 (49%), Gaps = 29/243 (12%)
 Frame = +3

Query  492   GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  671
             G  S + L G  L G++   + ++  L  L L++NN SG +   LG L  L+ LNLS N+
Sbjct  266   GSCSLLRLRGNSLIGEVPNWIGEMTSLETLDLSANNLSGNVPFSLGNLEFLKELNLSANT  325

Query  672   ISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSML------------------EN------  779
              +G +P+++ N S+L  +D+S NS +G V   M                   EN      
Sbjct  326   FAGELPETIKNCSNLISIDVSKNSFTGSVFQWMFNGNSESSSLSGYTLDKRSENDTISSI  385

Query  780   ---LGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTL  950
                L  LR L L+ + F G IP  +     L H+N+S N   G      GI GL     L
Sbjct  386   VGFLQGLRVLDLSSNGFSGQIPPDIWILRSLVHMNMSANALLGS--IPSGIGGLKATEVL  443

Query  951   DVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             D+SNN L+G++P       +LKEL L  N  SG+IP  +  C  L+ +DLS+N  +G IP
Sbjct  444   DLSNNLLNGTIPSEIGGAVSLKELKLQRNGLSGQIPGQISNCSALTAIDLSQNNLSGEIP  503

Query  1131  ESL  1139
              S+
Sbjct  504   VSI  506


 Score = 75.9 bits (185),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 93/190 (49%), Gaps = 27/190 (14%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             L+ L VL L+SN FSG I P + +L +L  +N+S N++ G++P  +G + + + LDLS N
Sbjct  389   LQGLRVLDLSSNGFSGQIPPDIWILRSLVHMNMSANALLGSIPSGIGGLKATEVLDLSNN  448

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
              L+G                          IPS +     L  L L  N  SG  +  G 
Sbjct  449   LLNGT-------------------------IPSEIGGAVSLKELKLQRNGLSG--QIPGQ  481

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDL  1100
             I   + L  +D+S N LSG +P+  + L NL+ + L  N+ SG +P ++    HL   ++
Sbjct  482   ISNCSALTAIDLSQNNLSGEIPVSIANLSNLQLVDLSVNNLSGSLPKEIVNLSHLISFNI  541

Query  1101  SENLFTGTIP  1130
             S N   G +P
Sbjct  542   SHNSIEGELP  551



>ref|XP_008442319.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=958

 Score =   213 bits (541),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 117/259 (45%), Positives = 160/259 (62%), Gaps = 26/259 (10%)
 Frame = +3

Query  366   DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  545
             DDVLGLIVFK+G+QDP   L TW+EDD++PC W  VKC+P   RVSE+ L G  LSG IG
Sbjct  25    DDVLGLIVFKAGLQDPMGKLVTWNEDDETPCNWFGVKCNPKTNRVSELVLDGFSLSGHIG  84

Query  546   RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFL  725
             RGL +L+ L +LSLA+NNF+G                        T+  +L ++ +LQ +
Sbjct  85    RGLLRLQFLQILSLANNNFTG------------------------TINSALSHLGNLQVI  120

Query  726   DLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDP  905
             DLS N+LSGP+ + + +  GS+R LS A +S  G IP SL+ C  L  LN S+N  SG  
Sbjct  121   DLSDNNLSGPIPEQLFQQCGSIRVLSFARNSLIGNIPQSLTSCFSLEVLNFSSNHLSG--  178

Query  906   RFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHL  1085
                 G+W L  L++LD S+N L G +P G   L++L+ +SL  N  SG++P D+G C  L
Sbjct  179   TLPSGLWYLRELQSLDFSDNLLEGQIPNGIQNLYDLRFVSLHKNRLSGKLPEDIGGCLLL  238

Query  1086  SRLDLSENLFTGTIPESLQ  1142
               LD SEN+ +G +PES+Q
Sbjct  239   KSLDFSENILSGGLPESMQ  257


 Score = 92.8 bits (229),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 81/233 (35%), Positives = 124/233 (53%), Gaps = 25/233 (11%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             ++L G  L+G++   + +L++L+ L L++NNFSG +   +G L  L+  N+S N ++  +
Sbjct  265   LNLRGNSLTGEVPHWIGELKNLDTLDLSANNFSGQLPSSIGNLQFLKKFNVSTNYLTRNL  324

Query  687   PDSLGNMSSLQFLDLSGNSLSG--------------PVSDSML-ENLGS------LRFLS  803
             P+S+ N ++L   D S N L+G              P S   L ENL S      L+ L 
Sbjct  325   PESMANCNNLLSFDASHNHLTGNLPIWLFKAAIPSVPFSSYRLGENLSSPASFKGLQVLD  384

Query  804   LAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGS  980
             L+ +   G IPS++ +   L  LN+S N   G  PR    I  L     +D S+N+L+GS
Sbjct  385   LSSNILSGHIPSNVGELGNLQLLNISRNHLVGSIPR---SIGELKSAYAIDFSDNQLNGS  441

Query  981   LPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +P       +LKEL L  N  +GEIPV +G C  L+ L LS N  TG+IP ++
Sbjct  442   IPAEIGGAISLKELRLEKNFLTGEIPVKIGKCSFLTSLILSHNNLTGSIPAAI  494


 Score = 83.2 bits (204),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 74/227 (33%), Positives = 115/227 (51%), Gaps = 27/227 (12%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L G+I  G++ L  L  +SL  N  SG +   +G    L++L+ S+N +SG +P+S+  +
Sbjct  200   LEGQIPNGIQNLYDLRFVSLHKNRLSGKLPEDIGGCLLLKSLDFSENILSGGLPESMQML  259

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
             SS  +L+L GNSL+G V   + E L +L  L L+ ++F G +PSS+     L   N+S N
Sbjct  260   SSCTYLNLRGNSLTGEVPHWIGE-LKNLDTLDLSANNFSGQLPSSIGNLQFLKKFNVSTN  318

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPI-----------------------GAS  998
               + +      +     L + D S+N L+G+LPI                        AS
Sbjct  319   YLTRN--LPESMANCNNLLSFDASHNHLTGNLPIWLFKAAIPSVPFSSYRLGENLSSPAS  376

Query  999   FLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             F   L+ L L SN  SG IP ++G   +L  L++S N   G+IP S+
Sbjct  377   F-KGLQVLDLSSNILSGHIPSNVGELGNLQLLNISRNHLVGSIPRSI  422


 Score = 77.8 bits (190),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 99/180 (55%), Gaps = 4/180 (2%)
 Frame = +3

Query  570   LNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLS  749
             L VL L+SN  SG I   +G L NLQ LN+S+N + G++P S+G + S   +D S N L+
Sbjct  380   LQVLDLSSNILSGHIPSNVGELGNLQLLNISRNHLVGSIPRSIGELKSAYAIDFSDNQLN  439

Query  750   GPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWG  929
             G +   +   + SL+ L L  +   G IP  + KC+ L  L LS+N  +G       I  
Sbjct  440   GSIPAEIGGAI-SLKELRLEKNFLTGEIPVKIGKCSFLTSLILSHNNLTGS--IPAAIAN  496

Query  930   LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSEN  1109
             L+ L  +D+S N+LSGSLP   + L +L   ++  NH  GE+PV  G    +S L +S N
Sbjct  497   LSNLVDVDLSFNKLSGSLPKELTNLSHLLSFNISHNHLEGELPVG-GFFNAISPLSISHN  555



>ref|XP_010683484.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=972

 Score =   213 bits (542),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 159/262 (61%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLIVFK+GV+DP + L +W+E DD PC WN VKC P   RV+E+ L G  LSG+
Sbjct  25    FNDDVLGLIVFKAGVKDPDAKLVSWNESDDKPCKWNGVKCDPTTNRVTEITLDGFSLSGQ  84

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             I R L +L+ L  +SL++NN SG ++P                           ++ +LQ
Sbjct  85    ISRSLLRLQFLQKISLSNNNLSGTVNP------------------------EFAHLWNLQ  120

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLSGN+LSG + + + +  GSL+ +S A +   G +P SLS C  L  +N S+NR SG
Sbjct  121   SIDLSGNNLSGFIPNELFQQCGSLKSVSFANNVLSGELPDSLSSCMTLQSVNFSSNRISG  180

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
               +    IW L  L++LD+SNN L G +P+G   +++LK +SLG N FSG +P D+G C 
Sbjct  181   --KLPKKIWSLNGLQSLDLSNNLLGGQIPLGFGEMYSLKVISLGKNAFSGLLPEDIGSCL  238

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  ++  EN F+G IPESLQ+
Sbjct  239   QLQSVNFGENSFSGVIPESLQK  260


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 71/217 (33%), Positives = 103/217 (47%), Gaps = 27/217 (12%)
 Frame = +3

Query  567   HLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSL  746
              L  ++   N+FSGVI   L  L    +++L+ N +SG VPD  G+M SL+ LDLS N  
Sbjct  239   QLQSVNFGENSFSGVIPESLQKLNMCTSVSLNGNLLSGEVPDWFGHMESLENLDLSVNKF  298

Query  747   SGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLL---------------------  863
              G +  + L N+ SL+ L+L+ +   G +P SL  C  L                     
Sbjct  299   FGRIPFT-LGNMRSLKELNLSSNGITGGLPQSLMNCDNLLSLDVSFNLLKGKMPNWIFEL  357

Query  864   --NHLNLSNNRFSGD---PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSL  1028
                  +LS N+F G    P          RL+ LD+S+N LSG +P        L+ L++
Sbjct  358   GLQKFSLSGNKFKGIIDFPPLRTNALSYERLQFLDLSSNVLSGVVPSEIGAFKGLQFLNM  417

Query  1029  GSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              SN F+G IP  +G       +DLS N F G+IP  +
Sbjct  418   SSNSFTGSIPRSVGDLNLAQVIDLSYNRFNGSIPSEI  454


 Score = 77.8 bits (190),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 102/198 (52%), Gaps = 13/198 (7%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKL----------EHLNVLSLASNNFSGVISPqlglltnlq  647
             + E+ L    LSG   +G+             E L  L L+SN  SGV+  ++G    LQ
Sbjct  354   IFELGLQKFSLSGNKFKGIIDFPPLRTNALSYERLQFLDLSSNVLSGVVPSEIGAFKGLQ  413

Query  648   tlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEG  827
              LN+S NS +G++P S+G+++  Q +DLS N  +G +   +   L +LR L L G+   G
Sbjct  414   FLNMSSNSFTGSIPRSVGDLNLAQVIDLSYNRFNGSIPSEIGGAL-ALRELRLEGNRLSG  472

Query  828   PIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLH  1007
              IP+ +  C+ L  L LS N  +G       I  L  L   D+S+N LSG+LP   + L 
Sbjct  473   HIPAQIENCSFLTALILSENNLTGP--IPPTIAKLVNLEIADLSHNNLSGNLPKELTGLS  530

Query  1008  NLKELSLGSNHFSGEIPV  1061
             +L   ++ +N+  GE+P 
Sbjct  531   HLVAFNISNNNLEGELPA  548


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 93/169 (55%), Gaps = 3/169 (2%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL    LSG +   +   + L  L+++SN+F+G I   +G L   Q ++LS N  
Sbjct  387   RLQFLDLSSNVLSGVVPSEIGAFKGLQFLNMSSNSFTGSIPRSVGDLNLAQVIDLSYNRF  446

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
             +G++P  +G   +L+ L L GN LSG +  + +EN   L  L L+ ++  GPIP +++K 
Sbjct  447   NGSIPSEIGGALALRELRLEGNRLSGHIP-AQIENCSFLTALILSENNLTGPIPPTIAKL  505

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASF  1001
               L   +LS+N  SG+      + GL+ L   ++SNN L G LP G  F
Sbjct  506   VNLEIADLSHNNLSGN--LPKELTGLSHLVAFNISNNNLEGELPAGGFF  552


 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 117/220 (53%), Gaps = 11/220 (5%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             + V L+G  LSG++      +E L  L L+ N F G I   LG + +L+ LNLS N I+G
Sbjct  265   TSVSLNGNLLSGEVPDWFGHMESLENLDLSVNKFFGRIPFTLGNMRSLKELNLSSNGITG  324

Query  681   TVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEG-----PIPSSL  845
              +P SL N  +L  LD+S N L G + + + E LG  +F SL+G+ F+G     P+ ++ 
Sbjct  325   GLPQSLMNCDNLLSLDVSFNLLKGKMPNWIFE-LGLQKF-SLSGNKFKGIIDFPPLRTNA  382

Query  846   SKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKEL  1022
                  L  L+LS+N  SG  P   G   GL   + L++S+N  +GS+P     L+  + +
Sbjct  383   LSYERLQFLDLSSNVLSGVVPSEIGAFKGL---QFLNMSSNSFTGSIPRSVGDLNLAQVI  439

Query  1023  SLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
              L  N F+G IP ++G    L  L L  N  +G IP  ++
Sbjct  440   DLSYNRFNGSIPSEIGGALALRELRLEGNRLSGHIPAQIE  479



>gb|AAL49790.1| unknown protein [Arabidopsis thaliana]
Length=964

 Score =   213 bits (541),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 119/262 (45%), Positives = 161/262 (61%), Gaps = 25/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LN DVLGLIVFK+ ++DP   LA+W+EDD +PC+WN VKCHP   RV+E++L G  LSG+
Sbjct  25    LNGDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWNGVKCHPRTNRVTELNLDGFSLSGR  84

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L+ LSL++NN +G+I+P                       + L ++ +L+
Sbjct  85    IGRGLLQLQFLHKLSLSNNNLTGIINP-----------------------NMLLSLVNLK  121

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N LSG + D      GSLR LSLA +   G IP S+S C+ L  LNLS+N FSG
Sbjct  122   VVDLSSNGLSGSLPDEFFRQCGSLRVLSLAKNKLTGKIPVSISSCSSLAALNLSSNGFSG  181

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIW L  LR+LD+S NEL G  P     L+NL+ L L  N  SG IP ++G C 
Sbjct  182   SMPL--GIWSLNTLRSLDLSRNELEGEFPEKIDRLNNLRALDLSRNRLSGPIPSEIGSCM  239

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLSEN  +G++P + Q+
Sbjct  240   LLKTIDLSENSLSGSLPNTFQQ  261


 Score = 84.0 bits (206),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 111/211 (53%), Gaps = 14/211 (7%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    LSG +    ++L     L+L  N   G +   +G + +L+TL+LS N  SG V
Sbjct  244   IDLSENSLSGSLPNTFQQLSLCYSLNLGKNALEGEVPKWIGEMRSLETLDLSMNKFSGQV  303

Query  687   PDSLGNMSSLQFLDLSGNSLSG--PVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTL  860
             PDS+GN+ +L+ L+ SGN L G  PVS +   N  +L  L L+G+S  G +P  L +   
Sbjct  304   PDSIGNLLALKVLNFSGNGLIGSLPVSTA---NCINLLALDLSGNSLTGKLPMWLFQDGS  360

Query  861   LNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNH  1040
              +   L N+  +G         G+ +++ LD+S+N  SG +  G   L +L+ L L  N 
Sbjct  361   RDVSALKNDNSTG---------GIKKIQVLDLSHNAFSGEIGAGLGDLRDLEGLHLSRNS  411

Query  1041  FSGEIPVDLGLCPHLSRLDLSENLFTGTIPE  1133
              +G IP  +G   HLS LD+S N   G IP 
Sbjct  412   LTGPIPSTIGELKHLSVLDVSHNQLNGMIPR  442


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 113/229 (49%), Gaps = 22/229 (10%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL     SG++   +  L  L VL+ + N   G +        NL  L+LS NS++G +
Sbjct  292   LDLSMNKFSGQVPDSIGNLLALKVLNFSGNGLIGSLPVSTANCINLLALDLSGNSLTGKL  351

Query  687   P-----------------DSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGS  815
             P                 +S G +  +Q LDLS N+ SG +  + L +L  L  L L+ +
Sbjct  352   PMWLFQDGSRDVSALKNDNSTGGIKKIQVLDLSHNAFSGEIG-AGLGDLRDLEGLHLSRN  410

Query  816   SFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIG  992
             S  GPIPS++ +   L+ L++S+N+ +G  PR +GG   L  LR   + NN L G++P  
Sbjct  411   SLTGPIPSTIGELKHLSVLDVSHNQLNGMIPRETGGAVSLEELR---LENNLLEGNIPSS  467

Query  993   ASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
                  +L+ L L  N   G IP +L     L  +DLS N   GT+P+ L
Sbjct  468   IKNCSSLRSLILSHNKLLGSIPPELAKLTRLEEVDLSFNELAGTLPKQL  516


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 95/167 (57%), Gaps = 3/167 (2%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             ++ + VL L+ N FSG I   LG L +L+ L+LS+NS++G +P ++G +  L  LD+S N
Sbjct  375   IKKIQVLDLSHNAFSGEIGAGLGDLRDLEGLHLSRNSLTGPIPSTIGELKHLSVLDVSHN  434

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
              L+G +       + SL  L L  +  EG IPSS+  C+ L  L LS+N+  G       
Sbjct  435   QLNGMIPRETGGAV-SLEELRLENNLLEGNIPSSIKNCSSLRSLILSHNKLLGS--IPPE  491

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             +  LTRL  +D+S NEL+G+LP   + L  L   ++  NH  GE+P 
Sbjct  492   LAKLTRLEEVDLSFNELAGTLPKQLANLGYLHTFNISHNHLFGELPA  538


 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 109/223 (49%), Gaps = 18/223 (8%)
 Frame = +3

Query  525   GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  704
              L G++ + + ++  L  L L+ N FSG +   +G L  L+ LN S N + G++P S  N
Sbjct  274   ALEGEVPKWIGEMRSLETLDLSMNKFSGQVPDSIGNLLALKVLNFSGNGLIGSLPVSTAN  333

Query  705   MSSLQFLDLSGNSLSGPV----------------SDSMLENLGSLRFLSLAGSSFEGPIP  836
               +L  LDLSGNSL+G +                +D+    +  ++ L L+ ++F G I 
Sbjct  334   CINLLALDLSGNSLTGKLPMWLFQDGSRDVSALKNDNSTGGIKKIQVLDLSHNAFSGEIG  393

Query  837   SSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLK  1016
             + L     L  L+LS N  +G       I  L  L  LDVS+N+L+G +P       +L+
Sbjct  394   AGLGDLRDLEGLHLSRNSLTGP--IPSTIGELKHLSVLDVSHNQLNGMIPRETGGAVSLE  451

Query  1017  ELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             EL L +N   G IP  +  C  L  L LS N   G+IP  L +
Sbjct  452   ELRLENNLLEGNIPSSIKNCSSLRSLILSHNKLLGSIPPELAK  494



>ref|XP_006429586.1| hypothetical protein CICLE_v10010994mg [Citrus clementina]
 gb|ESR42826.1| hypothetical protein CICLE_v10010994mg [Citrus clementina]
Length=969

 Score =   213 bits (541),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 157/262 (60%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLIVFK+G++DP   L +WSEDDD+PC W  VKC P   RV  + L G  LSG 
Sbjct  27    FNDDVLGLIVFKAGLEDPKEKLTSWSEDDDNPCNWVGVKCDPKTKRVVGLTLDGFSLSGH  86

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L VLSL++NNF+G I+                          L +  +LQ
Sbjct  87    IGRGLLRLQFLQVLSLSNNNFTGTINA------------------------DLASFGTLQ  122

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +D S N+LSG + D      GSLR +S A ++  GPIP SLS C+ L  +N S+NR SG
Sbjct  123   VVDFSENNLSGLIPDEFFRQCGSLREVSFANNNLTGPIPESLSFCSSLESVNFSSNRLSG  182

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                +  GIW L  L++LD+SNN L G +  G S L++L+ + LG N FSG++P D+G C 
Sbjct  183   QLPY--GIWFLRSLQSLDLSNNLLEGEIVKGISNLYDLRAIKLGKNKFSGQLPEDIGGCS  240

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LD   N  +G++P+SLQR
Sbjct  241   MLKVLDFGVNSLSGSLPDSLQR  262


 Score = 81.3 bits (199),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 116/240 (48%), Gaps = 29/240 (12%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             S + L G   +G++   + KL +L  L L+ N FS  I   +G L  L+ LN+S N  +G
Sbjct  267   SSLSLKGNSFTGEVPDWIGKLANLESLDLSLNQFSVRIPSSIGNLVFLKELNISMNQFTG  326

Query  681   TVPDSLGNMSSLQFLDLSGNSLSG---------------------------PVSDSMLEN  779
              +P+S+ N  +L  +D+S N L+G                           P S SM ++
Sbjct  327   GLPESMMNCGNLLAIDVSQNKLTGNIPTWIFKMGLQTVSLSGNRLGESMQYPSSASMKDS  386

Query  780   LGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVS  959
                L+ L L+ ++  G IPS++   + L  LN+S N   G       I  L  ++ LD S
Sbjct  387   YQGLQVLDLSSNALSGVIPSNIGDLSSLMLLNMSMNYLFGS--IPASIGKLKAIQVLDFS  444

Query  960   NNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +N L+G++P       +LKEL L  N  SG IP  +  C  L+ L LS+N  TG +P ++
Sbjct  445   DNWLNGTIPPQIGGAVSLKELKLEKNFLSGRIPSQIKNCSSLTSLILSQNNLTGPVPAAI  504


 Score = 77.8 bits (190),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 62/169 (37%), Positives = 93/169 (55%), Gaps = 3/169 (2%)
 Frame = +3

Query  555   EKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLS  734
             +  + L VL L+SN  SGVI   +G L++L  LN+S N + G++P S+G + ++Q LD S
Sbjct  385   DSYQGLQVLDLSSNALSGVIPSNIGDLSSLMLLNMSMNYLFGSIPASIGKLKAIQVLDFS  444

Query  735   GNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFS  914
              N L+G +    +    SL+ L L  +   G IPS +  C+ L  L LS N  +G     
Sbjct  445   DNWLNGTIP-PQIGGAVSLKELKLEKNFLSGRIPSQIKNCSSLTSLILSQNNLTGP--VP  501

Query  915   GGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
               I  L+ L+ +D+S N+LSG LP     L +L   ++  NH  GE+PV
Sbjct  502   AAIANLSNLKYVDLSFNDLSGILPKELINLSHLLSFNISHNHLHGELPV  550


 Score = 77.8 bits (190),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 68/207 (33%), Positives = 112/207 (54%), Gaps = 5/207 (2%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             LSG +   L++L   + LSL  N+F+G +   +G L NL++L+LS N  S  +P S+GN+
Sbjct  252   LSGSLPDSLQRLNSCSSLSLKGNSFTGEVPDWIGKLANLESLDLSLNQFSVRIPSSIGNL  311

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
               L+ L++S N  +G + +SM+ N G+L  + ++ +   G IP+ + K   L  ++LS N
Sbjct  312   VFLKELNISMNQFTGGLPESMM-NCGNLLAIDVSQNKLTGNIPTWIFKMG-LQTVSLSGN  369

Query  888   RFSGDPRFSGGIW---GLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
             R     ++            L+ LD+S+N LSG +P     L +L  L++  N+  G IP
Sbjct  370   RLGESMQYPSSASMKDSYQGLQVLDLSSNALSGVIPSNIGDLSSLMLLNMSMNYLFGSIP  429

Query  1059  VDLGLCPHLSRLDLSENLFTGTIPESL  1139
               +G    +  LD S+N   GTIP  +
Sbjct  430   ASIGKLKAIQVLDFSDNWLNGTIPPQI  456



>ref|XP_006481196.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=967

 Score =   212 bits (540),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 157/262 (60%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLIVFK+G++DP   L +WSEDDD+PC W  VKC P   RV  + L G  LSG 
Sbjct  25    FNDDVLGLIVFKAGLEDPKEKLTSWSEDDDNPCNWVGVKCDPKTKRVVGLTLDGFSLSGH  84

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L VLSL++NNF+G I+                          L +  +LQ
Sbjct  85    IGRGLLRLQFLQVLSLSNNNFTGTINA------------------------DLASFGTLQ  120

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +D S N+LSG + D      GSLR +S A ++  GPIP SLS C+ L  +N S+NR SG
Sbjct  121   VVDFSENNLSGLIPDEFFRQCGSLREVSFANNNLTGPIPESLSFCSSLESVNFSSNRLSG  180

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                +  GIW L  L++LD+SNN L G +  G S L++L+ + LG N FSG++P D+G C 
Sbjct  181   QLPY--GIWFLRSLQSLDLSNNLLEGEIVKGISNLYDLRAIKLGKNKFSGQLPEDIGGCS  238

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LD   N  +G++P+SLQR
Sbjct  239   MLKVLDFGVNSLSGSLPDSLQR  260


 Score = 81.3 bits (199),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 116/240 (48%), Gaps = 29/240 (12%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             S + L G   +G++   + KL +L  L L+ N FS  I   +G L  L+ LN+S N  +G
Sbjct  265   SSLSLKGNSFTGEVPDWIGKLANLESLDLSLNQFSVRIPSSIGNLVFLKELNISMNQFTG  324

Query  681   TVPDSLGNMSSLQFLDLSGNSLSG---------------------------PVSDSMLEN  779
              +P+S+ N  +L  +D+S N L+G                           P S SM ++
Sbjct  325   GLPESMMNCGNLLAIDVSQNKLTGNIPTWIFKMGLQTVSLSGNRLGESMQYPSSASMKDS  384

Query  780   LGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVS  959
                L+ L L+ ++  G IPS++   + L  LN+S N   G       I  L  ++ LD S
Sbjct  385   YQGLQVLDLSSNALSGVIPSNIGDLSSLMLLNMSMNYLFGS--IPASIGKLKAIQVLDFS  442

Query  960   NNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +N L+G++P       +LKEL L  N  SG IP  +  C  L+ L LS+N  TG +P ++
Sbjct  443   DNWLNGTIPPQIGGAVSLKELKLEKNFLSGRIPSQIKNCSSLTSLILSQNNLTGPVPAAI  502


 Score = 77.8 bits (190),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 68/207 (33%), Positives = 112/207 (54%), Gaps = 5/207 (2%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             LSG +   L++L   + LSL  N+F+G +   +G L NL++L+LS N  S  +P S+GN+
Sbjct  250   LSGSLPDSLQRLNSCSSLSLKGNSFTGEVPDWIGKLANLESLDLSLNQFSVRIPSSIGNL  309

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
               L+ L++S N  +G + +SM+ N G+L  + ++ +   G IP+ + K   L  ++LS N
Sbjct  310   VFLKELNISMNQFTGGLPESMM-NCGNLLAIDVSQNKLTGNIPTWIFKMG-LQTVSLSGN  367

Query  888   RFSGDPRFSGGIW---GLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
             R     ++            L+ LD+S+N LSG +P     L +L  L++  N+  G IP
Sbjct  368   RLGESMQYPSSASMKDSYQGLQVLDLSSNALSGVIPSNIGDLSSLMLLNMSMNYLFGSIP  427

Query  1059  VDLGLCPHLSRLDLSENLFTGTIPESL  1139
               +G    +  LD S+N   GTIP  +
Sbjct  428   ASIGKLKAIQVLDFSDNWLNGTIPPQI  454


 Score = 77.8 bits (190),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 62/169 (37%), Positives = 93/169 (55%), Gaps = 3/169 (2%)
 Frame = +3

Query  555   EKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLS  734
             +  + L VL L+SN  SGVI   +G L++L  LN+S N + G++P S+G + ++Q LD S
Sbjct  383   DSYQGLQVLDLSSNALSGVIPSNIGDLSSLMLLNMSMNYLFGSIPASIGKLKAIQVLDFS  442

Query  735   GNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFS  914
              N L+G +    +    SL+ L L  +   G IPS +  C+ L  L LS N  +G     
Sbjct  443   DNWLNGTIP-PQIGGAVSLKELKLEKNFLSGRIPSQIKNCSSLTSLILSQNNLTGP--VP  499

Query  915   GGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
               I  L+ L+ +D+S N+LSG LP     L +L   ++  NH  GE+PV
Sbjct  500   AAIANLSNLKYVDLSFNDLSGILPKELINLSHLLSFNISHNHLHGELPV  548



>gb|KDO64103.1| hypothetical protein CISIN_1g002094mg [Citrus sinensis]
Length=967

 Score =   212 bits (540),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 157/262 (60%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLIVFK+G++DP   L +WSEDDD+PC W  VKC P   RV  + L G  LSG 
Sbjct  25    FNDDVLGLIVFKAGLEDPKEKLTSWSEDDDNPCNWVGVKCDPKTKRVVGLTLDGFSLSGH  84

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L VLSL++NNF+G I+                          L +  +LQ
Sbjct  85    IGRGLLRLQFLQVLSLSNNNFTGTINA------------------------DLASFGTLQ  120

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +D S N+LSG + D      GSLR +S A ++  GPIP SLS C+ L  +N S+NR SG
Sbjct  121   VVDFSENNLSGLIPDEFFRQCGSLREVSFANNNLTGPIPESLSFCSSLESVNFSSNRLSG  180

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                +  GIW L  L++LD+SNN L G +  G S L++L+ + LG N FSG++P D+G C 
Sbjct  181   QLPY--GIWFLRSLQSLDLSNNLLEGEIVKGISNLYDLRAIKLGKNKFSGQLPEDIGGCS  238

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LD   N  +G++P+SLQR
Sbjct  239   MLKVLDFGVNSLSGSLPDSLQR  260


 Score = 84.3 bits (207),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 114/207 (55%), Gaps = 5/207 (2%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             LSG +   L++L   + LSL  N+F+G +   +G L NL++L+LS N  SG +P S+GN+
Sbjct  250   LSGSLPDSLQRLNSCSSLSLKGNSFTGEVPDWIGKLANLESLDLSLNQFSGRIPSSIGNL  309

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
               L+ L++S N  +G + +SM+ N G+L  + ++ +   G IP+ + K   L  ++LS N
Sbjct  310   VFLKELNISMNQFTGGLPESMM-NCGNLLAIDVSQNKLTGNIPTWIFKMG-LQTVSLSGN  367

Query  888   RFSGD---PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
             R       P F+        L+ LD+S+N LSG +P     L +L  L++  N+  G IP
Sbjct  368   RLGESMQYPSFASMKDSYQGLQVLDLSSNALSGVIPSNIGDLSSLMLLNMSMNYLFGSIP  427

Query  1059  VDLGLCPHLSRLDLSENLFTGTIPESL  1139
               +G    +  LD S+N   GTIP  +
Sbjct  428   ASIGKLKAIQVLDFSDNWLNGTIPPQI  454


 Score = 82.0 bits (201),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 116/240 (48%), Gaps = 29/240 (12%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             S + L G   +G++   + KL +L  L L+ N FSG I   +G L  L+ LN+S N  +G
Sbjct  265   SSLSLKGNSFTGEVPDWIGKLANLESLDLSLNQFSGRIPSSIGNLVFLKELNISMNQFTG  324

Query  681   TVPDSLGNMSSLQFLDLSGNSLSG---------------------------PVSDSMLEN  779
              +P+S+ N  +L  +D+S N L+G                           P   SM ++
Sbjct  325   GLPESMMNCGNLLAIDVSQNKLTGNIPTWIFKMGLQTVSLSGNRLGESMQYPSFASMKDS  384

Query  780   LGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVS  959
                L+ L L+ ++  G IPS++   + L  LN+S N   G       I  L  ++ LD S
Sbjct  385   YQGLQVLDLSSNALSGVIPSNIGDLSSLMLLNMSMNYLFGS--IPASIGKLKAIQVLDFS  442

Query  960   NNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +N L+G++P       +LKEL L  N  SG IP  +  C  L+ L LS+N  TG +P ++
Sbjct  443   DNWLNGTIPPQIGGAVSLKELKLEKNFLSGRIPSQIKNCSSLTSLILSQNNLTGPVPAAI  502


 Score = 77.8 bits (190),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 62/169 (37%), Positives = 93/169 (55%), Gaps = 3/169 (2%)
 Frame = +3

Query  555   EKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLS  734
             +  + L VL L+SN  SGVI   +G L++L  LN+S N + G++P S+G + ++Q LD S
Sbjct  383   DSYQGLQVLDLSSNALSGVIPSNIGDLSSLMLLNMSMNYLFGSIPASIGKLKAIQVLDFS  442

Query  735   GNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFS  914
              N L+G +    +    SL+ L L  +   G IPS +  C+ L  L LS N  +G     
Sbjct  443   DNWLNGTIP-PQIGGAVSLKELKLEKNFLSGRIPSQIKNCSSLTSLILSQNNLTGP--VP  499

Query  915   GGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
               I  L+ L+ +D+S N+LSG LP     L +L   ++  NH  GE+PV
Sbjct  500   AAIANLSNLKYVDLSFNDLSGILPKELINLSHLLSFNISHNHLHGELPV  548



>ref|XP_008388889.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=469

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 114/262 (44%), Positives = 160/262 (61%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ +QDP   L +WSEDDDS C+W  VKCHP + RV E++L    LSG 
Sbjct  31    LNDDVLGLIVFKANIQDPKGKLXSWSEDDDSACSWVGVKCHPRSNRVIELNLDDFSLSGH  90

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L  LSL+ NN +G ++P                        ++ ++ +L+
Sbjct  91    IGRGLLQLQALRKLSLSKNNLTGSLTP------------------------NIAHIDNLR  126

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              LDLS NS SG V +      GSLR +SLA + F G IP SL  C  L  +NLS N+FSG
Sbjct  127   VLDLSENSFSGDVPEEFFRQCGSLRXISLAKNKFSGKIPESLGSCPSLASVNLSLNQFSG  186

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   G+W L+ +R+LD+S+N L G +P G   L+NL+ ++L  N F+G++P  +G   
Sbjct  187   S--VPAGVWSLSGIRSLDLSDNLLEGGIPKGVEGLNNLRGINLARNRFTGQVPDGIGNWL  244

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLSEN F+G +P+++Q+
Sbjct  245   LLRSIDLSENSFSGNLPQTMQK  266


 Score = 92.8 bits (229),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 79/231 (34%), Positives = 111/231 (48%), Gaps = 27/231 (12%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
              +G++  G+     L  + L+ N+FSG +   +  L     LNL +N+ SG VP+ +G  
Sbjct  232   FTGQVPDGIGNWLLLRSIDLSENSFSGNLPQTMQKLGLCSYLNLHQNTFSGEVPEWIGEX  291

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
              SL+ LDLS N  SG V  S + NL SL+ L+ + + F G +P SLS CT L  L+ S N
Sbjct  292   KSLETLDLSSNQFSGEVPSS-IGNLESLKVLNFSANGFTGSLPKSLSYCTNLMALDFSKN  350

Query  888   RFSGD--------------------------PRFSGGIWGLTRLRTLDVSNNELSGSLPI  989
               +G+                          P  S     L  L+ LD+S N  SG +  
Sbjct  351   SMAGELPVWIFAAGTEEVSLSEKKLSGSKNIPLSSSAGNALKNLQVLDLSLNHFSGEITS  410

Query  990   GASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
                 L +L  L+L  N  +G IPV +G    L  LDLSEN   GTIP S++
Sbjct  411   DIGALSSLHVLNLSGNSLAGPIPVAIGDLKVLDNLDLSENRLNGTIPTSIE  461



>ref|XP_006398567.1| hypothetical protein EUTSA_v10012579mg [Eutrema salsugineum]
 gb|ESQ40020.1| hypothetical protein EUTSA_v10012579mg [Eutrema salsugineum]
Length=972

 Score =   212 bits (539),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 117/261 (45%), Positives = 160/261 (61%), Gaps = 26/261 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C P + RV+E+ L G  LSG 
Sbjct  26    FNDDVLGLIVFKAGLDDPYSKLASWNAEDYDPCNWAGCVCDPGSNRVTELRLDGFSLSGH  85

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L+ L L++NN +G ++P                           ++ +LQ
Sbjct  86    IGRGLLRLQFLHTLVLSNNNLTGTLNP------------------------EFPHLGTLQ  121

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              LD SGN+LSG + D   E  GSLR +SLA +   GP+P SLS C+ L HLNLS+N+ SG
Sbjct  122   VLDFSGNNLSGRIPDGFFEQCGSLRSVSLANNQLTGPLPVSLSYCSTLTHLNLSSNQISG  181

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
               R    IW L  L++LD+S N L G LP G   L++L+E +L  N FSG+IP D+G C 
Sbjct  182   --RLPREIWFLKSLKSLDLSVNFLQGLLPDGIGGLYDLREFNLSKNWFSGDIPSDIGTCS  239

Query  1080  HLSRLDLSENLFTGTIPESLQ  1142
              L+ LDLS+N F+G++P S++
Sbjct  240   SLTSLDLSDNYFSGSLPNSMK  260


 Score =   100 bits (248),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 86/243 (35%), Positives = 126/243 (52%), Gaps = 29/243 (12%)
 Frame = +3

Query  492   GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  671
             G  + + L G  L G+I   + ++  L  L L++NNFSG +   LG L  L+ LNLS N 
Sbjct  263   GSCTTIRLRGNSLIGEIPDWIGEMASLETLDLSANNFSGNVPLSLGNLEFLKVLNLSTNM  322

Query  672   ISGTVPDSLGNMSSLQFLDLSGNSLSGPV------------------------SDSMLEN  779
             ++G +P ++ N S+L  +D+S NSL+G V                        +D+ L  
Sbjct  323   LAGEIPQTISNCSNLISIDVSKNSLTGDVLRWMLNRNSESSSLSRFSLDKRSGNDTFLST  382

Query  780   LG---SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTL  950
             +G   SLR L L+ + F G IPS++   T L  LN+S N   G      GI GL     L
Sbjct  383   VGFLQSLRVLDLSSNGFSGEIPSNIWILTSLVQLNMSTNSLFGS--IPSGIGGLKVAEIL  440

Query  951   DVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             D+S+N L+G+LP       +LK+L L  N  +G+IP  +  C  L+ +DLSEN  +G IP
Sbjct  441   DLSSNLLNGTLPSEMGGAVSLKKLYLQRNRLTGQIPAQISNCSALNAIDLSENKLSGGIP  500

Query  1131  ESL  1139
              S+
Sbjct  501   GSI  503


 Score = 86.3 bits (212),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 96/166 (58%), Gaps = 3/166 (2%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             L+ L VL L+SN FSG I   + +LT+L  LN+S NS+ G++P  +G +   + LDLS N
Sbjct  386   LQSLRVLDLSSNGFSGEIPSNIWILTSLVQLNMSTNSLFGSIPSGIGGLKVAEILDLSSN  445

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
              L+G +   M   + SL+ L L  +   G IP+ +S C+ LN ++LS N+ SG     G 
Sbjct  446   LLNGTLPSEMGGAV-SLKKLYLQRNRLTGQIPAQISNCSALNAIDLSENKLSGG--IPGS  502

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
             I  L+ L  LD+S N LSGSLP     L +L   ++  N  +GE+P
Sbjct  503   IGSLSNLDYLDLSRNNLSGSLPKEIEKLSHLVTFNISHNSITGELP  548


 Score = 78.2 bits (191),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 74/232 (32%), Positives = 113/232 (49%), Gaps = 31/232 (13%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L G +  G+  L  L   +L+ N FSG I   +G  ++L +L+LS N  SG++P+S+  +
Sbjct  203   LQGLLPDGIGGLYDLREFNLSKNWFSGDIPSDIGTCSSLTSLDLSDNYFSGSLPNSMKTL  262

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
              S   + L GNSL G + D + E + SL  L L+ ++F G +P SL     L  LNLS N
Sbjct  263   GSCTTIRLRGNSLIGEIPDWIGE-MASLETLDLSANNFSGNVPLSLGNLEFLKVLNLSTN  321

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSG----------------------------SL  983
               +G+      I   + L ++DVS N L+G                            + 
Sbjct  322   MLAGE--IPQTISNCSNLISIDVSKNSLTGDVLRWMLNRNSESSSLSRFSLDKRSGNDTF  379

Query  984   PIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
                  FL +L+ L L SN FSGEIP ++ +   L +L++S N   G+IP  +
Sbjct  380   LSTVGFLQSLRVLDLSSNGFSGEIPSNIWILTSLVQLNMSTNSLFGSIPSGI  431



>ref|XP_002309183.1| hypothetical protein POPTR_0006s10910g [Populus trichocarpa]
 gb|EEE92706.1| hypothetical protein POPTR_0006s10910g [Populus trichocarpa]
Length=965

 Score =   212 bits (539),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 119/262 (45%), Positives = 163/262 (62%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLIVFK+G+QDP S L++W+EDDDSPC+W  VKC P   RV+E+ L G  LSG 
Sbjct  24    FNDDVLGLIVFKAGLQDPESKLSSWNEDDDSPCSWVGVKCEPNTHRVTELFLDGFSLSGH  83

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L VLSLA+N F+G I+P                         L  +  LQ
Sbjct  84    IGRGLLRLQFLQVLSLANNKFNGTINP------------------------DLPRLGGLQ  119

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS NSLSG + D   +  GSLR +S A +   G IP SLS C  L+ +N S+N   G
Sbjct  120   VIDLSDNSLSGSIPDGFFQQCGSLRSVSFARNDLTGMIPGSLSSCMTLSLVNFSSNGLCG  179

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
             +     G+W L  L++LD+S+N L G +P G + L++L+ ++L +N F+G++PVD+G   
Sbjct  180   E--LPSGLWYLRGLQSLDLSDNLLEGEIPEGIANLYDLRVINLKNNRFTGQLPVDIGGSQ  237

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LD SEN  +G++PESL+R
Sbjct  238   VLKLLDFSENSLSGSLPESLRR  259


 Score = 78.2 bits (191),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 118/240 (49%), Gaps = 29/240 (12%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             + V L G   +G++   + +L  L  L L++N FSG I   +G L  L+ LNLS N ++G
Sbjct  264   ATVRLGGNSFTGEVPGWIGELTDLESLDLSANRFSGRIPVSIGNLNVLKELNLSMNQLTG  323

Query  681   TVPDSLGNMSSLQFLDLSGNSLSG---------------------------PVSDSMLEN  779
              +P+S+ N  +L  +D+S N L+G                           P   S+  +
Sbjct  324   GLPESMMNCLNLLAIDVSHNRLTGNLPSWIFKSGLNRVSPSGNRFDESKQHPSGVSLAVS  383

Query  780   LGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVS  959
             +  L+ L L+ + F G IPS +   + L  LN+S N+  G       I  LT +R LD+S
Sbjct  384   IQGLQVLDLSSNVFSGEIPSDIGVLSSLLLLNVSRNQLFGS--IPSSIGDLTMIRALDLS  441

Query  960   NNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +N L+GS+P       +L EL L  N  +G+IP  +  C  L+ L LS N  TG IP ++
Sbjct  442   DNRLNGSIPSEIGGAISLTELRLEKNLLTGKIPTQIKKCSSLASLILSWNNLTGPIPVAV  501


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 66/196 (34%), Positives = 108/196 (55%), Gaps = 8/196 (4%)
 Frame = +3

Query  474   KCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtl  653
             +  P+  R  E   H  G+S  +      ++ L VL L+SN FSG I   +G+L++L  L
Sbjct  360   RVSPSGNRFDESKQHPSGVSLAV-----SIQGLQVLDLSSNVFSGEIPSDIGVLSSLLLL  414

Query  654   nlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPI  833
             N+S+N + G++P S+G+++ ++ LDLS N L+G +  S +    SL  L L  +   G I
Sbjct  415   NVSRNQLFGSIPSSIGDLTMIRALDLSDNRLNGSIP-SEIGGAISLTELRLEKNLLTGKI  473

Query  834   PSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNL  1013
             P+ + KC+ L  L LS N  +G       +  L  L+ +D+S N LSGSLP   + L +L
Sbjct  474   PTQIKKCSSLASLILSWNNLTGP--IPVAVANLINLQYVDLSFNRLSGSLPKELTNLSHL  531

Query  1014  KELSLGSNHFSGEIPV  1061
                ++  N+  G++P+
Sbjct  532   LSFNISHNNLQGDLPL  547


 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 72/233 (31%), Positives = 118/233 (51%), Gaps = 29/233 (12%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             LSG +   L +L     + L  N+F+G +   +G LT+L++L+LS N  SG +P S+GN+
Sbjct  249   LSGSLPESLRRLSSCATVRLGGNSFTGEVPGWIGELTDLESLDLSANRFSGRIPVSIGNL  308

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
             + L+ L+LS N L+G + +SM+  L +L  + ++ +   G +PS + K  L N ++ S N
Sbjct  309   NVLKELNLSMNQLTGGLPESMMNCL-NLLAIDVSHNRLTGNLPSWIFKSGL-NRVSPSGN  366

Query  888   RFSGDPRFSGGI---WGLTRLRTLD------------------------VSNNELSGSLP  986
             RF    +   G+     +  L+ LD                        VS N+L GS+P
Sbjct  367   RFDESKQHPSGVSLAVSIQGLQVLDLSSNVFSGEIPSDIGVLSSLLLLNVSRNQLFGSIP  426

Query  987   IGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
                  L  ++ L L  N  +G IP ++G    L+ L L +NL TG IP  +++
Sbjct  427   SSIGDLTMIRALDLSDNRLNGSIPSEIGGAISLTELRLEKNLLTGKIPTQIKK  479



>ref|NP_001290509.1| probably inactive leucine-rich repeat receptor-like protein kinase 
At3g28040 precursor [Elaeis guineensis]
 gb|AAO26311.1| receptor-like protein kinase [Elaeis guineensis]
Length=938

 Score =   211 bits (538),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 117/262 (45%), Positives = 162/262 (62%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ +++P S L +W+EDDD PC W  +KC P   RV+E+ L+G  LSGK
Sbjct  26    LNDDVLGLIVFKADLREPDSKLVSWNEDDDEPCCWTGIKCEPKTNRVTELSLNGFSLSGK  85

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L  LSL+ NNFSG +S                          L  + SL+
Sbjct  86    IGRGLLQLQSLRTLSLSKNNFSGTLS------------------------SDLLRLESLR  121

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              LDLS N LSGP+ D       S+R +SLA ++F G IPS++  C+ L  LNLS+NR SG
Sbjct  122   NLDLSENKLSGPIPDDFFGQCRSIRAISLAKNAFFGAIPSNVGFCSTLAALNLSSNRLSG  181

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                +   +W L  LR+LD+S+N L G +P+G S ++NL+ +SL  N  SG +P D+G C 
Sbjct  182   SLPWR--LWSLNALRSLDLSDNTLVGEIPVGISKMYNLRSISLHGNRLSGHLPDDIGDCL  239

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LDL+ N  +G++PES+++
Sbjct  240   LLKSLDLAGNSLSGSLPESMRK  261


 Score = 92.4 bits (228),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 109/209 (52%), Gaps = 6/209 (3%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             + LHG  LSG +   +     L  L LA N+ SG +   +  L+    L+LS N  SG V
Sbjct  220   ISLHGNRLSGHLPDDIGDCLLLKSLDLAGNSLSGSLPESMRKLSTCSYLSLSSNFFSGEV  279

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P  +G M SL+ LDLS N   G +  S L +L  L+ L L+ + F G  P SL  C  L 
Sbjct  280   PTWIGEMKSLETLDLSRNGFFGQLPGS-LGDLQLLKALKLSRNGFTGSFPESLCSCKSLV  338

Query  867   HLNLSNNRFSGDPRFSGGIWGL-TRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHF  1043
              ++LS N  +G       +W   + L+ + VS N+L+GS+ I +S   NL+ L L SN F
Sbjct  339   DVDLSQNSLTGKLP----LWVFESGLQQVLVSENKLNGSIVIPSSSASNLQVLVLSSNAF  394

Query  1044  SGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             SG IP  LG    L  LDLS N   G+IP
Sbjct  395   SGSIPEGLGKLKSLEVLDLSGNRLNGSIP  423


 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 84/237 (35%), Positives = 122/237 (51%), Gaps = 26/237 (11%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +  +DL G  LSG +   + KL   + LSL+SN FSG +   +G + +L+TL+LS+N   
Sbjct  241   LKSLDLAGNSLSGSLPESMRKLSTCSYLSLSSNFFSGEVPTWIGEMKSLETLDLSRNGFF  300

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIP-----SS  842
             G +P SLG++  L+ L LS N  +G   +S+  +  SL  + L+ +S  G +P     S 
Sbjct  301   GQLPGSLGDLQLLKALKLSRNGFTGSFPESLC-SCKSLVDVDLSQNSLTGKLPLWVFESG  359

Query  843   LSKCTL------------------LNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNE  968
             L +  +                  L  L LS+N FSG      G+  L  L  LD+S N 
Sbjct  360   LQQVLVSENKLNGSIVIPSSSASNLQVLVLSSNAFSGS--IPEGLGKLKSLEVLDLSGNR  417

Query  969   LSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             L+GS+P+      +LKEL L  N   G IP  +G C  L+ LDLS+N  TG IP +L
Sbjct  418   LNGSIPLEIGGAVSLKELRLEKNSLKGAIPTQIGNCASLTSLDLSQNNLTGPIPPTL  474



>ref|XP_002528692.1| Brassinosteroid LRR receptor kinase precursor, putative [Ricinus 
communis]
 gb|EEF33681.1| Brassinosteroid LRR receptor kinase precursor, putative [Ricinus 
communis]
Length=968

 Score =   211 bits (538),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 117/262 (45%), Positives = 161/262 (61%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLIVFK+G+QDP S L +W+ED ++PC W  VKC P   RV+E+ L G  LSG 
Sbjct  26    FNDDVLGLIVFKAGLQDPESKLTSWNEDSENPCNWVGVKCDPKTQRVTELALDGFFLSGH  85

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L +LSL++NNF+G I+P                         L  +  LQ
Sbjct  86    IGRGLIRLQFLQILSLSNNNFTGTINP------------------------DLSQLGGLQ  121

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N LSG + D   +  GSLR +S A ++  G IP SLS C  L  +N S+N+ SG
Sbjct  122   VIDLSRNKLSGFIPDEFFKQCGSLRSVSFAKNNLSGQIPESLSWCPSLAAVNFSSNQLSG  181

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
             +     G+W L  L++LD+S+N L G +P G + +++L+ + L  N FSG++PVD+G C 
Sbjct  182   E--LPSGLWFLRGLQSLDLSDNLLDGQIPGGIANVYDLRAIHLQKNRFSGQLPVDIGGCV  239

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LD SEN  +G++PESLQR
Sbjct  240   LLKMLDFSENSLSGSLPESLQR  261


 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 80/242 (33%), Positives = 113/242 (47%), Gaps = 31/242 (13%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +  +DL    L G+I  G+  +  L  + L  N FSG +   +G    L+ L+ S+NS+S
Sbjct  193   LQSLDLSDNLLDGQIPGGIANVYDLRAIHLQKNRFSGQLPVDIGGCVLLKMLDFSENSLS  252

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G++P+SL  + S   L L GNS +G +   + E L +L  L L+ + F G IP+S+    
Sbjct  253   GSLPESLQRLGSCTTLRLRGNSFAGEIPGWIGE-LPTLESLDLSANKFSGRIPTSIGNLN  311

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIG---------------  992
              L  LNLS N   G       +     L  LD+S N LSG+LP                 
Sbjct  312   TLKELNLSMNHLIGG--LPESMENCANLLVLDISQNRLSGTLPTWIFKMGLHSISISGNR  369

Query  993   -------------ASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPE  1133
                          AS L  LK L L SN  SGEIP D+G+   L   ++S N   G+IP 
Sbjct  370   LGWSMHYPSVASLASSLQGLKVLDLSSNALSGEIPADIGVISSLLLFNISRNRLFGSIPS  429

Query  1134  SL  1139
             S+
Sbjct  430   SI  431


 Score = 77.4 bits (189),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 93/167 (56%), Gaps = 3/167 (2%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             L+ L VL L+SN  SG I   +G++++L   N+S+N + G++P S+G +  +Q LD S N
Sbjct  386   LQGLKVLDLSSNALSGEIPADIGVISSLLLFNISRNRLFGSIPSSIGELKMIQVLDFSNN  445

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
              L+G +  S +    SL  L L  +S  G IP+ +  C+ L  L LS+N  +G       
Sbjct  446   KLNGRIP-SEIGGAASLVELRLEKNSLTGNIPTQIKNCSSLTSLILSHNNLTGP--VPAA  502

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             I  L+ L  +D+S N LSGSLP   + L  L   ++  N+  GE+P+
Sbjct  503   IANLSNLEYVDLSFNNLSGSLPKELTNLSRLVSFNISHNNLHGELPL  549


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 72/125 (58%), Gaps = 1/125 (1%)
 Frame = +3

Query  528  LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
            L G I   + +L+ + VL  ++N  +G I  ++G   +L  L L KNS++G +P  + N 
Sbjct  423  LFGSIPSSIGELKMIQVLDFSNNKLNGRIPSEIGGAASLVELRLEKNSLTGNIPTQIKNC  482

Query  708  SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
            SSL  L LS N+L+GPV  + + NL +L ++ L+ ++  G +P  L+  + L   N+S+N
Sbjct  483  SSLTSLILSHNNLTGPVP-AAIANLSNLEYVDLSFNNLSGSLPKELTNLSRLVSFNISHN  541

Query  888  RFSGD  902
               G+
Sbjct  542  NLHGE  546



>ref|XP_010103654.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB96537.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=978

 Score =   212 bits (539),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 163/262 (62%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ VQDP   LA+W+EDD+SPC W  V+C+P + RV+E++L G  LSG+
Sbjct  32    LNDDVLGLIVFKADVQDPKGMLASWNEDDNSPCGWMGVRCNPRSKRVTELNLDGFSLSGR  91

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             +GRGL +L+ L  LSLA                        +NS++G++  ++  + +L+
Sbjct  92    LGRGLLQLQFLRKLSLA------------------------RNSLNGSISSNIARIDNLR  127

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              LDL  NS SG + +      GSLR LSLA + F G IP SLS C+ +  ++LS+NR SG
Sbjct  128   VLDLRDNSFSGDIPEDFFRQCGSLRVLSLAKNKFSGKIPDSLSSCSTIASIDLSSNRLSG  187

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIW L  +R+LD+S+N L G +P     L+NL+ ++LG N  SG +P  +G C 
Sbjct  188   S--LPSGIWSLNGIRSLDLSDNFLEGEIPKAIQGLNNLRTINLGKNRLSGTVPDGIGSCL  245

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DL EN F+G++PE++Q+
Sbjct  246   LLRFIDLGENSFSGSLPETMQK  267


 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 73/240 (30%), Positives = 120/240 (50%), Gaps = 29/240 (12%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             ++LHG   +G++ + + ++++L  L L++N FSG +   LG L +L+ LN   N ++G++
Sbjct  274   LNLHGNSFAGEVPQWIGEMKNLETLDLSANKFSGQVPSSLGNLQSLKVLNFYANGLTGSL  333

Query  687   PDSLGNMSSLQFLDLSGNSLSG---------------------------PVSDSMLENLG  785
             P SL + ++L  LD S N ++G                           P+  S    L 
Sbjct  334   PKSLASCTNLLTLDFSQNLMTGDLPLWIFNSGLQEVSLSRGKQGGRMDIPMKSSAENGLQ  393

Query  786   SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNN  965
             +L+ L L+ +SF G I S++   + L  LNLS N   G    +     L  +  LD+S N
Sbjct  394   NLQVLDLSHNSFSGEISSNIGILSSLKFLNLSRNSLVGPIPVT--FEDLKLVVNLDLSRN  451

Query  966   ELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             +L+GS+P       +LKEL L  N   G+IP  +  C  L+ L LS N  +G IP ++ +
Sbjct  452   QLNGSIPEEIGGAVSLKELRLEENKLEGKIPTSIENCSSLTTLVLSLNKLSGPIPAAIAK  511


 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 81/239 (34%), Positives = 118/239 (49%), Gaps = 29/239 (12%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL     SG +   ++KL   N L+L  N+F+G +   +G + NL+TL+LS N  SG V
Sbjct  250   IDLGENSFSGSLPETMQKLSLCNYLNLHGNSFAGEVPQWIGEMKNLETLDLSANKFSGQV  309

Query  687   PDSLGNMSSLQFLDLSGNSLSG--PVSDSMLENLGSLRF--------------------L  800
             P SLGN+ SL+ L+   N L+G  P S +   NL +L F                    +
Sbjct  310   PSSLGNLQSLKVLNFYANGLTGSLPKSLASCTNLLTLDFSQNLMTGDLPLWIFNSGLQEV  369

Query  801   SLA----GSSFEGPIPSSLSK-CTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNN  965
             SL+    G   + P+ SS       L  L+LS+N FSG+   S  I  L+ L+ L++S N
Sbjct  370   SLSRGKQGGRMDIPMKSSAENGLQNLQVLDLSHNSFSGE--ISSNIGILSSLKFLNLSRN  427

Query  966   ELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
              L G +P+    L  +  L L  N  +G IP ++G    L  L L EN   G IP S++
Sbjct  428   SLVGPIPVTFEDLKLVVNLDLSRNQLNGSIPEEIGGAVSLKELRLEENKLEGKIPTSIE  486


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 82/157 (52%), Gaps = 3/157 (2%)
 Frame = +3

Query  660   SKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPS  839
             S NS SG +  ++G +SSL+FL+LS NSL GP+  +  E+L  +  L L+ +   G IP 
Sbjct  401   SHNSFSGEISSNIGILSSLKFLNLSRNSLVGPIPVT-FEDLKLVVNLDLSRNQLNGSIPE  459

Query  840   SLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKE  1019
              +     L  L L  N+  G  +    I   + L TL +S N+LSG +P   + L NL+ 
Sbjct  460   EIGGAVSLKELRLEENKLEG--KIPTSIENCSSLTTLVLSLNKLSGPIPAAIAKLVNLQN  517

Query  1020  LSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             + L  N+ +G +   L   P+L   ++S N   G +P
Sbjct  518   VDLSFNNLTGGLRKQLANLPNLISFNISHNNLQGELP  554



>ref|XP_010253067.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=970

 Score =   211 bits (538),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 119/262 (45%), Positives = 159/262 (61%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ +QDP S L +W+EDDDSPC W  VKC P   RVSE+ L G  LSG+
Sbjct  25    LNDDVLGLIVFKADLQDPESKLISWNEDDDSPCNWVGVKCDPRTNRVSELVLDGFSLSGR  84

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L  LSL++NNF+G I+P                        +L  +  L+
Sbjct  85    IGRGLLQLQFLRKLSLSNNNFTGSINP------------------------NLARLEGLR  120

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS NSLSG   D      GSLR +S A ++  G IP SL  C+ L  LN S+N+ SG
Sbjct  121   IIDLSDNSLSGSTPDDFFLQCGSLRAISFAKNNLSGQIPQSLISCSTLASLNFSSNQLSG  180

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIW L  LR+LD+S+N L G +P G    +NL+ ++L  N FSG++P D+G C 
Sbjct  181   P--LPSGIWSLNGLRSLDLSDNLLEGVIPKGMESSYNLRSINLRKNRFSGQLPDDIGGCS  238

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +D SEN  +G++P+S++R
Sbjct  239   LLRLIDFSENSLSGSLPDSMRR  260


 Score = 92.4 bits (228),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 119/215 (55%), Gaps = 7/215 (3%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             VDL G   +G I   L  L+ L +L+L+SN FSG +   L    NL  ++ S+NS++G +
Sbjct  291   VDLSGNMFAGGIPGSLGNLQSLKLLNLSSNGFSGGVPDSLSNCKNLLIIDFSQNSLTGNL  350

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSD----SMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
             P  +  +  LQ + LS N LSG + +    SM  +  +L+ L L+ ++F G IP ++   
Sbjct  351   PAWIFGLD-LQKVSLSENRLSGVIKNPSPLSMEPSYSNLQVLDLSDNAFSGEIPGNIGVF  409

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             + L  LN+S N   G    S G   L  +  LD+S N L+GS+P     + +LKEL L  
Sbjct  410   SNLLILNVSRNSLVGSIPTSIGY--LKAVTILDLSENRLNGSIPSEIGEVVSLKELRLEK  467

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             N  +G+IP  +G C  L+ L LS+N F+G IP +L
Sbjct  468   NFLAGKIPFQIGKCLSLTSLILSQNNFSGPIPATL  502


 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 128/241 (53%), Gaps = 35/241 (15%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    L G I +G+E   +L  ++L  N FSG +   +G  + L+ ++ S+NS+SG++
Sbjct  195   LDLSDNLLEGVIPKGMESSYNLRSINLRKNRFSGQLPDDIGGCSLLRLIDFSENSLSGSL  254

Query  687   PDSL------------------------GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  794
             PDS+                        G M SL+ +DLSGN  +G +  S L NL SL+
Sbjct  255   PDSMRRLTMCSSLSLHGNLFSGELPAVIGEMRSLEAVDLSGNMFAGGIPGS-LGNLQSLK  313

Query  795   FLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELS  974
              L+L+ + F G +P SLS C  L  ++ S N  +G+      I+GL  L+ + +S N LS
Sbjct  314   LLNLSSNGFSGGVPDSLSNCKNLLIIDFSQNSLTGN--LPAWIFGLD-LQKVSLSENRLS  370

Query  975   G------SLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPES  1136
             G       L +  S+  NL+ L L  N FSGEIP ++G+  +L  L++S N   G+IP S
Sbjct  371   GVIKNPSPLSMEPSY-SNLQVLDLSDNAFSGEIPGNIGVFSNLLILNVSRNSLVGSIPTS  429

Query  1137  L  1139
             +
Sbjct  430   I  430


 Score = 87.4 bits (215),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 112/214 (52%), Gaps = 5/214 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +D     LSG +   + +L   + LSL  N FSG +   +G + +L+ ++LS N  +G +
Sbjct  243   IDFSENSLSGSLPDSMRRLTMCSSLSLHGNLFSGELPAVIGEMRSLEAVDLSGNMFAGGI  302

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P SLGN+ SL+ L+LS N  SG V DS L N  +L  +  + +S  G +P+ +     L 
Sbjct  303   PGSLGNLQSLKLLNLSSNGFSGGVPDS-LSNCKNLLIIDFSQNSLTGNLPAWIFGLD-LQ  360

Query  867   HLNLSNNRFSG---DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSN  1037
              ++LS NR SG   +P         + L+ LD+S+N  SG +P       NL  L++  N
Sbjct  361   KVSLSENRLSGVIKNPSPLSMEPSYSNLQVLDLSDNAFSGEIPGNIGVFSNLLILNVSRN  420

Query  1038  HFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
                G IP  +G    ++ LDLSEN   G+IP  +
Sbjct  421   SLVGSIPTSIGYLKAVTILDLSENRLNGSIPSEI  454


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 67/192 (35%), Positives = 98/192 (51%), Gaps = 8/192 (4%)
 Frame = +3

Query  570   LNVLSLASNNFSGVI---SPqlg--lltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLS  734
             L  +SL+ N  SGVI   SP       +NLQ L+LS N+ SG +P ++G  S+L  L++S
Sbjct  359   LQKVSLSENRLSGVIKNPSPLSMEPSYSNLQVLDLSDNAFSGEIPGNIGVFSNLLILNVS  418

Query  735   GNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFS  914
              NSL G +  S +  L ++  L L+ +   G IPS + +   L  L L  N  +G   F 
Sbjct  419   RNSLVGSIPTS-IGYLKAVTILDLSENRLNGSIPSEIGEVVSLKELRLEKNFLAGKIPFQ  477

Query  915   GGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRL  1094
               I     L +L +S N  SG +P   + L NLK + L  N+ SG +P  L   P+L   
Sbjct  478   --IGKCLSLTSLILSQNNFSGPIPATLANLTNLKIVDLALNNLSGSLPKQLANLPYLLSF  535

Query  1095  DLSENLFTGTIP  1130
             ++S N   G +P
Sbjct  536   NISHNHLQGELP  547



>ref|XP_011019006.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score =   211 bits (536),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 163/262 (62%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGL+VFK+G+QDP S L++W+EDDDSPC+W  VKC P   RV+E+ L G  LSG 
Sbjct  24    LNDDVLGLMVFKAGLQDPESKLSSWNEDDDSPCSWVGVKCEPNTHRVTELFLDGFSLSGH  83

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L VLSLA+N F+G ++P                         L  +  LQ
Sbjct  84    IGRGLLRLQFLQVLSLANNKFNGTVNP------------------------DLPRLGGLQ  119

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS NSLSG + D   +  GSLR +S A +   G IP SLS C  L+ +N S+N   G
Sbjct  120   VIDLSDNSLSGSIPDGFFQQCGSLRSVSFARNDLTGMIPGSLSSCMTLSLVNFSSNGLCG  179

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
             +     G+W L  L++LD+S+N L G +P G + + +L+ ++L +N F+G++PVD+G   
Sbjct  180   E--LPSGLWYLRGLQSLDLSDNLLEGEVPEGIANMSDLRVINLKNNRFTGQLPVDIGGSQ  237

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LD SEN  +G++PESLQR
Sbjct  238   VLKLLDFSENSLSGSLPESLQR  259


 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 107/193 (55%), Gaps = 8/193 (4%)
 Frame = +3

Query  483   PANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlS  662
             P+  R  E   H  G+S  +      ++ L VL L+SN FSG I   +G+L++L  LNLS
Sbjct  363   PSGNRFDESIQHPSGVSLAV-----SIQGLQVLDLSSNVFSGEIPSDVGVLSSLLLLNLS  417

Query  663   KNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSS  842
             +N + G++P S+G+++ +Q LDLS N L+G +  S +    SL  L L  +   G IP+ 
Sbjct  418   RNQLFGSIPSSIGDLTMIQALDLSDNRLNGSLP-SEIGGAISLTELRLEKNLLTGKIPTQ  476

Query  843   LSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKEL  1022
             + KC+ L  L LS N  +G       I  L  L+ +D+S N LSGSLP   + L +L   
Sbjct  477   IKKCSSLTSLILSGNILTGP--IPVAIANLINLQYVDLSFNRLSGSLPKELTNLSHLLSF  534

Query  1023  SLGSNHFSGEIPV  1061
             ++  N+  G++P+
Sbjct  535   NISHNNLQGDLPL  547


 Score = 75.1 bits (183),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 81/253 (32%), Positives = 125/253 (49%), Gaps = 49/253 (19%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             LSG +   L++L     + L  N+F+G +   +G LT+L++L+LS N  SG +P S+GN+
Sbjct  249   LSGSLPESLQRLSSCATVRLGGNSFTGEVPGWIGELTDLESLDLSANRFSGRIPVSIGNL  308

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLG----------------------SLRFLSLAGSSF  821
             + L+ L+LS N L+G + +SM+  L                        L+ +S +G+ F
Sbjct  309   NVLKELNLSMNQLTGGLPESMMNCLNLLAIDVSHNRLTGNLPSWIFKPGLKSVSPSGNRF  368

Query  822   EGPI--PSSLSKCTL---LNHLNLSNNRFSGD-PRFSG---------------------G  920
             +  I  PS +S       L  L+LS+N FSG+ P   G                      
Sbjct  369   DESIQHPSGVSLAVSIQGLQVLDLSSNVFSGEIPSDVGVLSSLLLLNLSRNQLFGSIPSS  428

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDL  1100
             I  LT ++ LD+S+N L+GSLP       +L EL L  N  +G+IP  +  C  L+ L L
Sbjct  429   IGDLTMIQALDLSDNRLNGSLPSEIGGAISLTELRLEKNLLTGKIPTQIKKCSSLTSLIL  488

Query  1101  SENLFTGTIPESL  1139
             S N+ TG IP ++
Sbjct  489   SGNILTGPIPVAI  501


 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 79/283 (28%), Positives = 118/283 (42%), Gaps = 81/283 (29%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L G++  G+  +  L V++L +N F+G +   +G    L+ L+ S+NS+SG++P+SL  +
Sbjct  201   LEGEVPEGIANMSDLRVINLKNNRFTGQLPVDIGGSQVLKLLDFSENSLSGSLPESLQRL  260

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLS-N  884
             SS   + L GNS +G V   + E L  L  L L+ + F G IP S+    +L  LNLS N
Sbjct  261   SSCATVRLGGNSFTGEVPGWIGE-LTDLESLDLSANRFSGRIPVSIGNLNVLKELNLSMN  319

Query  885   NRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSL-------------------------PI  989
                 G P     +     L  +DVS+N L+G+L                         P 
Sbjct  320   QLTGGLPE---SMMNCLNLLAIDVSHNRLTGNLPSWIFKPGLKSVSPSGNRFDESIQHPS  376

Query  990   GASF---LHNLKELSLGSNHFSGEIPVDLGL-----------------------------  1073
             G S    +  L+ L L SN FSGEIP D+G+                             
Sbjct  377   GVSLAVSIQGLQVLDLSSNVFSGEIPSDVGVLSSLLLLNLSRNQLFGSIPSSIGDLTMIQ  436

Query  1074  -------------------CPHLSRLDLSENLFTGTIPESLQR  1145
                                   L+ L L +NL TG IP  +++
Sbjct  437   ALDLSDNRLNGSLPSEIGGAISLTELRLEKNLLTGKIPTQIKK  479


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 76/265 (29%), Positives = 119/265 (45%), Gaps = 55/265 (21%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             + V L G   +G++   + +L  L  L L++N FSG I   +G L  L+ LNLS N ++G
Sbjct  264   ATVRLGGNSFTGEVPGWIGELTDLESLDLSANRFSGRIPVSIGNLNVLKELNLSMNQLTG  323

Query  681   TVPDSLGNMSSLQFLDLSGNSLSG---------------------------PVSDSMLEN  779
              +P+S+ N  +L  +D+S N L+G                           P   S+  +
Sbjct  324   GLPESMMNCLNLLAIDVSHNRLTGNLPSWIFKPGLKSVSPSGNRFDESIQHPSGVSLAVS  383

Query  780   LGSLRFLSLAGSSFEGPIPS------------------------SLSKCTLLNHLNLSNN  887
             +  L+ L L+ + F G IPS                        S+   T++  L+LS+N
Sbjct  384   IQGLQVLDLSSNVFSGEIPSDVGVLSSLLLLNLSRNQLFGSIPSSIGDLTMIQALDLSDN  443

Query  888   RFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVD  1064
             R +G  P   GG   LT LR   +  N L+G +P       +L  L L  N  +G IPV 
Sbjct  444   RLNGSLPSEIGGAISLTELR---LEKNLLTGKIPTQIKKCSSLTSLILSGNILTGPIPVA  500

Query  1065  LGLCPHLSRLDLSENLFTGTIPESL  1139
             +    +L  +DLS N  +G++P+ L
Sbjct  501   IANLINLQYVDLSFNRLSGSLPKEL  525



>ref|XP_011019007.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score =   211 bits (536),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 163/262 (62%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGL+VFK+G+QDP S L++W+EDDDSPC+W  VKC P   RV+E+ L G  LSG 
Sbjct  24    LNDDVLGLMVFKAGLQDPESKLSSWNEDDDSPCSWVGVKCEPNTHRVTELFLDGFSLSGH  83

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L VLSLA+N F+G ++P                         L  +  LQ
Sbjct  84    IGRGLLRLQFLQVLSLANNKFNGTVNP------------------------DLPRLGGLQ  119

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS NSLSG + D   +  GSLR +S A +   G IP SLS C  L+ +N S+N   G
Sbjct  120   VIDLSDNSLSGSIPDGFFQQCGSLRSVSFARNDLTGMIPGSLSSCMTLSLVNFSSNGLCG  179

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
             +     G+W L  L++LD+S+N L G +P G + + +L+ ++L +N F+G++PVD+G   
Sbjct  180   E--LPSGLWYLRGLQSLDLSDNLLEGEVPEGIANMSDLRVINLKNNRFTGQLPVDIGGSQ  237

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LD SEN  +G++PESLQR
Sbjct  238   VLKLLDFSENSLSGSLPESLQR  259


 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 107/193 (55%), Gaps = 8/193 (4%)
 Frame = +3

Query  483   PANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlS  662
             P+  R  E   H  G+S  +      ++ L VL L+SN FSG I   +G+L++L  LNLS
Sbjct  363   PSGNRFDESIQHPSGVSLAV-----SIQGLQVLDLSSNVFSGEIPSDVGVLSSLLLLNLS  417

Query  663   KNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSS  842
             +N + G++P S+G+++ +Q LDLS N L+G +  S +    SL  L L  +   G IP+ 
Sbjct  418   RNQLFGSIPSSIGDLTMIQALDLSDNRLNGSLP-SEIGGAISLTELRLEKNLLTGKIPTQ  476

Query  843   LSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKEL  1022
             + KC+ L  L LS N  +G       I  L  L+ +D+S N LSGSLP   + L +L   
Sbjct  477   IKKCSSLTSLILSGNILTGP--IPVAIANLINLQYVDLSFNRLSGSLPKELTNLSHLLSF  534

Query  1023  SLGSNHFSGEIPV  1061
             ++  N+  G++P+
Sbjct  535   NISHNNLQGDLPL  547


 Score = 75.1 bits (183),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 81/253 (32%), Positives = 125/253 (49%), Gaps = 49/253 (19%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             LSG +   L++L     + L  N+F+G +   +G LT+L++L+LS N  SG +P S+GN+
Sbjct  249   LSGSLPESLQRLSSCATVRLGGNSFTGEVPGWIGELTDLESLDLSANRFSGRIPVSIGNL  308

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLG----------------------SLRFLSLAGSSF  821
             + L+ L+LS N L+G + +SM+  L                        L+ +S +G+ F
Sbjct  309   NVLKELNLSMNQLTGGLPESMMNCLNLLAIDVSHNRLTGNLPSWIFKPGLKSVSPSGNRF  368

Query  822   EGPI--PSSLSKCTL---LNHLNLSNNRFSGD-PRFSG---------------------G  920
             +  I  PS +S       L  L+LS+N FSG+ P   G                      
Sbjct  369   DESIQHPSGVSLAVSIQGLQVLDLSSNVFSGEIPSDVGVLSSLLLLNLSRNQLFGSIPSS  428

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDL  1100
             I  LT ++ LD+S+N L+GSLP       +L EL L  N  +G+IP  +  C  L+ L L
Sbjct  429   IGDLTMIQALDLSDNRLNGSLPSEIGGAISLTELRLEKNLLTGKIPTQIKKCSSLTSLIL  488

Query  1101  SENLFTGTIPESL  1139
             S N+ TG IP ++
Sbjct  489   SGNILTGPIPVAI  501


 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 79/283 (28%), Positives = 118/283 (42%), Gaps = 81/283 (29%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L G++  G+  +  L V++L +N F+G +   +G    L+ L+ S+NS+SG++P+SL  +
Sbjct  201   LEGEVPEGIANMSDLRVINLKNNRFTGQLPVDIGGSQVLKLLDFSENSLSGSLPESLQRL  260

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLS-N  884
             SS   + L GNS +G V   + E L  L  L L+ + F G IP S+    +L  LNLS N
Sbjct  261   SSCATVRLGGNSFTGEVPGWIGE-LTDLESLDLSANRFSGRIPVSIGNLNVLKELNLSMN  319

Query  885   NRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSL-------------------------PI  989
                 G P     +     L  +DVS+N L+G+L                         P 
Sbjct  320   QLTGGLPE---SMMNCLNLLAIDVSHNRLTGNLPSWIFKPGLKSVSPSGNRFDESIQHPS  376

Query  990   GASF---LHNLKELSLGSNHFSGEIPVDLGL-----------------------------  1073
             G S    +  L+ L L SN FSGEIP D+G+                             
Sbjct  377   GVSLAVSIQGLQVLDLSSNVFSGEIPSDVGVLSSLLLLNLSRNQLFGSIPSSIGDLTMIQ  436

Query  1074  -------------------CPHLSRLDLSENLFTGTIPESLQR  1145
                                   L+ L L +NL TG IP  +++
Sbjct  437   ALDLSDNRLNGSLPSEIGGAISLTELRLEKNLLTGKIPTQIKK  479


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 76/265 (29%), Positives = 119/265 (45%), Gaps = 55/265 (21%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             + V L G   +G++   + +L  L  L L++N FSG I   +G L  L+ LNLS N ++G
Sbjct  264   ATVRLGGNSFTGEVPGWIGELTDLESLDLSANRFSGRIPVSIGNLNVLKELNLSMNQLTG  323

Query  681   TVPDSLGNMSSLQFLDLSGNSLSG---------------------------PVSDSMLEN  779
              +P+S+ N  +L  +D+S N L+G                           P   S+  +
Sbjct  324   GLPESMMNCLNLLAIDVSHNRLTGNLPSWIFKPGLKSVSPSGNRFDESIQHPSGVSLAVS  383

Query  780   LGSLRFLSLAGSSFEGPIPS------------------------SLSKCTLLNHLNLSNN  887
             +  L+ L L+ + F G IPS                        S+   T++  L+LS+N
Sbjct  384   IQGLQVLDLSSNVFSGEIPSDVGVLSSLLLLNLSRNQLFGSIPSSIGDLTMIQALDLSDN  443

Query  888   RFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVD  1064
             R +G  P   GG   LT LR   +  N L+G +P       +L  L L  N  +G IPV 
Sbjct  444   RLNGSLPSEIGGAISLTELR---LEKNLLTGKIPTQIKKCSSLTSLILSGNILTGPIPVA  500

Query  1065  LGLCPHLSRLDLSENLFTGTIPESL  1139
             +    +L  +DLS N  +G++P+ L
Sbjct  501   IANLINLQYVDLSFNRLSGSLPKEL  525



>ref|XP_002870895.1| hypothetical protein ARALYDRAFT_486880 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47154.1| hypothetical protein ARALYDRAFT_486880 [Arabidopsis lyrata subsp. 
lyrata]
Length=968

 Score =   211 bits (536),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 118/261 (45%), Positives = 158/261 (61%), Gaps = 26/261 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLIVFKSG+ DP S L++W+ +D  PC W    C PA+ RVSE+ L    LSG 
Sbjct  25    FNDDVLGLIVFKSGLDDPLSKLSSWNSEDYDPCNWVGCTCDPASNRVSELRLDSFSLSGH  84

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L+ L L++NN +G ++P                           ++ SLQ
Sbjct  85    IGRGLLRLQFLHTLVLSNNNLTGTLNP------------------------EFPHLGSLQ  120

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +D SGNSLSG + D   E  GSLR +SLA +   GP+P SLS C+ L HLNLS+N+ SG
Sbjct  121   VVDFSGNSLSGRIPDGFFEQCGSLRSVSLANNKLTGPLPVSLSYCSTLIHLNLSSNQLSG  180

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
               R    IW L  L++LD+S N L G +P G   L++L+  +L  N FSG++P D+G CP
Sbjct  181   --RLPRDIWFLKSLKSLDLSVNFLQGDIPDGLGGLYDLRLFNLSRNWFSGDVPSDIGRCP  238

Query  1080  HLSRLDLSENLFTGTIPESLQ  1142
              L  LDLSEN F+G +P S++
Sbjct  239   SLKSLDLSENYFSGNLPASMK  259


 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 81/243 (33%), Positives = 122/243 (50%), Gaps = 29/243 (12%)
 Frame = +3

Query  492   GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  671
             G    + L G  L G+I   +  +  L  L L++NNFSG +   LG L  L+ LNLS N 
Sbjct  262   GSCRSIRLRGNSLIGEIPDWIGDVATLETLDLSANNFSGTVPSSLGNLEFLKELNLSANM  321

Query  672   ISGTVPDSLGNMSSLQFLDLSGNSLSGPV------------------------SDSMLEN  779
             ++G +P ++ N S+L  +D+S NS +G V                        +D++L  
Sbjct  322   LAGELPQTISNCSNLISIDVSKNSFTGDVLKWMFTGNSESPSLSRFSLHKRSGNDTILPI  381

Query  780   LG---SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTL  950
             +G    LR L L+ + F G +PS++   T L  LN+S N   G      G+ GL     L
Sbjct  382   VGFLQGLRVLDLSSNGFSGELPSNIWILTSLLQLNMSTNSLFGS--IPTGVGGLKVAEIL  439

Query  951   DVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             D+S N L+G++P       +LK+L L  N  SG+IP  +  C  L+ ++LSEN  +G IP
Sbjct  440   DLSCNLLNGTVPSEIGGAVSLKKLHLQRNRLSGQIPAQISNCSALNAINLSENELSGAIP  499

Query  1131  ESL  1139
              S+
Sbjct  500   GSI  502


 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 95/167 (57%), Gaps = 3/167 (2%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             L+ L VL L+SN FSG +   + +LT+L  LN+S NS+ G++P  +G +   + LDLS N
Sbjct  385   LQGLRVLDLSSNGFSGELPSNIWILTSLLQLNMSTNSLFGSIPTGVGGLKVAEILDLSCN  444

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
              L+G V  S +    SL+ L L  +   G IP+ +S C+ LN +NLS N  SG     G 
Sbjct  445   LLNGTVP-SEIGGAVSLKKLHLQRNRLSGQIPAQISNCSALNAINLSENELSG--AIPGS  501

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             I  L+ L  +D+S N LSGSLP     L +L   ++  N  +GE+P 
Sbjct  502   IGSLSNLEYIDLSRNNLSGSLPKEIEKLSHLLTFNISHNSITGELPA  548



>ref|XP_004305081.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
 ref|XP_011466417.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=956

 Score =   210 bits (535),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 117/262 (45%), Positives = 162/262 (62%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLIVFK+G+ DP + L++W+E+DD+PC W  VKC   + RVSE+ L G GLSG 
Sbjct  26    FNDDVLGLIVFKAGLLDPEAKLSSWNEEDDTPCHWVGVKCDVRSNRVSELALDGFGLSGH  85

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             + RGL +L+ +  LSL++NNF+G I+P                         L ++ +LQ
Sbjct  86    VNRGLLRLQVIQRLSLSNNNFTGSINP------------------------DLAHIGTLQ  121

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS NSLSG + D   +  GSLR +S A +   G IP SLS C+ L  +N S+N+ SG
Sbjct  122   VIDLSQNSLSGSIPDEFFQQCGSLRVVSFAKNKLSGRIPESLSFCSALVAVNFSSNQLSG  181

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIW L  L+ LD+S N L G +  G  +L++L+ ++LG N FSG +P D+G C 
Sbjct  182   S--LPSGIWYLRGLQELDLSGNLLEGEVHEGIGYLYDLRVVNLGKNRFSGWLPGDVGGCS  239

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
             HL  LD S+NLF+G IPES++R
Sbjct  240   HLKLLDFSDNLFSGGIPESIKR  261


 Score = 75.9 bits (185),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 78/258 (30%), Positives = 121/258 (47%), Gaps = 44/258 (17%)
 Frame = +3

Query  492   GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  671
             G    + L G  L+G++   + +L  L +L L+ NNFSG I   LG L  L+ LNLS N 
Sbjct  263   GLCRSLSLKGNSLTGQVPAWIGELRSLGMLDLSCNNFSGGIPGSLGNLKLLEKLNLSVNE  322

Query  672   ISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLE------------------NLGSLRF  797
              +G++P+SL N  +L  LD+S N L G +   +L+                  + G L+ 
Sbjct  323   FTGSLPESLTNCFNLLALDVSRNQLVGKLPSWILKLGVGHGKLEYNPLKPIAASHGGLQV  382

Query  798   LSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSG  977
             L L+ ++F   +PS +   + L  LN+S N+  G       I  L     LD+S+N L+G
Sbjct  383   LDLSSNAFSDVLPSDIGVLSSLQFLNVSRNQLLGS--IPASIGNLKTAYVLDLSDNRLNG  440

Query  978   SLPIGASFLHNLKELSLGSNHFSGEIPVDLGLC------------------------PHL  1085
             S+P       +LKEL L  N  +G++P  +  C                         +L
Sbjct  441   SIPSEIGGAVSLKELRLHKNFLTGKLPSQIEKCSSLSSLLLSQNNLSGPVPVAIANLTNL  500

Query  1086  SRLDLSENLFTGTIPESL  1139
               +DLS N F+G++P+ L
Sbjct  501   QYVDLSLNQFSGSLPKEL  518


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 107/187 (57%), Gaps = 15/187 (8%)
 Frame = +3

Query  537   KIGRGLEKLEH------------LNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             K+G G  KLE+            L VL L+SN FS V+   +G+L++LQ LN+S+N + G
Sbjct  357   KLGVGHGKLEYNPLKPIAASHGGLQVLDLSSNAFSDVLPSDIGVLSSLQFLNVSRNQLLG  416

Query  681   TVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTL  860
             ++P S+GN+ +   LDLS N L+G +  S +    SL+ L L  +   G +PS + KC+ 
Sbjct  417   SIPASIGNLKTAYVLDLSDNRLNGSIP-SEIGGAVSLKELRLHKNFLTGKLPSQIEKCSS  475

Query  861   LNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNH  1040
             L+ L LS N  SG    +  I  LT L+ +D+S N+ SGSLP   + L +L   ++  NH
Sbjct  476   LSSLLLSQNNLSGPVPVA--IANLTNLQYVDLSLNQFSGSLPKELTNLSHLLYFNVSYNH  533

Query  1041  FSGEIPV  1061
               GE+PV
Sbjct  534   LQGELPV  540


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 81/157 (52%), Gaps = 3/157 (2%)
 Frame = +3

Query  660   SKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPS  839
             S N+ S  +P  +G +SSLQFL++S N L G +  S + NL +   L L+ +   G IPS
Sbjct  386   SSNAFSDVLPSDIGVLSSLQFLNVSRNQLLGSIPAS-IGNLKTAYVLDLSDNRLNGSIPS  444

Query  840   SLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKE  1019
              +     L  L L  N  +G  +    I   + L +L +S N LSG +P+  + L NL+ 
Sbjct  445   EIGGAVSLKELRLHKNFLTG--KLPSQIEKCSSLSSLLLSQNNLSGPVPVAIANLTNLQY  502

Query  1020  LSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             + L  N FSG +P +L    HL   ++S N   G +P
Sbjct  503   VDLSLNQFSGSLPKELTNLSHLLYFNVSYNHLQGELP  539



>ref|XP_008782666.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=938

 Score =   210 bits (534),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 119/261 (46%), Positives = 159/261 (61%), Gaps = 26/261 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ ++DP S L +W+EDDD PC W  VKC P   RV+E+ L G  LSGK
Sbjct  26    LNDDVLGLIVFKADLRDPGSKLVSWNEDDDDPCHWLGVKCDPKTNRVTELSLVGFFLSGK  85

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L  LSL+ NNFSG +S                          L  + SL+
Sbjct  86    IGRGLLQLQSLRTLSLSKNNFSGTLS------------------------SDLLRLESLR  121

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              LDLS N LSGP+ D       S+R +SLA ++F G IP ++  C+ L  LNLS+NR SG
Sbjct  122   NLDLSENKLSGPIPDDFFGQCRSIRSISLAKNAFFGAIPPNVGSCSTLAALNLSSNRLSG  181

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   G+W L  LR+LD+S+N L G +P+G S ++NL+ +SL  N  SG +P D+G C 
Sbjct  182   S--LPCGLWSLNALRSLDLSDNNLVGEIPVGISKMYNLRSISLHGNRLSGHLPDDIGDCL  239

Query  1080  HLSRLDLSENLFTGTIPESLQ  1142
              L  LDL+ N  +G++PES++
Sbjct  240   LLKSLDLAGNSLSGSLPESMR  260


 Score = 93.2 bits (230),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 84/237 (35%), Positives = 120/237 (51%), Gaps = 26/237 (11%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +  +DL G  LSG +   +  L     LSL+SN+FSG +   +G + +L TL+LS+N  S
Sbjct  241   LKSLDLAGNSLSGSLPESMRNLSICTYLSLSSNSFSGEVPTWIGEMKSLATLDLSRNGFS  300

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIP-------  836
             G +P SLG++  L+ L LS N  +G   +  L +  SL  + L+ +S  G +P       
Sbjct  301   GQLPGSLGDLQLLEVLKLSRNGFTGSFPEP-LRSCKSLVDVDLSQNSLTGNLPLWVFELG  359

Query  837   --------SSLS--------KCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNE  968
                     + LS          + L  L+LS+N FSG      G+  L  L  LD+S N 
Sbjct  360   LQQVLVSKNKLSGSIEIPPTSASTLQVLDLSSNAFSGS--IPEGVGKLKSLEVLDLSGNR  417

Query  969   LSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             L+GS+P       +LKEL LG N   G  P  +G C  L+ LDLS+N  TG IP +L
Sbjct  418   LNGSIPSQIGGAASLKELRLGKNSLKGAXPTQIGNCSSLTSLDLSQNNLTGPIPPTL  474


 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 77/132 (58%), Gaps = 1/132 (1%)
 Frame = +3

Query  507  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
            +DL     SG I  G+ KL+ L VL L+ N  +G I  Q+G   +L+ L L KNS+ G  
Sbjct  387  LDLSSNAFSGSIPEGVGKLKSLEVLDLSGNRLNGSIPSQIGGAASLKELRLGKNSLKGAX  446

Query  687  PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
            P  +GN SSL  LDLS N+L+GP+  + L NL +L+ ++ + +   G IP  LS  + L 
Sbjct  447  PTQIGNCSSLTSLDLSQNNLTGPIPPT-LANLTNLQIINFSRNRLTGTIPKQLSDISHLL  505

Query  867  HLNLSNNRFSGD  902
              N+S+N  SGD
Sbjct  506  SFNISHNLLSGD  517


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 73/142 (51%), Gaps = 4/142 (3%)
 Frame = +3

Query  723   LDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD  902
             L L G  LSG +   +L+ L SLR LSL+ ++F G + S L +   L +L+LS N+ SG 
Sbjct  75    LSLVGFFLSGKIGRGLLQ-LQSLRTLSLSKNNFSGTLSSDLLRLESLRNLDLSENKLSGP  133

Query  903   PRFSGGIWGLTR-LRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                    +G  R +R++ ++ N   G++P        L  L+L SN  SG +P  L    
Sbjct  134   --IPDDFFGQCRSIRSISLAKNAFFGAIPPNVGSCSTLAALNLSSNRLSGSLPCGLWSLN  191

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LDLS+N   G IP  + +
Sbjct  192   ALRSLDLSDNNLVGEIPVGISK  213



>ref|XP_002319878.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE95801.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=965

 Score =   210 bits (534),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/261 (43%), Positives = 164/261 (63%), Gaps = 26/261 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDV GLIVFK+ +QDP   L++W++DDD+PC W  VKC+P + RV+E+ L GL LSG+
Sbjct  30    LNDDVFGLIVFKADLQDPKRKLSSWNQDDDTPCNWFGVKCNPRSNRVTELSLDGLSLSGQ  89

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L+ LSL+ N  +G I+P                        +L  + +L+
Sbjct  90    IGRGLMQLQFLHKLSLSRNCLTGSINP------------------------NLTRLENLR  125

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS NSLSG + +   ++ G+LR +SLA + F G IPS+LS C  L  +NLS+N+FSG
Sbjct  126   IIDLSENSLSGTIPEDFFKDCGALRDISLAKNKFSGKIPSTLSSCASLASINLSSNQFSG  185

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIWGL  L +LD+S N L   +P G   L+NL+ ++L  N F+G +P  +G C 
Sbjct  186   S--LPAGIWGLNGLSSLDLSGNLLDSEIPRGIEVLNNLRNINLSKNRFNGGVPNGIGSCL  243

Query  1080  HLSRLDLSENLFTGTIPESLQ  1142
              L  +D SEN+ +GT+P+++Q
Sbjct  244   LLRSVDFSENMLSGTVPDTMQ  264


 Score = 96.7 bits (239),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 89/255 (35%), Positives = 124/255 (49%), Gaps = 44/255 (17%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             VD     LSG +   ++ L   N LSL++N F+G +   +G L  L+TL+LS N  SG V
Sbjct  248   VDFSENMLSGTVPDTMQNLGLCNYLSLSNNMFTGEVPNWIGELNRLETLDLSGNRFSGQV  307

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSM--------------------------------  770
             P S+GN+ SL+  +LS NSLSG + +SM                                
Sbjct  308   PTSIGNLQSLKVFNLSANSLSGNLPESMTNCGNLLVLDCSQNLLSGDLPVWIFGSGLEKV  367

Query  771   --LEN--------LGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
               LEN           L+ L L+ + F G I SS+   + L  LNLS N   G     G 
Sbjct  368   LQLENKLSGKFSSAQKLQVLDLSHNDFSGKIASSIGVSSSLQFLNLSRNSLMGP--IPGT  425

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDL  1100
                L  L  LD+S+N+L+GS+P+       LKEL L  N  SG+IP  +G C  L+ L L
Sbjct  426   FGDLKELDVLDLSDNKLNGSIPMEIGGAFALKELRLERNSLSGQIPSSIGTCSSLTTLIL  485

Query  1101  SENLFTGTIPESLQR  1145
             S+N  +GTIP ++ +
Sbjct  486   SQNNLSGTIPVAIAK  500


 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 80/252 (32%), Positives = 123/252 (49%), Gaps = 42/252 (17%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +S +DL G  L  +I RG+E L +L  ++L+ N F+G +   +G    L++++ S+N +S
Sbjct  197   LSSLDLSGNLLDSEIPRGIEVLNNLRNINLSKNRFNGGVPNGIGSCLLLRSVDFSENMLS  256

Query  678   GTVPDSL------------------------GNMSSLQFLDLSGNSLSGPVSDSMLENLG  785
             GTVPD++                        G ++ L+ LDLSGN  SG V  S + NL 
Sbjct  257   GTVPDTMQNLGLCNYLSLSNNMFTGEVPNWIGELNRLETLDLSGNRFSGQVPTS-IGNLQ  315

Query  786   SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD-----------------PRFS  914
             SL+  +L+ +S  G +P S++ C  L  L+ S N  SGD                  + S
Sbjct  316   SLKVFNLSANSLSGNLPESMTNCGNLLVLDCSQNLLSGDLPVWIFGSGLEKVLQLENKLS  375

Query  915   GGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRL  1094
             G      +L+ LD+S+N+ SG +        +L+ L+L  N   G IP   G    L  L
Sbjct  376   GKFSSAQKLQVLDLSHNDFSGKIASSIGVSSSLQFLNLSRNSLMGPIPGTFGDLKELDVL  435

Query  1095  DLSENLFTGTIP  1130
             DLS+N   G+IP
Sbjct  436   DLSDNKLNGSIP  447


 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 77/255 (30%), Positives = 123/255 (48%), Gaps = 42/255 (16%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL G   SG++   +  L+ L V +L++N+ SG +   +    NL  L+ S+N +
Sbjct  292   RLETLDLSGNRFSGQVPTSIGNLQSLKVFNLSANSLSGNLPESMTNCGNLLVLDCSQNLL  351

Query  675   SGTVP-------------------DSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRF  797
             SG +P                       +   LQ LDLS N  SG ++ S+  +  SL+F
Sbjct  352   SGDLPVWIFGSGLEKVLQLENKLSGKFSSAQKLQVLDLSHNDFSGKIASSIGVS-SSLQF  410

Query  798   LSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLR----------  944
             L+L+ +S  GPIP +      L+ L+LS+N+ +G  P   GG + L  LR          
Sbjct  411   LNLSRNSLMGPIPGTFGDLKELDVLDLSDNKLNGSIPMEIGGAFALKELRLERNSLSGQI  470

Query  945   -----------TLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSR  1091
                        TL +S N LSG++P+  + L NL+++ +  N  SG +P  L   P+LS 
Sbjct  471   PSSIGTCSSLTTLILSQNNLSGTIPVAIAKLGNLQDVDVSFNSLSGTLPKQLANLPNLSS  530

Query  1092  LDLSENLFTGTIPES  1136
              ++S N   G +P S
Sbjct  531   FNISHNNLQGELPAS  545



>ref|XP_004492560.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=958

 Score =   210 bits (534),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/262 (42%), Positives = 158/262 (60%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDD+LGLIVFK+G++DP   L++W+EDD++PC W  VKC P+N +V+ + L G  LSG 
Sbjct  30    FNDDILGLIVFKAGLKDPNHKLSSWNEDDNTPCNWEGVKCDPSNNKVTSLVLDGFSLSGH  89

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             + RGL +L+ L +LSL  NNF+G I+P                         L  + +LQ
Sbjct  90    VDRGLLRLQFLQILSLKGNNFTGFINP------------------------DLPKLGTLQ  125

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N+L G + +   +  GSLR +S A ++  G IP S+  C  L ++N S+N+  G
Sbjct  126   VVDLSDNNLQGTIPEEFFQQCGSLRTVSFAKNNLTGKIPDSIGSCATLTNVNFSSNQIYG  185

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
             +  F  G+W L  L++LD+SNN L G +P G   L++++ELSL  N FSG IP D+G C 
Sbjct  186   E--FPSGVWFLRGLQSLDLSNNLLEGEIPEGIQNLYDMRELSLKKNRFSGRIPEDIGGCI  243

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LDLS N  +G IP S+QR
Sbjct  244   VLKSLDLSGNFLSGGIPNSMQR  265


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 121/225 (54%), Gaps = 15/225 (7%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL G  LSG I   +++L   N LSL  N+ +G I   +G L +L+ L+LS N  SG +
Sbjct  248   LDLSGNFLSGGIPNSMQRLSSCNSLSLQGNSLTGNIPDWIGELKDLEKLDLSSNRFSGLI  307

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTL--  860
             P SLGN+  LQ L+ S N L G V DSM+ N   L  + ++ +   G +PS   +  L  
Sbjct  308   PKSLGNLDMLQILNFSRNQLVGNVPDSMI-NCSKLLAIDISHNQLFGHLPSWTFRIGLQS  366

Query  861   ----------LNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHN  1010
                       L  L+LS+N FSG+     GI GL+ L+ L++SNN LSGS+P+    L +
Sbjct  367   LSLSGNNYHGLEVLDLSSNAFSGE--LPSGIGGLSSLQLLNISNNNLSGSVPVDIGQLKS  424

Query  1011  LKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             L  + L  N F+G IP ++     LS L L +N   G IP  + +
Sbjct  425   LYIVDLSGNKFNGSIPFEIEGAISLSELRLQKNFLGGRIPAQIAK  469


 Score = 95.1 bits (235),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 81/223 (36%), Positives = 119/223 (53%), Gaps = 15/223 (7%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +  +DL    L G+I  G++ L  +  LSL  N FSG I   +G    L++L+LS N +S
Sbjct  197   LQSLDLSNNLLEGEIPEGIQNLYDMRELSLKKNRFSGRIPEDIGGCIVLKSLDLSGNFLS  256

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G +P+S+  +SS   L L GNSL+G + D + E L  L  L L+ + F G IP SL    
Sbjct  257   GGIPNSMQRLSSCNSLSLQGNSLTGNIPDWIGE-LKDLEKLDLSSNRFSGLIPKSLGNLD  315

Query  858   LLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLP-----IGASFL------  1004
             +L  LN S N+  G+      +   ++L  +D+S+N+L G LP     IG   L      
Sbjct  316   MLQILNFSRNQLVGN--VPDSMINCSKLLAIDISHNQLFGHLPSWTFRIGLQSLSLSGNN  373

Query  1005  -HNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
              H L+ L L SN FSGE+P  +G    L  L++S N  +G++P
Sbjct  374   YHGLEVLDLSSNAFSGELPSGIGGLSSLQLLNISNNNLSGSVP  416


 Score = 93.6 bits (231),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 107/186 (58%), Gaps = 9/186 (5%)
 Frame = +3

Query  504   EVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGT  683
              + L  L LSG    GLE      VL L+SN FSG +   +G L++LQ LN+S N++SG+
Sbjct  361   RIGLQSLSLSGNNYHGLE------VLDLSSNAFSGELPSGIGGLSSLQLLNISNNNLSGS  414

Query  684   VPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLL  863
             VP  +G + SL  +DLSGN  +G +    +E   SL  L L  +   G IP+ ++KC+ L
Sbjct  415   VPVDIGQLKSLYIVDLSGNKFNGSIPFE-IEGAISLSELRLQKNFLGGRIPAQIAKCSSL  473

Query  864   NHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHF  1043
               L LS+N+ +G       I  LT L+ +D+S NELSGSLP   + L NL   ++  NH 
Sbjct  474   TSLVLSHNKLTGS--IPASIANLTNLQHVDLSWNELSGSLPKELTNLSNLSSFNVSYNHL  531

Query  1044  SGEIPV  1061
              GE+PV
Sbjct  532   QGELPV  537



>ref|XP_009416321.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=969

 Score =   209 bits (533),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/261 (44%), Positives = 160/261 (61%), Gaps = 26/261 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLI FK+G++DP S LA+W+E+D+ PC W+ +KC P + RV+ V L G  LSGK
Sbjct  26    LNDDVLGLIAFKAGIEDPRSKLASWNENDNDPCNWDGIKCDPKSNRVAVVALDGFALSGK  85

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             +GRGL +L+ L+ LSL+ NNFSG ++P                        +   + SL+
Sbjct  86    LGRGLLRLQFLDTLSLSVNNFSGSVTP------------------------AFLRLESLR  121

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              LDLS N+LSG + D       S+R +SLA +S  G IPS +  C+ L  LNLS+N+ SG
Sbjct  122   TLDLSANNLSGTIPDGFFGQCRSIRDISLAKNSISGKIPSDVGACSTLASLNLSSNQLSG  181

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                  G IW L  LR+LD+S+N L G +P+G S + NL+ +SL  N  +G++P D G C 
Sbjct  182   S--LPGEIWSLNALRSLDLSHNSLVGEIPVGISRMFNLRMISLRGNRLTGQLPNDTGKCL  239

Query  1080  HLSRLDLSENLFTGTIPESLQ  1142
              L  LD+ EN  +G +PES++
Sbjct  240   LLKSLDVGENQLSGDLPESMR  260


 Score = 92.8 bits (229),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 80/224 (36%), Positives = 108/224 (48%), Gaps = 24/224 (11%)
 Frame = +3

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  713
             G++   +  +  L  L L+ N FSG +   L  L  L+ L LS NS SG+VPDSL    S
Sbjct  277   GEVPAWIGDMNSLETLDLSRNRFSGGVPSSLSNLQFLKLLKLSDNSFSGSVPDSLAACRS  336

Query  714   LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRF  893
             L  +DL  N+L+G +     E     R + L G+   GPI       + L  L+LS N F
Sbjct  337   LLDVDLGRNTLTGNLPSWAFET--GFRQILLPGNKLSGPIDVPRVTDSTLQVLDLSGNAF  394

Query  894   SGD-PR---------------------FSGGIWGLTRLRTLDVSNNELSGSLPIGASFLH  1007
             SG  P+                         +  L  L  LDVS N LSG +P   +   
Sbjct  395   SGKFPKEVSSLRSIEFLNLSSNSLSDSIPIDVGELKSLEVLDVSRNLLSGRIPSEVALAT  454

Query  1008  NLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +L+EL L  N  + EIPV +G C  L+ LDLS+N  TG+IPE+L
Sbjct  455   SLRELRLEGNSLTREIPVQIGSCSSLAYLDLSQNNLTGSIPETL  498


 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 73/211 (35%), Positives = 114/211 (54%), Gaps = 4/211 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    L G+I  G+ ++ +L ++SL  N  +G +    G    L++L++ +N +SG +
Sbjct  196   LDLSHNSLVGEIPVGISRMFNLRMISLRGNRLTGQLPNDTGKCLLLKSLDVGENQLSGDL  255

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P+S+ N+S+  +L LS NSLSG V  + + ++ SL  L L+ + F G +PSSLS    L 
Sbjct  256   PESMRNLSTCTYLSLSSNSLSGEVP-AWIGDMNSLETLDLSRNRFSGGVPSSLSNLQFLK  314

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
              L LS+N FSG       +     L  +D+  N L+G+LP  A F    +++ L  N  S
Sbjct  315   LLKLSDNSFSGS--VPDSLAACRSLLDVDLGRNTLTGNLPSWA-FETGFRQILLPGNKLS  371

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             G I V       L  LDLS N F+G  P+ +
Sbjct  372   GPIDVPRVTDSTLQVLDLSGNAFSGKFPKEV  402


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 73/254 (29%), Positives = 110/254 (43%), Gaps = 48/254 (19%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL     SG +   L  L+ L +L L+ N+FSG +   L    +L  ++L +N+++G +
Sbjct  292   LDLSRNRFSGGVPSSLSNLQFLKLLKLSDNSFSGSVPDSLAACRSLLDVDLGRNTLTGNL  351

Query  687   PDSL-----------GNM------------SSLQFLDLSGNSLSG--PVSDSMLEN----  779
             P              GN             S+LQ LDLSGN+ SG  P   S L +    
Sbjct  352   PSWAFETGFRQILLPGNKLSGPIDVPRVTDSTLQVLDLSGNAFSGKFPKEVSSLRSIEFL  411

Query  780   -----------------LGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPR  908
                              L SL  L ++ +   G IPS ++  T L  L L  N  + +  
Sbjct  412   NLSSNSLSDSIPIDVGELKSLEVLDVSRNLLSGRIPSEVALATSLRELRLEGNSLTRE--  469

Query  909   FSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLS  1088
                 I   + L  LD+S N L+GS+P   + L NL+ +    N  SG +P  L   PHL 
Sbjct  470   IPVQIGSCSSLAYLDLSQNNLTGSIPETLANLTNLRVVDFSRNRLSGTLPKQLSDLPHLL  529

Query  1089  RLDLSENLFTGTIP  1130
               ++S N  +G +P
Sbjct  530   SFNISHNQLSGGLP  543


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 99/177 (56%), Gaps = 4/177 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL G   SGK  + +  L  +  L+L+SN+ S  I   +G L +L+ L++S+N +SG +
Sbjct  387   LDLSGNAFSGKFPKEVSSLRSIEFLNLSSNSLSDSIPIDVGELKSLEVLDVSRNLLSGRI  446

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P  +   +SL+ L L GNSL+  +    + +  SL +L L+ ++  G IP +L+  T L 
Sbjct  447   PSEVALATSLRELRLEGNSLTREIP-VQIGSCSSLAYLDLSQNNLTGSIPETLANLTNLR  505

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSN  1037
              ++ S NR SG       +  L  L + ++S+N+LSG LP G SF +N+   SL  N
Sbjct  506   VVDFSRNRLSG--TLPKQLSDLPHLLSFNISHNQLSGGLPAG-SFFNNIPPSSLTDN  559



>ref|XP_011084816.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=972

 Score =   209 bits (533),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 120/263 (46%), Positives = 160/263 (61%), Gaps = 27/263 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCA-WNFVKCHPANGRVSEVDLHGLGLSG  536
             LNDDVLGLIVFK+ +QDP   L++W+E+DDSPC  W  VKC+P + RVS++ L G GLSG
Sbjct  25    LNDDVLGLIVFKADIQDPDGKLSSWNEEDDSPCNNWVGVKCNPRSNRVSDLVLDGFGLSG  84

Query  537   KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  716
             K+GRGL +L+ L  LSLA NN +G IS                         S   +S L
Sbjct  85    KLGRGLLQLQFLRKLSLAKNNLTGSISL------------------------SFSELSDL  120

Query  717   QFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFS  896
             + LDLS N  SG +        GSLR +SLA + F GPIP SL  C+ L  LNLS N+FS
Sbjct  121   RVLDLSENGFSGSIPSDFFSQCGSLRSISLAKNRFSGPIPESLGSCSTLAALNLSGNQFS  180

Query  897   GDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLC  1076
             G   F   +W L+ LR LD+S+N L G +P G   L+NL+ +SL +N  +GE+P  +G C
Sbjct  181   GSLPFQ--LWSLSGLRALDLSDNLLDGEIPKGIEALNNLRAISLRNNQLTGEVPEGIGNC  238

Query  1077  PHLSRLDLSENLFTGTIPESLQR  1145
               L  +DLS+NL +G +P ++Q+
Sbjct  239   LLLRSIDLSQNLLSGGLPSTMQK  261


 Score = 91.7 bits (226),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 119/214 (56%), Gaps = 5/214 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    LSG +   ++KL   N L L +N F G +   +G + +L TL+LS+N+ +G V
Sbjct  244   IDLSQNLLSGGLPSTMQKLSLCNDLVLGNNGFIGEVPQWIGDMRSLVTLDLSENNFTGQV  303

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             PDSLG + S++  ++S N+L+G + ++M  N  +L    ++ +S  G +PS + K  L  
Sbjct  304   PDSLGKLRSVKIFNVSKNALTGSLPEAM-SNCVNLLAFDISHNSLTGNLPSWVFKLGLQQ  362

Query  867   HLNLSNNRFSG---DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSN  1037
              L LS+N  SG   D   S      T+L  LD+S N+LSG +P     L +L+ L++  N
Sbjct  363   VL-LSDNGLSGSIDDALASSKENSRTKLLILDISQNKLSGEIPSTVGDLGSLQLLNMSRN  421

Query  1038  HFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              F G IP  +G    LS LD SEN   G+IP  +
Sbjct  422   SFVGTIPARIGQLKSLSILDFSENQLNGSIPSEI  455


 Score = 87.8 bits (216),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 76/234 (32%), Positives = 116/234 (50%), Gaps = 29/234 (12%)
 Frame = +3

Query  525   GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  704
             G  G++ + +  +  L  L L+ NNF+G +   LG L +++  N+SKN+++G++P+++ N
Sbjct  274   GFIGEVPQWIGDMRSLVTLDLSENNFTGQVPDSLGKLRSVKIFNVSKNALTGSLPEAMSN  333

Query  705   MSSLQFLDLSGNSLSGPV-------------------SDSMLENLGS--------LRFLS  803
               +L   D+S NSL+G +                   S S+ + L S        L  L 
Sbjct  334   CVNLLAFDISHNSLTGNLPSWVFKLGLQQVLLSDNGLSGSIDDALASSKENSRTKLLILD  393

Query  804   LAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSL  983
             ++ +   G IPS++     L  LN+S N F G       I  L  L  LD S N+L+GS+
Sbjct  394   ISQNKLSGEIPSTVGDLGSLQLLNMSRNSFVG--TIPARIGQLKSLSILDFSENQLNGSI  451

Query  984   PIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             P     L +L ELSL  N   G IP  +G C  L  L L+ N  TG+IP SL +
Sbjct  452   PSEIGLLKSLNELSLEKNSLWGNIPTSIGNCAGLISLCLAHNEITGSIPASLAK  505


 Score = 70.9 bits (172),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 92/165 (56%), Gaps = 3/165 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +D+    LSG+I   +  L  L +L+++ N+F G I  ++G L +L  L+ S+N ++G++
Sbjct  392   LDISQNKLSGEIPSTVGDLGSLQLLNMSRNSFVGTIPARIGQLKSLSILDFSENQLNGSI  451

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P  +G + SL  L L  NSL G +  S + N   L  L LA +   G IP+SL+K T L 
Sbjct  452   PSEIGLLKSLNELSLEKNSLWGNIPTS-IGNCAGLISLCLAHNEITGSIPASLAKLTYLT  510

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASF  1001
              ++ S NR +G       +  L  L+  ++S+N+L G LP GA F
Sbjct  511   VVDFSFNRLTG--AIPKQLANLASLQLFNISHNQLQGELPAGAFF  553


 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 80/158 (51%), Gaps = 5/158 (3%)
 Frame = +3

Query  660   SKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPS  839
             S+N +SG +P ++G++ SLQ L++S NS  G +  + +  L SL  L  + +   G IPS
Sbjct  395   SQNKLSGEIPSTVGDLGSLQLLNMSRNSFVGTIP-ARIGQLKSLSILDFSENQLNGSIPS  453

Query  840   SLSKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLK  1016
              +     LN L+L  N   G+ P   G   GL    +L +++NE++GS+P   + L  L 
Sbjct  454   EIGLLKSLNELSLEKNSLWGNIPTSIGNCAGLI---SLCLAHNEITGSIPASLAKLTYLT  510

Query  1017  ELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
              +    N  +G IP  L     L   ++S N   G +P
Sbjct  511   VVDFSFNRLTGAIPKQLANLASLQLFNISHNQLQGELP  548



>ref|XP_011001391.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=963

 Score =   209 bits (532),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 117/262 (45%), Positives = 167/262 (64%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P + RV+E+ L GL LSG+
Sbjct  28    LNDDVLGLIVFKADLQDPMRKLSSWNQDDDTPCNWFGVKCNPRSNRVAELTLDGLSLSGR  87

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L+ LSL+ NN +G I P                        +L  + +L+
Sbjct  88    IGRGLLQLQFLHKLSLSRNNLTGSIDP------------------------NLTRLENLR  123

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS NSLSG +S+ + +   +LR LSLA + F G IP SLS C  L  +NLS+N+F+G
Sbjct  124   IIDLSENSLSGTISEDLFKECAALRDLSLANNKFSGKIPGSLSSCASLASINLSSNQFTG  183

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIWGL  LR+LD+S N L G +P G   L+NL+ ++L  N F+GE+P  +G C 
Sbjct  184   S--LPAGIWGLNGLRSLDLSGNLLDGEIPKGIEVLNNLRRINLSKNRFNGEVPNGIGSCL  241

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +D SEN+ +G +P+++Q+
Sbjct  242   LLRSVDFSENMLSGHVPDTMQK  263


 Score = 90.5 bits (223),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 93/257 (36%), Positives = 125/257 (49%), Gaps = 48/257 (19%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             VD     LSG +   ++KL   + LSL+SN F+G +   +G L  L+TL+LS N  SG V
Sbjct  246   VDFSENMLSGHVPDTMQKLGLCDYLSLSSNMFTGEVPSWIGELNRLETLDLSGNRFSGQV  305

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSM--------------------------------  770
             P S+G +  L+ L+LS N LSG + +SM                                
Sbjct  306   PISIGKLQLLKVLNLSANGLSGNLPESMANCGNLLALDFSQNLLSGDLPTWIFGSRLEKA  365

Query  771   --LENLGS--------LRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
               LEN  S        L+FL L+ + F G I SS+   + L  LNLS N   G     G 
Sbjct  366   LHLENKLSGKFSSAPKLQFLDLSHNDFSGKIASSIGVLSSLQFLNLSKNSLFGP--VPGT  423

Query  921   IWGLTRLRTLDVSNNELSGSLP--IGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRL  1094
                L  L  LD+S+N+L+GS+P  IG +F   LKEL L  N  SG+IP  +G C  L  L
Sbjct  424   FGDLKELDILDLSDNKLNGSIPTEIGGAFA--LKELRLERNSLSGKIPDSIGNCSSLMTL  481

Query  1095  DLSENLFTGTIPESLQR  1145
              LS N   GTIP ++ +
Sbjct  482   ILSHNNLAGTIPAAIAK  498


 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 122/235 (52%), Gaps = 24/235 (10%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL G   SG++   + KL+ L VL+L++N  SG +   +    NL  L+ S+N +
Sbjct  290   RLETLDLSGNRFSGQVPISIGKLQLLKVLNLSANGLSGNLPESMANCGNLLALDFSQNLL  349

Query  675   SGTVPDSL----------------GNMSS---LQFLDLSGNSLSGPVSDSMLENLGSLRF  797
             SG +P  +                G  SS   LQFLDLS N  SG ++ S +  L SL+F
Sbjct  350   SGDLPTWIFGSRLEKALHLENKLSGKFSSAPKLQFLDLSHNDFSGKIASS-IGVLSSLQF  408

Query  798   LSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELS  974
             L+L+ +S  GP+P +      L+ L+LS+N+ +G  P   GG + L  LR   +  N LS
Sbjct  409   LNLSKNSLFGPVPGTFGDLKELDILDLSDNKLNGSIPTEIGGAFALKELR---LERNSLS  465

Query  975   GSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             G +P       +L  L L  N+ +G IP  +    +L  +DLS N  TG++P+ L
Sbjct  466   GKIPDSIGNCSSLMTLILSHNNLAGTIPAAIAKLGNLKDVDLSLNSLTGSLPKQL  520


 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 99/182 (54%), Gaps = 3/182 (2%)
 Frame = +3

Query  516   HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  695
               L L  K+         L  L L+ N+FSG I+  +G+L++LQ LNLSKNS+ G VP +
Sbjct  364   KALHLENKLSGKFSSAPKLQFLDLSHNDFSGKIASSIGVLSSLQFLNLSKNSLFGPVPGT  423

Query  696   LGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLN  875
              G++  L  LDLS N L+G +  + +    +L+ L L  +S  G IP S+  C+ L  L 
Sbjct  424   FGDLKELDILDLSDNKLNGSIP-TEIGGAFALKELRLERNSLSGKIPDSIGNCSSLMTLI  482

Query  876   LSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEI  1055
             LS+N  +G       I  L  L+ +D+S N L+GSLP   + L NL   ++  N+  GE+
Sbjct  483   LSHNNLAG--TIPAAIAKLGNLKDVDLSLNSLTGSLPKQLANLPNLISFNISHNNLQGEL  540

Query  1056  PV  1061
             P 
Sbjct  541   PA  542



>ref|XP_002325929.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF00311.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=963

 Score =   209 bits (532),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 167/262 (64%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ +QDP   L++W++DDD+PC W  VKC+P + RV+E+ L GL LSG+
Sbjct  28    LNDDVLGLIVFKADLQDPMRKLSSWNQDDDTPCNWFGVKCNPRSNRVAELTLDGLSLSGR  87

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L+ LSL+ NN +G I+P                        +L  + +L+
Sbjct  88    IGRGLLQLQFLHKLSLSRNNLTGSINP------------------------NLTRLENLR  123

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS NSLSG +S+   +   +LR LSLA + F G IP SLS C  L  +NLS+N+F+G
Sbjct  124   IIDLSENSLSGTISEDFFKECAALRDLSLANNKFSGKIPGSLSSCASLASINLSSNQFTG  183

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIWGL  LR+LD+S N L G +P G   L+NL+ ++L  N F+GE+P  +G C 
Sbjct  184   S--LPAGIWGLNGLRSLDLSGNLLDGEIPKGIEVLNNLRRINLSKNRFNGEVPDGIGSCL  241

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +D SEN+ +G IP+++Q+
Sbjct  242   LLRSVDFSENMLSGHIPDTMQK  263


 Score = 92.8 bits (229),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 117/219 (53%), Gaps = 12/219 (5%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL G   SG++   + KL+ L VL+L++N  SG +   +    NL  L+ S+N +
Sbjct  290   RLETLDLSGNRFSGQVPISIGKLQLLKVLNLSANGLSGNLPESMANCGNLLALDFSQNLL  349

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
             SG +P  +    S + L L  N LSG  S +       L+FL L+ + F G I SS+   
Sbjct  350   SGDLPTWIFGSRSEKVLHLE-NKLSGKFSSA-----PRLQFLDLSHNDFSGKIASSIGVL  403

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLP--IGASFLHNLKELSL  1028
             + L  LNLS N   G     G    L  L  LD+S+N+L+GS+P  IG +F   LKEL L
Sbjct  404   SSLQFLNLSKNSLFGP--VPGTFGDLKELDILDLSDNKLNGSIPTEIGGAFA--LKELRL  459

Query  1029  GSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
               N  SG+IP  +G C  L  L LS+N   GTIP ++ +
Sbjct  460   ERNSLSGQIPDSIGNCSSLMTLILSQNNLAGTIPAAIAK  498


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 102/190 (54%), Gaps = 6/190 (3%)
 Frame = +3

Query  492   GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  671
             G  SE  LH   L  K+         L  L L+ N+FSG I+  +G+L++LQ LNLSKNS
Sbjct  359   GSRSEKVLH---LENKLSGKFSSAPRLQFLDLSHNDFSGKIASSIGVLSSLQFLNLSKNS  415

Query  672   ISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSK  851
             + G VP + G++  L  LDLS N L+G +  + +    +L+ L L  +S  G IP S+  
Sbjct  416   LFGPVPGTFGDLKELDILDLSDNKLNGSIP-TEIGGAFALKELRLERNSLSGQIPDSIGN  474

Query  852   CTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLG  1031
             C+ L  L LS N  +G       I  L  L+ +D+S N L+GSLP   + L NL   ++ 
Sbjct  475   CSSLMTLILSQNNLAG--TIPAAIAKLGNLKDVDLSLNSLTGSLPKQLANLPNLISFNIS  532

Query  1032  SNHFSGEIPV  1061
              N+  GE+P 
Sbjct  533   HNNLQGELPA  542



>ref|XP_010067617.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW65785.1| hypothetical protein EUGRSUZ_G03140 [Eucalyptus grandis]
Length=972

 Score =   209 bits (532),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 119/262 (45%), Positives = 159/262 (61%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ VQDP   LA+W EDDD+PC W   KC+P + RV E++L G  LSG 
Sbjct  27    LNDDVLGLIVFKADVQDPKGKLASWDEDDDNPCNWVGCKCNPRSNRVVELNLDGFSLSGH  86

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             +GRGL +L+ L  LSLA NN +G IS                         S+  + +L+
Sbjct  87    LGRGLLQLQFLRKLSLAKNNLTGSIS------------------------SSIARIDNLR  122

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              LDLS NSLSG + D      GSLR +SLA + F G IP +L  C++L  ++LS+N  SG
Sbjct  123   VLDLSENSLSGTIPDEFFRQCGSLRSVSLASNKFSGKIPETLGSCSMLASIDLSSNMLSG  182

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                    IW ++ LR+LD+S+N L G +P G + + NL+ +SL  N FSG IP  LG C 
Sbjct  183   --VSPDNIWTVSGLRSLDLSDNLLEGGIPEGIAGMKNLRGVSLRKNRFSGLIPDGLGSCL  240

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLSEN  +G+IP++LQ+
Sbjct  241   LLRSIDLSENALSGSIPDTLQK  262


 Score =   103 bits (258),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 88/243 (36%), Positives = 120/243 (49%), Gaps = 30/243 (12%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             + +DLHG  L+G +G  + K+E L  L L+ N  SG +   LG L +LQ  N S+N  +G
Sbjct  267   TSLDLHGNLLTGGVGDWIGKIEALERLDLSGNGLSGELPISLGNLQSLQVANFSRNGFTG  326

Query  681   TVPDSLGNMSSLQFLDLSGNSLSG----------------------------PVSDSMLE  776
              +P +L +  +LQ LDLS N+ SG                            P++ S   
Sbjct  327   ALPQALSSCKNLQSLDLSNNAYSGHIPSWIMGPNSLKSSLLDKEEVAAKYASPIASSAEG  386

Query  777   NLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDV  956
             +L  L+ L L+ +SF G I S +   T L  LNLSNN   G       I  L  L  LD+
Sbjct  387   SLQKLQILDLSSNSFAGEISSDIGDLTGLQSLNLSNNSLKGS--IPATIGKLKALDVLDL  444

Query  957   SNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPES  1136
             + NELSGS+P      ++LKEL LG N   G IP  +  C  L+ L LS+N   G IP S
Sbjct  445   TANELSGSIPSEIGDANSLKELRLGGNKLVGIIPDSIVKCSALTTLILSQNNLNGLIPAS  504

Query  1137  LQR  1145
             L +
Sbjct  505   LSK  507


 Score = 92.4 bits (228),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 82/237 (35%), Positives = 124/237 (52%), Gaps = 36/237 (15%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL---  698
             L G I  G+  +++L  +SL  N FSG+I   LG    L++++LS+N++SG++PD+L   
Sbjct  204   LEGGIPEGIAGMKNLRGVSLRKNRFSGLIPDGLGSCLLLRSIDLSENALSGSIPDTLQKL  263

Query  699   ---------------------GNMSSLQFLDLSGNSLSG--PVSDSMLENLGSLRFLSLA  809
                                  G + +L+ LDLSGN LSG  P+S   L NL SL+  + +
Sbjct  264   TLCTSLDLHGNLLTGGVGDWIGKIEALERLDLSGNGLSGELPIS---LGNLQSLQVANFS  320

Query  810   GSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSL--  983
              + F G +P +LS C  L  L+LSNN +SG       I G   L++  +   E++     
Sbjct  321   RNGFTGALPQALSSCKNLQSLDLSNNAYSG--HIPSWIMGPNSLKSSLLDKEEVAAKYAS  378

Query  984   PIGASF---LHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             PI +S    L  L+ L L SN F+GEI  D+G    L  L+LS N   G+IP ++ +
Sbjct  379   PIASSAEGSLQKLQILDLSSNSFAGEISSDIGDLTGLQSLNLSNNSLKGSIPATIGK  435


 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 101/167 (60%), Gaps = 3/167 (2%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             L+ L +L L+SN+F+G IS  +G LT LQ+LNLS NS+ G++P ++G + +L  LDL+ N
Sbjct  388   LQKLQILDLSSNSFAGEISSDIGDLTGLQSLNLSNNSLKGSIPATIGKLKALDVLDLTAN  447

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
              LSG +  S + +  SL+ L L G+   G IP S+ KC+ L  L LS N  +G       
Sbjct  448   ELSGSIP-SEIGDANSLKELRLGGNKLVGIIPDSIVKCSALTTLILSQNNLNG--LIPAS  504

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             +  L  L+ +D+S N  +G+LP   + L +L   ++  NHF GE+P+
Sbjct  505   LSKLANLQMVDLSFNNFTGTLPKQLANLPHLLLFNISHNHFQGELPL  551



>ref|XP_003522510.2| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=978

 Score =   209 bits (532),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 114/259 (44%), Positives = 162/259 (63%), Gaps = 28/259 (11%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPC--AWNFVKCHPANGRVSEVDLHGLGLS  533
             LNDDVLGLIVFK+ ++DP   LA+W+EDD+S C  +W  VKC+P + RV EV+L G  LS
Sbjct  32    LNDDVLGLIVFKADIRDPKGKLASWNEDDESACGGSWVGVKCNPRSNRVVEVNLDGFSLS  91

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  713
             G+IGRGL++L+ L  LSLA+NN +G I+P                        ++  + +
Sbjct  92    GRIGRGLQRLQFLRKLSLANNNLTGGINP------------------------NIARIDN  127

Query  714   LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRF  893
             L+ +DLSGNSLSG VS+ +    GSLR +SLA + F G IPS+L  C+ L  ++LSNN+F
Sbjct  128   LRVIDLSGNSLSGEVSEDVFRQCGSLRTVSLARNRFSGSIPSTLGACSALAAIDLSNNQF  187

Query  894   SGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGL  1073
             SG       +W L+ LR+LD+S+N L G +P G   + NL+ +S+  N  +G +P   G 
Sbjct  188   SGS--VPSRVWSLSALRSLDLSDNLLEGEIPKGIEAMKNLRSVSVARNRLTGNVPYGFGS  245

Query  1074  CPHLSRLDLSENLFTGTIP  1130
             C  L  +DL +N F+G+IP
Sbjct  246   CLLLRSIDLGDNSFSGSIP  264


 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 116/240 (48%), Gaps = 31/240 (13%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL     SG I    ++L     +SL  N FSG +   +G +  L+TL+LS N  +G V
Sbjct  252   IDLGDNSFSGSIPGDFKELTLCGYISLRGNAFSGGVPQWIGEMRGLETLDLSNNGFTGQV  311

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIP-----SSLSK  851
             P S+GN+ SL+ L+ SGN L+G + +SM  N   L  L ++ +S  G +P     S L K
Sbjct  312   PSSIGNLQSLKMLNFSGNGLTGSLPESM-ANCTKLLVLDVSRNSMSGWLPLWVFKSDLDK  370

Query  852   CTL-----------------------LNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSN  962
               +                       L  L+LS+N FSG+   +  + GL+ L+ L+++N
Sbjct  371   VLVSENVQSGSKKSPLFAMAELAVQSLQVLDLSHNAFSGE--ITSAVGGLSSLQVLNLAN  428

Query  963   NELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
             N L G +P     L     L L  N  +G IP ++G    L  L L +N   G IP S++
Sbjct  429   NSLGGPIPPAVGELKTCSSLDLSYNKLNGSIPWEIGGAVSLKELVLEKNFLNGKIPTSIE  488


 Score = 83.6 bits (205),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 124/240 (52%), Gaps = 29/240 (12%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             + L G   SG + + + ++  L  L L++N F+G +   +G L +L+ LN S N ++G++
Sbjct  276   ISLRGNAFSGGVPQWIGEMRGLETLDLSNNGFTGQVPSSIGNLQSLKMLNFSGNGLTGSL  335

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVS--------DSML--ENLGS----------------  788
             P+S+ N + L  LD+S NS+SG +         D +L  EN+ S                
Sbjct  336   PESMANCTKLLVLDVSRNSMSGWLPLWVFKSDLDKVLVSENVQSGSKKSPLFAMAELAVQ  395

Query  789   -LRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNN  965
              L+ L L+ ++F G I S++   + L  LNL+NN   G       +  L    +LD+S N
Sbjct  396   SLQVLDLSHNAFSGEITSAVGGLSSLQVLNLANNSLGGP--IPPAVGELKTCSSLDLSYN  453

Query  966   ELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             +L+GS+P       +LKEL L  N  +G+IP  +  C  L+ L LS+N  +G IP ++ +
Sbjct  454   KLNGSIPWEIGGAVSLKELVLEKNFLNGKIPTSIENCSLLTTLILSQNKLSGPIPAAVAK  513


 Score = 83.2 bits (204),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 98/167 (59%), Gaps = 3/167 (2%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             ++ L VL L+ N FSG I+  +G L++LQ LNL+ NS+ G +P ++G + +   LDLS N
Sbjct  394   VQSLQVLDLSHNAFSGEITSAVGGLSSLQVLNLANNSLGGPIPPAVGELKTCSSLDLSYN  453

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
              L+G +   +   + SL+ L L  +   G IP+S+  C+LL  L LS N+ SG       
Sbjct  454   KLNGSIPWEIGGAV-SLKELVLEKNFLNGKIPTSIENCSLLTTLILSQNKLSGP--IPAA  510

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             +  LT L+T+DVS N L+G+LP   + L NL   +L  N+  GE+P 
Sbjct  511   VAKLTNLQTVDVSFNNLTGALPKQLANLANLLTFNLSHNNLQGELPA  557


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 75/141 (53%), Gaps = 4/141 (3%)
 Frame = +3

Query  723   LDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD  902
             ++L G SLSG +    L+ L  LR LSLA ++  G I  ++++   L  ++LS N  SG+
Sbjct  83    VNLDGFSLSGRIGRG-LQRLQFLRKLSLANNNLTGGINPNIARIDNLRVIDLSGNSLSGE  141

Query  903   PRFSGGIW-GLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                S  ++     LRT+ ++ N  SGS+P        L  + L +N FSG +P  +    
Sbjct  142   --VSEDVFRQCGSLRTVSLARNRFSGSIPSTLGACSALAAIDLSNNQFSGSVPSRVWSLS  199

Query  1080  HLSRLDLSENLFTGTIPESLQ  1142
              L  LDLS+NL  G IP+ ++
Sbjct  200   ALRSLDLSDNLLEGEIPKGIE  220



>ref|XP_008808300.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=939

 Score =   209 bits (531),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 117/262 (45%), Positives = 158/262 (60%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ ++DP S L +W+EDDD PC W  VKC P   RV+E+ L G  LSGK
Sbjct  26    LNDDVLGLIVFKADLRDPDSKLVSWNEDDDDPCHWIGVKCDPKTNRVAELSLDGFSLSGK  85

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L  LSL+ NNFSG +S                          L  + SL+
Sbjct  86    IGRGLLQLQSLRTLSLSKNNFSGSLS------------------------SDLLRLESLR  121

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              LDLS N LSGP+ D        +  +SLA ++F G IP ++  C+ L  L+LS+NR SG
Sbjct  122   NLDLSENKLSGPIPDDFFGQCRFIGAISLAKNAFSGVIPPNVGSCSTLAALDLSSNRLSG  181

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   G+W L  LR+LD+S+N L G +P+G + ++NL+ +SL  N  SG +P D+G C 
Sbjct  182   S--LPAGLWSLNALRSLDLSDNALVGEIPVGITKIYNLRSISLRGNRLSGHLPDDIGDCL  239

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LDL  NL +G++PES+Q+
Sbjct  240   LLKSLDLGGNLLSGSLPESMQK  261


 Score = 87.0 bits (214),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 75/204 (37%), Positives = 109/204 (53%), Gaps = 4/204 (2%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
              +G++   + +++ L  L L+ N FSG +   LG L  L+ L LS N   G+ P+SL + 
Sbjct  275   FTGEVPSWIGEMKSLETLDLSRNGFSGQLPSSLGDLQLLKELKLSSNHFMGSFPESLSSC  334

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
              SL  +D + NSL+G +   +      L+ + ++ +   G I    S  + L  L+LS+N
Sbjct  335   KSLSVVDFNQNSLTGNLPSWVFAL--DLQQILISENKLHGSIEIPSSPASTLQVLDLSSN  392

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDL  1067
              FSG    S G   L  L  LD+S N L+GS+P+      +LKEL L  N  SG IP  +
Sbjct  393   AFSGSIPESVG--KLKSLEFLDLSGNRLNGSIPLEVGGAVSLKELRLEKNSLSGGIPTQI  450

Query  1068  GLCPHLSRLDLSENLFTGTIPESL  1139
             G C  L+ LDLS+N  TG IP SL
Sbjct  451   GNCSSLATLDLSQNNLTGPIPPSL  474



>ref|XP_007033525.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY04451.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=965

 Score =   209 bits (531),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 114/262 (44%), Positives = 159/262 (61%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLI FK+G+ DP + L +WSEDD+ PC W  VKC P   RV+E+ L GL LSG 
Sbjct  23    FNDDVLGLIFFKAGLDDPNAKLQSWSEDDNDPCNWMGVKCDPTTYRVTELHLDGLSLSGH  82

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             +GRGL +L+ L VLSL++NN +G I+                          L ++ SL+
Sbjct  83    VGRGLLRLQFLQVLSLSNNNLTGPIN------------------------SELSHIGSLK  118

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLSGNSLSG + D      GSL  +S A ++  G IP SLS C+ L  +N S+N+ SG
Sbjct  119   VIDLSGNSLSGLIPDDFFAQCGSLGSVSFARNNLTGQIPDSLSSCSTLVAVNFSSNQISG  178

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
               +   GIW L  L++LD+S N + G +P G   L++L+++  G+N FSG +P D+G C 
Sbjct  179   --QLPSGIWFLRGLQSLDISGNLVEGDIPEGIGNLYDLRQIDFGNNRFSGRLPEDIGSCS  236

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LD SEN  +G++P+S+QR
Sbjct  237   QLKSLDFSENYLSGSLPDSMQR  258


 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 75/243 (31%), Positives = 120/243 (49%), Gaps = 29/243 (12%)
 Frame = +3

Query  492   GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  671
             G  + + L G    G++   + +L +L  L L++NNFSG +   LG L  L+ L+LS N 
Sbjct  260   GSCTSISLRGNSFRGQVPDWIGELTNLESLDLSANNFSGRVPFSLGNLQFLRKLDLSMNQ  319

Query  672   ISGTVPDSLGNMSSLQFLDLSGNSLSG---------------------------PVSDSM  770
              +G +P+S+ N  +L  +D+S N L+G                           P+  S 
Sbjct  320   FTGALPESMANCFNLLAMDVSQNLLTGNVPSWMFKLGVNSALISGNTLIGKMESPLLASR  379

Query  771   LENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTL  950
             + +  SL+ L L+ ++  G IPS+L   + L   N+S N   G       I  L     +
Sbjct  380   VSSYQSLQILDLSSNALSGEIPSNLGVLSSLILFNMSRNHLFGS--IPSSIGELKTTEVI  437

Query  951   DVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             D+S+N L+GS+P       +LKELSL  N  SG++P  +  C  L+ L LS+N  +G+IP
Sbjct  438   DLSDNWLNGSIPSEIGGAVSLKELSLQRNFLSGKVPTQIVNCSSLTTLILSQNNLSGSIP  497

Query  1131  ESL  1139
              ++
Sbjct  498   PAI  500


 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 95/166 (57%), Gaps = 3/166 (2%)
 Frame = +3

Query  564   EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNS  743
             + L +L L+SN  SG I   LG+L++L   N+S+N + G++P S+G + + + +DLS N 
Sbjct  384   QSLQILDLSSNALSGEIPSNLGVLSSLILFNMSRNHLFGSIPSSIGELKTTEVIDLSDNW  443

Query  744   LSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGI  923
             L+G +  S +    SL+ LSL  +   G +P+ +  C+ L  L LS N  SG       I
Sbjct  444   LNGSIP-SEIGGAVSLKELSLQRNFLSGKVPTQIVNCSSLTTLILSQNNLSGS--IPPAI  500

Query  924   WGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
               L+ L+ +D+S N+L+GSLP   + L  L   ++  NH  GE+P+
Sbjct  501   ANLSNLQYVDLSLNDLTGSLPKELANLSQLMSFNISHNHLRGELPL  546


 Score = 70.9 bits (172),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 110/239 (46%), Gaps = 31/239 (13%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL     SG++   L  L+ L  L L+ N F+G +   +    NL  +++S+N ++G V
Sbjct  289   LDLSANNFSGRVPFSLGNLQFLRKLDLSMNQFTGALPESMANCFNLLAMDVSQNLLTGNV  348

Query  687   PDSL----------------GNM------------SSLQFLDLSGNSLSGPVSDSMLENL  782
             P  +                G M             SLQ LDLS N+LSG +  S L  L
Sbjct  349   PSWMFKLGVNSALISGNTLIGKMESPLLASRVSSYQSLQILDLSSNALSGEIP-SNLGVL  407

Query  783   GSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSN  962
              SL   +++ +   G IPSS+ +      ++LS+N  +G       I G   L+ L +  
Sbjct  408   SSLILFNMSRNHLFGSIPSSIGELKTTEVIDLSDNWLNGS--IPSEIGGAVSLKELSLQR  465

Query  963   NELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             N LSG +P       +L  L L  N+ SG IP  +    +L  +DLS N  TG++P+ L
Sbjct  466   NFLSGKVPTQIVNCSSLTTLILSQNNLSGSIPPAIANLSNLQYVDLSLNDLTGSLPKEL  524


 Score = 70.9 bits (172),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 80/157 (51%), Gaps = 3/157 (2%)
 Frame = +3

Query  660   SKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPS  839
             S N++SG +P +LG +SSL   ++S N L G +  S+ E L +   + L+ +   G IPS
Sbjct  392   SSNALSGEIPSNLGVLSSLILFNMSRNHLFGSIPSSIGE-LKTTEVIDLSDNWLNGSIPS  450

Query  840   SLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKE  1019
              +     L  L+L  N  SG  +    I   + L TL +S N LSGS+P   + L NL+ 
Sbjct  451   EIGGAVSLKELSLQRNFLSG--KVPTQIVNCSSLTTLILSQNNLSGSIPPAIANLSNLQY  508

Query  1020  LSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             + L  N  +G +P +L     L   ++S N   G +P
Sbjct  509   VDLSLNDLTGSLPKELANLSQLMSFNISHNHLRGELP  545



>gb|KJB71525.1| hypothetical protein B456_011G127000 [Gossypium raimondii]
Length=967

 Score =   208 bits (530),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 112/262 (43%), Positives = 161/262 (61%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLI FK+G++DP + L +WS DD+ PC W  VKC P   RV+E+ L GL LSG 
Sbjct  26    FNDDVLGLIFFKAGLKDPTAKLQSWSADDNDPCNWMGVKCDPTTYRVTELHLDGLSLSGH  85

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             +GRGL +L  L VLSL                        SKN+++GT+   L  + SL+
Sbjct  86    VGRGLLRLPFLQVLSL------------------------SKNNLTGTINSELSRIGSLR  121

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLSGNSLSG + D      GSLR +S A ++  G +P+SLS C+ L  +N S+N+ SG
Sbjct  122   VIDLSGNSLSGSIPDDFFTQCGSLRSISFARNNLTGELPASLSSCSTLVAVNFSSNQISG  181

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
               +    IW L  L++LD+S N L G +P G   L++L++++LG+N FSG +P D+G C 
Sbjct  182   --QLPSEIWYLRSLQSLDMSGNLLEGEIPEGIGNLYDLRQINLGNNRFSGRLPGDIGSCS  239

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
             HL  +D S+N   G++P+S+++
Sbjct  240   HLKSVDFSDNYLYGSLPDSIRK  261


 Score = 89.4 bits (220),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 78/261 (30%), Positives = 118/261 (45%), Gaps = 51/261 (20%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +D+ G  L G+I  G+  L  L  ++L +N FSG +   +G  ++L++++ S N + G++
Sbjct  196   LDMSGNLLEGEIPEGIGNLYDLRQINLGNNRFSGRLPGDIGSCSHLKSVDFSDNYLYGSL  255

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             PDS+  + S   + L GNSL G V D + E L SL  L L+ ++F G +PSSL    LL 
Sbjct  256   PDSIRKLGSCSSISLGGNSLRGQVPDWIGE-LTSLESLDLSANNFSGKVPSSLGNLQLLR  314

Query  867   HLNLSNNRFSG-------------------------------------------------  899
              LNLS N+F+G                                                 
Sbjct  315   ELNLSMNQFTGALPESMANCYNLLAIDVSQNLLTGNVPSWMFKMGVQGALISGNKLMGNV  374

Query  900   -DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLC  1076
               P  +  +     LR LD+S+N LSG +P     L +L   ++  NH  G IP  +G  
Sbjct  375   KSPSLASTVPSYQGLRMLDLSSNALSGEIPSNLGVLSSLLFFNMSRNHLFGSIPASIGEL  434

Query  1077  PHLSRLDLSENLFTGTIPESL  1139
                  +DLS NL  G+IP  +
Sbjct  435   KATQVIDLSHNLLNGSIPSEI  455


 Score = 84.3 bits (207),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 80/243 (33%), Positives = 119/243 (49%), Gaps = 29/243 (12%)
 Frame = +3

Query  492   GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  671
             G  S + L G  L G++   + +L  L  L L++NNFSG +   LG L  L+ LNLS N 
Sbjct  263   GSCSSISLGGNSLRGQVPDWIGELTSLESLDLSANNFSGKVPSSLGNLQLLRELNLSMNQ  322

Query  672   ISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLE---------------NLGS------  788
              +G +P+S+ N  +L  +D+S N L+G V   M +               N+ S      
Sbjct  323   FTGALPESMANCYNLLAIDVSQNLLTGNVPSWMFKMGVQGALISGNKLMGNVKSPSLAST  382

Query  789   ------LRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTL  950
                   LR L L+ ++  G IPS+L   + L   N+S N   G       I  L   + +
Sbjct  383   VPSYQGLRMLDLSSNALSGEIPSNLGVLSSLLFFNMSRNHLFGS--IPASIGELKATQVI  440

Query  951   DVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             D+S+N L+GS+P       +LKEL L  N  SG+IP  +  C  L+ L LS N  +G+IP
Sbjct  441   DLSHNLLNGSIPSEIGGAVSLKELRLQRNFLSGKIPTQIVKCSSLTVLILSRNNLSGSIP  500

Query  1131  ESL  1139
              ++
Sbjct  501   TAI  503


 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 81/157 (52%), Gaps = 3/157 (2%)
 Frame = +3

Query  660   SKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPS  839
             S N++SG +P +LG +SSL F ++S N L G +  S+ E L + + + L+ +   G IPS
Sbjct  395   SSNALSGEIPSNLGVLSSLLFFNMSRNHLFGSIPASIGE-LKATQVIDLSHNLLNGSIPS  453

Query  840   SLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKE  1019
              +     L  L L  N  SG  +    I   + L  L +S N LSGS+P   S L NL+ 
Sbjct  454   EIGGAVSLKELRLQRNFLSG--KIPTQIVKCSSLTVLILSRNNLSGSIPTAISNLSNLQY  511

Query  1020  LSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             + L  N F+G +P +L     L   ++S N   G +P
Sbjct  512   VDLSLNDFTGSLPKELANLSQLMFFNISHNHLHGELP  548


 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 94/166 (57%), Gaps = 3/166 (2%)
 Frame = +3

Query  564   EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNS  743
             + L +L L+SN  SG I   LG+L++L   N+S+N + G++P S+G + + Q +DLS N 
Sbjct  387   QGLRMLDLSSNALSGEIPSNLGVLSSLLFFNMSRNHLFGSIPASIGELKATQVIDLSHNL  446

Query  744   LSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGI  923
             L+G +  S +    SL+ L L  +   G IP+ + KC+ L  L LS N  SG       I
Sbjct  447   LNGSIP-SEIGGAVSLKELRLQRNFLSGKIPTQIVKCSSLTVLILSRNNLSGS--IPTAI  503

Query  924   WGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
               L+ L+ +D+S N+ +GSLP   + L  L   ++  NH  GE+P+
Sbjct  504   SNLSNLQYVDLSLNDFTGSLPKELANLSQLMFFNISHNHLHGELPL  549



>ref|NP_195809.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAL11557.1|AF424563_1 AT5g01890/T20L15_160 [Arabidopsis thaliana]
 emb|CAB82759.1| putative protein [Arabidopsis thaliana]
 gb|AAO42766.1| At5g01890/T20L15_160 [Arabidopsis thaliana]
 gb|ACN59360.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED90406.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
Length=967

 Score =   208 bits (529),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 115/261 (44%), Positives = 157/261 (60%), Gaps = 26/261 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLIVFK+G+ DP S L++W+ +D  PC W    C PA  RVSE+ L    LSG 
Sbjct  24    FNDDVLGLIVFKAGLDDPLSKLSSWNSEDYDPCNWVGCTCDPATNRVSELRLDAFSLSGH  83

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L+ L L++NN +G ++P                           ++ SLQ
Sbjct  84    IGRGLLRLQFLHTLVLSNNNLTGTLNP------------------------EFPHLGSLQ  119

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +D SGN+LSG + D   E  GSLR +SLA +   G IP SLS C+ L HLNLS+N+ SG
Sbjct  120   VVDFSGNNLSGRIPDGFFEQCGSLRSVSLANNKLTGSIPVSLSYCSTLTHLNLSSNQLSG  179

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
               R    IW L  L++LD S+N L G +P G   L++L+ ++L  N FSG++P D+G C 
Sbjct  180   --RLPRDIWFLKSLKSLDFSHNFLQGDIPDGLGGLYDLRHINLSRNWFSGDVPSDIGRCS  237

Query  1080  HLSRLDLSENLFTGTIPESLQ  1142
              L  LDLSEN F+G +P+S++
Sbjct  238   SLKSLDLSENYFSGNLPDSMK  258


 Score = 93.6 bits (231),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 125/243 (51%), Gaps = 29/243 (12%)
 Frame = +3

Query  492   GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  671
             G  S + L G  L G+I   +  +  L +L L++NNF+G +   LG L  L+ LNLS N 
Sbjct  261   GSCSSIRLRGNSLIGEIPDWIGDIATLEILDLSANNFTGTVPFSLGNLEFLKDLNLSANM  320

Query  672   ISGTVPDSLGNMSSLQFLDLSGNSLSGPV------------------------SDSMLEN  779
             ++G +P +L N S+L  +D+S NS +G V                        +D+++  
Sbjct  321   LAGELPQTLSNCSNLISIDVSKNSFTGDVLKWMFTGNSESSSLSRFSLHKRSGNDTIMPI  380

Query  780   LG---SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTL  950
             +G    LR L L+ + F G +PS++   T L  LN+S N   G      GI GL     L
Sbjct  381   VGFLQGLRVLDLSSNGFTGELPSNIWILTSLLQLNMSTNSLFGS--IPTGIGGLKVAEIL  438

Query  951   DVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             D+S+N L+G+LP       +LK+L L  N  SG+IP  +  C  L+ ++LSEN  +G IP
Sbjct  439   DLSSNLLNGTLPSEIGGAVSLKQLHLHRNRLSGQIPAKISNCSALNTINLSENELSGAIP  498

Query  1131  ESL  1139
              S+
Sbjct  499   GSI  501


 Score = 83.6 bits (205),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 96/167 (57%), Gaps = 3/167 (2%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             L+ L VL L+SN F+G +   + +LT+L  LN+S NS+ G++P  +G +   + LDLS N
Sbjct  384   LQGLRVLDLSSNGFTGELPSNIWILTSLLQLNMSTNSLFGSIPTGIGGLKVAEILDLSSN  443

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
              L+G +  S +    SL+ L L  +   G IP+ +S C+ LN +NLS N  SG     G 
Sbjct  444   LLNGTLP-SEIGGAVSLKQLHLHRNRLSGQIPAKISNCSALNTINLSENELSG--AIPGS  500

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             I  L+ L  +D+S N LSGSLP     L +L   ++  N+ +GE+P 
Sbjct  501   IGSLSNLEYIDLSRNNLSGSLPKEIEKLSHLLTFNISHNNITGELPA  547


 Score = 80.1 bits (196),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 79/254 (31%), Positives = 123/254 (48%), Gaps = 51/254 (20%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL---  698
             L G I  GL  L  L  ++L+ N FSG +   +G  ++L++L+LS+N  SG +PDS+   
Sbjct  201   LQGDIPDGLGGLYDLRHINLSRNWFSGDVPSDIGRCSSLKSLDLSENYFSGNLPDSMKSL  260

Query  699   ---------------------GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGS  815
                                  G++++L+ LDLS N+ +G V  S L NL  L+ L+L+ +
Sbjct  261   GSCSSIRLRGNSLIGEIPDWIGDIATLEILDLSANNFTGTVPFS-LGNLEFLKDLNLSAN  319

Query  816   SFEGPIPSSLSKCTLLNHLNLSNNRFSGDP---RFSGG----------------------  920
                G +P +LS C+ L  +++S N F+GD     F+G                       
Sbjct  320   MLAGELPQTLSNCSNLISIDVSKNSFTGDVLKWMFTGNSESSSLSRFSLHKRSGNDTIMP  379

Query  921   -IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLD  1097
              +  L  LR LD+S+N  +G LP     L +L +L++ +N   G IP  +G       LD
Sbjct  380   IVGFLQGLRVLDLSSNGFTGELPSNIWILTSLLQLNMSTNSLFGSIPTGIGGLKVAEILD  439

Query  1098  LSENLFTGTIPESL  1139
             LS NL  GT+P  +
Sbjct  440   LSSNLLNGTLPSEI  453



>ref|XP_010525412.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Tarenaya hassleriana]
Length=965

 Score =   207 bits (528),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 160/262 (61%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ ++DP   LA+W+EDD SPC W  +KC+P   RV+E++L G  LSG+
Sbjct  28    LNDDVLGLIVFKADLRDPEQKLASWNEDDYSPCNWVGLKCNPRTNRVTELNLDGFSLSGR  87

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L  LSL++NN +G I+P                        +L ++  L+
Sbjct  88    IGRGLLQLQFLRKLSLSNNNLTGNINP------------------------NLLSLQDLK  123

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N LSG + D      GSLR +SLA ++  G IP S+S C+ L  LNLS+N  SG
Sbjct  124   IVDLSNNGLSGSIPDGFFRQCGSLRAISLANNNLSGKIPVSISSCSSLAALNLSSNHLSG  183

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIW L  LR+LD+S N L G +P G   L+NL+ L L  N FSG +P ++G C 
Sbjct  184   S--LPSGIWSLNTLRSLDLSGNGLEGEIPEGIDSLNNLRVLDLSRNRFSGLVPSEIGNCL  241

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLSEN  +G +P+SLQ+
Sbjct  242   LLKYVDLSENSLSGNLPDSLQK  263


 Score =   106 bits (265),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 87/250 (35%), Positives = 129/250 (52%), Gaps = 40/250 (16%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL G GL G+I  G++ L +L VL L+ N FSG++  ++G    L+ ++LS+NS+SG +
Sbjct  198   LDLSGNGLEGEIPEGIDSLNNLRVLDLSRNRFSGLVPSEIGNCLLLKYVDLSENSLSGNL  257

Query  687   PDSL------------------------GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  794
             PDSL                        G M SL+ LD S N  SG + DS + NL SL+
Sbjct  258   PDSLQKLNLCYFLDLGKNALEGDVPKWIGEMRSLETLDFSMNKFSGQIPDS-IGNLLSLK  316

Query  795   FLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPR---FSGG------------IWG  929
              L+L+ + F G +P  L+ C  L  L+ S N  SG+     F GG               
Sbjct  317   TLNLSANGFTGGLPDPLAHCVNLLALDFSQNSLSGNLPVWIFQGGSHEVSSLKNGNSTGS  376

Query  930   LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSEN  1109
             +  ++ LD+S+N +SG L  G   L +L+ L+L  N  +G IP  +G   +L  LDLS N
Sbjct  377   IKNIQVLDLSDNSISGELASGVGDLADLQVLNLSRNSLAGPIPSAIGELKNLDVLDLSHN  436

Query  1110  LFTGTIPESL  1139
                G+IP+ +
Sbjct  437   QLNGSIPQDI  446


 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 74/221 (33%), Positives = 121/221 (55%), Gaps = 22/221 (10%)
 Frame = +3

Query  531   SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP-------  689
             SG+I   +  L  L  L+L++N F+G +   L    NL  L+ S+NS+SG +P       
Sbjct  302   SGQIPDSIGNLLSLKTLNLSANGFTGGLPDPLAHCVNLLALDFSQNSLSGNLPVWIFQGG  361

Query  690   ----------DSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPS  839
                       +S G++ ++Q LDLS NS+SG ++ S + +L  L+ L+L+ +S  GPIPS
Sbjct  362   SHEVSSLKNGNSTGSIKNIQVLDLSDNSISGELA-SGVGDLADLQVLNLSRNSLAGPIPS  420

Query  840   SLSKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLK  1016
             ++ +   L+ L+LS+N+ +G  P+  GG   L  LR   + +N L G +P       +L+
Sbjct  421   AIGELKNLDVLDLSHNQLNGSIPQDIGGAVSLEELR---LESNLLEGRIPSSIKNCSSLR  477

Query  1017  ELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              L L  N+  G +P ++    +L  +DLS N  TGT+P+ L
Sbjct  478   SLILSQNNLLGPVPPEIAKLSNLRDVDLSFNDLTGTLPKQL  518


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 102/178 (57%), Gaps = 9/178 (5%)
 Frame = +3

Query  537   KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSL  716
             K G     ++++ VL L+ N+ SG ++  +G L +LQ LNLS+NS++G +P ++G + +L
Sbjct  369   KNGNSTGSIKNIQVLDLSDNSISGELASGVGDLADLQVLNLSRNSLAGPIPSAIGELKNL  428

Query  717   QFLDLSGNSLSGPVSDSMLENLG---SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
               LDLS N L+G    S+ +++G   SL  L L  +  EG IPSS+  C+ L  L LS N
Sbjct  429   DVLDLSHNQLNG----SIPQDIGGAVSLEELRLESNLLEGRIPSSIKNCSSLRSLILSQN  484

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
                G       I  L+ LR +D+S N+L+G+LP   + L NL   ++  N   GE+P 
Sbjct  485   NLLGP--VPPEIAKLSNLRDVDLSFNDLTGTLPKQLANLGNLHTFNISHNQICGELPT  540


 Score = 78.2 bits (191),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 114/229 (50%), Gaps = 18/229 (8%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    L G + + + ++  L  L  + N FSG I   +G L +L+TLNLS N  +G +
Sbjct  270   LDLGKNALEGDVPKWIGEMRSLETLDFSMNKFSGQIPDSIGNLLSLKTLNLSANGFTGGL  329

Query  687   PDSLGNMSSLQFLDLSGNSLSG--PV--------SDSMLEN------LGSLRFLSLAGSS  818
             PD L +  +L  LD S NSLSG  PV          S L+N      + +++ L L+ +S
Sbjct  330   PDPLAHCVNLLALDFSQNSLSGNLPVWIFQGGSHEVSSLKNGNSTGSIKNIQVLDLSDNS  389

Query  819   FEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGAS  998
               G + S +     L  LNLS N  +G       I  L  L  LD+S+N+L+GS+P    
Sbjct  390   ISGELASGVGDLADLQVLNLSRNSLAGP--IPSAIGELKNLDVLDLSHNQLNGSIPQDIG  447

Query  999   FLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
                +L+EL L SN   G IP  +  C  L  L LS+N   G +P  + +
Sbjct  448   GAVSLEELRLESNLLEGRIPSSIKNCSSLRSLILSQNNLLGPVPPEIAK  496



>ref|XP_003521989.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=970

 Score =   207 bits (527),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 116/264 (44%), Positives = 158/264 (60%), Gaps = 26/264 (10%)
 Frame = +3

Query  354   LQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  533
             L  NDDVLGLI+FK+G+QDP   L+TW+EDD SPC W  VKC PAN RVS + L G  LS
Sbjct  28    LSFNDDVLGLIMFKAGLQDPKGKLSTWNEDDYSPCHWVGVKCDPANNRVSSLVLDGFSLS  87

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  713
             G I RGL +L+ L +LSL+ NNF+G I+P                         L  +  
Sbjct  88    GHIDRGLLRLQFLQILSLSRNNFTGTIAP------------------------DLLTIGD  123

Query  714   LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRF  893
             L  +DLS N+LSGP+ D + +   SLR +S A ++  G +P SLS C  L  +N S+N+ 
Sbjct  124   LLVVDLSENNLSGPIPDGIFQQCWSLRVVSFANNNLTGKVPDSLSSCYSLAIVNFSSNQL  183

Query  894   SGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGL  1073
              G+     G+W L  L+++D+SNN L G +P G   L +L+EL LGSNHF+G +P  +G 
Sbjct  184   HGE--LPSGMWFLRGLQSIDLSNNFLEGEIPEGIQNLIDLRELRLGSNHFTGRVPEHIGD  241

Query  1074  CPHLSRLDLSENLFTGTIPESLQR  1145
             C  L  +D S N  +G +PES+Q+
Sbjct  242   CLLLKLVDFSGNSLSGRLPESMQK  265


 Score = 94.4 bits (233),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 81/242 (33%), Positives = 124/242 (51%), Gaps = 32/242 (13%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +  +DL    L G+I  G++ L  L  L L SN+F+G +   +G    L+ ++ S NS+S
Sbjct  197   LQSIDLSNNFLEGEIPEGIQNLIDLRELRLGSNHFTGRVPEHIGDCLLLKLVDFSGNSLS  256

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G +P+S+  ++S  FL L GNS +G +   + E + SL  L  + + F G IP+S+    
Sbjct  257   GRLPESMQKLTSCTFLSLQGNSFTGGIPHWIGE-MKSLETLDFSANRFSGWIPNSIGNLD  315

Query  858   LLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLP-------------IGA  995
             LL+ LNLS N+ +G+ P     +    +L TLD+S+N L+G LP              G 
Sbjct  316   LLSRLNLSRNQITGNLPEL---MVNCIKLLTLDISHNHLAGHLPSWIFRMGLQSVSLSGN  372

Query  996   SF--------------LHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPE  1133
             SF               H L+ L L SN F G++P  +G    L  L+LS N  +G+IP 
Sbjct  373   SFSESNYPSLTSIPVSFHGLQVLDLSSNAFFGQLPSGVGGLSSLQVLNLSTNNISGSIPV  432

Query  1134  SL  1139
             S+
Sbjct  433   SI  434


 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 76/214 (36%), Positives = 118/214 (55%), Gaps = 4/214 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             VD  G  LSG++   ++KL     LSL  N+F+G I   +G + +L+TL+ S N  SG +
Sbjct  248   VDFSGNSLSGRLPESMQKLTSCTFLSLQGNSFTGGIPHWIGEMKSLETLDFSANRFSGWI  307

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P+S+GN+  L  L+LS N ++G + + M+ N   L  L ++ +   G +PS + +  L  
Sbjct  308   PNSIGNLDLLSRLNLSRNQITGNLPELMV-NCIKLLTLDISHNHLAGHLPSWIFRMGL-Q  365

Query  867   HLNLSNNRFSGD--PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNH  1040
              ++LS N FS    P  +        L+ LD+S+N   G LP G   L +L+ L+L +N+
Sbjct  366   SVSLSGNSFSESNYPSLTSIPVSFHGLQVLDLSSNAFFGQLPSGVGGLSSLQVLNLSTNN  425

Query  1041  FSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
              SG IPV +G    L  LDLS N   G+IP  ++
Sbjct  426   ISGSIPVSIGELKSLCILDLSNNKLNGSIPSEVE  459


 Score = 87.8 bits (216),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 97/164 (59%), Gaps = 3/164 (2%)
 Frame = +3

Query  570   LNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLS  749
             L VL L+SN F G +   +G L++LQ LNLS N+ISG++P S+G + SL  LDLS N L+
Sbjct  392   LQVLDLSSNAFFGQLPSGVGGLSSLQVLNLSTNNISGSIPVSIGELKSLCILDLSNNKLN  451

Query  750   GPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWG  929
             G +  S +E   SL  + L  +   G IP+ + KC+ L  LNLS+N+  G       I  
Sbjct  452   GSIP-SEVEGAISLSEMRLQKNFLGGRIPTQIEKCSELTFLNLSHNKLIGS--IPSAIAN  508

Query  930   LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             LT L+  D S NELSG+LP   + L NL   ++  NH  GE+PV
Sbjct  509   LTNLQHADFSWNELSGNLPKELTNLSNLFSFNVSYNHLLGELPV  552



>ref|XP_007140080.1| hypothetical protein PHAVU_008G082500g [Phaseolus vulgaris]
 gb|ESW12074.1| hypothetical protein PHAVU_008G082500g [Phaseolus vulgaris]
Length=968

 Score =   207 bits (526),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 112/262 (43%), Positives = 161/262 (61%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLIVFK+G++DP   L++W+EDD+SPC W  VKC P++ RV+ + L G  LSG 
Sbjct  27    FNDDVLGLIVFKAGLEDPKRKLSSWNEDDNSPCNWEGVKCDPSSNRVTALVLDGFSLSGH  86

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             + RGL +L+ L +LSL+ NNF+G+I+P                         L  + SLQ
Sbjct  87    VDRGLLRLQFLQILSLSRNNFTGLINP------------------------DLPRLGSLQ  122

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +D S N+LSG + +   +  GSLR +S A ++  G IP SLS C+ L  +N S+N+  G
Sbjct  123   AVDFSDNNLSGEIPEGFFQQCGSLRTVSFAKNNLTGKIPESLSSCSNLATVNFSSNQLHG  182

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
             +     G+W L  L++LD+S+N L G +P G   L++++ELSL  N FSG +P D+G C 
Sbjct  183   E--LPNGVWFLRGLQSLDLSDNMLEGEIPEGIQNLYDMRELSLQRNRFSGRLPGDIGGCL  240

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LDLS N  +G +P+S+QR
Sbjct  241   LLKSLDLSGNFLSGELPQSMQR  262


 Score =   100 bits (248),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 84/217 (39%), Positives = 122/217 (56%), Gaps = 4/217 (2%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +  +DL G  LSG++ + +++L     LSL  N+F+G I   +G L NL  L+LS NS S
Sbjct  242   LKSLDLSGNFLSGELPQSMQRLTSCTSLSLQGNSFTGGIPDWIGELKNLDMLDLSANSFS  301

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G +P SLGN+ SL  L+LS N L+G + DSML N   L  L ++ +   G +PS + K  
Sbjct  302   GWIPKSLGNLDSLHRLNLSRNQLTGNLPDSML-NCTKLLTLDISHNHLAGHVPSWIFKMG  360

Query  858   LLNHLNLSNNRFSGD--PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLG  1031
              +  ++LS N FS    P           L  LD+S N  SG LP G   L +L+ L++ 
Sbjct  361   -VQSISLSGNGFSKGNYPALKSTPTSYHGLEVLDLSFNAFSGVLPSGIGGLSSLQVLNIS  419

Query  1032  SNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
             +N+ SG IPV +G    L  +DLS+N F G+IP  ++
Sbjct  420   TNNISGPIPVGIGELKSLYIIDLSDNKFNGSIPSEIE  456


 Score = 87.4 bits (215),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 98/164 (60%), Gaps = 3/164 (2%)
 Frame = +3

Query  570   LNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLS  749
             L VL L+ N FSGV+   +G L++LQ LN+S N+ISG +P  +G + SL  +DLS N  +
Sbjct  389   LEVLDLSFNAFSGVLPSGIGGLSSLQVLNISTNNISGPIPVGIGELKSLYIIDLSDNKFN  448

Query  750   GPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWG  929
             G +  S +E   SLR L L  +   G IP+ + KC+ L  L LS+N+ +G       I  
Sbjct  449   GSIP-SEIEGAISLRELRLQKNFLGGRIPAQIDKCSSLTFLILSHNKLTGS--IPPAIAN  505

Query  930   LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             L+ L+ +D+S N+LSGSLP   + L +L   ++  NH  GE+PV
Sbjct  506   LSNLQYVDLSRNQLSGSLPKELTNLSHLFSFNVSYNHLEGELPV  549


 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 70/125 (56%), Gaps = 1/125 (1%)
 Frame = +3

Query  528  LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
            +SG I  G+ +L+ L ++ L+ N F+G I  ++    +L+ L L KN + G +P  +   
Sbjct  423  ISGPIPVGIGELKSLYIIDLSDNKFNGSIPSEIEGAISLRELRLQKNFLGGRIPAQIDKC  482

Query  708  SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
            SSL FL LS N L+G +  + + NL +L+++ L+ +   G +P  L+  + L   N+S N
Sbjct  483  SSLTFLILSHNKLTGSIPPA-IANLSNLQYVDLSRNQLSGSLPKELTNLSHLFSFNVSYN  541

Query  888  RFSGD  902
               G+
Sbjct  542  HLEGE  546



>gb|EEC75203.1| hypothetical protein OsI_11455 [Oryza sativa Indica Group]
Length=971

 Score =   206 bits (525),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 159/273 (58%), Gaps = 26/273 (10%)
 Frame = +3

Query  327   TSGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSE  506
               G G A +  L+DDVLGLIVFK+ V DP   LATWSEDD+ PCAW  V C P  GRV+ 
Sbjct  19    AKGGGPASAAALDDDVLGLIVFKADVVDPEGRLATWSEDDERPCAWAGVTCDPLTGRVAG  78

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             + L G GLSGK+GRGL +LE L  LSL+ NNFSG                         +
Sbjct  79    LSLAGFGLSGKLGRGLLRLESLQSLSLSGNNFSG------------------------DL  114

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P  L  +  LQ LDLS N+ SG + D    +  +LR +SLA ++F G +P  +  C  L 
Sbjct  115   PADLARLPDLQSLDLSANAFSGAIPDGFFGHCRNLRDVSLANNAFSGDVPRDVGACATLA  174

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
              LNLS+NR +G       IW L  LRTLD+S N ++G LP+G S + NL+ L+L SN  +
Sbjct  175   SLNLSSNRLAG--ALPSDIWSLNALRTLDLSGNAITGDLPVGVSRMFNLRSLNLRSNRLA  232

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             G +P D+G CP L  +DL  N  +G +PESL+R
Sbjct  233   GSLPDDIGDCPLLRSVDLGSNNISGNLPESLRR  265


 Score = 93.6 bits (231),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 118/213 (55%), Gaps = 4/213 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL G  ++G +  G+ ++ +L  L+L SN  +G +   +G    L++++L  N+ISG +
Sbjct  200   LDLSGNAITGDLPVGVSRMFNLRSLNLRSNRLAGSLPDDIGDCPLLRSVDLGSNNISGNL  259

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P+SL  +S+  +LDLS N+L+G V  + +  + SL  L L+G+ F G IP S+     L 
Sbjct  260   PESLRRLSTCTYLDLSSNALTGNVP-TWVGEMASLETLDLSGNKFSGEIPGSIGGLMSLK  318

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
              L LS N F+G       I G   L  +DVS N L+G+LP    F   ++ +S+  N  S
Sbjct  319   ELRLSGNGFTGG--LPESIGGCKSLVHVDVSWNSLTGTLP-SWVFASGVQWVSVSDNTLS  375

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             GE+ V +     +  +DLS N F+G IP  + +
Sbjct  376   GEVFVPVNASSMVRGVDLSSNAFSGMIPSEISQ  408


 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 81/233 (35%), Positives = 119/233 (51%), Gaps = 25/233 (11%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    L+G +   + ++  L  L L+ N FSG I   +G L +L+ L LS N  +G +
Sbjct  272   LDLSSNALTGNVPTWVGEMASLETLDLSGNKFSGEIPGSIGGLMSLKELRLSGNGFTGGL  331

Query  687   PDSLGNMSSLQFLDLSGNSLSGP--------------VSDSMLE-------NLGSL-RFL  800
             P+S+G   SL  +D+S NSL+G               VSD+ L        N  S+ R +
Sbjct  332   PESIGGCKSLVHVDVSWNSLTGTLPSWVFASGVQWVSVSDNTLSGEVFVPVNASSMVRGV  391

Query  801   SLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGS  980
              L+ ++F G IPS +S+   L  LN+S N  SG       I  +  L  LD++ N L+GS
Sbjct  392   DLSSNAFSGMIPSEISQVITLQSLNMSWNSLSGS--IPPSIVQMKSLEVLDLTANRLNGS  449

Query  981   LPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +P       +L+EL L  N  +GEIP  +G    L+ LDLS N  TG IP ++
Sbjct  450   IPATVGG-ESLRELRLAKNSLTGEIPAQIGNLSALASLDLSHNNLTGAIPATI  501


 Score = 86.7 bits (213),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 73/225 (32%), Positives = 114/225 (51%), Gaps = 22/225 (10%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L+G +   +     L  + L SNN SG +   L  L+    L+LS N+++G VP  +G M
Sbjct  231   LAGSLPDDIGDCPLLRSVDLGSNNISGNLPESLRRLSTCTYLDLSSNALTGNVPTWVGEM  290

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
             +SL+ LDLSGN  SG +  S +  L SL+ L L+G+ F G +P S+  C  L H+++S N
Sbjct  291   ASLETLDLSGNKFSGEIPGS-IGGLMSLKELRLSGNGFTGGLPESIGGCKSLVHVDVSWN  349

Query  888   RFSG-----------------DPRFSGGIW----GLTRLRTLDVSNNELSGSLPIGASFL  1004
               +G                 D   SG ++      + +R +D+S+N  SG +P   S +
Sbjct  350   SLTGTLPSWVFASGVQWVSVSDNTLSGEVFVPVNASSMVRGVDLSSNAFSGMIPSEISQV  409

Query  1005  HNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
               L+ L++  N  SG IP  +     L  LDL+ N   G+IP ++
Sbjct  410   ITLQSLNMSWNSLSGSIPPSIVQMKSLEVLDLTANRLNGSIPATV  454


 Score = 84.3 bits (207),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 104/177 (59%), Gaps = 4/177 (2%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             LSG++   +     +  + L+SN FSG+I  ++  +  LQ+LN+S NS+SG++P S+  M
Sbjct  374   LSGEVFVPVNASSMVRGVDLSSNAFSGMIPSEISQVITLQSLNMSWNSLSGSIPPSIVQM  433

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
              SL+ LDL+ N L+G +  ++     SLR L LA +S  G IP+ +   + L  L+LS+N
Sbjct  434   KSLEVLDLTANRLNGSIPATVGGE--SLRELRLAKNSLTGEIPAQIGNLSALASLDLSHN  491

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
               +G       I  +T L+T+D+S N+L+G LP   S L +L   ++  N  SG++P
Sbjct  492   NLTG--AIPATIANITNLQTVDLSRNKLTGGLPKQLSDLPHLVRFNISHNQLSGDLP  546



>gb|KFK24685.1| hypothetical protein AALP_AA8G011600 [Arabis alpina]
Length=976

 Score =   206 bits (525),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 116/269 (43%), Positives = 156/269 (58%), Gaps = 26/269 (10%)
 Frame = +3

Query  336   AGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  515
             A   ++   NDDVLGLIVFKSG+ DP S L++W+ +D  PC W    C P+  RV+E+ L
Sbjct  21    AAAGQNPTFNDDVLGLIVFKSGLHDPLSKLSSWNSEDLDPCNWLGCICDPSTNRVTELRL  80

Query  516   HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDS  695
              G  LSG IGRGL +L  L+ L L++NN +G ++P                         
Sbjct  81    DGFSLSGHIGRGLLRLNFLHTLLLSNNNLTGTLNP------------------------E  116

Query  696   LGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLN  875
               ++ SLQ LD SGN+LSG + D+  +  GSLR +S A +   G +P SLS C+ L HLN
Sbjct  117   FPHLGSLQVLDFSGNNLSGRIPDAFFQQCGSLRSVSFANNKLTGSLPVSLSYCSTLTHLN  176

Query  876   LSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEI  1055
             LS N+ SG  RF   +W L  L +LD+S+N L G LP G   L++L+E+    N FSG +
Sbjct  177   LSTNQLSG--RFPRELWFLKSLTSLDLSDNFLQGELPDGVGGLYDLREIDFSKNWFSGHV  234

Query  1056  PVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
             P DLG C  L  LD SEN F+G +P S+Q
Sbjct  235   PSDLGKCSSLKSLDFSENYFSGNLPGSMQ  263


 Score = 90.1 bits (222),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 82/239 (34%), Positives = 121/239 (51%), Gaps = 30/239 (13%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             + L G  L G+I   + ++  L  L L+ NNFSG +   LG L  L+ LNLS N + G +
Sbjct  271   IRLRGNSLVGEIPDWIGEIATLETLDLSGNNFSGNVPFSLGNLEFLKELNLSANMLVGEI  330

Query  687   PDSLGNMSSLQFLDLSGNSLSGPV-------------------------SDSMLENLG--  785
             P+++ N S+L  +D+S NS +G V                         +DS+L  +G  
Sbjct  331   PETISNCSNLVSIDVSKNSFTGDVLKWMFNGNSESSSLLSRYSLDKRSGNDSVLSIVGFL  390

Query  786   -SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSN  962
               LR L L+ + F G IPS++     L  LN+S N   G      GI GL     LD+S+
Sbjct  391   QGLRVLDLSSNGFSGEIPSNIYVLRSLVQLNMSTNSLFGS--IPSGIGGLKLAEILDLSS  448

Query  963   NELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             N L+G++P       +LK+L+L  N  SG+IP  +  C  L  +DLS+N  +G IP S+
Sbjct  449   NLLNGTVPSEIGGALSLKQLNLQRNRISGQIPSQISNCSALKAIDLSDNELSGGIPGSI  507


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 93/190 (49%), Gaps = 27/190 (14%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             L+ L VL L+SN FSG I   + +L +L  LN+S NS+ G++P  +G +   + LDLS N
Sbjct  390   LQGLRVLDLSSNGFSGEIPSNIYVLRSLVQLNMSTNSLFGSIPSGIGGLKLAEILDLSSN  449

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
              L+G V                         PS +     L  LNL  NR SG  +    
Sbjct  450   LLNGTV-------------------------PSEIGGALSLKQLNLQRNRISG--QIPSQ  482

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDL  1100
             I   + L+ +D+S+NELSG +P     L NL+ + L  N  SG +P ++    HL   ++
Sbjct  483   ISNCSALKAIDLSDNELSGGIPGSIGSLSNLEYMDLSRNKLSGSLPKEMEKLSHLVTFNI  542

Query  1101  SENLFTGTIP  1130
             S N  TG +P
Sbjct  543   SHNSITGELP  552



>ref|XP_009362809.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=952

 Score =   206 bits (524),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 160/262 (61%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ +QDP   LA+WSEDDDS C+W  +KCHP + RV E++L    LSG 
Sbjct  31    LNDDVLGLIVFKANIQDPKGKLASWSEDDDSACSWVGIKCHPRSNRVIELNLDDFSLSGH  90

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L  LSL+ NN  G ++P                        ++ ++ +L+
Sbjct  91    IGRGLLQLQALRKLSLSKNNLIGSLTP------------------------NIAHIDNLR  126

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              LDLS NS SG V +      GSLR +SLA + F G +P SL  C  L  +NLS N+FSG
Sbjct  127   VLDLSENSFSGDVPEEFFRQCGSLRVISLAKNKFSGKLPESLGSCPSLASVNLSLNQFSG  186

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   G+W L+ +R+LD+S+N L G +P G   L+NL+ ++L  N F+G++P  +G   
Sbjct  187   S--VPAGVWSLSGIRSLDLSDNLLEGGIPKGVEGLNNLRGINLARNRFTGQVPDGIGNWL  244

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLSEN F+G +P+++Q+
Sbjct  245   LLRSIDLSENSFSGNLPQTMQK  266


 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 80/231 (35%), Positives = 112/231 (48%), Gaps = 27/231 (12%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
              +G++  G+     L  + L+ N+FSG +   +  L     LNL +N+ SG VP+ +G M
Sbjct  232   FTGQVPDGIGNWLLLRSIDLSENSFSGNLPQTMQKLGLCSYLNLHQNTFSGEVPEWIGEM  291

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
              SL+ LDLS N  SG V  S + NL SL+ L+ + + F G +P SLS CT L  L+ S N
Sbjct  292   KSLETLDLSSNRFSGEVPSS-IGNLESLKVLNFSANGFTGSLPKSLSYCTNLLGLDFSKN  350

Query  888   RFSGD--------------------------PRFSGGIWGLTRLRTLDVSNNELSGSLPI  989
               +G+                          P  S     L  L+ LD+S N  SG +  
Sbjct  351   SMAGELPVWIFAAGTEEVSLSEKKPSGSKNIPLSSSAGNALKNLQVLDLSLNHFSGEITS  410

Query  990   GASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
                 L +L  L+L  N  +G IPV +G    L  LDLSEN   GTIP S++
Sbjct  411   DIGALSSLHVLNLSGNSLAGPIPVAIGDLKVLDNLDLSENRLNGTIPTSIE  461


 Score = 81.6 bits (200),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 73/221 (33%), Positives = 113/221 (51%), Gaps = 5/221 (2%)
 Frame = +3

Query  492   GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  671
             G  S ++LH    SG++   + +++ L  L L+SN FSG +   +G L +L+ LN S N 
Sbjct  268   GLCSYLNLHQNTFSGEVPEWIGEMKSLETLDLSSNRFSGEVPSSIGNLESLKVLNFSANG  327

Query  672   ISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSK  851
              +G++P SL   ++L  LD S NS++G +   +         LS    S    IP S S 
Sbjct  328   FTGSLPKSLSYCTNLLGLDFSKNSMAGELPVWIFAAGTEEVSLSEKKPSGSKNIPLSSSA  387

Query  852   CTLLNH---LNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKEL  1022
                L +   L+LS N FSG+   +  I  L+ L  L++S N L+G +P+    L  L  L
Sbjct  388   GNALKNLQVLDLSLNHFSGE--ITSDIGALSSLHVLNLSGNSLAGPIPVAIGDLKVLDNL  445

Query  1023  SLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              L  N  +G IP  +  C  L+ L +S+N  TG IP ++ +
Sbjct  446   DLSENRLNGTIPTSIENCSSLTTLIVSQNRLTGPIPAAMSK  486



>ref|XP_009349085.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=952

 Score =   206 bits (524),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 160/262 (61%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ +QDP   LA+WSEDDDS C+W  +KCHP + RV E++L    LSG 
Sbjct  31    LNDDVLGLIVFKANIQDPKGKLASWSEDDDSACSWVGIKCHPRSNRVIELNLDDFSLSGH  90

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L  LSL+ NN  G ++P                        ++ ++ +L+
Sbjct  91    IGRGLLQLQALRKLSLSKNNLIGSLTP------------------------NIAHIDNLR  126

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              LDLS NS SG V +      GSLR +SLA + F G +P SL  C  L  +NLS N+FSG
Sbjct  127   VLDLSENSFSGDVPEEFFRQCGSLRVISLAKNKFSGKLPESLGSCPSLASVNLSLNQFSG  186

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   G+W L+ +R+LD+S+N L G +P G   L+NL+ ++L  N F+G++P  +G   
Sbjct  187   S--VPAGVWSLSGIRSLDLSDNLLEGGIPKGVEGLNNLRGINLARNRFTGQVPDGIGNWL  244

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLSEN F+G +P+++Q+
Sbjct  245   LLRSIDLSENSFSGNLPQTMQK  266


 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 80/231 (35%), Positives = 112/231 (48%), Gaps = 27/231 (12%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
              +G++  G+     L  + L+ N+FSG +   +  L     LNL +N+ SG VP+ +G M
Sbjct  232   FTGQVPDGIGNWLLLRSIDLSENSFSGNLPQTMQKLGLCSYLNLHQNTFSGEVPEWIGEM  291

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
              SL+ LDLS N  SG V  S + NL SL+ L+ + + F G +P SLS CT L  L+ S N
Sbjct  292   KSLETLDLSSNRFSGEVPSS-IGNLESLKVLNFSANGFTGSLPKSLSYCTNLLGLDFSKN  350

Query  888   RFSGD--------------------------PRFSGGIWGLTRLRTLDVSNNELSGSLPI  989
               +G+                          P  S     L  L+ LD+S N  SG +  
Sbjct  351   SMAGELPVWIFAAGTEEVSLSEKKPSGSKNIPLSSSAGNALKNLQVLDLSLNHFSGEITS  410

Query  990   GASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
                 L +L  L+L  N  +G IPV +G    L  LDLSEN   GTIP S++
Sbjct  411   DIGALSSLHVLNLSGNSLAGPIPVAIGDLKVLDNLDLSENRLNGTIPTSIE  461


 Score = 81.6 bits (200),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 73/221 (33%), Positives = 113/221 (51%), Gaps = 5/221 (2%)
 Frame = +3

Query  492   GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  671
             G  S ++LH    SG++   + +++ L  L L+SN FSG +   +G L +L+ LN S N 
Sbjct  268   GLCSYLNLHQNTFSGEVPEWIGEMKSLETLDLSSNRFSGEVPSSIGNLESLKVLNFSANG  327

Query  672   ISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSK  851
              +G++P SL   ++L  LD S NS++G +   +         LS    S    IP S S 
Sbjct  328   FTGSLPKSLSYCTNLLGLDFSKNSMAGELPVWIFAAGTEEVSLSEKKPSGSKNIPLSSSA  387

Query  852   CTLLNH---LNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKEL  1022
                L +   L+LS N FSG+   +  I  L+ L  L++S N L+G +P+    L  L  L
Sbjct  388   GNALKNLQVLDLSLNHFSGE--ITSDIGALSSLHVLNLSGNSLAGPIPVAIGDLKVLDNL  445

Query  1023  SLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              L  N  +G IP  +  C  L+ L +S+N  TG IP ++ +
Sbjct  446   DLSENRLNGTIPTSIENCSSLTTLIVSQNRLTGPIPAAMSK  486



>ref|XP_003516434.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like isoform X1 [Glycine max]
 ref|XP_006573410.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like isoform X2 [Glycine max]
Length=969

 Score =   206 bits (524),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 115/262 (44%), Positives = 158/262 (60%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLIVFK+G++DP   L+TW+EDD SPC W  VKC  AN RVS + L G  LSG 
Sbjct  30    FNDDVLGLIVFKAGLEDPKGKLSTWNEDDYSPCNWVGVKCDLANNRVSSLVLDGFSLSGH  89

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             I RGL +L+ L +LSL+ NNF+G I+P                         L ++  LQ
Sbjct  90    IDRGLLRLQFLQILSLSRNNFTGTIAP------------------------DLLSIGDLQ  125

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N+L GP+ D + +   SLR +S A ++  G IP SLS C  L  +N S+N+  G
Sbjct  126   VVDLSENNLYGPIPDGIFQQCWSLRVVSFANNNLTGKIPDSLSSCYSLAVVNFSSNQLHG  185

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
             +     G+W L  L+++D+SNN L G +P G   L +L+EL LGSNHF+G +P  +G C 
Sbjct  186   E--LPSGMWFLRGLQSIDLSNNFLEGEIPEGIQNLIDLRELRLGSNHFTGRVPEHIGDCL  243

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +D S+N  +G +PES+Q+
Sbjct  244   LLKLVDFSDNSISGRLPESMQK  265


 Score = 98.6 bits (244),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 124/243 (51%), Gaps = 34/243 (14%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +  +DL    L G+I  G++ L  L  L L SN+F+G +   +G    L+ ++ S NSIS
Sbjct  197   LQSIDLSNNFLEGEIPEGIQNLIDLRELRLGSNHFTGRVPEHIGDCLLLKLVDFSDNSIS  256

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G +P+S+  ++S  FL L GNS +G +   + E + SL  L L+ + F G IP S+    
Sbjct  257   GRLPESMQKLTSCTFLSLQGNSFTGGIPHWIGE-MKSLEVLDLSANRFSGWIPKSIGNLD  315

Query  858   LLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLP----------------  986
             LL+ LNLS N+ +G+ P     +    +L TLD+S+N L+G LP                
Sbjct  316   LLSRLNLSRNQITGNLPEL---MVNCIKLLTLDISHNHLAGHLPSWIFRMGLQSVSLSGN  372

Query  987   ------------IGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
                         I  SF H L+ L L SN F G++P  +G    L  L+LS N  +G+IP
Sbjct  373   RFSESNYPSLTSIPVSF-HGLQVLDLSSNAFFGQLPSGIGGLSSLQVLNLSTNNISGSIP  431

Query  1131  ESL  1139
              S+
Sbjct  432   MSI  434


 Score = 87.8 bits (216),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 96/164 (59%), Gaps = 3/164 (2%)
 Frame = +3

Query  570   LNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLS  749
             L VL L+SN F G +   +G L++LQ LNLS N+ISG++P S+G + SL  LDLS N L+
Sbjct  392   LQVLDLSSNAFFGQLPSGIGGLSSLQVLNLSTNNISGSIPMSIGELKSLYILDLSDNKLN  451

Query  750   GPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWG  929
             G +  S +E   SL  + L  +   G IP+ + KC+ L  LNLS+N+  G       I  
Sbjct  452   GSIP-SEVEGAISLSEMRLQKNFLGGRIPAQIEKCSELTFLNLSHNKLIGS--IPSAIAN  508

Query  930   LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             LT L+  D S NELSGSLP   + L NL   ++  N   GE+PV
Sbjct  509   LTNLQYADFSWNELSGSLPKELTNLSNLFSFNVSYNRLQGELPV  552


 Score = 84.0 bits (206),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 75/215 (35%), Positives = 118/215 (55%), Gaps = 8/215 (4%)
 Frame = +3

Query  513   LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  692
             L G   +G I   + +++ L VL L++N FSG I   +G L  L  LNLS+N I+G +P+
Sbjct  274   LQGNSFTGGIPHWIGEMKSLEVLDLSANRFSGWIPKSIGNLDLLSRLNLSRNQITGNLPE  333

Query  693   SLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNH-  869
              + N   L  LD+S N L+G +  S +  +G L+ +SL+G+ F      SL+   +  H 
Sbjct  334   LMVNCIKLLTLDISHNHLAGHLP-SWIFRMG-LQSVSLSGNRFSESNYPSLTSIPVSFHG  391

Query  870   ---LNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNH  1040
                L+LS+N F G  +   GI GL+ L+ L++S N +SGS+P+    L +L  L L  N 
Sbjct  392   LQVLDLSSNAFFG--QLPSGIGGLSSLQVLNLSTNNISGSIPMSIGELKSLYILDLSDNK  449

Query  1041  FSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              +G IP ++     LS + L +N   G IP  +++
Sbjct  450   LNGSIPSEVEGAISLSEMRLQKNFLGGRIPAQIEK  484



>gb|KHN11868.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=969

 Score =   206 bits (523),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 114/262 (44%), Positives = 158/262 (60%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLIVFK+G++DP   L+TW+EDD SPC W  VKC  AN RVS + L G  LSG 
Sbjct  30    FNDDVLGLIVFKAGLEDPKGKLSTWNEDDYSPCNWVGVKCDLANNRVSSLVLDGFSLSGH  89

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             I RGL +L+ L +LSL+ NNF+G I+P                         L ++  LQ
Sbjct  90    IDRGLLRLQFLQILSLSRNNFTGTIAP------------------------DLLSIGDLQ  125

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N+L GP+ D + +   SLR +S A ++  G +P SLS C  L  +N S+N+  G
Sbjct  126   VVDLSENNLYGPIPDGIFQQCWSLRVVSFANNNLTGKVPDSLSSCYSLAVVNFSSNQLHG  185

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
             +     G+W L  L+++D+SNN L G +P G   L +L+EL LGSNHF+G +P  +G C 
Sbjct  186   E--LPSGMWFLRGLQSIDLSNNFLEGEIPEGIQNLIDLRELRLGSNHFTGRVPEHIGDCL  243

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +D S+N  +G +PES+Q+
Sbjct  244   LLKLVDFSDNSISGRLPESMQK  265


 Score = 98.6 bits (244),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 124/243 (51%), Gaps = 34/243 (14%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +  +DL    L G+I  G++ L  L  L L SN+F+G +   +G    L+ ++ S NSIS
Sbjct  197   LQSIDLSNNFLEGEIPEGIQNLIDLRELRLGSNHFTGRVPEHIGDCLLLKLVDFSDNSIS  256

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G +P+S+  ++S  FL L GNS +G +   + E + SL  L L+ + F G IP S+    
Sbjct  257   GRLPESMQKLTSCTFLSLQGNSFTGGIPHWIGE-MKSLEVLDLSANRFSGWIPKSIGNLD  315

Query  858   LLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLP----------------  986
             LL+ LNLS N+ +G+ P     +    +L TLD+S+N L+G LP                
Sbjct  316   LLSRLNLSRNQITGNLPEL---MVNCIKLLTLDISHNHLAGHLPSWIFRMGLQSVSLSGN  372

Query  987   ------------IGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
                         I  SF H L+ L L SN F G++P  +G    L  L+LS N  +G+IP
Sbjct  373   RFSESNYPSLTSIPVSF-HGLQVLDLSSNAFFGQLPSGIGGLSSLQVLNLSTNNISGSIP  431

Query  1131  ESL  1139
              S+
Sbjct  432   MSI  434


 Score = 87.8 bits (216),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 96/164 (59%), Gaps = 3/164 (2%)
 Frame = +3

Query  570   LNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLS  749
             L VL L+SN F G +   +G L++LQ LNLS N+ISG++P S+G + SL  LDLS N L+
Sbjct  392   LQVLDLSSNAFFGQLPSGIGGLSSLQVLNLSTNNISGSIPMSIGELKSLYILDLSDNKLN  451

Query  750   GPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWG  929
             G +  S +E   SL  + L  +   G IP+ + KC+ L  LNLS+N+  G       I  
Sbjct  452   GSIP-SEVEGAISLSEMRLQKNFLGGRIPAQIEKCSELTFLNLSHNKLIGS--IPSAIAN  508

Query  930   LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             LT L+  D S NELSGSLP   + L NL   ++  N   GE+PV
Sbjct  509   LTNLQYADFSWNELSGSLPKELTNLSNLFSFNVSYNRLQGELPV  552


 Score = 84.0 bits (206),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 75/215 (35%), Positives = 118/215 (55%), Gaps = 8/215 (4%)
 Frame = +3

Query  513   LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  692
             L G   +G I   + +++ L VL L++N FSG I   +G L  L  LNLS+N I+G +P+
Sbjct  274   LQGNSFTGGIPHWIGEMKSLEVLDLSANRFSGWIPKSIGNLDLLSRLNLSRNQITGNLPE  333

Query  693   SLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNH-  869
              + N   L  LD+S N L+G +  S +  +G L+ +SL+G+ F      SL+   +  H 
Sbjct  334   LMVNCIKLLTLDISHNHLAGHLP-SWIFRMG-LQSVSLSGNRFSESNYPSLTSIPVSFHG  391

Query  870   ---LNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNH  1040
                L+LS+N F G  +   GI GL+ L+ L++S N +SGS+P+    L +L  L L  N 
Sbjct  392   LQVLDLSSNAFFG--QLPSGIGGLSSLQVLNLSTNNISGSIPMSIGELKSLYILDLSDNK  449

Query  1041  FSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              +G IP ++     LS + L +N   G IP  +++
Sbjct  450   LNGSIPSEVEGAISLSEMRLQKNFLGGRIPAQIEK  484



>ref|XP_009793754.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=965

 Score =   205 bits (522),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 111/261 (43%), Positives = 157/261 (60%), Gaps = 26/261 (10%)
 Frame = +3

Query  363   NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
             NDDV+GLIVFK+G  DP S L +W+EDD +PC W  +KC P + RVSE+ L    LSG I
Sbjct  24    NDDVMGLIVFKAGFTDPKSKLTSWTEDDATPCNWVGIKCDPYSNRVSEILLDNFSLSGHI  83

Query  543   GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  722
             GR L +L+ L VLSL++NNF+G I+P                         L  + SL+ 
Sbjct  84    GRSLLRLQFLRVLSLSNNNFTGNINPI------------------------LAQIPSLRV  119

Query  723   LDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD  902
             +DLS NSLSG + D      GSL+ +S A ++  G IP SL+ C+ L  +N S+N  SG 
Sbjct  120   IDLSDNSLSGSLPDDFFRQCGSLQAVSFAKNNLTGQIPDSLTSCSTLERVNFSSNGLSG-  178

Query  903   PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPH  1082
              +   G+W L+ LR LD+S+N L G +P     L++L+ ++L  N F+G +P ++G C  
Sbjct  179   -QLPSGLWSLSSLRYLDISDNVLEGEIPKAIEGLYSLRSINLQKNKFTGWLPENIGNCVQ  237

Query  1083  LSRLDLSENLFTGTIPESLQR  1145
             L  +DLSENL +G +PES++R
Sbjct  238   LKSIDLSENLLSGGLPESMRR  258


 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 80/244 (33%), Positives = 119/244 (49%), Gaps = 28/244 (11%)
 Frame = +3

Query  492   GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  671
             G  + +DL     +G+I   + +++ L VL L++NN SG I   +G L  L  LNLS N 
Sbjct  260   GLCTTMDLRSNSFNGEIPDWIAEMKSLQVLDLSANNLSGRIPSSMGDLPLLAELNLSNNQ  319

Query  672   ISGTVPDSL-----------------GNMSSLQF------LDLSGNSLSGPVS---DSML  773
               G++P SL                 GN+ S  F      + LSGN  +G +     S+ 
Sbjct  320   FVGSLPRSLMKCINLVILDIGHNLLTGNLPSWAFTLGLKSISLSGNRFTGSIDYPPTSIA  379

Query  774   ENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLD  953
              +  SL+ L L+ ++  G IPS++     L  +N+S N  +G       +  L   R LD
Sbjct  380   TSYQSLQVLDLSSNALSGEIPSAIWNINSLEVMNISRNFLTG--IIPEAVGKLNATRVLD  437

Query  954   VSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPE  1133
             +S+N+L+GS+P       +L EL L  N  SG IP D+  C  L+ LDLS N  TG IP 
Sbjct  438   LSHNQLNGSIPYEIGSAVSLLELKLRENRLSGTIPADIANCSALTLLDLSHNNLTGPIPP  497

Query  1134  SLQR  1145
              + +
Sbjct  498   EISK  501


 Score = 78.6 bits (192),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 96/166 (58%), Gaps = 3/166 (2%)
 Frame = +3

Query  564   EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNS  743
             + L VL L+SN  SG I   +  + +L+ +N+S+N ++G +P+++G +++ + LDLS N 
Sbjct  383   QSLQVLDLSSNALSGEIPSAIWNINSLEVMNISRNFLTGIIPEAVGKLNATRVLDLSHNQ  442

Query  744   LSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGI  923
             L+G +   +   + SL  L L  +   G IP+ ++ C+ L  L+LS+N  +G       I
Sbjct  443   LNGSIPYEIGSAV-SLLELKLRENRLSGTIPADIANCSALTLLDLSHNNLTGP--IPPEI  499

Query  924   WGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
               LT L  +D S N++SGSLP   + L +L   ++  NH  GE+PV
Sbjct  500   SKLTILEVVDFSFNQISGSLPKELTNLSHLITFNVSHNHLKGELPV  545



>ref|XP_006279331.1| hypothetical protein CARUB_v10012717mg [Capsella rubella]
 gb|EOA12229.1| hypothetical protein CARUB_v10012717mg [Capsella rubella]
Length=967

 Score =   205 bits (521),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 113/261 (43%), Positives = 157/261 (60%), Gaps = 26/261 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG 
Sbjct  24    FNDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDAFSLSGH  83

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L+ L L++NN +G ++P                            + SLQ
Sbjct  84    IGRGLLRLQFLHTLVLSNNNLTGNLNP------------------------EFPRLGSLQ  119

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              ++ SGN+LSG + D   E  GSLR +SLA +   GP+P SLS C+ L HLNLS+N+ SG
Sbjct  120   VINFSGNNLSGRIPDGFFEQCGSLRSVSLANNKLTGPLPVSLSYCSTLTHLNLSSNQLSG  179

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
               R +  IW L  L++LD+S+N L G +P G + L++L+ + L  N FSG +P D+G C 
Sbjct  180   --RLAREIWFLKSLKSLDLSDNFLQGDIPDGLAALYDLRLIDLSRNWFSGHLPSDIGRCS  237

Query  1080  HLSRLDLSENLFTGTIPESLQ  1142
              L  LD S+N F+G +P+SL+
Sbjct  238   SLKSLDFSDNYFSGNLPDSLR  258


 Score = 98.2 bits (243),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 83/240 (35%), Positives = 125/240 (52%), Gaps = 29/240 (12%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             + V L G  L+G+I   +  +  L  L L++NNFSG +   LG L  L+ LNLS N ++G
Sbjct  264   TSVRLRGNSLAGEIPNWIGDIASLETLDLSANNFSGNVPFSLGNLEFLKELNLSTNMLTG  323

Query  681   TVPDSLGNMSSLQFLDLSGNSLSGPV------------------------SDSMLENLG-  785
              +P ++ N SSL  +D+S NS +G V                        +D++L  +G 
Sbjct  324   ELPQTISNCSSLISIDISKNSFTGDVLKWMFTGNSESSSLSRFSLHKRSGNDTILPIVGF  383

Query  786   --SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVS  959
                LR L L+ + F G +PS++   T L  LN+S N   G      GI GL     +D+S
Sbjct  384   LQDLRVLDLSSNRFSGELPSNIWVLTSLVQLNMSTNSLFGS--IPTGIGGLKVAEIIDLS  441

Query  960   NNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +N  +G++P       +LKEL+L  N  SG+IPV +  C  L+ +DLSEN  +G +P S+
Sbjct  442   SNLFNGTVPSAIGGAISLKELNLQRNRLSGQIPVQISNCSALNAIDLSENELSGEVPASI  501


 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 80/256 (31%), Positives = 116/256 (45%), Gaps = 55/256 (21%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             LSG++ R +  L+ L  L L+ N   G I   L  L +L+ ++LS+N  SG +P  +G  
Sbjct  177   LSGRLAREIWFLKSLKSLDLSDNFLQGDIPDGLAALYDLRLIDLSRNWFSGHLPSDIGRC  236

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
             SSL+ LD S N  SG + DS L  + S   + L G+S  G IP+ +     L  L+LS N
Sbjct  237   SSLKSLDFSDNYFSGNLPDS-LRTISSCTSVRLRGNSLAGEIPNWIGDIASLETLDLSAN  295

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGAS-----------------------  998
              FSG+  FS G   L  L+ L++S N L+G LP   S                       
Sbjct  296   NFSGNVPFSLG--NLEFLKELNLSTNMLTGELPQTISNCSSLISIDISKNSFTGDVLKWM  353

Query  999   -----------------------------FLHNLKELSLGSNHFSGEIPVDLGLCPHLSR  1091
                                          FL +L+ L L SN FSGE+P ++ +   L +
Sbjct  354   FTGNSESSSLSRFSLHKRSGNDTILPIVGFLQDLRVLDLSSNRFSGELPSNIWVLTSLVQ  413

Query  1092  LDLSENLFTGTIPESL  1139
             L++S N   G+IP  +
Sbjct  414   LNMSTNSLFGSIPTGI  429


 Score = 77.8 bits (190),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 93/190 (49%), Gaps = 27/190 (14%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             L+ L VL L+SN FSG +   + +LT+L  LN+S NS+ G++P  +G +   + +DLS N
Sbjct  384   LQDLRVLDLSSNRFSGELPSNIWVLTSLVQLNMSTNSLFGSIPTGIGGLKVAEIIDLSSN  443

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
                                       F G +PS++     L  LNL  NR SG  +    
Sbjct  444   L-------------------------FNGTVPSAIGGAISLKELNLQRNRLSG--QIPVQ  476

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDL  1100
             I   + L  +D+S NELSG +P     L NLK + L  N+ SG +P ++    HL   ++
Sbjct  477   ISNCSALNAIDLSENELSGEVPASIGSLSNLKYVDLSRNNLSGSLPKEIEKLLHLLTFNI  536

Query  1101  SENLFTGTIP  1130
             S N  TG +P
Sbjct  537   SHNNITGELP  546



>ref|XP_003623626.1| Receptor-like protein kinase [Medicago truncatula]
Length=948

 Score =   204 bits (519),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 153/262 (58%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDD+LGLIVFK+G+QDP   L +W+EDD +PC W  VKC  +N RV+ V L G  LSG 
Sbjct  30    FNDDILGLIVFKAGLQDPKHKLISWNEDDYTPCNWEGVKCDSSNNRVTSVILDGFSLSGH  89

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             I RGL +L+ L  LSL+ NNF+G I+P                         L  + SLQ
Sbjct  90    IDRGLLRLQFLQTLSLSGNNFTGFINP------------------------DLPKLGSLQ  125

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +D S N+L G + +   +  GSL+ ++ A ++  G IP SL  C  L ++N S N+  G
Sbjct  126   VVDFSDNNLKGTIPEGFFQQCGSLKTVNFAKNNLTGNIPVSLGTCNTLANVNFSYNQIDG  185

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
               +    +W L  L++LDVSNN L G +P G   L++++ELSL  N FSG IP D+G C 
Sbjct  186   --KLPSEVWFLRGLQSLDVSNNLLDGEIPEGIQNLYDMRELSLKKNRFSGRIPQDIGGCI  243

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LDLS NL +G IP+S+QR
Sbjct  244   VLKSLDLSGNLLSGGIPQSMQR  265


 Score =   105 bits (262),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 87/240 (36%), Positives = 123/240 (51%), Gaps = 28/240 (12%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +  +DL G  LSG I + +++L   N LSL  N+F+G I   +G L +L+ L+LS N  S
Sbjct  245   LKSLDLSGNLLSGGIPQSMQRLNSCNSLSLQGNSFTGNIPDWIGELKDLENLDLSANRFS  304

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLE--------------------------N  779
             G +P SLGN++ LQ L+ S N L+G + DSM+                           N
Sbjct  305   GWIPKSLGNLNMLQRLNFSRNQLTGNLPDSMMNCTKLLALDISNNQLNGYLPSWIFRNGN  364

Query  780   LGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVS  959
                L  L L+ +SF G IPS +   + L   N+S N FSG      GI  L  L  +D+S
Sbjct  365   YHGLEVLDLSSNSFSGEIPSDIGGLSSLKIWNMSTNYFSGSVPV--GIGELKSLCIVDLS  422

Query  960   NNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +N+L+GS+P       +L EL L  N   G IP  +  C  L+ LDLS N  TG+IP ++
Sbjct  423   DNKLNGSIPFELEGAISLGELRLQKNSIGGRIPDQIAKCSALTSLDLSHNKLTGSIPGAI  482


 Score = 96.7 bits (239),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 80/234 (34%), Positives = 118/234 (50%), Gaps = 34/234 (15%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L G+I  G++ L  +  LSL  N FSG I   +G    L++L+LS N +SG +P S+  +
Sbjct  207   LDGEIPEGIQNLYDMRELSLKKNRFSGRIPQDIGGCIVLKSLDLSGNLLSGGIPQSMQRL  266

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
             +S   L L GNS +G + D + E L  L  L L+ + F G IP SL    +L  LN S N
Sbjct  267   NSCNSLSLQGNSFTGNIPDWIGE-LKDLENLDLSANRFSGWIPKSLGNLNMLQRLNFSRN  325

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLP---------------------------  986
             + +G+      +   T+L  LD+SNN+L+G LP                           
Sbjct  326   QLTGN--LPDSMMNCTKLLALDISNNQLNGYLPSWIFRNGNYHGLEVLDLSSNSFSGEIP  383

Query  987   --IGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
               IG   L +LK  ++ +N+FSG +PV +G    L  +DLS+N   G+IP  L+
Sbjct  384   SDIGG--LSSLKIWNMSTNYFSGSVPVGIGELKSLCIVDLSDNKLNGSIPFELE  435


 Score = 93.6 bits (231),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 98/164 (60%), Gaps = 3/164 (2%)
 Frame = +3

Query  570   LNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLS  749
             L VL L+SN+FSG I   +G L++L+  N+S N  SG+VP  +G + SL  +DLS N L+
Sbjct  368   LEVLDLSSNSFSGEIPSDIGGLSSLKIWNMSTNYFSGSVPVGIGELKSLCIVDLSDNKLN  427

Query  750   GPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWG  929
             G +    LE   SL  L L  +S  G IP  ++KC+ L  L+LS+N+ +G     G I  
Sbjct  428   GSIPFE-LEGAISLGELRLQKNSIGGRIPDQIAKCSALTSLDLSHNKLTGS--IPGAIAN  484

Query  930   LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             LT L+ +D+S NELSG+LP   + L NL    +  NH  GE+PV
Sbjct  485   LTNLQHVDLSWNELSGTLPKELTNLSNLLSFDVSYNHLQGELPV  528



>gb|AES79844.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=954

 Score =   204 bits (519),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 153/262 (58%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDD+LGLIVFK+G+QDP   L +W+EDD +PC W  VKC  +N RV+ V L G  LSG 
Sbjct  36    FNDDILGLIVFKAGLQDPKHKLISWNEDDYTPCNWEGVKCDSSNNRVTSVILDGFSLSGH  95

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             I RGL +L+ L  LSL+ NNF+G I+P                         L  + SLQ
Sbjct  96    IDRGLLRLQFLQTLSLSGNNFTGFINP------------------------DLPKLGSLQ  131

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +D S N+L G + +   +  GSL+ ++ A ++  G IP SL  C  L ++N S N+  G
Sbjct  132   VVDFSDNNLKGTIPEGFFQQCGSLKTVNFAKNNLTGNIPVSLGTCNTLANVNFSYNQIDG  191

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
               +    +W L  L++LDVSNN L G +P G   L++++ELSL  N FSG IP D+G C 
Sbjct  192   --KLPSEVWFLRGLQSLDVSNNLLDGEIPEGIQNLYDMRELSLKKNRFSGRIPQDIGGCI  249

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LDLS NL +G IP+S+QR
Sbjct  250   VLKSLDLSGNLLSGGIPQSMQR  271


 Score =   105 bits (262),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 87/240 (36%), Positives = 123/240 (51%), Gaps = 28/240 (12%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +  +DL G  LSG I + +++L   N LSL  N+F+G I   +G L +L+ L+LS N  S
Sbjct  251   LKSLDLSGNLLSGGIPQSMQRLNSCNSLSLQGNSFTGNIPDWIGELKDLENLDLSANRFS  310

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLE--------------------------N  779
             G +P SLGN++ LQ L+ S N L+G + DSM+                           N
Sbjct  311   GWIPKSLGNLNMLQRLNFSRNQLTGNLPDSMMNCTKLLALDISNNQLNGYLPSWIFRNGN  370

Query  780   LGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVS  959
                L  L L+ +SF G IPS +   + L   N+S N FSG      GI  L  L  +D+S
Sbjct  371   YHGLEVLDLSSNSFSGEIPSDIGGLSSLKIWNMSTNYFSGSVPV--GIGELKSLCIVDLS  428

Query  960   NNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +N+L+GS+P       +L EL L  N   G IP  +  C  L+ LDLS N  TG+IP ++
Sbjct  429   DNKLNGSIPFELEGAISLGELRLQKNSIGGRIPDQIAKCSALTSLDLSHNKLTGSIPGAI  488


 Score = 96.7 bits (239),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 80/234 (34%), Positives = 118/234 (50%), Gaps = 34/234 (15%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L G+I  G++ L  +  LSL  N FSG I   +G    L++L+LS N +SG +P S+  +
Sbjct  213   LDGEIPEGIQNLYDMRELSLKKNRFSGRIPQDIGGCIVLKSLDLSGNLLSGGIPQSMQRL  272

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
             +S   L L GNS +G + D + E L  L  L L+ + F G IP SL    +L  LN S N
Sbjct  273   NSCNSLSLQGNSFTGNIPDWIGE-LKDLENLDLSANRFSGWIPKSLGNLNMLQRLNFSRN  331

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLP---------------------------  986
             + +G+      +   T+L  LD+SNN+L+G LP                           
Sbjct  332   QLTGN--LPDSMMNCTKLLALDISNNQLNGYLPSWIFRNGNYHGLEVLDLSSNSFSGEIP  389

Query  987   --IGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
               IG   L +LK  ++ +N+FSG +PV +G    L  +DLS+N   G+IP  L+
Sbjct  390   SDIGG--LSSLKIWNMSTNYFSGSVPVGIGELKSLCIVDLSDNKLNGSIPFELE  441


 Score = 93.6 bits (231),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 98/164 (60%), Gaps = 3/164 (2%)
 Frame = +3

Query  570   LNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLS  749
             L VL L+SN+FSG I   +G L++L+  N+S N  SG+VP  +G + SL  +DLS N L+
Sbjct  374   LEVLDLSSNSFSGEIPSDIGGLSSLKIWNMSTNYFSGSVPVGIGELKSLCIVDLSDNKLN  433

Query  750   GPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWG  929
             G +    LE   SL  L L  +S  G IP  ++KC+ L  L+LS+N+ +G     G I  
Sbjct  434   GSIPFE-LEGAISLGELRLQKNSIGGRIPDQIAKCSALTSLDLSHNKLTGS--IPGAIAN  490

Query  930   LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             LT L+ +D+S NELSG+LP   + L NL    +  NH  GE+PV
Sbjct  491   LTNLQHVDLSWNELSGTLPKELTNLSNLLSFDVSYNHLQGELPV  534



>ref|XP_004308984.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=969

 Score =   204 bits (519),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 113/261 (43%), Positives = 158/261 (61%), Gaps = 26/261 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ +QDP + L +W+EDDDSPC W  V C+P +  V E++L G  LSG 
Sbjct  26    LNDDVLGLIVFKADIQDPKAKLGSWNEDDDSPCGWVGVNCNPRSNAVVELNLDGFSLSGH  85

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L  LSL                        SKN+++G++   + ++ +L+
Sbjct  86    IGRGLLQLQSLRKLSL------------------------SKNNLTGSLSAKIAHIDNLR  121

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              LDLSGN  SG V +      GSLR +SLAG+ F G IP SL  C  L  ++LS N+FSG
Sbjct  122   VLDLSGNGFSGSVPEEFFRQCGSLRVVSLAGNKFSGKIPESLGGCAGLATIDLSLNQFSG  181

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
             +     G+W L  +R+LD+S N L G +P     L+NL+ ++LG N FSG +P  +G C 
Sbjct  182   E--VPAGVWSLNGIRSLDLSGNLLEGEIPEAIEGLNNLRAINLGRNQFSGLVPDGIGSCL  239

Query  1080  HLSRLDLSENLFTGTIPESLQ  1142
              L  +DLSEN F+G +P +++
Sbjct  240   LLRSVDLSENGFSGNLPRTMR  260


 Score = 90.1 bits (222),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 78/239 (33%), Positives = 116/239 (49%), Gaps = 30/239 (13%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             VDL   G SG + R +  L     L++  N+ SG +   +G + +L+TL++S N  SG V
Sbjct  244   VDLSENGFSGNLPRTMRGLGLCGALNVQKNSLSGELPEWIGEMKSLETLDISSNRFSGEV  303

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTL--  860
             P SLGN+ +L+ L+ SGN  +G +  S++ N  SL  L  + +S EG +P  + K  L  
Sbjct  304   PSSLGNLGALKVLNFSGNGFAGSLPKSLV-NCTSLLALDFSKNSLEGDLPEWMFKAGLEG  362

Query  861   -------------------------LNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNN  965
                                      L  L+LS N FSG  + +  I  L+ L  L++S+N
Sbjct  363   VLVSGKKLSGSSPSSSLKLPLGLQKLEVLDLSGNGFSG--KITSAIGALSSLHVLNLSDN  420

Query  966   ELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
              L G +P     L  L  L +  N  SG IP ++G    L  L L +N  TG IP S++
Sbjct  421   SLVGPVPASIGELKALDSLDMSENQLSGSIPPEIGGAYALKELRLEKNFLTGKIPTSIE  479


 Score = 89.7 bits (221),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 78/232 (34%), Positives = 116/232 (50%), Gaps = 28/232 (12%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             LSG++   + +++ L  L ++SN FSG +   LG L  L+ LN S N  +G++P SL N 
Sbjct  275   LSGELPEWIGEMKSLETLDISSNRFSGEVPSSLGNLGALKVLNFSGNGFAGSLPKSLVNC  334

Query  708   SSLQFLDLSGNSLSGPVSDSMLE--------------------------NLGSLRFLSLA  809
             +SL  LD S NSL G + + M +                           L  L  L L+
Sbjct  335   TSLLALDFSKNSLEGDLPEWMFKAGLEGVLVSGKKLSGSSPSSSLKLPLGLQKLEVLDLS  394

Query  810   GSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPI  989
             G+ F G I S++   + L+ LNLS+N   G       I  L  L +LD+S N+LSGS+P 
Sbjct  395   GNGFSGKITSAIGALSSLHVLNLSDNSLVGP--VPASIGELKALDSLDMSENQLSGSIPP  452

Query  990   GASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
                  + LKEL L  N  +G+IP  +  C  L+ L +S+N   G IP ++ +
Sbjct  453   EIGGAYALKELRLEKNFLTGKIPTSIENCSSLTTLIVSQNKLFGPIPAAVGK  504


 Score = 78.6 bits (192),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 97/170 (57%), Gaps = 6/170 (4%)
 Frame = +3

Query  549   GLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLD  728
             GL+KLE   VL L+ N FSG I+  +G L++L  LNLS NS+ G VP S+G + +L  LD
Sbjct  384   GLQKLE---VLDLSGNGFSGKITSAIGALSSLHVLNLSDNSLVGPVPASIGELKALDSLD  440

Query  729   LSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPR  908
             +S N LSG +    +    +L+ L L  +   G IP+S+  C+ L  L +S N+  G   
Sbjct  441   MSENQLSGSIPPE-IGGAYALKELRLEKNFLTGKIPTSIENCSSLTTLIVSQNKLFGP--  497

Query  909   FSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
                 +  L+ L+ +D+S N LSG+LP   + L N+   ++  N+  GE+P
Sbjct  498   IPAAVGKLSNLQYVDLSFNNLSGALPKQLANLPNIVSFNISHNNLQGELP  547


 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 74/135 (55%), Gaps = 6/135 (4%)
 Frame = +3

Query  513  LHGLGLS-----GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
            LH L LS     G +   + +L+ L+ L ++ N  SG I P++G    L+ L L KN ++
Sbjct  412  LHVLNLSDNSLVGPVPASIGELKALDSLDMSENQLSGSIPPEIGGAYALKELRLEKNFLT  471

Query  678  GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
            G +P S+ N SSL  L +S N L GP+  + +  L +L+++ L+ ++  G +P  L+   
Sbjct  472  GKIPTSIENCSSLTTLIVSQNKLFGPIP-AAVGKLSNLQYVDLSFNNLSGALPKQLANLP  530

Query  858  LLNHLNLSNNRFSGD  902
             +   N+S+N   G+
Sbjct  531  NIVSFNISHNNLQGE  545



>emb|CDP13903.1| unnamed protein product [Coffea canephora]
Length=898

 Score =   204 bits (518),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 117/262 (45%), Positives = 155/262 (59%), Gaps = 45/262 (17%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             +NDDVLGLIVFK+ VQDP   LA+W+EDD+SPC WN V+C+P + RVSE+ L GL     
Sbjct  1     MNDDVLGLIVFKADVQDPQGKLASWNEDDESPCIWNGVQCNPRSNRVSELVLDGL-----  55

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
                           SLA NN +G ++                         SLG + +L+
Sbjct  56    --------------SLADNNLTGSLTL------------------------SLGQLPNLR  77

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              LDLSGNSLSGP+S    +  GSLR LSLA + F G IP+SLS C++L  LN+S+N+FSG
Sbjct  78    TLDLSGNSLSGPISSDFFQQCGSLRSLSLAKNKFSGQIPASLSSCSMLTSLNISSNQFSG  137

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
               +   G+W +  LRTLD+S+N L G +P G   L  L+ L+L  N F GEIP  +G C 
Sbjct  138   --QLPAGVWSMRALRTLDLSDNMLEGEIPKGIEGLTALRALNLRKNRFVGEIPDGIGGCI  195

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLSEN  +G +P S+Q+
Sbjct  196   MLRSIDLSENSLSGALPGSMQK  217


 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 69/217 (32%), Positives = 114/217 (53%), Gaps = 7/217 (3%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL     SG +   + +L  L  L++++N FSG++   +    NL  L++S NS+SG +
Sbjct  248   LDLSENNFSGGLPTSIGQLRSLKQLNISTNTFSGILPDSMSGCVNLLVLDVSHNSLSGNI  307

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR----FLSLAGSSFEGPIPSSLSKC  854
             P  +  +S LQ L  S N LSG + ++   ++ + R     L ++ ++  G IP ++   
Sbjct  308   PSWIFRLS-LQQLIFSENRLSGTMDNAFAASMENSRQKVVALDISHNNLSGEIPPAIGVF  366

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
             + L  LNLS N   G       I  L  L  LD+S N+L+GS+P+      +L +L L  
Sbjct  367   SSLQVLNLSKNSLIGG--IPSNIGELKLLDILDLSENQLNGSIPLEIGRATSLNKLILEK  424

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             N  +G IP  +G C  L+ L LS+N  TG +P ++ +
Sbjct  425   NFLAGNIPTSIGNCSMLTSLSLSQNNLTGPVPAAVAK  461


 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 76/239 (32%), Positives = 121/239 (51%), Gaps = 31/239 (13%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    L G+I +G+E L  L  L+L  N F G I   +G    L++++LS+NS+SG +
Sbjct  152   LDLSDNMLEGEIPKGIEGLTALRALNLRKNRFVGEIPDGIGGCIMLRSIDLSENSLSGAL  211

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P S+  ++    L L  N+ +G + D + E + SL  L L+ ++F G +P+S+ +   L 
Sbjct  212   PGSMQKLTLCNDLSLQINAFTGNMPDWIGE-MRSLEALDLSENNFSGGLPTSIGQLRSLK  270

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLP--------------------  986
              LN+S N FSG       + G   L  LDVS+N LSG++P                    
Sbjct  271   QLNISTNTFSG--ILPDSMSGCVNLLVLDVSHNSLSGNIPSWIFRLSLQQLIFSENRLSG  328

Query  987   ----IGASFLHNLKE----LSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
                   A+ + N ++    L +  N+ SGEIP  +G+   L  L+LS+N   G IP ++
Sbjct  329   TMDNAFAASMENSRQKVVALDISHNNLSGEIPPAIGVFSSLQVLNLSKNSLIGGIPSNI  387


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 91/166 (55%), Gaps = 3/166 (2%)
 Frame = +3

Query  564   EHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNS  743
             + +  L ++ NN SG I P +G+ ++LQ LNLSKNS+ G +P ++G +  L  LDLS N 
Sbjct  343   QKVVALDISHNNLSGEIPPAIGVFSSLQVLNLSKNSLIGGIPSNIGELKLLDILDLSENQ  402

Query  744   LSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGI  923
             L+G +    +    SL  L L  +   G IP+S+  C++L  L+LS N  +G       +
Sbjct  403   LNGSIPLE-IGRATSLNKLILEKNFLAGNIPTSIGNCSMLTSLSLSQNNLTGP--VPAAV  459

Query  924   WGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
               L  L+ +D+S N+L G+LP   + L  L   ++  N   GE+P 
Sbjct  460   AKLAYLQYVDLSFNKLIGTLPKQLADLGRLLSFNISHNQLQGELPA  505


 Score = 69.3 bits (168),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 95/169 (56%), Gaps = 3/169 (2%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             +V  +D+    LSG+I   +     L VL+L+ N+  G I   +G L  L  L+LS+N +
Sbjct  344   KVVALDISHNNLSGEIPPAIGVFSSLQVLNLSKNSLIGGIPSNIGELKLLDILDLSENQL  403

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
             +G++P  +G  +SL  L L  N L+G +  S + N   L  LSL+ ++  GP+P++++K 
Sbjct  404   NGSIPLEIGRATSLNKLILEKNFLAGNIPTS-IGNCSMLTSLSLSQNNLTGPVPAAVAKL  462

Query  855   TLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASF  1001
               L +++LS N+  G       +  L RL + ++S+N+L G LP GA F
Sbjct  463   AYLQYVDLSFNKLIG--TLPKQLADLGRLLSFNISHNQLQGELPAGAFF  509



>ref|XP_003605286.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES87483.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=866

 Score =   203 bits (516),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 158/262 (60%), Gaps = 25/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              N+D+LGLIVFK+G++DP + L++W+EDD SPC W  VKC P+  RVS + L G  LSG 
Sbjct  27    FNEDMLGLIVFKAGLEDPKNKLSSWNEDDYSPCNWEGVKCDPSTNRVSSLVLDGFSLSGH  86

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IG+ L +L+ L +LSL+ NNF+G I+                        D L  + +L+
Sbjct  87    IGKSLMRLQFLQILSLSRNNFTGRINH-----------------------DLLITLWNLK  123

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N+L G + D + +   SLR LS A ++  G IP SLS C  L  LN S+N+  G
Sbjct  124   VVDLSENNLVGTIPDELFKQCWSLRVLSFAKNNLTGTIPDSLSSCYSLASLNFSSNQLKG  183

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
             +  +  G+W L  L++LD+SNN L G +P G   L++L+EL LG N F G+IP  +G C 
Sbjct  184   ELHY--GMWFLKELQSLDLSNNFLEGEIPEGIQNLYDLRELRLGRNFFIGKIPESIGNCL  241

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +D S+NL T  IPES+QR
Sbjct  242   LLKLIDFSDNLLTDVIPESIQR  263


 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 113/226 (50%), Gaps = 23/226 (10%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L G++  G+  L+ L  L L++N   G I   +  L +L+ L L +N   G +P+S+GN 
Sbjct  181   LKGELHYGMWFLKELQSLDLSNNFLEGEIPEGIQNLYDLRELRLGRNFFIGKIPESIGNC  240

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
               L+ +D S N L+  + +S ++ L S   LSL G+ F G IP  + +   L  L LS+N
Sbjct  241   LLLKLIDFSDNLLTDVIPES-IQRLASCTLLSLQGNYFNGSIPHWIGELNNLEILKLSSN  299

Query  888   RFSGDPRFSGG----------------------IWGLTRLRTLDVSNNELSGSLPIGASF  1001
             RF G   F  G                      I  L  L TLD+S+N+L+GS+P     
Sbjct  300   RFYGQIPFGIGGLRSLQVLNFSANNISGSIPVSIRELKSLYTLDLSDNKLNGSIPYEIEG  359

Query  1002  LHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
               +L EL L  N   G IPV +G C  L+ L+L+ N   G+IP S+
Sbjct  360   AISLSELRLQRNFLGGRIPVQIGKCSELTSLNLAHNKLIGSIPTSI  405


 Score = 83.2 bits (204),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 102/183 (56%), Gaps = 3/183 (2%)
 Frame = +3

Query  513   LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  692
             L G   +G I   + +L +L +L L+SN F G I   +G L +LQ LN S N+ISG++P 
Sbjct  272   LQGNYFNGSIPHWIGELNNLEILKLSSNRFYGQIPFGIGGLRSLQVLNFSANNISGSIPV  331

Query  693   SLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHL  872
             S+  + SL  LDLS N L+G +    +E   SL  L L  +   G IP  + KC+ L  L
Sbjct  332   SIRELKSLYTLDLSDNKLNGSIPYE-IEGAISLSELRLQRNFLGGRIPVQIGKCSELTSL  390

Query  873   NLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGE  1052
             NL++N+  G       I  LT L+  D+S N+LSG+LP   + L +L   ++  N+  GE
Sbjct  391   NLAHNKLIGS--IPTSIADLTNLQYADLSYNKLSGTLPKNLTNLTHLFSFNVSYNNLKGE  448

Query  1053  IPV  1061
             +P+
Sbjct  449   LPI  451



>ref|XP_008369373.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=973

 Score =   203 bits (517),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 114/262 (44%), Positives = 159/262 (61%), Gaps = 27/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ +QDP   LA+WSE D+SPC W  VKC+P + RV E+ L    LSG 
Sbjct  31    LNDDVLGLIVFKADIQDPKGKLASWSEVDNSPCNWVGVKCNPRSNRVIELSLDDFSLSGH  90

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L  LSL+ NN +G ++P                        +  ++ +L+
Sbjct  91    IGRGLLQLQALRKLSLSKNNLTGSLTP------------------------NFTHIDNLR  126

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              LDLS NS SG V + +    GSLR +SLA + F G IP SL  C  L  +N S N+FSG
Sbjct  127   VLDLSENSFSGGVPEELFRQCGSLRVISLAKNKFSGKIPESLGSCASLAAVNFSLNQFSG  186

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   G+W L+ LR+LD+S+N L G +P G   L+NL+ ++L  N F+G++P  +G C 
Sbjct  187   S--IPAGVWSLSGLRSLDLSDNLLKGEIPKGIE-LNNLRGVNLARNRFTGQVPDGIGSCS  243

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLSEN F+G +P+++Q+
Sbjct  244   LLRSIDLSENSFSGNLPQTMQK  265


 Score = 86.7 bits (213),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 79/247 (32%), Positives = 123/247 (50%), Gaps = 33/247 (13%)
 Frame = +3

Query  492   GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  671
             G  S ++LH    SG++   + +++ L  L L+SN F+G +   +G L  L+ L  S N 
Sbjct  267   GLCSYLNLHQNTFSGEVPEWIGEMKSLETLDLSSNRFTGEVPSSIGNLEALKVLKFSANG  326

Query  672   ISGTVPDSLGNMSSLQFLDLSGNSLSG--PV-------------------------SDSM  770
              +G++P S+   ++L  LD S NS++G  PV                         S S 
Sbjct  327   FTGSLPKSMAYCTNLLALDFSKNSMAGELPVWIFDAGEEEVSLSXKKLSGSKNINQSLSA  386

Query  771   LENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTL  950
                L +L+ L L+ + F G I S +   + L+ LNLS N  +G       I  L  L  L
Sbjct  387   ENALQNLQVLDLSLNHFSGEIASDIGALSSLHTLNLSGNSLAGP--IPVAIGELKVLNNL  444

Query  951   DVSNNELSGSLP--IGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGT  1124
             D+S N L+GS+P  IG +F  +LKEL L  N  +G+IP  +  C  L+ L +S+N  TG 
Sbjct  445   DLSENRLNGSIPQEIGGAF--SLKELRLEKNFLTGKIPTSIEHCSSLTTLTVSQNRLTGP  502

Query  1125  IPESLQR  1145
             +P ++ +
Sbjct  503   LPAAMSK  509


 Score = 83.2 bits (204),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 118/239 (49%), Gaps = 29/239 (12%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL     SG + + ++KL   + L+L  N FSG +   +G + +L+TL+LS N  +G V
Sbjct  248   IDLSENSFSGNLPQTMQKLGLCSYLNLHQNTFSGEVPEWIGEMKSLETLDLSSNRFTGEV  307

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSM--LENLGSLRF--------------------L  800
             P S+GN+ +L+ L  S N  +G +  SM    NL +L F                    +
Sbjct  308   PSSIGNLEALKVLKFSANGFTGSLPKSMAYCTNLLALDFSKNSMAGELPVWIFDAGEEEV  367

Query  801   SLAGSSFEGP--IPSSLSKCTLLNH---LNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNN  965
             SL+     G   I  SLS    L +   L+LS N FSG+   +  I  L+ L TL++S N
Sbjct  368   SLSXKKLSGSKNINQSLSAENALQNLQVLDLSLNHFSGE--IASDIGALSSLHTLNLSGN  425

Query  966   ELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
              L+G +P+    L  L  L L  N  +G IP ++G    L  L L +N  TG IP S++
Sbjct  426   SLAGPIPVAIGELKVLNNLDLSENRLNGSIPQEIGGAFSLKELRLEKNFLTGKIPTSIE  484



>ref|XP_010092789.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB52375.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=957

 Score =   202 bits (515),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 149/262 (57%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDV GLIVFK+G+QDP   L +W+EDD++P  W  VKC     RVSE+ L G  LSG 
Sbjct  23    FNDDVWGLIVFKAGLQDPEEKLISWNEDDENPSKWVGVKCDSQTNRVSELSLDGFSLSGH  82

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             I +GL +L+ L  LSL+ NNFSG I+P                         L ++  LQ
Sbjct  83    IDKGLLRLQFLQKLSLSKNNFSGTINP------------------------DLPHLGGLQ  118

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N LSG + D   +  GSLR +S AG+   G IP S+S C  L  +N S+N+ SG
Sbjct  119   VIDLSENRLSGQIPDEFFQQCGSLREVSFAGNGLTGQIPESISSCFSLTKVNFSSNKLSG  178

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
               +   G+W L  L  LD+S+N L G +P G   L+ LK +S   N FSG +P D+G C 
Sbjct  179   --KLPSGLWNLRGLELLDLSDNFLEGEIPQGVEILYALKTISFRKNWFSGNLPGDIGGCL  236

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +D SEN  +G +PES+QR
Sbjct  237   ELRFVDFSENFLSGRLPESMQR  258


 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 74/220 (34%), Positives = 117/220 (53%), Gaps = 20/220 (9%)
 Frame = +3

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  713
             G++   + +L +L VL L+ NNFSG I   +G L  L+ LNLS N  SG++P+S+ N ++
Sbjct  274   GEVPEWIGELINLEVLDLSKNNFSGWIPVSIGNLQLLEKLNLSMNEFSGSLPESMSNCTN  333

Query  714   LQFLDLSGNSLSGPV--------------SDSMLENL----GSLRFLSLAGSSFEGPIPS  839
             L  LD+S N L G +              SDS + ++    G L+ L+L+ ++F G +P 
Sbjct  334   LLALDVSHNLLGGSLPSWIFKQGLQSVSLSDSGIPSIRAASGGLQVLNLSSNAFSGELPQ  393

Query  840   SLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKE  1019
              +   + L  LN+S N   G       I  L     +D+S+N L+G++P       +LK+
Sbjct  394   DIGALSSLRFLNMSKNDLFGP--IPKSIGELKTAYAVDLSDNRLNGTIPSEIGGAKSLKD  451

Query  1020  LSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             L L  N  +G+IP  +  C  L+ L LS+N  +G IP +L
Sbjct  452   LRLQKNLLTGKIPPQIEKCSELTSLILSQNNLSGPIPAAL  491


 Score = 84.0 bits (206),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 93/164 (57%), Gaps = 3/164 (2%)
 Frame = +3

Query  570   LNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLS  749
             L VL+L+SN FSG +   +G L++L+ LN+SKN + G +P S+G + +   +DLS N L+
Sbjct  377   LQVLNLSSNAFSGELPQDIGALSSLRFLNMSKNDLFGPIPKSIGELKTAYAVDLSDNRLN  436

Query  750   GPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWG  929
             G +  S +    SL+ L L  +   G IP  + KC+ L  L LS N  SG       +  
Sbjct  437   GTIP-SEIGGAKSLKDLRLQKNLLTGKIPPQIEKCSELTSLILSQNNLSGP--IPAALAN  493

Query  930   LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             LT L+ +D S NELSGSLP   + L  L   ++  NH  GE+PV
Sbjct  494   LTNLQYVDFSFNELSGSLPKELTNLSRLLSFNVSHNHIEGELPV  537



>ref|XP_004246289.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=965

 Score =   202 bits (514),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 109/262 (42%), Positives = 158/262 (60%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDV+GLIVFK+G+ DP S LA+W+EDD +PC W  + C+P + RVSE+ L    LSG 
Sbjct  23    FNDDVMGLIVFKAGLTDPKSKLASWTEDDPTPCNWVGINCYPQSNRVSEILLDNFSLSGH  82

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGR L +L+ L VLSL+ NNF+G I+P                         L  + SL+
Sbjct  83    IGRSLLRLQFLKVLSLSHNNFTGNINPI------------------------LSQIPSLR  118

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N+LSG + D  L+   SL+ +S A ++  G IP SL+ C+ L  +N S+N  SG
Sbjct  119   VIDLSHNTLSGSIPDEFLQQCTSLQSVSFANNNLTGQIPQSLTSCSTLQRVNFSSNHLSG  178

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                    +W LT L++LDVS+N L G +P     L++L+ ++L  N F+G +P ++G C 
Sbjct  179   S--LPSALWSLTSLQSLDVSDNLLEGEIPKAIEGLYSLRSINLHKNKFAGWLPENIGNCV  236

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLS+NL TG +P+S++R
Sbjct  237   QLMSIDLSDNLLTGGLPQSMRR  258


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 83/244 (34%), Positives = 122/244 (50%), Gaps = 28/244 (11%)
 Frame = +3

Query  492   GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  671
             G  + ++L     +G+I   + +++ L VL L++NN SG I   +G L+ L+ LNLS N 
Sbjct  260   GFCTNLELRSNLFNGEIPDWIAEMKSLKVLDLSANNLSGRIPTSMGDLSLLKELNLSNNY  319

Query  672   ISGTVPDSLGNMSSLQFLD-----------------------LSGNSLSGPV---SDSML  773
               G++P SL   S+L  LD                       LSGN  +G +   S S+ 
Sbjct  320   FVGSLPRSLMKCSNLVILDIGNNFLTGNLPSWTFELGVERISLSGNRFTGHINYPSISIG  379

Query  774   ENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLD  953
              +  SL+ L L+ +   G IP+++   + L  LN+S N  SG       +  L   R LD
Sbjct  380   ASYRSLQVLDLSSNELSGEIPAAIWNISGLQVLNISRNFLSG--AIPEAVGKLNATRILD  437

Query  954   VSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPE  1133
             +S+N+L+GS+P       +L EL L  NH SG IP D+  C  LS LDLS N  TG IP 
Sbjct  438   LSHNQLNGSIPNEIGSAVSLLELKLRENHLSGTIPADIANCSSLSSLDLSHNNLTGPIPP  497

Query  1134  SLQR  1145
              + +
Sbjct  498   EIAK  501


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 96/164 (59%), Gaps = 3/164 (2%)
 Frame = +3

Query  570   LNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLS  749
             L VL L+SN  SG I   +  ++ LQ LN+S+N +SG +P+++G +++ + LDLS N L+
Sbjct  385   LQVLDLSSNELSGEIPAAIWNISGLQVLNISRNFLSGAIPEAVGKLNATRILDLSHNQLN  444

Query  750   GPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWG  929
             G + + +   + SL  L L  +   G IP+ ++ C+ L+ L+LS+N  +G       I  
Sbjct  445   GSIPNEIGSAV-SLLELKLRENHLSGTIPADIANCSSLSSLDLSHNNLTGP--IPPEIAK  501

Query  930   LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             LT L  +D S N+ SGSLP   + L +L   ++  NH  GE+PV
Sbjct  502   LTILEVVDFSFNQFSGSLPKELTNLSHLATFNVSHNHLKGELPV  545


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 82/157 (52%), Gaps = 3/157 (2%)
 Frame = +3

Query  660   SKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPS  839
             S N +SG +P ++ N+S LQ L++S N LSG + +++   L + R L L+ +   G IP+
Sbjct  391   SSNELSGEIPAAIWNISGLQVLNISRNFLSGAIPEAV-GKLNATRILDLSHNQLNGSIPN  449

Query  840   SLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKE  1019
              +     L  L L  N  SG       I   + L +LD+S+N L+G +P   + L  L+ 
Sbjct  450   EIGSAVSLLELKLRENHLSG--TIPADIANCSSLSSLDLSHNNLTGPIPPEIAKLTILEV  507

Query  1020  LSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             +    N FSG +P +L    HL+  ++S N   G +P
Sbjct  508   VDFSFNQFSGSLPKELTNLSHLATFNVSHNHLKGELP  544



>ref|XP_009363794.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
 ref|XP_009363882.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=973

 Score =   202 bits (514),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 114/262 (44%), Positives = 157/262 (60%), Gaps = 27/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIV K+ +QDP   LA+WSE D SPC W  VKCHP + RV E+ L    LSG 
Sbjct  31    LNDDVLGLIVLKADIQDPKGKLASWSEVDSSPCNWVGVKCHPRSNRVIELSLDDFSLSGH  90

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L  LSL+ NN +G ++P                        +  ++ +L+
Sbjct  91    IGRGLLQLQALRKLSLSKNNLTGSLTP------------------------NFTHIDNLR  126

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              LDLS NS SG V + +    GSLR +SLA + F G IP SL  C  L  +N S N+FSG
Sbjct  127   VLDLSENSFSGGVPEELFRQCGSLRVISLAKNKFSGKIPESLGSCASLAAVNFSLNQFSG  186

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   G+W L+ LR+LD+S+N L G +P G   L+NL+ ++L  N F+G++P  +G C 
Sbjct  187   S--VPAGVWSLSGLRSLDLSDNLLKGEIPKGIE-LNNLRGVNLARNRFTGQLPDGIGSCS  243

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLSEN F+G +P+++Q+
Sbjct  244   LLRSIDLSENSFSGNLPQTMQK  265


 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 125/247 (51%), Gaps = 33/247 (13%)
 Frame = +3

Query  492   GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  671
             G  S ++LH    SG++   + +++ L  L L+SN F+G +   +G L  L+ LN S N 
Sbjct  267   GLCSYLNLHQNTFSGEVPEWIGEMKSLETLDLSSNRFTGEVPSSIGNLEALKVLNFSANG  326

Query  672   ISGTVPDSLGNMSSLQFLDLSGNSLSG--PV------------SDSML------------  773
              +G++P S+   ++L  LD S NS++G  PV            SD  L            
Sbjct  327   FTGSLPKSMAYCTNLLALDFSKNSMAGELPVWIFEAGADEVSLSDKKLSISKNINQSLSA  386

Query  774   -ENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTL  950
                L +L+ L L+ + F G I S +   + L+ LNLS N  +G       I  L  L  L
Sbjct  387   GNALQNLQVLDLSLNHFSGEIASDIGALSSLHTLNLSGNSLAGP--LPVAIGELKVLNNL  444

Query  951   DVSNNELSGSLP--IGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGT  1124
             D+S N L+GS+P  IG +F  +LKEL L  N  +G+IP  +  C  L+ L +S+N  TG 
Sbjct  445   DLSENRLNGSIPQEIGGAF--SLKELRLDKNFLTGKIPTSIEHCSSLTTLTVSQNRLTGP  502

Query  1125  IPESLQR  1145
             +P S+ +
Sbjct  503   LPASMSK  509


 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 81/239 (34%), Positives = 119/239 (50%), Gaps = 29/239 (12%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL     SG + + ++KL   + L+L  N FSG +   +G + +L+TL+LS N  +G V
Sbjct  248   IDLSENSFSGNLPQTMQKLGLCSYLNLHQNTFSGEVPEWIGEMKSLETLDLSSNRFTGEV  307

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSM--LENLGSLRFL--SLAGS-------------  815
             P S+GN+ +L+ L+ S N  +G +  SM    NL +L F   S+AG              
Sbjct  308   PSSIGNLEALKVLNFSANGFTGSLPKSMAYCTNLLALDFSKNSMAGELPVWIFEAGADEV  367

Query  816   -------SFEGPIPSSLSKCTLLNH---LNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNN  965
                    S    I  SLS    L +   L+LS N FSG+   +  I  L+ L TL++S N
Sbjct  368   SLSDKKLSISKNINQSLSAGNALQNLQVLDLSLNHFSGE--IASDIGALSSLHTLNLSGN  425

Query  966   ELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
              L+G LP+    L  L  L L  N  +G IP ++G    L  L L +N  TG IP S++
Sbjct  426   SLAGPLPVAIGELKVLNNLDLSENRLNGSIPQEIGGAFSLKELRLDKNFLTGKIPTSIE  484


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 90/158 (57%), Gaps = 3/158 (2%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
              SG+I   +  L  L+ L+L+ N+ +G +   +G L  L  L+LS+N ++G++P  +G  
Sbjct  403   FSGEIASDIGALSSLHTLNLSGNSLAGPLPVAIGELKVLNNLDLSENRLNGSIPQEIGGA  462

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
              SL+ L L  N L+G +  S +E+  SL  L+++ +   GP+P+S+SK T L  ++LS N
Sbjct  463   FSLKELRLDKNFLTGKIPTS-IEHCSSLTTLTVSQNRLTGPLPASMSKLTNLQIVDLSFN  521

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASF  1001
               +G       +  L  L + ++S+N L G LP GA F
Sbjct  522   NLTGG--LPKQLANLPNLLSFNISHNNLQGELPTGAFF  557



>ref|NP_001050035.1| Os03g0335500 [Oryza sativa Japonica Group]
 gb|ABF95811.1| leucine-rich repeat transmembrane protein kinase, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11949.1| Os03g0335500 [Oryza sativa Japonica Group]
Length=971

 Score =   201 bits (512),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 120/262 (46%), Positives = 155/262 (59%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             L+DDVLGLIVFK+ V DP   LATWSEDD+ PCAW  V C P  GRV+ + L G GLSGK
Sbjct  30    LDDDVLGLIVFKADVVDPEGRLATWSEDDERPCAWAGVTCDPLTGRVAGLSLAGFGLSGK  89

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             +GRGL +LE L  LSL+ NNFSG                         +P  L  +  LQ
Sbjct  90    LGRGLLRLESLQSLSLSGNNFSG------------------------DLPADLARLPDLQ  125

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              LDLS N+ SG + D    +  +LR +SLA ++F G +P  +  C  L  LNLS+NR +G
Sbjct  126   SLDLSANAFSGAIPDGFFGHCRNLRDVSLANNAFSGDVPRDVGACATLASLNLSSNRLAG  185

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                    IW L  LRTLD+S N ++G LP+G S + NL+ L+L SN  +G +P D+G CP
Sbjct  186   --ALPSDIWSLNALRTLDLSGNAITGDLPVGVSRMFNLRSLNLRSNRLAGSLPDDIGDCP  243

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DL  N  +G +PESL+R
Sbjct  244   LLRSVDLGSNNISGNLPESLRR  265


 Score = 93.6 bits (231),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 118/213 (55%), Gaps = 4/213 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL G  ++G +  G+ ++ +L  L+L SN  +G +   +G    L++++L  N+ISG +
Sbjct  200   LDLSGNAITGDLPVGVSRMFNLRSLNLRSNRLAGSLPDDIGDCPLLRSVDLGSNNISGNL  259

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P+SL  +S+  +LDLS N+L+G V  + +  + SL  L L+G+ F G IP S+     L 
Sbjct  260   PESLRRLSTCTYLDLSSNALTGNVP-TWVGEMASLETLDLSGNKFSGEIPGSIGGLMSLK  318

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
              L LS N F+G       I G   L  +DVS N L+G+LP    F   ++ +S+  N  S
Sbjct  319   ELRLSGNGFTGG--LPESIGGCKSLVHVDVSWNSLTGTLP-SWVFASGVQWVSVSDNTLS  375

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             GE+ V +     +  +DLS N F+G IP  + +
Sbjct  376   GEVFVPVNASSMVRGVDLSSNAFSGMIPSEISQ  408


 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 81/233 (35%), Positives = 119/233 (51%), Gaps = 25/233 (11%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    L+G +   + ++  L  L L+ N FSG I   +G L +L+ L LS N  +G +
Sbjct  272   LDLSSNALTGNVPTWVGEMASLETLDLSGNKFSGEIPGSIGGLMSLKELRLSGNGFTGGL  331

Query  687   PDSLGNMSSLQFLDLSGNSLSGP--------------VSDSMLE-------NLGSL-RFL  800
             P+S+G   SL  +D+S NSL+G               VSD+ L        N  S+ R +
Sbjct  332   PESIGGCKSLVHVDVSWNSLTGTLPSWVFASGVQWVSVSDNTLSGEVFVPVNASSMVRGV  391

Query  801   SLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGS  980
              L+ ++F G IPS +S+   L  LN+S N  SG       I  +  L  LD++ N L+GS
Sbjct  392   DLSSNAFSGMIPSEISQVITLQSLNMSWNSLSGS--IPPSIVQMKSLEVLDLTANRLNGS  449

Query  981   LPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +P       +L+EL L  N  +GEIP  +G    L+ LDLS N  TG IP ++
Sbjct  450   IPATVGG-ESLRELRLAKNSLTGEIPAQIGNLSALASLDLSHNNLTGAIPATI  501


 Score = 86.7 bits (213),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 73/225 (32%), Positives = 114/225 (51%), Gaps = 22/225 (10%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L+G +   +     L  + L SNN SG +   L  L+    L+LS N+++G VP  +G M
Sbjct  231   LAGSLPDDIGDCPLLRSVDLGSNNISGNLPESLRRLSTCTYLDLSSNALTGNVPTWVGEM  290

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
             +SL+ LDLSGN  SG +  S +  L SL+ L L+G+ F G +P S+  C  L H+++S N
Sbjct  291   ASLETLDLSGNKFSGEIPGS-IGGLMSLKELRLSGNGFTGGLPESIGGCKSLVHVDVSWN  349

Query  888   RFSG-----------------DPRFSGGIW----GLTRLRTLDVSNNELSGSLPIGASFL  1004
               +G                 D   SG ++      + +R +D+S+N  SG +P   S +
Sbjct  350   SLTGTLPSWVFASGVQWVSVSDNTLSGEVFVPVNASSMVRGVDLSSNAFSGMIPSEISQV  409

Query  1005  HNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
               L+ L++  N  SG IP  +     L  LDL+ N   G+IP ++
Sbjct  410   ITLQSLNMSWNSLSGSIPPSIVQMKSLEVLDLTANRLNGSIPATV  454


 Score = 84.3 bits (207),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 104/177 (59%), Gaps = 4/177 (2%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             LSG++   +     +  + L+SN FSG+I  ++  +  LQ+LN+S NS+SG++P S+  M
Sbjct  374   LSGEVFVPVNASSMVRGVDLSSNAFSGMIPSEISQVITLQSLNMSWNSLSGSIPPSIVQM  433

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
              SL+ LDL+ N L+G +  ++     SLR L LA +S  G IP+ +   + L  L+LS+N
Sbjct  434   KSLEVLDLTANRLNGSIPATVGGE--SLRELRLAKNSLTGEIPAQIGNLSALASLDLSHN  491

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
               +G       I  +T L+T+D+S N+L+G LP   S L +L   ++  N  SG++P
Sbjct  492   NLTG--AIPATIANITNLQTVDLSRNKLTGGLPKQLSDLPHLVRFNISHNQLSGDLP  546



>gb|KEH35536.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=989

 Score =   201 bits (511),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 115/276 (42%), Positives = 165/276 (60%), Gaps = 30/276 (11%)
 Frame = +3

Query  327   TSGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPC--AWNFVKCHPANGRV  500
             T  A  A +  LNDDVLGLIVFK+ ++DP   L +W+EDD+S C  +W  VKC+P + RV
Sbjct  28    TVTAVKAVNPSLNDDVLGLIVFKADIKDPKGKLTSWNEDDESACGGSWVGVKCNPRSNRV  87

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
              EV+L+G  LSG+IGRGL++L+ L  L L +NN +G I+                     
Sbjct  88    VEVNLNGFSLSGRIGRGLQRLQFLRRLYLGNNNLTGSINA--------------------  127

Query  681   TVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTL  860
                 ++  + +L+ LDLS N+LSG V D      GS+R +SLA + F G +PSSL  C  
Sbjct  128   ----NIATIDNLRVLDLSNNNLSGVVPDDFFRQCGSMRVVSLARNRFSGNVPSSLGSCAA  183

Query  861   LNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSN  1037
             +  ++LS N+FSG+ P+   GIW L+ LR+LD+S+N L G +P G   + NL+ +SL  N
Sbjct  184   IATIDLSFNQFSGNVPK---GIWSLSGLRSLDMSDNLLEGEVPEGVEAMKNLRSISLARN  240

Query  1038  HFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              FSG+IP   G C  L  +D  +N F+G++P  L+ 
Sbjct  241   SFSGKIPDGFGSCLLLRSIDFGDNSFSGSVPSDLKE  276


 Score = 90.1 bits (222),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 80/236 (34%), Positives = 123/236 (52%), Gaps = 29/236 (12%)
 Frame = +3

Query  513   LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  692
             LHG   SG +   + +++ L  L L+ N FSG++   LG + +L+TLNLS N  +G +P+
Sbjct  285   LHGNAFSGDVPDWIGEMKGLQTLDLSQNRFSGLVPNSLGNIWSLKTLNLSGNGFTGNLPE  344

Query  693   SLGNMSSLQFLDLSGNSLSG---------------------------PVSDSMLENLGSL  791
             S+ N ++L  LD+S NSLSG                           P+      ++ SL
Sbjct  345   SMVNCTNLLALDVSQNSLSGDLPSWIFRWDLEKVMVVKNRISGRAKTPLYSLTEASVQSL  404

Query  792   RFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNEL  971
             + L L+ ++F G I S++S  + L  LNLS N   G       I  L    +LD+S N+L
Sbjct  405   QVLDLSHNAFSGEITSAVSGLSSLQVLNLSYNSLGG--HIPAAIGDLKTCSSLDLSYNKL  462

Query  972   SGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +GS+P       +LKELSL +N   G+IP+ +  C  L  L LS+N  +G+IP ++
Sbjct  463   NGSIPSEVGGAVSLKELSLENNFLIGKIPISIENCSSLKTLILSKNRLSGSIPSAV  518


 Score = 86.3 bits (212),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 77/214 (36%), Positives = 115/214 (54%), Gaps = 5/214 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +D      SG +   L++L      SL  N FSG +   +G +  LQTL+LS+N  SG V
Sbjct  259   IDFGDNSFSGSVPSDLKELVLCGYFSLHGNAFSGDVPDWIGEMKGLQTLDLSQNRFSGLV  318

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P+SLGN+ SL+ L+LSGN  +G + +SM+ N  +L  L ++ +S  G +PS + +   L 
Sbjct  319   PNSLGNIWSLKTLNLSGNGFTGNLPESMV-NCTNLLALDVSQNSLSGDLPSWIFRWD-LE  376

Query  867   HLNLSNNRFSG---DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSN  1037
              + +  NR SG    P +S     +  L+ LD+S+N  SG +    S L +L+ L+L  N
Sbjct  377   KVMVVKNRISGRAKTPLYSLTEASVQSLQVLDLSHNAFSGEITSAVSGLSSLQVLNLSYN  436

Query  1038  HFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
                G IP  +G     S LDLS N   G+IP  +
Sbjct  437   SLGGHIPAAIGDLKTCSSLDLSYNKLNGSIPSEV  470


 Score = 84.0 bits (206),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 97/167 (58%), Gaps = 3/167 (2%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             ++ L VL L+ N FSG I+  +  L++LQ LNLS NS+ G +P ++G++ +   LDLS N
Sbjct  401   VQSLQVLDLSHNAFSGEITSAVSGLSSLQVLNLSYNSLGGHIPAAIGDLKTCSSLDLSYN  460

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
              L+G +  S +    SL+ LSL  +   G IP S+  C+ L  L LS NR SG       
Sbjct  461   KLNGSIP-SEVGGAVSLKELSLENNFLIGKIPISIENCSSLKTLILSKNRLSGS--IPSA  517

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             +  LT L+T+D+S N L+G+LP   S L NL   +L  N+  GE+P 
Sbjct  518   VASLTNLKTVDLSFNNLTGNLPKQLSNLPNLITFNLSHNNLKGELPA  564


 Score = 81.3 bits (199),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 69/216 (32%), Positives = 110/216 (51%), Gaps = 9/216 (4%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             ++L G G +G +   +    +L  L ++ N+ SG + P      +L+ + + KN ISG  
Sbjct  331   LNLSGNGFTGNLPESMVNCTNLLALDVSQNSLSGDL-PSWIFRWDLEKVMVVKNRISGRA  389

Query  687   PDSL-----GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSK  851
                L      ++ SLQ LDLS N+ SG ++ S +  L SL+ L+L+ +S  G IP+++  
Sbjct  390   KTPLYSLTEASVQSLQVLDLSHNAFSGEIT-SAVSGLSSLQVLNLSYNSLGGHIPAAIGD  448

Query  852   CTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLG  1031
                 + L+LS N+ +G       + G   L+ L + NN L G +PI      +LK L L 
Sbjct  449   LKTCSSLDLSYNKLNGS--IPSEVGGAVSLKELSLENNFLIGKIPISIENCSSLKTLILS  506

Query  1032  SNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              N  SG IP  +    +L  +DLS N  TG +P+ L
Sbjct  507   KNRLSGSIPSAVASLTNLKTVDLSFNNLTGNLPKQL  542


 Score = 80.5 bits (197),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 101/188 (54%), Gaps = 5/188 (3%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             ++ +DL     SG + +G+  L  L  L ++ N   G +   +  + NL++++L++NS S
Sbjct  184   IATIDLSFNQFSGNVPKGIWSLSGLRSLDMSDNLLEGEVPEGVEAMKNLRSISLARNSFS  243

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCT  857
             G +PD  G+   L+ +D   NS SG V  S L+ L    + SL G++F G +P  + +  
Sbjct  244   GKIPDGFGSCLLLRSIDFGDNSFSGSVP-SDLKELVLCGYFSLHGNAFSGDVPDWIGEMK  302

Query  858   LLNHLNLSNNRFSG-DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
              L  L+LS NRFSG  P   G IW    L+TL++S N  +G+LP       NL  L +  
Sbjct  303   GLQTLDLSQNRFSGLVPNSLGNIWS---LKTLNLSGNGFTGNLPESMVNCTNLLALDVSQ  359

Query  1035  NHFSGEIP  1058
             N  SG++P
Sbjct  360   NSLSGDLP  367



>ref|XP_006341303.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=982

 Score =   201 bits (511),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 107/262 (41%), Positives = 156/262 (60%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDV+GLIV K+G  DP S LA+W+EDD +PC W  + C+P + RVSE+ L    LSG 
Sbjct  40    FNDDVMGLIVLKAGFTDPKSKLASWTEDDPTPCNWVGINCYPQSNRVSEILLDNFSLSGH  99

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGR L +L+ L VLSL++NNF+G I+P                         L  + SL+
Sbjct  100   IGRSLLRLQFLKVLSLSNNNFTGNINPI------------------------LSQIPSLR  135

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N+LSG + D   +   SL+ +S A ++  G IP SL+ C+ L  +N S+NR SG
Sbjct  136   VIDLSHNTLSGSIPDEFFQQCSSLQSVSFANNNLTGEIPQSLTSCSTLQRVNFSSNRLSG  195

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                    +W LT L++LDVS+N + G +P     L++L+ ++L  N F+G +P ++G C 
Sbjct  196   P--LPSALWSLTSLQSLDVSDNLMEGEIPKAIEGLYSLRSINLHKNKFTGWLPENIGNCV  253

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLS+NL  G +PES++R
Sbjct  254   QLKSIDLSDNLLNGELPESMRR  275


 Score = 95.1 bits (235),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 84/244 (34%), Positives = 125/244 (51%), Gaps = 28/244 (11%)
 Frame = +3

Query  492   GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  671
             G  + ++L    L+G+I   + +++ L VL L++NN SG I   +G ++ L+ LNLS N 
Sbjct  277   GFCTNMELRSNLLNGQIPDWIAEMKSLKVLDLSANNLSGRIPTSMGDVSLLKELNLSNNY  336

Query  672   ISGTVPDSL-----------------GNMSSLQF------LDLSGNSLSGPV---SDSML  773
               G++P SL                 GN+ S  F      + LSGN  +G +   S SM 
Sbjct  337   FVGSLPRSLMKCNDLVILDIGNNFLTGNLPSWTFELGVESISLSGNRFTGHIDYPSISMD  396

Query  774   ENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLD  953
              +  SL+ L L+ ++  G IP+++   + L  LN+S N  SG       +  L   R LD
Sbjct  397   ASYRSLQVLDLSSNALSGEIPAAIWNISSLQVLNISRNFLSG--TIPEAVGKLNATRILD  454

Query  954   VSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPE  1133
             +S+N+L+GS+P       +L EL L  NH SG IP D+  C  LS LDLS N  TG IP 
Sbjct  455   LSHNQLNGSIPSEIGSAVSLLELKLRENHLSGTIPADIANCSALSSLDLSHNNLTGPIPP  514

Query  1134  SLQR  1145
              + +
Sbjct  515   EIAK  518


 Score = 83.6 bits (205),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 98/164 (60%), Gaps = 3/164 (2%)
 Frame = +3

Query  570   LNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLS  749
             L VL L+SN  SG I   +  +++LQ LN+S+N +SGT+P+++G +++ + LDLS N L+
Sbjct  402   LQVLDLSSNALSGEIPAAIWNISSLQVLNISRNFLSGTIPEAVGKLNATRILDLSHNQLN  461

Query  750   GPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWG  929
             G +  S + +  SL  L L  +   G IP+ ++ C+ L+ L+LS+N  +G       I  
Sbjct  462   GSIP-SEIGSAVSLLELKLRENHLSGTIPADIANCSALSSLDLSHNNLTGP--IPPEIAK  518

Query  930   LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             LT L  +D S N+ SGSLP   + L +L   ++  NH  GE+PV
Sbjct  519   LTILEVVDFSFNQFSGSLPKELTNLSHLATFNVSHNHLKGELPV  562


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 84/157 (54%), Gaps = 3/157 (2%)
 Frame = +3

Query  660   SKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPS  839
             S N++SG +P ++ N+SSLQ L++S N LSG + +++   L + R L L+ +   G IPS
Sbjct  408   SSNALSGEIPAAIWNISSLQVLNISRNFLSGTIPEAV-GKLNATRILDLSHNQLNGSIPS  466

Query  840   SLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKE  1019
              +     L  L L  N  SG       I   + L +LD+S+N L+G +P   + L  L+ 
Sbjct  467   EIGSAVSLLELKLRENHLSG--TIPADIANCSALSSLDLSHNNLTGPIPPEIAKLTILEV  524

Query  1020  LSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             +    N FSG +P +L    HL+  ++S N   G +P
Sbjct  525   VDFSFNQFSGSLPKELTNLSHLATFNVSHNHLKGELP  561



>ref|XP_003557968.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brachypodium distachyon]
Length=970

 Score =   200 bits (509),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 125/272 (46%), Positives = 157/272 (58%), Gaps = 27/272 (10%)
 Frame = +3

Query  330   SGAGGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEV  509
             +G G      LNDDVLGLIVFK+ V DP   LATWSEDD+  CAW  V C P   RVS +
Sbjct  20    AGRGAGSVAALNDDVLGLIVFKADVVDPEGRLATWSEDDERACAWAGVTCDPRTSRVSGL  79

Query  510   DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP  689
              L G GLSGK+GRGL +LE L  LSL+ NNFSG                         +P
Sbjct  80    SLDGFGLSGKLGRGLLRLESLQSLSLSRNNFSG------------------------DLP  115

Query  690   DSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNH  869
               L  +  LQ LDLS N+ SG V D       SLR +SLA ++F G IP  +  C  L  
Sbjct  116   ADLARLPDLQSLDLSSNAFSGAVPDGFFGKCHSLRDVSLANNAFSGGIPD-VGGCATLAS  174

Query  870   LNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSG  1049
             LN+S+NR +G     GGIW L  LRTLD+S N ++G LP+G S + NL+ L+L SN  +G
Sbjct  175   LNMSSNRLAG--TLPGGIWSLNALRTLDLSGNAITGDLPVGISKMFNLRALNLRSNRLTG  232

Query  1050  EIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              +P D+G CP L  ++L  N  +G +PESL+R
Sbjct  233   SLPDDIGDCPLLRSVNLRSNSLSGNLPESLRR  264


 Score = 99.0 bits (245),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 86/237 (36%), Positives = 126/237 (53%), Gaps = 29/237 (12%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             +++DL    L+G +   + ++  L +L L+ N FSG I   +G L +L+ L LS N  +G
Sbjct  269   TDLDLSSNELTGTVPTWIGEMASLEMLDLSGNKFSGEIPESIGGLMSLRELRLSGNGFTG  328

Query  681   TVPDSLGNMSSLQFLDLSGNSLSGP--------------VSDSMLE-------NLGS-LR  794
              +P+S+G   SL  +D+S NSL+G               VSD+ L        N  S ++
Sbjct  329   GLPESIGRCRSLVHVDVSWNSLTGSLPAWIFSSGVQWVSVSDNTLSGEVLVPVNASSVIQ  388

Query  795   FLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELS  974
              + L+ ++F GPIPS +S+   L  LN+S N  SG       I  +  L  LD+S N L+
Sbjct  389   GVDLSSNAFSGPIPSEISQLLTLQSLNISWNSLSGS--IPASIMEMKSLELLDLSANRLN  446

Query  975   GSLP--IGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             G +P  IG     +LK L LG N  +GEIPV +G C  L+ LDLS N  TG IP ++
Sbjct  447   GRIPATIGG---KSLKVLRLGKNSLAGEIPVQIGDCSALASLDLSHNGLTGAIPATI  500


 Score = 92.4 bits (228),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 79/216 (37%), Positives = 118/216 (55%), Gaps = 10/216 (5%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL G  ++G +  G+ K+ +L  L+L SN  +G +   +G    L+++NL  NS+SG +
Sbjct  199   LDLSGNAITGDLPVGISKMFNLRALNLRSNRLTGSLPDDIGDCPLLRSVNLRSNSLSGNL  258

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P+SL  +SS   LDLS N L+G V  + +  + SL  L L+G+ F G IP S+     L 
Sbjct  259   PESLRRLSSCTDLDLSSNELTGTVP-TWIGEMASLEMLDLSGNKFSGEIPESIGGLMSLR  317

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTL---DVSNNELSGSLPIGASFLHNLKELSLGSN  1037
              L LS N F+G    S G     R R+L   DVS N L+GSLP    F   ++ +S+  N
Sbjct  318   ELRLSGNGFTGGLPESIG-----RCRSLVHVDVSWNSLTGSLPAWI-FSSGVQWVSVSDN  371

Query  1038  HFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
               SGE+ V +     +  +DLS N F+G IP  + +
Sbjct  372   TLSGEVLVPVNASSVIQGVDLSSNAFSGPIPSEISQ  407



>ref|XP_006650049.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Oryza brachyantha]
Length=971

 Score =   200 bits (509),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 120/260 (46%), Positives = 153/260 (59%), Gaps = 26/260 (10%)
 Frame = +3

Query  366   DDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  545
             DDVLGLIVFK+ V DP   LATWSEDD+ PCAW  V C P  GRV+ + L G GLSGK+G
Sbjct  32    DDVLGLIVFKADVVDPEGRLATWSEDDERPCAWASVTCDPLTGRVAGLSLAGFGLSGKLG  91

Query  546   RGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFL  725
             RGL +LE L  LSL+ NNFSG                         +P  L  +  LQ L
Sbjct  92    RGLLRLESLQSLSLSRNNFSG------------------------DLPADLARLPDLQSL  127

Query  726   DLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDP  905
             DLS N+ SG + D    +  SLR +SLA ++F G +P  +  C  L  LNLS+NR +G  
Sbjct  128   DLSSNAFSGAIPDGFFGHCRSLRDISLANNAFSGDVPRDVGSCATLATLNLSSNRLAG--  185

Query  906   RFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHL  1085
                  IW L  LRTLD+S N ++G LP+G S + NL+ L+L SN  +G +P D+G CP L
Sbjct  186   ALPSDIWSLNALRTLDLSGNAITGDLPVGVSRMFNLRSLNLRSNRLTGGLPDDIGDCPLL  245

Query  1086  SRLDLSENLFTGTIPESLQR  1145
               +DL  N  +G +PESL+R
Sbjct  246   RSVDLGSNNLSGNLPESLRR  265


 Score = 95.9 bits (237),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 82/233 (35%), Positives = 121/233 (52%), Gaps = 25/233 (11%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    L+G +   + ++  L VL L+ N FSG I   +G L +L+ L LS N  +G +
Sbjct  272   LDLSSNALTGNVATWVGEMASLEVLDLSGNKFSGEIPGSIGGLMSLKELRLSGNGFTGGL  331

Query  687   PDSLGNMSSLQFLDLSGNSLSGP--------------VSDSMLE-------NLGSL-RFL  800
             P+S+G    L  +D+S NSL+G               VSD+ L        N  S+ R +
Sbjct  332   PESIGGCKGLVHVDVSWNSLTGALPAWVFASSVQWVSVSDNTLSGEVSVPVNASSMVRGV  391

Query  801   SLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGS  980
              L+ ++F G IP  +S+   L  LN+S N  SG       I  +  L  LD++ N L+GS
Sbjct  392   DLSSNAFSGRIPFEISQLVTLQSLNMSWNSLSGS--IPASIVQMKSLELLDLTANRLNGS  449

Query  981   LPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +P     + +L+EL LG N  +GEIP  +G C  L+ LDLS N  TG IP ++
Sbjct  450   IPATIGGV-SLRELRLGKNSLTGEIPAQIGNCTALASLDLSYNNLTGAIPATI  501


 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 103/179 (58%), Gaps = 8/179 (4%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             LSG++   +     +  + L+SN FSG I  ++  L  LQ+LN+S NS+SG++P S+  M
Sbjct  374   LSGEVSVPVNASSMVRGVDLSSNAFSGRIPFEISQLVTLQSLNMSWNSLSGSIPASIVQM  433

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLG--SLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLS  881
              SL+ LDL+ N L+G    S+   +G  SLR L L  +S  G IP+ +  CT L  L+LS
Sbjct  434   KSLELLDLTANRLNG----SIPATIGGVSLRELRLGKNSLTGEIPAQIGNCTALASLDLS  489

Query  882   NNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
              N  +G       I  LT L+T+D+S N+LSG LP   S L +L   ++  N  SG++P
Sbjct  490   YNNLTG--AIPATIANLTNLQTVDISRNKLSGGLPKQLSDLPHLVHFNISHNQLSGDLP  546



>gb|EPS70735.1| hypothetical protein M569_04020, partial [Genlisea aurea]
Length=954

 Score =   200 bits (508),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 115/268 (43%), Positives = 156/268 (58%), Gaps = 26/268 (10%)
 Frame = +3

Query  342   GAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  521
             G+ +  LNDDVLGLIVFK+ +QDP   L++W+E+DDS C W  VKC P + RVSE+ L G
Sbjct  1     GSGTPSLNDDVLGLIVFKADIQDPEGKLSSWNEEDDSACNWVSVKCDPRSKRVSELSLDG  60

Query  522   LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLG  701
               L+GK+GRGL +L+ L  LSLA NN +G +S                         SL 
Sbjct  61    FSLTGKLGRGLLQLQFLRKLSLAKNNLTGSLSL------------------------SLA  96

Query  702   NMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLS  881
              + +L+FLDLS N+ SG + +       SLR +SLA + F G IP SL  C  L  LNLS
Sbjct  97    QLPNLKFLDLSDNAFSGSIPNDFFTQCASLRSISLALNRFSGQIPGSLDSCLTLASLNLS  156

Query  882   NNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
              N+FSG      G+W L  LR+LD+SNN L G +P     L +L  ++L +N F+GE+P 
Sbjct  157   GNQFSGSLPL--GLWSLAGLRSLDLSNNVLEGQIPESIQHLTSLSGVNLSNNRFTGEVPD  214

Query  1062  DLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              +G C  L  +DL  N F G+ P ++Q+
Sbjct  215   GIGRCLLLRSIDLGRNSFYGSFPSTMQK  242


 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 72/214 (34%), Positives = 113/214 (53%), Gaps = 5/214 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL      G     ++KL   + L +  N F+G +   +G +T L+ L++S N ISG++
Sbjct  225   IDLGRNSFYGSFPSTMQKLSLCSSLVIGGNGFTGNVPAWIGDMTKLEYLDISANKISGSI  284

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             PDS G + SL+ L++S N +SG + +SM  N G+L    ++ +     +PS L K  L  
Sbjct  285   PDSFGKLQSLKTLNVSHNGISGSIPESM-SNCGNLIVFDVSHNYLTSSLPSWLFKVGLQQ  343

Query  867   HLNLSNNRFSG--DPRFSGGIW-GLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSN  1037
              L +SNN  +G  D  F        ++L  LD SNN  SG +P       +L+ L++ SN
Sbjct  344   AL-VSNNGLNGSVDDAFRLSTENSKSKLVVLDASNNRFSGVVPSTVGEFTSLQVLNMASN  402

Query  1038  HFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
               SG IP+ +G    LS +DL +N   G+IP  +
Sbjct  403   SLSGSIPLRIGQLKRLSVVDLGDNELNGSIPSEI  436


 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 77/242 (32%), Positives = 119/242 (49%), Gaps = 29/242 (12%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             S + + G G +G +   +  +  L  L +++N  SG I    G L +L+TLN+S N ISG
Sbjct  247   SSLVIGGNGFTGNVPAWIGDMTKLEYLDISANKISGSIPDSFGKLQSLKTLNVSHNGISG  306

Query  681   TVPDSLGNMSSLQFLDLS-----------------------GNSLSGPVSDSM---LENL  782
             ++P+S+ N  +L   D+S                        N L+G V D+     EN 
Sbjct  307   SIPESMSNCGNLIVFDVSHNYLTSSLPSWLFKVGLQQALVSNNGLNGSVDDAFRLSTENS  366

Query  783   GS-LRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVS  959
              S L  L  + + F G +PS++ + T L  LN+++N  SG       I  L RL  +D+ 
Sbjct  367   KSKLVVLDASNNRFSGVVPSTVGEFTSLQVLNMASNSLSGSIPLR--IGQLKRLSVVDLG  424

Query  960   NNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +NEL+GS+P     L +L  L L +N  S  IP  +G C  L  L L+ N  +G+IP S+
Sbjct  425   DNELNGSIPSEIGMLSSLAYLRLDNNSLSNSIPASIGDCAALVSLSLARNQLSGSIPASI  484

Query  1140  QR  1145
              +
Sbjct  485   SK  486


 Score = 76.6 bits (187),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 79/157 (50%), Gaps = 3/157 (2%)
 Frame = +3

Query  660   SKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPS  839
             S N  SG VP ++G  +SLQ L+++ NSLSG +    +  L  L  + L  +   G IPS
Sbjct  376   SNNRFSGVVPSTVGEFTSLQVLNMASNSLSGSIP-LRIGQLKRLSVVDLGDNELNGSIPS  434

Query  840   SLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKE  1019
              +   + L +L L NN  S        I     L +L ++ N+LSGS+P   S L  L+ 
Sbjct  435   EIGMLSSLAYLRLDNNSLSNS--IPASIGDCAALVSLSLARNQLSGSIPASISKLSQLQA  492

Query  1020  LSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             + L SN  +G +P  LG   +L   ++S N   G +P
Sbjct  493   VDLSSNQLTGTLPKQLGDLVNLRLFNVSHNDLEGELP  529



>ref|XP_004502826.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=970

 Score =   200 bits (508),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 114/264 (43%), Positives = 162/264 (61%), Gaps = 30/264 (11%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPC--AWNFVKCHPANGRVSEVDLHGLGLS  533
             LNDDVLGLIVFK+ +QDP   L +W+EDD+S C  +W  VKC+P + RV E++L+G  LS
Sbjct  23    LNDDVLGLIVFKADIQDPKGKLTSWNEDDESACGGSWVGVKCNPRSNRVVEINLNGFSLS  82

Query  534   GKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSS  713
             G+IGRGL++L+ L  L LA+NN +G I+P                        ++  + +
Sbjct  83    GRIGRGLQRLQFLRRLYLANNNLTGNIAP------------------------NIAIIDN  118

Query  714   LQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRF  893
             L+ LDLS N+LSG V D      GS+R +SLAG+ F G IPSSL  C+ +  ++LS N+F
Sbjct  119   LRVLDLSKNNLSGVVPDDFFRQCGSMRVVSLAGNMFSGNIPSSLGSCSAIATIDLSFNQF  178

Query  894   SGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLG  1070
             SG  P+    +W L+ LR+LD+S+N L G +P   + L NL+ ++L  N FSG+IP   G
Sbjct  179   SGSVPK---EVWTLSGLRSLDLSDNLLEGDIPQDVTALKNLRSINLARNSFSGKIPNGFG  235

Query  1071  LCPHLSRLDLSENLFTGTIPESLQ  1142
              C  L  +D  +N FTG +P  L+
Sbjct  236   SCLLLRSIDFGDNSFTGGLPIDLK  259


 Score = 93.2 bits (230),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 81/234 (35%), Positives = 111/234 (47%), Gaps = 27/234 (12%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             ++L     SGKI  G      L  +    N+F+G +   L  L      +L  N+ SG V
Sbjct  219   INLARNSFSGKIPNGFGSCLLLRSIDFGDNSFTGGLPIDLKGLVLCGYFSLRGNAFSGDV  278

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P+ +G M  LQ LDLS N  SG V +S L NL SL+ L+L+ + F G +P S++ CT L 
Sbjct  279   PEWIGEMKGLQTLDLSMNRFSGLVPNS-LGNLWSLKRLNLSANGFTGNLPESMANCTNLL  337

Query  867   HLNLSNNRFSGD--------------------------PRFSGGIWGLTRLRTLDVSNNE  968
              L++S N  SGD                          P +S     +  L+ LD S+N 
Sbjct  338   ALDVSQNLMSGDLPSWIFRSDLEKVLVAENRMSGSLKNPLYSFTEVAVQSLQVLDFSHNA  397

Query  969   LSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
              SG +  G S L +L+ L+L  N  SG IP  +G     S LDLS N   G+IP
Sbjct  398   FSGEITSGVSGLSSLRVLNLSYNSLSGHIPATIGDLKTCSSLDLSYNKLNGSIP  451


 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 118/238 (50%), Gaps = 29/238 (12%)
 Frame = +3

Query  513   LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  692
             L G   SG +   + +++ L  L L+ N FSG++   LG L +L+ LNLS N  +G +P+
Sbjct  269   LRGNAFSGDVPEWIGEMKGLQTLDLSMNRFSGLVPNSLGNLWSLKRLNLSANGFTGNLPE  328

Query  693   SLGNMSSLQFLDLSGNSLSG---------------------------PVSDSMLENLGSL  791
             S+ N ++L  LD+S N +SG                           P+       + SL
Sbjct  329   SMANCTNLLALDVSQNLMSGDLPSWIFRSDLEKVLVAENRMSGSLKNPLYSFTEVAVQSL  388

Query  792   RFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNEL  971
             + L  + ++F G I S +S  + L  LNLS N  SG       I  L    +LD+S N+L
Sbjct  389   QVLDFSHNAFSGEITSGVSGLSSLRVLNLSYNSLSG--HIPATIGDLKTCSSLDLSYNKL  446

Query  972   SGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             +GS+P       +LKEL L +N   GEIP  +  C  L+ L LS+N  +G+IP ++ +
Sbjct  447   NGSIPWEICGAGSLKELILENNFLVGEIPTSIENCSALTTLILSKNRLSGSIPATVAK  504


 Score = 70.9 bits (172),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 95/190 (50%), Gaps = 27/190 (14%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             ++ L VL  + N FSG I+  +  L++L+ LNLS NS+SG +P ++G++ +   LDLS N
Sbjct  385   VQSLQVLDFSHNAFSGEITSGVSGLSSLRVLNLSYNSLSGHIPATIGDLKTCSSLDLSYN  444

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
              L+G +   +    GSL+ L L  +   G IP+S+  C+ L  L LS NR          
Sbjct  445   KLNGSIPWEIC-GAGSLKELILENNFLVGEIPTSIENCSALTTLILSKNR----------  493

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDL  1100
                             LSGS+P   + L NL+ + L  N+  G +P  L   P+L   +L
Sbjct  494   ----------------LSGSIPATVAKLSNLQTVDLSFNNLIGILPKQLANLPNLLTFNL  537

Query  1101  SENLFTGTIP  1130
             S N   G +P
Sbjct  538   SHNNLRGELP  547



>ref|XP_007134721.1| hypothetical protein PHAVU_010G070400g [Phaseolus vulgaris]
 gb|ESW06715.1| hypothetical protein PHAVU_010G070400g [Phaseolus vulgaris]
Length=982

 Score =   200 bits (508),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 116/262 (44%), Positives = 155/262 (59%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLI FK+G++DP   L+TW+ DD SPC W  VKC P N RVS + L G  LSG 
Sbjct  39    FNDDVLGLITFKAGLEDPKGKLSTWNADDYSPCNWVGVKCDPVNNRVSSLVLDGFSLSGH  98

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             I RGL KL+ L +LSL+ NNF G I+P                       D LG +  LQ
Sbjct  99    IDRGLLKLQFLQILSLSRNNFKGTIAP-----------------------DLLG-IGDLQ  134

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N+LSG + + + +   SLR LS A ++  G IP SLS C  L  +N S+N+  G
Sbjct  135   VVDLSENNLSGLIPNEIFQQCWSLRVLSFANNNLTGKIPDSLSSCYSLAVVNFSSNQIHG  194

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
             +     G+W L RL+++D+SNN L G +P G   L +L+EL LG N F+G+IP  +G C 
Sbjct  195   E--LPSGMWFLRRLQSIDLSNNLLEGEIPEGIRNLIDLRELRLGRNLFTGKIPEHIGDCL  252

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +D S N  +G +PES+Q+
Sbjct  253   LLKMVDFSGNSLSGRLPESMQK  274


 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 85/243 (35%), Positives = 123/243 (51%), Gaps = 32/243 (13%)
 Frame = +3

Query  495   RVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSI  674
             R+  +DL    L G+I  G+  L  L  L L  N F+G I   +G    L+ ++ S NS+
Sbjct  205   RLQSIDLSNNLLEGEIPEGIRNLIDLRELRLGRNLFTGKIPEHIGDCLLLKMVDFSGNSL  264

Query  675   SGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKC  854
             SG +P+S+  +SS  FL L GNS +G +   + E + SL  L L+ + F G IP S+   
Sbjct  265   SGRLPESMQKLSSCTFLSLQGNSFTGGIPHWIGE-MKSLDILDLSANRFSGWIPKSIGNL  323

Query  855   TLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLP-------------IG  992
              LL+ LNLS N+ +G+ P     +    +L TLD+S+N L+G LP              G
Sbjct  324   DLLSRLNLSRNQITGNLPEL---MVNCIKLLTLDISHNHLAGHLPSWIFRMGLQSISISG  380

Query  993   ASF--------------LHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
              SF               H L+ L L SN FSG++P  +G    L  L+LS N  +G+IP
Sbjct  381   NSFSEGNYPSLTSIPVSFHGLQVLDLSSNAFSGQLPFGIGGLGSLHVLNLSTNNISGSIP  440

Query  1131  ESL  1139
              S+
Sbjct  441   VSI  443


 Score = 92.8 bits (229),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 97/164 (59%), Gaps = 3/164 (2%)
 Frame = +3

Query  570   LNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLS  749
             L VL L+SN FSG +   +G L +L  LNLS N+ISG++P S+G + SL  LDLS N L+
Sbjct  401   LQVLDLSSNAFSGQLPFGIGGLGSLHVLNLSTNNISGSIPVSIGELKSLYILDLSDNKLN  460

Query  750   GPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWG  929
             G +  S +E   S+  + L  +   G IP+ + KC+ L  LNLS+N+  G       I  
Sbjct  461   GSIP-SEIEGAISVSEMRLQKNFLSGRIPAQIDKCSELTFLNLSHNKLIGS--IPSAIAN  517

Query  930   LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             LT L+ +D S NELSGSLP   + L NL   ++  NH  GE+PV
Sbjct  518   LTNLQDVDFSWNELSGSLPKELTNLSNLFSFNVSYNHLQGELPV  561



>ref|XP_003533657.2| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
 gb|KHN29502.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=967

 Score =   199 bits (507),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 159/262 (61%), Gaps = 27/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLIVFK+G+ DP   L++W+EDD+SPC W  VKC P++ RV+ + L G  LSG 
Sbjct  27    FNDDVLGLIVFKAGLDDPKRKLSSWNEDDNSPCNWEGVKCDPSSNRVTALVLDGFSLSGH  86

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             + RGL +L+ L +LSL+ NNF+G I+P                         L  + SLQ
Sbjct  87    VDRGLLRLQSLQILSLSRNNFTGSINP------------------------DLPLLGSLQ  122

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N+LSG + +   +  GSLR +S A ++  G IP SLS C+ L  +N S+N+  G
Sbjct  123   VVDLSDNNLSGEIPEGFFQQCGSLRTVSFAKNNLTGKIPESLSSCSNLASVNFSSNQLHG  182

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
             +     G+W L  L++LD+S+N L G +P G   L++++ELSL  N FSG +P D+G C 
Sbjct  183   E--LPNGVWFLRGLQSLDLSDNFLEGEIPEGIQNLYDMRELSLQRNRFSGRLPGDIGGCI  240

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LDLS N F   +P+S+QR
Sbjct  241   LLKSLDLSGN-FLSELPQSMQR  261


 Score = 92.4 bits (228),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 121/222 (55%), Gaps = 14/222 (6%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             + + L G   +G I   + +L++L VL L++N FSG I   LG L +L  LNLS+N ++G
Sbjct  266   TSISLQGNSFTGGIPEWIGELKNLEVLDLSANGFSGWIPKSLGNLDSLHRLNLSRNRLTG  325

Query  681   TVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEG-------PIPS  839
              +PDS+ N + L  LD+S N L+G V  S +  +G ++ +SL+G  F         P P+
Sbjct  326   NMPDSMMNCTKLLALDISHNHLAGHVP-SWIFKMG-VQSISLSGDGFSKGNYPSLKPTPA  383

Query  840   SLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKE  1019
             S      L  L+LS+N FSG      GI GL  L+ L+ S N +SGS+P+G   L +L  
Sbjct  384   SYHG---LEVLDLSSNAFSG--VLPSGIGGLGSLQVLNFSTNNISGSIPVGIGDLKSLYI  438

Query  1020  LSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             + L  N  +G IP ++     LS L L +N   G IP  + +
Sbjct  439   VDLSDNKLNGSIPSEIEGATSLSELRLQKNFLGGRIPAQIDK  480


 Score = 92.0 bits (227),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 99/164 (60%), Gaps = 3/164 (2%)
 Frame = +3

Query  570   LNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLS  749
             L VL L+SN FSGV+   +G L +LQ LN S N+ISG++P  +G++ SL  +DLS N L+
Sbjct  388   LEVLDLSSNAFSGVLPSGIGGLGSLQVLNFSTNNISGSIPVGIGDLKSLYIVDLSDNKLN  447

Query  750   GPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWG  929
             G +  S +E   SL  L L  +   G IP+ + KC+ L  L LS+N+ +G       I  
Sbjct  448   GSIP-SEIEGATSLSELRLQKNFLGGRIPAQIDKCSSLTFLILSHNKLTGS--IPAAIAN  504

Query  930   LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             LT L+ +D+S NELSGSLP   + L +L   ++  NH  GE+PV
Sbjct  505   LTNLQYVDLSWNELSGSLPKELTNLSHLFSFNVSYNHLEGELPV  548


 Score = 86.3 bits (212),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 118/216 (55%), Gaps = 8/216 (4%)
 Frame = +3

Query  513   LHGLGLSG----KIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             L  L LSG    ++ + +++L     +SL  N+F+G I   +G L NL+ L+LS N  SG
Sbjct  242   LKSLDLSGNFLSELPQSMQRLTSCTSISLQGNSFTGGIPEWIGELKNLEVLDLSANGFSG  301

Query  681   TVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTL  860
              +P SLGN+ SL  L+LS N L+G + DSM+ N   L  L ++ +   G +PS + K  +
Sbjct  302   WIPKSLGNLDSLHRLNLSRNRLTGNMPDSMM-NCTKLLALDISHNHLAGHVPSWIFKMGV  360

Query  861   LNHLNLSNNRFSGD--PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGS  1034
                ++LS + FS    P           L  LD+S+N  SG LP G   L +L+ L+  +
Sbjct  361   -QSISLSGDGFSKGNYPSLKPTPASYHGLEVLDLSSNAFSGVLPSGIGGLGSLQVLNFST  419

Query  1035  NHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
             N+ SG IPV +G    L  +DLS+N   G+IP  ++
Sbjct  420   NNISGSIPVGIGDLKSLYIVDLSDNKLNGSIPSEIE  455



>ref|XP_004138394.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis sativus]
 gb|KGN45839.1| hypothetical protein Csa_6G014590 [Cucumis sativus]
Length=964

 Score =   199 bits (506),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 161/262 (61%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LN+DVLGLIVFK+ ++DP   LA+W+EDDD+PC W  +KC+P + RV E++L G  L+G+
Sbjct  25    LNEDVLGLIVFKADIEDPEGKLASWNEDDDNPCNWVGLKCNPRSNRVVELNLDGFSLNGR  84

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             +GRGL +L+ L  LSLA+NN +G +SP                              +L+
Sbjct  85    LGRGLLQLQFLRKLSLANNNLTGNLSPNN------------------------ARFENLR  120

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLSGN   G + D      GSLR +SLA +   G IP SLS C+ L  +NLS+N+FSG
Sbjct  121   VVDLSGNGFHGMIPDDFFRQCGSLRVISLANNKISGKIPESLSSCSSLAAVNLSSNQFSG  180

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIW LT LR+LD+S+N L G +P     ++NL+ ++LG N FSG+IP  +G C 
Sbjct  181   S--LPSGIWSLTGLRSLDLSDNILEGEIPPEVKGMNNLRAVNLGKNRFSGQIPDGIGSCM  238

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLSEN F+G +P ++++
Sbjct  239   LLRSVDLSENSFSGNVPATMKK  260


 Score = 93.2 bits (230),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 111/184 (60%), Gaps = 6/184 (3%)
 Frame = +3

Query  510   DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVP  689
             D+    LS  +G+ L  L+   VL L+ N FSG ISP +G+L++LQ LNL KNS  G +P
Sbjct  366   DIKRSSLSTTVGKALVNLQ---VLDLSHNAFSGEISPDIGILSSLQVLNLCKNSFVGAIP  422

Query  690   DSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNH  869
             +S+G + +L FLDLS N L+G + +++  ++ SL+ L L  +  EG +P+S+  C+ L  
Sbjct  423   ESIGGLKALVFLDLSENQLNGSIPETLGRDV-SLKELRLGKNLLEGGVPNSVGNCSSLVT  481

Query  870   LNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSG  1049
             L++S NR +G       +  L  L+ +D+S N LSG+LP   + L NL   ++  N+  G
Sbjct  482   LDVSENRLTGS--IPAELSQLINLQIVDLSTNNLSGALPKQLANLPNLLLFNISHNNLQG  539

Query  1050  EIPV  1061
             E+P 
Sbjct  540   ELPA  543


 Score = 86.3 bits (212),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 81/259 (31%), Positives = 120/259 (46%), Gaps = 48/259 (19%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             VDL     SG +   ++KL   + L+L  N F G +   +G +  L+ L+LS N  SG +
Sbjct  243   VDLSENSFSGNVPATMKKLSLCSTLNLRRNLFQGEVPEWIGGMEGLEILDLSGNRFSGPI  302

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSML--ENLGS------------------------  788
             P S GN+  L+ L++SGN L+G +++S++  +NL +                        
Sbjct  303   PSSFGNLQKLKVLNVSGNGLTGSLAESIVPSQNLSAMDLGHGSLTGVLPAWILKLGSQNV  362

Query  789   --------------------LRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPR  908
                                 L+ L L+ ++F G I   +   + L  LNL  N F G   
Sbjct  363   LPSDIKRSSLSTTVGKALVNLQVLDLSHNAFSGEISPDIGILSSLQVLNLCKNSFVG--A  420

Query  909   FSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLS  1088
                 I GL  L  LD+S N+L+GS+P       +LKEL LG N   G +P  +G C  L 
Sbjct  421   IPESIGGLKALVFLDLSENQLNGSIPETLGRDVSLKELRLGKNLLEGGVPNSVGNCSSLV  480

Query  1089  RLDLSENLFTGTIPESLQR  1145
              LD+SEN  TG+IP  L +
Sbjct  481   TLDVSENRLTGSIPAELSQ  499


 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 76/226 (34%), Positives = 110/226 (49%), Gaps = 22/226 (10%)
 Frame = +3

Query  531   SGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMS  710
             SG+I  G+     L  + L+ N+FSG +   +  L+   TLNL +N   G VP+ +G M 
Sbjct  227   SGQIPDGIGSCMLLRSVDLSENSFSGNVPATMKKLSLCSTLNLRRNLFQGEVPEWIGGME  286

Query  711   SLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNL----  878
              L+ LDLSGN  SGP+  S   NL  L+ L+++G+   G +  S+     L+ ++L    
Sbjct  287   GLEILDLSGNRFSGPIPSS-FGNLQKLKVLNVSGNGLTGSLAESIVPSQNLSAMDLGHGS  345

Query  879   -------------SNNRFSGDPRFSGGIW----GLTRLRTLDVSNNELSGSLPIGASFLH  1007
                          S N    D + S         L  L+ LD+S+N  SG +      L 
Sbjct  346   LTGVLPAWILKLGSQNVLPSDIKRSSLSTTVGKALVNLQVLDLSHNAFSGEISPDIGILS  405

Query  1008  NLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             +L+ L+L  N F G IP  +G    L  LDLSEN   G+IPE+L R
Sbjct  406   SLQVLNLCKNSFVGAIPESIGGLKALVFLDLSENQLNGSIPETLGR  451



>ref|XP_010427454.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Camelina sativa]
 ref|XP_010427455.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Camelina sativa]
Length=967

 Score =   199 bits (505),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 119/262 (45%), Positives = 164/262 (63%), Gaps = 25/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+ ++DP   LA+W+EDD +PC+W  VKCHP   RV+E+ L G  LSG+
Sbjct  28    LNDDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWTGVKCHPRTNRVTELTLDGFSLSGR  87

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L+ LSL++NN +GVI+P                       + L ++ +L+
Sbjct  88    IGRGLLQLQFLHKLSLSNNNLTGVINP-----------------------NFLLSLVNLK  124

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N+LSG + D   +  GSLR LSLA +   G IP S+S C+ L  LNLS+NRFSG
Sbjct  125   VVDLSSNALSGSLPDEFFKQCGSLRVLSLAKNKLTGKIPVSISSCSSLASLNLSSNRFSG  184

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   G+W L  LR+LD+S NEL G  P     L+NL+ L L  N  SG IP ++G C 
Sbjct  185   S--MPSGVWSLNTLRSLDLSRNELEGEFPDKIDRLNNLRSLDLSRNRLSGPIPSEIGSCM  242

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLS+N  +G++P++ Q+
Sbjct  243   LLKTIDLSDNSLSGSLPDTFQQ  264


 Score = 93.2 bits (230),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 80/224 (36%), Positives = 113/224 (50%), Gaps = 16/224 (7%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    LSG I   +     L  + L+ N+ SG +      L+   +LNL KN++ G V
Sbjct  223   LDLSRNRLSGPIPSEIGSCMLLKTIDLSDNSLSGSLPDTFQQLSLCYSLNLGKNALEGEV  282

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P  +G M SL+ LDLS N  SG V DS + NL +L+ L+ +G+   G +P S + C  L 
Sbjct  283   PKWIGEMRSLESLDLSMNKFSGQVPDS-IGNLLALKVLNFSGNGLIGSLPDSTANCINLL  341

Query  867   HLNLSNNRFSGD-PR--FSGG------------IWGLTRLRTLDVSNNELSGSLPIGASF  1001
              L+LS N  +G  P   F  G              G+ +++ LD+S+N  SG +  G   
Sbjct  342   ALDLSGNSLTGKLPMWIFQDGSRDVSALKNDNSTGGIKKIQVLDLSHNSFSGEIGDGLGD  401

Query  1002  LHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPE  1133
             L +L+ L L  N  +G IP  +G   HL  LDLS N   GTIP 
Sbjct  402   LRDLEGLHLSRNSLTGPIPSTIGELKHLVVLDLSHNQLNGTIPR  445


 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 112/229 (49%), Gaps = 22/229 (10%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL     SG++   +  L  L VL+ + N   G +        NL  L+LS NS++G +
Sbjct  295   LDLSMNKFSGQVPDSIGNLLALKVLNFSGNGLIGSLPDSTANCINLLALDLSGNSLTGKL  354

Query  687   P-----------------DSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGS  815
             P                 +S G +  +Q LDLS NS SG + D  L +L  L  L L+ +
Sbjct  355   PMWIFQDGSRDVSALKNDNSTGGIKKIQVLDLSHNSFSGEIGDG-LGDLRDLEGLHLSRN  413

Query  816   SFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIG  992
             S  GPIPS++ +   L  L+LS+N+ +G  PR +GG   L  LR   + NN L GS+P  
Sbjct  414   SLTGPIPSTIGELKHLVVLDLSHNQLNGTIPRETGGAVSLEELR---LDNNLLDGSIPPS  470

Query  993   ASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
                   L+ L L  N   G IP +L     L  +D+S N  TGT+P+ L
Sbjct  471   IKNCSPLRSLILSHNKLLGSIPRELAKLTKLEEVDISFNELTGTLPKQL  519


 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 63/168 (38%), Positives = 97/168 (58%), Gaps = 5/168 (3%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             ++ + VL L+ N+FSG I   LG L +L+ L+LS+NS++G +P ++G +  L  LDLS N
Sbjct  378   IKKIQVLDLSHNSFSGEIGDGLGDLRDLEGLHLSRNSLTGPIPSTIGELKHLVVLDLSHN  437

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PRFSG  917
              L+G +       + SL  L L  +  +G IP S+  C+ L  L LS+N+  G  PR   
Sbjct  438   QLNGTIPRETGGAV-SLEELRLDNNLLDGSIPPSIKNCSPLRSLILSHNKLLGSIPR---  493

Query  918   GIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
              +  LT+L  +D+S NEL+G+LP   + L  L   ++  NH  GE+P 
Sbjct  494   ELAKLTKLEEVDISFNELTGTLPKQLANLGYLHTFNMSHNHLFGELPA  541



>gb|EAZ26832.1| hypothetical protein OsJ_10748 [Oryza sativa Japonica Group]
Length=971

 Score =   199 bits (505),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 119/262 (45%), Positives = 154/262 (59%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             L+DDVLGLIVFK+ V DP   LATWSEDD+ PCAW  V C P  GRV+ + L   GLSGK
Sbjct  30    LDDDVLGLIVFKADVVDPEGRLATWSEDDERPCAWAGVTCDPITGRVAGLSLACFGLSGK  89

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             +GRGL +LE L  LSL+ NNFSG                         +P  L  +  LQ
Sbjct  90    LGRGLLRLESLQSLSLSGNNFSG------------------------DLPADLARLPDLQ  125

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              LDLS N+ SG + D    +  +LR +SLA ++F G +P  +  C  L  LNLS+NR +G
Sbjct  126   SLDLSANAFSGAIPDGFFGHCRNLRDVSLANNAFSGDVPRDVGACATLASLNLSSNRLAG  185

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                    IW L  LRTLD+S N ++G LP+G S + NL+ L+L SN  +G +P D+G CP
Sbjct  186   --ALPSDIWSLNALRTLDLSGNAITGDLPVGVSRMFNLRSLNLRSNRLAGSLPDDIGDCP  243

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DL  N  +G +PESL+R
Sbjct  244   LLRSVDLGSNNISGNLPESLRR  265


 Score = 93.6 bits (231),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 118/213 (55%), Gaps = 4/213 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL G  ++G +  G+ ++ +L  L+L SN  +G +   +G    L++++L  N+ISG +
Sbjct  200   LDLSGNAITGDLPVGVSRMFNLRSLNLRSNRLAGSLPDDIGDCPLLRSVDLGSNNISGNL  259

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P+SL  +S+  +LDLS N+L+G V  + +  + SL  L L+G+ F G IP S+     L 
Sbjct  260   PESLRRLSTCTYLDLSSNALTGNVP-TWVGEMASLETLDLSGNKFSGEIPGSIGGLMSLK  318

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
              L LS N F+G       I G   L  +DVS N L+G+LP    F   ++ +S+  N  S
Sbjct  319   ELRLSGNGFTGG--LPESIGGCKSLVHVDVSWNSLTGTLP-SWVFASGVQWVSVSDNTLS  375

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
             GE+ V +     +  +DLS N F+G IP  + +
Sbjct  376   GEVFVPVNASSMVRGVDLSSNAFSGMIPSEISQ  408


 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 81/233 (35%), Positives = 119/233 (51%), Gaps = 25/233 (11%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    L+G +   + ++  L  L L+ N FSG I   +G L +L+ L LS N  +G +
Sbjct  272   LDLSSNALTGNVPTWVGEMASLETLDLSGNKFSGEIPGSIGGLMSLKELRLSGNGFTGGL  331

Query  687   PDSLGNMSSLQFLDLSGNSLSGP--------------VSDSMLE-------NLGSL-RFL  800
             P+S+G   SL  +D+S NSL+G               VSD+ L        N  S+ R +
Sbjct  332   PESIGGCKSLVHVDVSWNSLTGTLPSWVFASGVQWVSVSDNTLSGEVFVPVNASSMVRGV  391

Query  801   SLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGS  980
              L+ ++F G IPS +S+   L  LN+S N  SG       I  +  L  LD++ N L+GS
Sbjct  392   DLSSNAFSGMIPSEISQVITLQSLNMSWNSLSGS--IPPSIVQMKSLEVLDLTANRLNGS  449

Query  981   LPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             +P       +L+EL L  N  +GEIP  +G    L+ LDLS N  TG IP ++
Sbjct  450   IPATVGG-ESLRELRLAKNSLTGEIPAQIGNLSALASLDLSHNNLTGAIPATI  501


 Score = 86.7 bits (213),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 73/225 (32%), Positives = 114/225 (51%), Gaps = 22/225 (10%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L+G +   +     L  + L SNN SG +   L  L+    L+LS N+++G VP  +G M
Sbjct  231   LAGSLPDDIGDCPLLRSVDLGSNNISGNLPESLRRLSTCTYLDLSSNALTGNVPTWVGEM  290

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
             +SL+ LDLSGN  SG +  S +  L SL+ L L+G+ F G +P S+  C  L H+++S N
Sbjct  291   ASLETLDLSGNKFSGEIPGS-IGGLMSLKELRLSGNGFTGGLPESIGGCKSLVHVDVSWN  349

Query  888   RFSG-----------------DPRFSGGIW----GLTRLRTLDVSNNELSGSLPIGASFL  1004
               +G                 D   SG ++      + +R +D+S+N  SG +P   S +
Sbjct  350   SLTGTLPSWVFASGVQWVSVSDNTLSGEVFVPVNASSMVRGVDLSSNAFSGMIPSEISQV  409

Query  1005  HNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
               L+ L++  N  SG IP  +     L  LDL+ N   G+IP ++
Sbjct  410   ITLQSLNMSWNSLSGSIPPSIVQMKSLEVLDLTANRLNGSIPATV  454


 Score = 84.3 bits (207),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 104/177 (59%), Gaps = 4/177 (2%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             LSG++   +     +  + L+SN FSG+I  ++  +  LQ+LN+S NS+SG++P S+  M
Sbjct  374   LSGEVFVPVNASSMVRGVDLSSNAFSGMIPSEISQVITLQSLNMSWNSLSGSIPPSIVQM  433

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
              SL+ LDL+ N L+G +  ++     SLR L LA +S  G IP+ +   + L  L+LS+N
Sbjct  434   KSLEVLDLTANRLNGSIPATVGGE--SLRELRLAKNSLTGEIPAQIGNLSALASLDLSHN  491

Query  888   RFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
               +G       I  +T L+T+D+S N+L+G LP   S L +L   ++  N  SG++P
Sbjct  492   NLTG--AIPATIANITNLQTVDLSRNKLTGGLPKQLSDLPHLVRFNISHNQLSGDLP  546



>ref|XP_009406870.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
 ref|XP_009406871.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=969

 Score =   198 bits (504),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 115/261 (44%), Positives = 153/261 (59%), Gaps = 26/261 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVFK+GV+DP S LA+W+EDD  PC W  V+C   + RV+E+ L G  LSGK
Sbjct  26    LNDDVLGLIVFKAGVEDPRSKLASWNEDDVDPCNWAGVRCDAKSNRVTELALDGFALSGK  85

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             +GRGL  L+ L  LSL+ NNFSG +SP                         L  + SL+
Sbjct  86    LGRGLLWLQFLETLSLSMNNFSGSLSP------------------------DLLRLESLR  121

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              LDLS N LSG + D       S+R +SLA +S  G IP  +  C+ L  LNLS+N+ SG
Sbjct  122   TLDLSANHLSGTIPDGFFGQCRSIRDISLAKNSISGKIPPDVGSCSTLVSLNLSSNQLSG  181

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                    IW L  LR+LD+S+N L G +P+G S + NL+ +SL  N  +G++P D G C 
Sbjct  182   S--LPSEIWSLNALRSLDLSDNSLVGEIPLGISRMFNLRMISLRRNRLTGQLPNDTGNCM  239

Query  1080  HLSRLDLSENLFTGTIPESLQ  1142
              L  LD+ EN  +G +P S++
Sbjct  240   LLKSLDVGENQLSGDLPYSMR  260


 Score =   108 bits (270),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 117/211 (55%), Gaps = 4/211 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL G   SG     L  L+ L VL L+ N+FSG +   L    +L  ++LS+N+++G +
Sbjct  292   LDLSGNKFSGGFPSSLSNLQLLKVLKLSDNSFSGGLPDSLAACRSLLDVDLSRNTLTGNL  351

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P  +      Q L LSGN  SGP+    + +  +++ L L+G++F G  P+ +S    L 
Sbjct  352   PSWVFESGFTQIL-LSGNKFSGPIVIPSVTD-STIQVLDLSGNAFSGKFPNEVSNLRSLE  409

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
              LNLS +  SG       +  +  L+ LDVS N LSGS+P+      +L+E+ L  N  +
Sbjct  410   FLNLSFDSLSGP--IPASVGEMKSLQVLDVSGNRLSGSIPLEVGLAASLREMRLEKNSLT  467

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              EIP+ +G C  L+ LDLS+N  TG IPE+L
Sbjct  468   AEIPIQIGSCSSLAYLDLSQNNLTGPIPETL  498


 Score = 68.2 bits (165),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 95/172 (55%), Gaps = 3/172 (2%)
 Frame = +3

Query  486   ANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSK  665
              +  +  +DL G   SGK    +  L  L  L+L+ ++ SG I   +G + +LQ L++S 
Sbjct  380   TDSTIQVLDLSGNAFSGKFPNEVSNLRSLEFLNLSFDSLSGPIPASVGEMKSLQVLDVSG  439

Query  666   NSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSL  845
             N +SG++P  +G  +SL+ + L  NSL+  +    + +  SL +L L+ ++  GPIP +L
Sbjct  440   NRLSGSIPLEVGLAASLREMRLEKNSLTAEIP-IQIGSCSSLAYLDLSQNNLTGPIPETL  498

Query  846   SKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASF  1001
             +  T L  ++ S N+ SG       +  L  L + ++S+N+LSG LP G+ F
Sbjct  499   ANLTNLQVVDFSRNQLSG--TIPKQLADLPHLLSFNISHNQLSGDLPAGSFF  548



>ref|XP_010043193.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW88339.1| hypothetical protein EUGRSUZ_A00726 [Eucalyptus grandis]
Length=962

 Score =   197 bits (500),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 116/262 (44%), Positives = 161/262 (61%), Gaps = 26/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLIVFK+G+ DP   L+TW+ED + PC W  +KC P + RV+EV L G  LSG 
Sbjct  23    FNDDVLGLIVFKAGLHDPKDKLSTWNEDAEYPCDWVGIKCDPRSKRVTEVALDGFSLSGH  82

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L VLSL+ NNFSG I+                         SL ++ +LQ
Sbjct  83    IGRGLLRLQFLQVLSLSKNNFSGPIN------------------------TSLTHIGTLQ  118

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              LDLS N+ +G + D M +  GSLR +S A +S  G IP SLS C+ L  +N S+N+ SG
Sbjct  119   VLDLSENNFTGAIPDEMFQQCGSLRVVSFAKNSLMGRIPDSLSYCSTLVAVNFSSNQLSG  178

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
               +   G+W    L++LD+S N L   +P G   L++++ ++L  N F+G+IP D+G   
Sbjct  179   --KLPPGMWFSRGLQSLDLSENLLEAEIPEGIQNLYDVRVVNLRRNRFTGQIPRDIGGNL  236

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  LDLS+NLF+G++PES+QR
Sbjct  237   LLRSLDLSDNLFSGSLPESMQR  258


 Score =   100 bits (248),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 83/239 (35%), Positives = 126/239 (53%), Gaps = 25/239 (10%)
 Frame = +3

Query  492   GRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNS  671
             G  S +D+HG  L+G+I   + +L +L  L L+ N  SG I P +G + +L+ LNLS N 
Sbjct  260   GLCSSLDVHGNLLTGEIPDWIGELRNLKNLDLSRNELSGSIPPSIGNIQSLKKLNLSTNL  319

Query  672   ISGTVPDSLGNMSSLQFLDLSGN---------------SLSGPVSDSMLEN--------L  782
             ++G++PDS+ N  +L  LD+S N               SLSG   D   E          
Sbjct  320   LTGSLPDSISNCKNLSVLDVSQNLLTGGFPFKLDTRGVSLSGNGVDESAEYTSLPATTLY  379

Query  783   GSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSN  962
              +L+ + ++ +S  G IP++L     +  LN+S N F G    S G+   T+   LD+SN
Sbjct  380   NNLQVMDISSNSLSGEIPANLGVLGSVESLNMSRNLFFGSIPASIGVLKYTQF--LDLSN  437

Query  963   NELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             N L+GS+P       +LK+L L  N  SG IP  +G C +L+ L LS+N  TG +P ++
Sbjct  438   NRLNGSIPPEIGVAISLKDLKLDKNFLSGNIPTQIGACSNLTSLILSQNNLTGPVPPAM  496


 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 94/165 (57%), Gaps = 3/165 (2%)
 Frame = +3

Query  567   HLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSL  746
             +L V+ ++SN+ SG I   LG+L ++++LN+S+N   G++P S+G +   QFLDLS N L
Sbjct  381   NLQVMDISSNSLSGEIPANLGVLGSVESLNMSRNLFFGSIPASIGVLKYTQFLDLSNNRL  440

Query  747   SGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIW  926
             +G +   +   + SL+ L L  +   G IP+ +  C+ L  L LS N  +G       + 
Sbjct  441   NGSIPPEIGVAI-SLKDLKLDKNFLSGNIPTQIGACSNLTSLILSQNNLTGP--VPPAMA  497

Query  927   GLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
              LT L  +D+S N LSGSLP   + L  L   ++  NH  GE+PV
Sbjct  498   NLTNLEHVDLSLNNLSGSLPKELANLSRLVYFNISHNHLEGELPV  542



>ref|XP_010504542.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=968

 Score =   197 bits (500),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 164/262 (63%), Gaps = 25/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLIVF++ ++DP   LA+W+EDD +PC+W  VKCHP   RV+E+ L G  LSG+
Sbjct  29    LNDDVLGLIVFEADLRDPEQKLASWNEDDYTPCSWTGVKCHPRTNRVTELTLDGFSLSGR  88

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L+ LSL++NN +G+I+P                       + L ++ +L+
Sbjct  89    IGRGLLQLQFLHKLSLSNNNLTGIINP-----------------------NFLLSLVNLK  125

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N+LSG + D   +  GSLR LSLA +   G IP S+S C+ L  LNLS+NRFSG
Sbjct  126   VVDLSSNALSGSLPDGFFKQCGSLRVLSLAKNKLTGKIPVSISSCSSLASLNLSSNRFSG  185

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIW L  LR+LD+S NEL G  P     L+NL+ L L  N  SG IP ++G C 
Sbjct  186   S--MPSGIWSLNTLRSLDLSRNELEGEFPEKIDRLNNLRSLDLSRNRLSGPIPSEIGSCM  243

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLS+N  +G++P++ Q+
Sbjct  244   LLKTIDLSDNSLSGSLPDTFQQ  265


 Score = 91.7 bits (226),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 78/224 (35%), Positives = 113/224 (50%), Gaps = 16/224 (7%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    LSG I   +     L  + L+ N+ SG +      L+   +LNL KN++ G V
Sbjct  224   LDLSRNRLSGPIPSEIGSCMLLKTIDLSDNSLSGSLPDTFQQLSLCYSLNLGKNALEGEV  283

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P  +G M SL+ LDLS N  +G V DS + NL +L+ L+ +G+   G +P S + C  L 
Sbjct  284   PKWIGEMRSLETLDLSMNKFTGQVPDS-IGNLLALKVLNFSGNGLIGSLPDSTANCINLL  342

Query  867   HLNLSNNRFSGD-PR--FSGG------------IWGLTRLRTLDVSNNELSGSLPIGASF  1001
              L++S N  +G  P   F  G              G+ +++ LD+S+N  SG +  G   
Sbjct  343   ALDISGNSLTGKLPMLIFQDGSRDVSALKNDNSTGGIKKIQVLDLSHNSFSGEIGDGLGD  402

Query  1002  LHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPE  1133
             L +L+ L L  N  +G IP  +G   HL  LDLS N   GTIP 
Sbjct  403   LRDLEGLHLSRNSLTGPIPSTIGELKHLVVLDLSHNQLNGTIPR  446


 Score = 83.6 bits (205),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 113/229 (49%), Gaps = 22/229 (10%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL     +G++   +  L  L VL+ + N   G +        NL  L++S NS++G +
Sbjct  296   LDLSMNKFTGQVPDSIGNLLALKVLNFSGNGLIGSLPDSTANCINLLALDISGNSLTGKL  355

Query  687   P-----------------DSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGS  815
             P                 +S G +  +Q LDLS NS SG + D  L +L  L  L L+ +
Sbjct  356   PMLIFQDGSRDVSALKNDNSTGGIKKIQVLDLSHNSFSGEIGDG-LGDLRDLEGLHLSRN  414

Query  816   SFEGPIPSSLSKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIG  992
             S  GPIPS++ +   L  L+LS+N+ +G  PR +GG   L  LR   + NN L+G++P  
Sbjct  415   SLTGPIPSTIGELKHLVVLDLSHNQLNGTIPRETGGAVSLEELR---LDNNLLAGNIPPS  471

Query  993   ASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
                   L+ L L  N   G IP +L     L  +D+S N  TGT+P+ L
Sbjct  472   IKNCSPLRSLILSHNKLLGSIPPELAKLTKLEEVDISFNELTGTLPKQL  520


 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 94/167 (56%), Gaps = 3/167 (2%)
 Frame = +3

Query  561   LEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGN  740
             ++ + VL L+ N+FSG I   LG L +L+ L+LS+NS++G +P ++G +  L  LDLS N
Sbjct  379   IKKIQVLDLSHNSFSGEIGDGLGDLRDLEGLHLSRNSLTGPIPSTIGELKHLVVLDLSHN  438

Query  741   SLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGG  920
              L+G +       + SL  L L  +   G IP S+  C+ L  L LS+N+  G       
Sbjct  439   QLNGTIPRETGGAV-SLEELRLDNNLLAGNIPPSIKNCSPLRSLILSHNKLLGS--IPPE  495

Query  921   IWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             +  LT+L  +D+S NEL+G+LP   + L  L   ++  NH  GE+P 
Sbjct  496   LAKLTKLEEVDISFNELTGTLPKQLANLGYLHTFNMSHNHLFGELPA  542



>ref|XP_004514781.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=946

 Score =   197 bits (500),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 107/267 (40%), Positives = 161/267 (60%), Gaps = 26/267 (10%)
 Frame = +3

Query  345   AESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  524
             +++   N+D+LGLIVFK+G++DP + L+TW+EDD SPC W+ VKC P+  RVS + L G 
Sbjct  23    SQNQPFNEDMLGLIVFKAGLEDPKNKLSTWNEDDYSPCNWDGVKCDPSTNRVSSLILDGF  82

Query  525   GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  704
              L G I RGL +L+ L +LSL+ NNF+G                        T+ + L  
Sbjct  83    SLYGHINRGLMRLQFLQILSLSRNNFTG------------------------TIKNDLLT  118

Query  705   MSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSN  884
             + +L+ +DLS N+L G + D   +   SLR LS + ++  G IP SL+ C  L  LN S+
Sbjct  119   LWNLKVVDLSENNLFGTIPDGFFQQCWSLRVLSFSKNNLTGKIPDSLTSCFSLATLNFSS  178

Query  885   NRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVD  1064
             N+  G+  +  G+W L  L++LD+SNN + G++P G   L++L+EL +G N F+G+IP  
Sbjct  179   NQLCGELPY--GMWFLRELQSLDLSNNLIKGNIPEGFQNLYDLRELRVGKNLFTGKIPES  236

Query  1065  LGLCPHLSRLDLSENLFTGTIPESLQR  1145
             +G C  L  +D S+N  +G  PES+QR
Sbjct  237   VGNCLLLKLIDFSDNFLSGKFPESIQR  263


 Score = 95.1 bits (235),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 78/211 (37%), Positives = 113/211 (54%), Gaps = 4/211 (2%)
 Frame = +3

Query  513   LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPD  692
             L G   +G I   + +L +L +L L+ N FSG I   +G L +L  LNLS+N I+G +P+
Sbjct  272   LQGNSFTGGIPHWIGELINLEILDLSENRFSGWIPNSIGNLESLSRLNLSRNHITGNLPE  331

Query  693   SLGNMSSLQFLDLSGNSLSGPVSDSMLE--NLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             ++ N   L  LD+S N L G +S  +    N   L+ L L+ ++F G IP  +   + L 
Sbjct  332   TMVNCIKLLSLDVSHNHLKGIISSWLFRIGNYYGLQVLDLSSNAFFGQIPFGIGGLSSLQ  391

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
              LNLS N   G    S  +  L  L  LD+S+NEL+GS+P     + +L EL L  N   
Sbjct  392   TLNLSTNNIYGFIPVS--VRELKSLYILDLSHNELNGSIPDEIEGVISLTELRLQRNFLG  449

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             G IPV +  C  L  L+L+ N   G+IP S+
Sbjct  450   GRIPVQIAKCSALRSLNLAHNKLNGSIPASI  480


 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 97/164 (59%), Gaps = 3/164 (2%)
 Frame = +3

Query  570   LNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLS  749
             L VL L+SN F G I   +G L++LQTLNLS N+I G +P S+  + SL  LDLS N L+
Sbjct  366   LQVLDLSSNAFFGQIPFGIGGLSSLQTLNLSTNNIYGFIPVSVRELKSLYILDLSHNELN  425

Query  750   GPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWG  929
             G + D  +E + SL  L L  +   G IP  ++KC+ L  LNL++N+ +G       I  
Sbjct  426   GSIPDE-IEGVISLTELRLQRNFLGGRIPVQIAKCSALRSLNLAHNKLNGS--IPASIAE  482

Query  930   LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV  1061
             LT L+  D+S N+LSG+LP   + L  L   ++  NH  GE+PV
Sbjct  483   LTNLQYADLSYNKLSGTLPKELTNLTQLFSFNVSYNHLQGELPV  526


 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 79/254 (31%), Positives = 116/254 (46%), Gaps = 50/254 (20%)
 Frame = +3

Query  528   LSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNM  707
             L G++  G+  L  L  L L++N   G I      L +L+ L + KN  +G +P+S+GN 
Sbjct  181   LCGELPYGMWFLRELQSLDLSNNLIKGNIPEGFQNLYDLRELRVGKNLFTGKIPESVGNC  240

Query  708   SSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNN  887
               L+ +D S N LSG   +S ++ L S  FLSL G+SF G IP  + +   L  L+LS N
Sbjct  241   LLLKLIDFSDNFLSGKFPES-IQRLTSCTFLSLQGNSFTGGIPHWIGELINLEILDLSEN  299

Query  888   RFSG-DPRFSGGIWGLTRL-----------------------------------------  941
             RFSG  P   G +  L+RL                                         
Sbjct  300   RFSGWIPNSIGNLESLSRLNLSRNHITGNLPETMVNCIKLLSLDVSHNHLKGIISSWLFR  359

Query  942   -------RTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDL  1100
                    + LD+S+N   G +P G   L +L+ L+L +N+  G IPV +     L  LDL
Sbjct  360   IGNYYGLQVLDLSSNAFFGQIPFGIGGLSSLQTLNLSTNNIYGFIPVSVRELKSLYILDL  419

Query  1101  SENLFTGTIPESLQ  1142
             S N   G+IP+ ++
Sbjct  420   SHNELNGSIPDEIE  433



>ref|XP_009116341.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
Length=959

 Score =   196 bits (499),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 123/262 (47%), Positives = 161/262 (61%), Gaps = 25/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGL+ FKS ++DP   LA+W+EDD +PCAWN VKCHP   RV+E+ L G  LSG+
Sbjct  29    LNDDVLGLVAFKSDLRDPDQKLASWNEDDYTPCAWNGVKCHPRTNRVTELTLDGFSLSGR  88

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L+ LSL++NN +G ++P               N IS     SLG   SL+
Sbjct  89    IGRGLLQLQSLHKLSLSNNNLTGTVNP---------------NLIS-----SLG---SLK  125

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLSGN LSG + D      GSLR  S+A +   G IP S+  C+ L  LNLS+NRFSG
Sbjct  126   VVDLSGNGLSGSLPDGFFRQCGSLRVFSVAENKLTGKIPVSVGSCSSLASLNLSSNRFSG  185

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   GIW L  LR+LD+S NEL G L      L+NL+ + L  N  SG IP ++G C 
Sbjct  186   SMPL--GIWSLNTLRSLDLSRNELEGELGTKIGRLNNLRAIDLSRNRLSGPIPSEIGSCM  243

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLSEN  +G +P++ Q+
Sbjct  244   LLKSVDLSENSLSGNLPDTFQQ  265


 Score = 92.4 bits (228),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 79/241 (33%), Positives = 122/241 (51%), Gaps = 36/241 (15%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    L G++G  + +L +L  + L+ N  SG I  ++G    L++++LS+NS+SG +
Sbjct  200   LDLSRNELEGELGTKIGRLNNLRAIDLSRNRLSGPIPSEIGSCMLLKSVDLSENSLSGNL  259

Query  687   PDS------------------------LGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLR  794
             PD+                        +G M SL+ LDLS N  SG V  S + NL  L+
Sbjct  260   PDTFQQLSLCYYLNLGRNLLDGEVPKWIGEMRSLESLDLSMNKFSGEVPGS-IGNLLRLK  318

Query  795   FLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG--------DPRFSGGIWGLTRLRTL  950
              L+ +G+ F G +P S   C  L  L++S N  +G        D   +GG+    +++ L
Sbjct  319   VLNFSGNGFIGSLPDSTGNCISLMALDVSGNLLTGKLPVWLFQDGNSTGGV---KKIQVL  375

Query  951   DVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             D+S N  SG +  G   L +L+ L+L  N  +G IP  +G   HL  LDLS N   GT+P
Sbjct  376   DLSCNSFSGVIGAGFGGLRDLQGLNLSRNSLTGPIPSTIGDLKHLGVLDLSHNQLNGTVP  435

Query  1131  E  1133
             +
Sbjct  436   K  436


 Score = 86.3 bits (212),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 108/192 (56%), Gaps = 10/192 (5%)
 Frame = +3

Query  507   VDLHGLGLSGKI-------GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSK  665
             +D+ G  L+GK+       G     ++ + VL L+ N+FSGVI    G L +LQ LNLS+
Sbjct  344   LDVSGNLLTGKLPVWLFQDGNSTGGVKKIQVLDLSCNSFSGVIGAGFGGLRDLQGLNLSR  403

Query  666   NSISGTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSL  845
             NS++G +P ++G++  L  LDLS N L+G V       + SL  L L  +  EG IPSS+
Sbjct  404   NSLTGPIPSTIGDLKHLGVLDLSHNQLNGTVPKETGGAV-SLEELRLENNMLEGTIPSSI  462

Query  846   SKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELS  1025
               C+ L  L LS+N+  G       +  LT L+ +D+S N+L+G+LP   + L  L   +
Sbjct  463   KNCSSLQSLILSHNKLQG--AIPPEMARLTNLQEVDLSFNDLTGTLPKQLANLGYLHTFN  520

Query  1026  LGSNHFSGEIPV  1061
             +  NH SGE+P 
Sbjct  521   ISHNHLSGELPA  532


 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 74/219 (34%), Positives = 114/219 (52%), Gaps = 12/219 (5%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL     SG++   +  L  L VL+ + N F G +    G   +L  L++S N ++G +
Sbjct  296   LDLSMNKFSGEVPGSIGNLLRLKVLNFSGNGFIGSLPDSTGNCISLMALDVSGNLLTGKL  355

Query  687   P-------DSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSL  845
             P       +S G +  +Q LDLS NS SG V  +    L  L+ L+L+ +S  GPIPS++
Sbjct  356   PVWLFQDGNSTGGVKKIQVLDLSCNSFSG-VIGAGFGGLRDLQGLNLSRNSLTGPIPSTI  414

Query  846   SKCTLLNHLNLSNNRFSGD-PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKEL  1022
                  L  L+LS+N+ +G  P+ +GG   L  LR   + NN L G++P       +L+ L
Sbjct  415   GDLKHLGVLDLSHNQLNGTVPKETGGAVSLEELR---LENNMLEGTIPSSIKNCSSLQSL  471

Query  1023  SLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
              L  N   G IP ++    +L  +DLS N  TGT+P+ L
Sbjct  472   ILSHNKLQGAIPPEMARLTNLQEVDLSFNDLTGTLPKQL  510


 Score = 80.1 bits (196),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 110/222 (50%), Gaps = 10/222 (5%)
 Frame = +3

Query  498   VSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSIS  677
             +  VDL    LSG +    ++L     L+L  N   G +   +G + +L++L+LS N  S
Sbjct  245   LKSVDLSENSLSGNLPDTFQQLSLCYYLNLGRNLLDGEVPKWIGEMRSLESLDLSMNKFS  304

Query  678   GTVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIP-------  836
             G VP S+GN+  L+ L+ SGN   G + DS   N  SL  L ++G+   G +P       
Sbjct  305   GEVPGSIGNLLRLKVLNFSGNGFIGSLPDST-GNCISLMALDVSGNLLTGKLPVWLFQDG  363

Query  837   SSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLK  1016
             +S      +  L+LS N FSG      G  GL  L+ L++S N L+G +P     L +L 
Sbjct  364   NSTGGVKKIQVLDLSCNSFSG--VIGAGFGGLRDLQGLNLSRNSLTGPIPSTIGDLKHLG  421

Query  1017  ELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESLQ  1142
              L L  N  +G +P + G    L  L L  N+  GTIP S++
Sbjct  422   VLDLSHNQLNGTVPKETGGAVSLEELRLENNMLEGTIPSSIK  463



>ref|XP_010451924.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=953

 Score =   196 bits (498),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 110/262 (42%), Positives = 152/262 (58%), Gaps = 27/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
              NDDVLGLIVFK+G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG 
Sbjct  24    FNDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDAFSLSGH  83

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRGL +L+ L  L L++NN +G I+P                           ++ SLQ
Sbjct  84    IGRGLLRLQFLRALVLSNNNLTGTINP------------------------EFPHLGSLQ  119

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +D SGN LSG + +   E  GSL  +S A +   GP+P SL+ C+ L HLNLS+N  SG
Sbjct  120   VVDFSGNHLSGRIPEGFFEQCGSLSSVSFANNKLTGPLPLSLTYCSTLTHLNLSSNHLSG  179

Query  900   DPRFSGGIWG-LTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLC  1076
               R    IWG L  L++LD S+N L G +P G S L++L+ ++   N FSG++P D+G C
Sbjct  180   --RLPRDIWGSLKSLKSLDFSDNFLQGDIPDGLSALYDLRLINFSRNWFSGDLPSDMGRC  237

Query  1077  PHLSRLDLSENLFTGTIPESLQ  1142
               L  LD S+N  +G +P+S++
Sbjct  238   SSLKSLDFSDNYLSGNLPDSMK  259


 Score = 99.8 bits (247),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 82/222 (37%), Positives = 122/222 (55%), Gaps = 11/222 (5%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             + + L G  L+G I   +  +  L  L L+ NNFSG +   LG L  L+ LNLS N ++G
Sbjct  266   TSIRLRGNSLAGDIPDWIGDVASLETLDLSGNNFSGNVPFSLGNLEFLKELNLSSNMLAG  325

Query  681   TVPDSLGNMSSLQFLDLSGNSLSGPV---------SDSMLENLGSLRFLSLAGSSFEGPI  833
              +P ++ N S+L  +D+S NS +G V         S S++  L +LR L L+ +SF G +
Sbjct  326   ELPQTISNCSNLISIDVSKNSFTGDVLKWMFTQSSSLSIVAFLPALRVLDLSSNSFSGEL  385

Query  834   PSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNL  1013
             PS++   T L HLN+S N   G       I GL     LD+S+N L+G++P       +L
Sbjct  386   PSNIWILTSLVHLNISTNSLFGS--IPTAIGGLKAAEVLDLSSNLLNGTVPCEIGGAVSL  443

Query  1014  KELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             K+L+L  N  SG IP  +  C  L+ +DLS+N  +G IP S+
Sbjct  444   KQLNLQRNRLSGHIPPQISNCSALNAIDLSDNELSGVIPGSI  485


 Score = 83.6 bits (205),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 109/215 (51%), Gaps = 13/215 (6%)
 Frame = +3

Query  528   LSGKIGRGL-EKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGN  704
             LSG++ R +   L+ L  L  + N   G I   L  L +L+ +N S+N  SG +P  +G 
Sbjct  177   LSGRLPRDIWGSLKSLKSLDFSDNFLQGDIPDGLSALYDLRLINFSRNWFSGDLPSDMGR  236

Query  705   MSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSN  884
              SSL+ LD S N LSG + DSM     S   + L G+S  G IP  +     L  L+LS 
Sbjct  237   CSSLKSLDFSDNYLSGNLPDSMKTISSSCTSIRLRGNSLAGDIPDWIGDVASLETLDLSG  296

Query  885   NRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPV-  1061
             N FSG+  FS G   L  L+ L++S+N L+G LP   S   NL  + +  N F+G++   
Sbjct  297   NNFSGNVPFSLG--NLEFLKELNLSSNMLAGELPQTISNCSNLISIDVSKNSFTGDVLKW  354

Query  1062  ---------DLGLCPHLSRLDLSENLFTGTIPESL  1139
                       +   P L  LDLS N F+G +P ++
Sbjct  355   MFTQSSSLSIVAFLPALRVLDLSSNSFSGELPSNI  389



>dbj|BAK06250.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=973

 Score =   196 bits (498),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 120/261 (46%), Positives = 154/261 (59%), Gaps = 27/261 (10%)
 Frame = +3

Query  363   NDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  542
             NDDVLGLIVFK+ V DP   LATWSEDD+  CAW  + C P  GRVS ++L G GLSGK+
Sbjct  31    NDDVLGLIVFKADVVDPEGRLATWSEDDERACAWAGITCDPRTGRVSGLNLAGFGLSGKL  90

Query  543   GRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQF  722
             GRGL +LE L  LSL++NNFSG I P                         L  +  LQ 
Sbjct  91    GRGLLRLESLQSLSLSANNFSGDIPP------------------------DLARLPDLQS  126

Query  723   LDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGD  902
             LDLS N+ S P+ +       +LR +SLA ++F G  P  +  C  L  LNLS+NR +G 
Sbjct  127   LDLSCNAFSAPIPEGFFGKCHALRDVSLANNAFTGDTPD-VGACGTLASLNLSSNRLAG-  184

Query  903   PRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCPH  1082
                  GIW L  LRTLD+S N ++G LP+G S + NL+ L+L  N  +G +P D+G CP 
Sbjct  185   -MLPSGIWSLNALRTLDLSGNAITGELPVGISKMFNLRALNLRRNRLTGSLPDDIGDCPL  243

Query  1083  LSRLDLSENLFTGTIPESLQR  1145
             L  +DLS N  +G +PESL+R
Sbjct  244   LRSVDLSSNSLSGNLPESLRR  264


 Score = 96.3 bits (238),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 117/208 (56%), Gaps = 4/208 (2%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL G  ++G++  G+ K+ +L  L+L  N  +G +   +G    L++++LS NS+SG +
Sbjct  199   LDLSGNAITGELPVGISKMFNLRALNLRRNRLTGSLPDDIGDCPLLRSVDLSSNSLSGNL  258

Query  687   PDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLN  866
             P+SL  +S+   LDLS N L+G V  + +  + S+  L L+G+ F G IP S+     L 
Sbjct  259   PESLRRLSTCTDLDLSSNELTGNVP-TWVGEMVSMETLDLSGNKFSGEIPGSIGGLMSLR  317

Query  867   HLNLSNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFS  1046
              L LS N F+G       I G T L  +DVS N L+GSLP    F   ++ +S+  N FS
Sbjct  318   ELRLSGNGFTGG--LPESIGGCTSLVHVDVSWNSLTGSLPTWV-FASGVQWVSVSYNTFS  374

Query  1047  GEIPVDLGLCPHLSRLDLSENLFTGTIP  1130
             GE+ V +     +  LDLS N F+G IP
Sbjct  375   GEVMVPVNASSVIQGLDLSSNSFSGRIP  402


 Score = 88.6 bits (218),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 96/160 (60%), Gaps = 4/160 (3%)
 Frame = +3

Query  579   LSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQFLDLSGNSLSGPV  758
             L L+SN+FSG I  QL  L  LQ+LN+S NS+SG+VP S+  M SL+ LDLS N L+G +
Sbjct  390   LDLSSNSFSGRIPSQLSQLLTLQSLNMSWNSLSGSVPASIVEMKSLELLDLSANRLNGSI  449

Query  759   SDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSGDPRFSGGIWGLTR  938
               ++     S + LSLA +S  G IPS +  C+ L  L+LS+N  +G       I  LT 
Sbjct  450   PSTIGGK--SFKLLSLAKNSLTGEIPSQIGDCSALASLDLSHNGLTG--AIPAAIANLTN  505

Query  939   LRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
             L + D+S N+L+G LP   S L +L   ++  N  SG++P
Sbjct  506   LESADLSRNKLTGGLPKQLSNLAHLIRFNISHNQLSGDLP  545


 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 74/238 (31%), Positives = 123/238 (52%), Gaps = 31/238 (13%)
 Frame = +3

Query  501   SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISG  680
             +++DL    L+G +   + ++  +  L L+ N FSG I   +G L +L+ L LS N  +G
Sbjct  269   TDLDLSSNELTGNVPTWVGEMVSMETLDLSGNKFSGEIPGSIGGLMSLRELRLSGNGFTG  328

Query  681   TVPDSLGNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTL  860
              +P+S+G  +SL  +D+S NSL+G +   +  +   ++++S++ ++F G +   ++  ++
Sbjct  329   GLPESIGGCTSLVHVDVSWNSLTGSLPTWVFAS--GVQWVSVSYNTFSGEVMVPVNASSV  386

Query  861   LNHLNLSNNRFSG----------------------DPRFSGGIWGLTRLRTLDVSNNELS  974
             +  L+LS+N FSG                             I  +  L  LD+S N L+
Sbjct  387   IQGLDLSSNSFSGRIPSQLSQLLTLQSLNMSWNSLSGSVPASIVEMKSLELLDLSANRLN  446

Query  975   GSLPI---GASFLHNLKELSLGSNHFSGEIPVDLGLCPHLSRLDLSENLFTGTIPESL  1139
             GS+P    G SF    K LSL  N  +GEIP  +G C  L+ LDLS N  TG IP ++
Sbjct  447   GSIPSTIGGKSF----KLLSLAKNSLTGEIPSQIGDCSALASLDLSHNGLTGAIPAAI  500



>ref|XP_010412798.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1231

 Score =   196 bits (499),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 116/262 (44%), Positives = 164/262 (63%), Gaps = 25/262 (10%)
 Frame = +3

Query  360   LNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  539
             LNDDVLGLI+FK+ ++DP   LA+W+EDD +PC+W  VKCHP   RV+E+ L G  LSG+
Sbjct  28    LNDDVLGLILFKADLRDPEQKLASWNEDDYTPCSWTGVKCHPRTNRVTELTLDGFSLSGR  87

Query  540   IGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSLGNMSSLQ  719
             IGRG+ +L+ L+ LSL++NN +G+I+                       P+ L ++ +L+
Sbjct  88    IGRGILQLQFLHKLSLSNNNLTGIIN-----------------------PNFLLSLVNLK  124

Query  720   FLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNLSNNRFSG  899
              +DLS N+LSG + D   +  GSLR LSLA +   G IP S+S C+ L  LNLS+NRFSG
Sbjct  125   VVDLSSNALSGSLPDEFFKQCGSLRVLSLAKNKLTGKIPVSISSCSSLASLNLSSNRFSG  184

Query  900   DPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIPVDLGLCP  1079
                   G+W L  LR+LD+S NEL G  P+    L+NL+ L L  N  SG IP ++G C 
Sbjct  185   S--MPSGVWSLNTLRSLDLSRNELEGEFPVKIDRLNNLRSLDLSRNMLSGPIPSEIGSCM  242

Query  1080  HLSRLDLSENLFTGTIPESLQR  1145
              L  +DLS+N  +G++P + Q+
Sbjct  243   LLKTIDLSDNSLSGSLPVTFQQ  264


 Score =   176 bits (447),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 111/269 (41%), Positives = 159/269 (59%), Gaps = 27/269 (10%)
 Frame = +3

Query  339   GGAESLQLNDDVLGLIVFKSGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  518
             G   SL+  D  L +  F   ++DP   LA+W+EDD +PC+W  VKCHP   RV+E+ L 
Sbjct  287   GEMRSLETLD--LSMNKFSGQLRDPEQKLASWNEDDYTPCSWTGVKCHPRTNRVTELTLD  344

Query  519   GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTVPDSL  698
             G  LSG+IGRG+ +L+ L+ LSL++NN +G+I+P                       + L
Sbjct  345   GFSLSGRIGRGILQLQFLHKLSLSNNNLTGIINP-----------------------NFL  381

Query  699   GNMSSLQFLDLSGNSLSGPVSDSMLENLGSLRFLSLAGSSFEGPIPSSLSKCTLLNHLNL  878
              ++ +L+ +DLS N+LSG + D   +  GSLR LSLA +   G IP S+S C+ L  LNL
Sbjct  382   LSLVNLKVVDLSSNALSGSLPDGFFKQCGSLRVLSLAKNKLTGKIPVSISSCSSLASLNL  441

Query  879   SNNRFSGDPRFSGGIWGLTRLRTLDVSNNELSGSLPIGASFLHNLKELSLGSNHFSGEIP  1058
             S+NRFSG      G+W L  LR+LD+S NEL G  P+    L+NL+ L L  N  SG IP
Sbjct  442   SSNRFSGS--MPSGVWSLNTLRSLDLSRNELEGEFPVKIDRLNNLRSLDLSRNMLSGPIP  499

Query  1059  VDLGLCPHLSRLDLSENLFTGTIPESLQR  1145
              ++G C  L  +DLS+N  +G++P + Q+
Sbjct  500   SEIGSCMLLKTIDLSDNSLSGSLPVTFQQ  528


 Score = 92.0 bits (227),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 113/224 (50%), Gaps = 16/224 (7%)
 Frame = +3

Query  507   VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPqlglltnlqtlnlSKNSISGTV  686
             +DL    LSG I   +     L  + L+ N+ SG +      L+   +LNL KN++ G V
Sbjct  487   LDLSRNMLSGPIPSEIGSCMLL