BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3408

Length=1060
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011080863.1|  PREDICTED: heat shock 70 kDa protein 14-like       546   0.0      Sesamum indicum [beniseed]
ref|XP_009610834.1|  PREDICTED: heat shock 70 kDa protein 15-like...    543   0.0      Nicotiana tomentosiformis
ref|XP_009624163.1|  PREDICTED: heat shock 70 kDa protein 15-like       540   0.0      Nicotiana tomentosiformis
ref|XP_009801414.1|  PREDICTED: heat shock 70 kDa protein 15-like       533   5e-180   Nicotiana sylvestris
ref|XP_009587742.1|  PREDICTED: heat shock 70 kDa protein 15-like       531   3e-179   Nicotiana tomentosiformis
emb|CDO98063.1|  unnamed protein product                                531   3e-179   Coffea canephora [robusta coffee]
ref|XP_006346577.1|  PREDICTED: heat shock 70 kDa protein 15-like...    531   5e-179   Solanum tuberosum [potatoes]
ref|XP_004252334.1|  PREDICTED: heat shock 70 kDa protein 15-like       527   1e-177   Solanum lycopersicum
ref|XP_002528199.1|  Heat shock 70 kDa protein, putative                525   1e-176   Ricinus communis
ref|XP_010254149.1|  PREDICTED: heat shock 70 kDa protein 15-like       525   1e-176   Nelumbo nucifera [Indian lotus]
ref|XP_011072334.1|  PREDICTED: heat shock 70 kDa protein 15-like       524   2e-176   Sesamum indicum [beniseed]
gb|EYU21549.1|  hypothetical protein MIMGU_mgv1a001311mg                522   9e-176   Erythranthe guttata [common monkey flower]
ref|XP_009794901.1|  PREDICTED: heat shock 70 kDa protein 15-like       505   1e-175   Nicotiana sylvestris
ref|XP_008228510.1|  PREDICTED: heat shock 70 kDa protein 15-like       521   2e-175   Prunus mume [ume]
ref|XP_010521527.1|  PREDICTED: heat shock 70 kDa protein 15            521   3e-175   Tarenaya hassleriana [spider flower]
ref|XP_007217050.1|  hypothetical protein PRUPE_ppa001317mg             520   1e-174   Prunus persica
ref|XP_010249783.1|  PREDICTED: heat shock 70 kDa protein 15-like       519   2e-174   Nelumbo nucifera [Indian lotus]
ref|XP_004252333.1|  PREDICTED: heat shock 70 kDa protein 15-like       517   8e-174   Solanum lycopersicum
ref|XP_010098045.1|  Heat shock 70 kDa protein 15                       516   3e-173   Morus notabilis
ref|XP_002887853.1|  hypothetical protein ARALYDRAFT_896005             510   3e-171   Arabidopsis lyrata subsp. lyrata
emb|CBI36157.3|  unnamed protein product                                509   3e-171   Vitis vinifera
ref|XP_006346576.1|  PREDICTED: heat shock 70 kDa protein 15-like       510   4e-171   Solanum tuberosum [potatoes]
gb|KDO51190.1|  hypothetical protein CISIN_1g003056mg                   506   5e-171   Citrus sinensis [apfelsine]
ref|NP_850984.4|  Heat shock protein 70                                 509   5e-171   
gb|AAL38353.1|  putative heat-shock protein                             509   5e-171   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031305.1|  heat shock protein 91                              508   5e-171   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008371663.1|  PREDICTED: heat shock 70 kDa protein 15-like       510   7e-171   
ref|XP_012073334.1|  PREDICTED: heat shock 70 kDa protein 15-like       509   7e-171   Jatropha curcas
ref|NP_178110.6|  Heat shock protein 70                                 509   9e-171   
ref|XP_009147592.1|  PREDICTED: heat shock 70 kDa protein 14            508   1e-170   Brassica rapa
ref|XP_002279789.2|  PREDICTED: heat shock 70 kDa protein 14-like       509   2e-170   Vitis vinifera
ref|XP_006842242.1|  PREDICTED: heat shock 70 kDa protein 14            509   2e-170   Amborella trichopoda
ref|XP_009358190.1|  PREDICTED: heat shock 70 kDa protein 15-like       509   2e-170   Pyrus x bretschneideri [bai li]
ref|NP_178111.1|  heat shock protein 91                                 508   2e-170   Arabidopsis thaliana [mouse-ear cress]
gb|EYU24688.1|  hypothetical protein MIMGU_mgv1a001324mg                508   3e-170   Erythranthe guttata [common monkey flower]
emb|CDY24089.1|  BnaA06g00870D                                          507   9e-170   Brassica napus [oilseed rape]
ref|XP_009358191.1|  PREDICTED: heat shock 70 kDa protein 15-like       507   1e-169   Pyrus x bretschneideri [bai li]
ref|XP_006427039.1|  hypothetical protein CICLE_v10024883mg             507   1e-169   Citrus clementina [clementine]
ref|XP_006392781.1|  hypothetical protein EUTSA_v10011242mg             506   1e-169   Eutrema salsugineum [saltwater cress]
gb|KDO51189.1|  hypothetical protein CISIN_1g003056mg                   507   1e-169   Citrus sinensis [apfelsine]
ref|XP_006465548.1|  PREDICTED: heat shock 70 kDa protein 14-like       506   2e-169   Citrus sinensis [apfelsine]
emb|CAA94389.1|  heat-shock protein                                     506   2e-169   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010473008.1|  PREDICTED: heat shock 70 kDa protein 15-like       503   2e-168   Camelina sativa [gold-of-pleasure]
ref|XP_010539495.1|  PREDICTED: heat shock 70 kDa protein 15-like       504   2e-168   Tarenaya hassleriana [spider flower]
ref|XP_010430044.1|  PREDICTED: heat shock 70 kDa protein 15            503   3e-168   
ref|XP_006300740.1|  hypothetical protein CARUB_v10019803mg             501   6e-168   Capsella rubella
ref|XP_008362708.1|  PREDICTED: heat shock 70 kDa protein 15-like       502   6e-168   
ref|XP_010538015.1|  PREDICTED: heat shock 70 kDa protein 14            501   8e-168   Tarenaya hassleriana [spider flower]
ref|XP_010430043.1|  PREDICTED: heat shock 70 kDa protein 15-like       500   2e-167   Camelina sativa [gold-of-pleasure]
ref|XP_010473009.1|  PREDICTED: heat shock 70 kDa protein 15-like       500   3e-167   Camelina sativa [gold-of-pleasure]
emb|CDY45119.1|  BnaC06g06400D                                          503   4e-167   Brassica napus [oilseed rape]
ref|XP_010417776.1|  PREDICTED: heat shock 70 kDa protein 15-like...    499   4e-167   Camelina sativa [gold-of-pleasure]
ref|XP_010417777.1|  PREDICTED: heat shock 70 kDa protein 15-like...    499   9e-167   Camelina sativa [gold-of-pleasure]
ref|XP_008354139.1|  PREDICTED: heat shock 70 kDa protein 15-like       498   1e-166   
ref|XP_006287070.1|  hypothetical protein CARUB_v10000229mg             498   2e-166   Capsella rubella
ref|XP_003546366.1|  PREDICTED: heat shock 70 kDa protein 14-like       496   2e-165   Glycine max [soybeans]
ref|XP_007024112.1|  Heat shock protein 91 isoform 1                    495   4e-165   
ref|XP_004302913.1|  PREDICTED: heat shock 70 kDa protein 15-like       494   5e-165   Fragaria vesca subsp. vesca
gb|KJB70511.1|  hypothetical protein B456_011G076800                    491   7e-165   Gossypium raimondii
ref|XP_010033884.1|  PREDICTED: heat shock 70 kDa protein 14-like       495   8e-165   Eucalyptus grandis [rose gum]
gb|AAG52244.1|AC011717_12  putative heat-shock protein; 41956-44878     490   2e-164   Arabidopsis thaliana [mouse-ear cress]
emb|CDX76065.1|  BnaA04g03290D                                          491   4e-164   
gb|KJB70509.1|  hypothetical protein B456_011G076800                    493   4e-164   Gossypium raimondii
ref|XP_002299641.1|  heat shock protein 70                              491   2e-163   Populus trichocarpa [western balsam poplar]
ref|XP_009139126.1|  PREDICTED: heat shock 70 kDa protein 15            489   3e-163   Brassica rapa
ref|XP_011013254.1|  PREDICTED: heat shock 70 kDa protein 15-like       489   1e-162   Populus euphratica
gb|KHG16619.1|  Heat shock 70 kDa 15 -like protein                      489   1e-162   Gossypium arboreum [tree cotton]
ref|XP_002304187.1|  heat shock protein 70                              488   2e-162   Populus trichocarpa [western balsam poplar]
ref|XP_010915054.1|  PREDICTED: heat shock 70 kDa protein 14-like       488   3e-162   Elaeis guineensis
ref|XP_010033879.1|  PREDICTED: heat shock 70 kDa protein 14-like       488   3e-162   Eucalyptus grandis [rose gum]
ref|XP_011000832.1|  PREDICTED: heat shock 70 kDa protein 14-like...    484   1e-161   Populus euphratica
ref|XP_007150665.1|  hypothetical protein PHAVU_005G171400g             486   1e-161   Phaseolus vulgaris [French bean]
ref|XP_008775317.1|  PREDICTED: heat shock 70 kDa protein 14-like       486   1e-161   Phoenix dactylifera
ref|XP_010925584.1|  PREDICTED: heat shock 70 kDa protein 14-like       485   2e-161   Elaeis guineensis
ref|XP_011000830.1|  PREDICTED: heat shock 70 kDa protein 15-like...    484   7e-161   Populus euphratica
ref|XP_008793460.1|  PREDICTED: heat shock 70 kDa protein 14-like       484   8e-161   Phoenix dactylifera
ref|XP_003529646.1|  PREDICTED: heat shock 70 kDa protein 15-like...    483   2e-160   
emb|CDY43337.1|  BnaC04g25190D                                          484   2e-160   Brassica napus [oilseed rape]
gb|KJB35056.1|  hypothetical protein B456_006G098500                    482   5e-160   Gossypium raimondii
gb|KHG16198.1|  Heat shock 70 kDa 15 -like protein                      481   1e-159   Gossypium arboreum [tree cotton]
ref|XP_009399777.1|  PREDICTED: heat shock 70 kDa protein 14-like       478   2e-158   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003531683.1|  PREDICTED: heat shock 70 kDa protein 14-like...    478   2e-158   Glycine max [soybeans]
ref|XP_003543647.1|  PREDICTED: heat shock 70 kDa protein 14-like       478   3e-158   Glycine max [soybeans]
gb|KHN47807.1|  Heat shock 70 kDa protein 14                            476   3e-158   Glycine soja [wild soybean]
ref|XP_008786326.1|  PREDICTED: heat shock 70 kDa protein 15-like       475   2e-157   Phoenix dactylifera
ref|XP_004141777.1|  PREDICTED: heat shock 70 kDa protein 15-like       474   3e-157   Cucumis sativus [cucumbers]
ref|XP_010691292.1|  PREDICTED: heat shock 70 kDa protein 15-like       474   6e-157   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010925328.1|  PREDICTED: heat shock 70 kDa protein 14-like       474   6e-157   Elaeis guineensis
ref|XP_006585595.1|  PREDICTED: heat shock 70 kDa protein 14-like...    473   1e-156   Glycine max [soybeans]
ref|XP_008462146.1|  PREDICTED: heat shock 70 kDa protein 15-like       473   1e-156   Cucumis melo [Oriental melon]
gb|KHN32604.1|  Heat shock 70 kDa protein 14                            473   2e-156   Glycine soja [wild soybean]
ref|XP_004506857.1|  PREDICTED: heat shock 70 kDa protein 15-like       473   2e-156   Cicer arietinum [garbanzo]
ref|XP_009389931.1|  PREDICTED: heat shock 70 kDa protein 14-like       471   1e-155   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007135698.1|  hypothetical protein PHAVU_010G150800g             469   3e-155   Phaseolus vulgaris [French bean]
ref|XP_004506856.1|  PREDICTED: heat shock 70 kDa protein 15-like       469   4e-155   Cicer arietinum [garbanzo]
ref|XP_009408938.1|  PREDICTED: heat shock 70 kDa protein 15-like       467   3e-154   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH28782.1|  heat shock 70 kDa protein                               467   4e-154   Medicago truncatula
gb|KDO51188.1|  hypothetical protein CISIN_1g003056mg                   462   2e-152   Citrus sinensis [apfelsine]
gb|KFK42397.1|  hypothetical protein AALP_AA2G250600                    448   1e-151   Arabis alpina [alpine rockcress]
ref|XP_006643833.1|  PREDICTED: heat shock 70 kDa protein 14-like       458   6e-151   Oryza brachyantha
ref|XP_003597778.1|  97 kDa heat shock protein                          458   1e-150   Medicago truncatula
ref|XP_009388669.1|  PREDICTED: heat shock 70 kDa protein 14-like       452   2e-148   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001042210.1|  Os01g0180800                                       444   1e-145   
ref|XP_004960855.1|  PREDICTED: heat shock 70 kDa protein 15-like...    444   2e-145   Setaria italica
ref|XP_002440718.1|  hypothetical protein SORBIDRAFT_09g005570          441   2e-144   Sorghum bicolor [broomcorn]
emb|CCM07272.1|  Putative 97 kDa heat shock protein                     441   5e-144   Musa balbisiana [starchy banana]
ref|XP_004960853.1|  PREDICTED: heat shock 70 kDa protein 14-like...    436   3e-142   Setaria italica
ref|XP_004960852.1|  PREDICTED: heat shock 70 kDa protein 14-like...    436   6e-142   
ref|NP_001151579.1|  heat shock 70 kDa protein 4                        435   9e-142   Zea mays [maize]
gb|ACG43420.1|  heat shock 70 kDa protein 4                             435   9e-142   Zea mays [maize]
ref|XP_008655087.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    435   2e-141   Zea mays [maize]
ref|XP_010231644.1|  PREDICTED: heat shock 70 kDa protein 15-like       433   4e-141   Brachypodium distachyon [annual false brome]
gb|EMT31029.1|  Heat shock 70 kDa protein 4L                            432   6e-141   
dbj|BAJ90753.1|  predicted protein                                      431   2e-140   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008647466.1|  PREDICTED: uncharacterized protein LOC100217...    429   2e-139   
gb|EMS61926.1|  Heat shock 70 kDa protein 4L                            426   2e-138   Triticum urartu
gb|EMT09857.1|  Heat shock 70 kDa protein 4L                            426   7e-138   
ref|XP_008649434.1|  PREDICTED: heat shock 70 kDa protein 14-like       422   6e-137   Zea mays [maize]
ref|XP_010231645.1|  PREDICTED: heat shock 70 kDa protein 14-like       420   3e-136   
ref|XP_002439385.1|  hypothetical protein SORBIDRAFT_09g005580          418   2e-135   Sorghum bicolor [broomcorn]
gb|EMS52665.1|  Heat shock 70 kDa protein 4L                            426   1e-134   Triticum urartu
ref|XP_008654914.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    416   2e-134   
ref|NP_001147805.1|  heat shock 70 kDa protein 4                        415   2e-134   Zea mays [maize]
gb|AFW77408.1|  hypothetical protein ZEAMMB73_835876                    421   3e-133   
gb|EAY72790.1|  hypothetical protein OsI_00654                          395   6e-127   Oryza sativa Indica Group [Indian rice]
gb|EYU24689.1|  hypothetical protein MIMGU_mgv1a001324mg                381   3e-124   Erythranthe guttata [common monkey flower]
ref|XP_006654112.1|  PREDICTED: heat shock 70 kDa protein 15-like       379   3e-120   Oryza brachyantha
ref|XP_007024113.1|  Heat shock protein 91 isoform 2                    367   7e-119   
ref|NP_001054812.1|  Os05g0181000                                       374   2e-118   
gb|KJB35057.1|  hypothetical protein B456_006G098500                    366   1e-117   Gossypium raimondii
ref|XP_006389708.1|  hypothetical protein EUTSA_v100181451mg            363   3e-117   
ref|XP_002986462.1|  hypothetical protein SELMODRAFT_124091             368   7e-117   
ref|XP_008354138.1|  PREDICTED: heat shock 70 kDa protein 15-like       361   1e-116   
ref|XP_002978946.1|  hypothetical protein SELMODRAFT_109750             365   9e-116   
gb|EAY96776.1|  hypothetical protein OsI_18700                          367   2e-115   Oryza sativa Indica Group [Indian rice]
ref|XP_001755636.1|  predicted protein                                  352   7e-111   
gb|EPS59607.1|  hypothetical protein M569_15197                         337   9e-108   Genlisea aurea
ref|XP_001760080.1|  predicted protein                                  343   6e-107   
ref|NP_001137020.1|  uncharacterized protein LOC100217188               328   1e-104   
gb|AFA36608.1|  70 kDa heat shock protein                               321   1e-104   Lolium perenne [perennial ryegrass]
ref|XP_001764380.1|  predicted protein                                  333   4e-103   
gb|AFW81561.1|  hypothetical protein ZEAMMB73_352123                    315   2e-98    
ref|XP_012070816.1|  PREDICTED: heat shock 70 kDa protein 16            289   8e-87    Jatropha curcas
ref|XP_011628468.1|  PREDICTED: heat shock 70 kDa protein 16            284   7e-85    Amborella trichopoda
ref|XP_009372708.1|  PREDICTED: heat shock 70 kDa protein 16-like...    280   1e-83    Pyrus x bretschneideri [bai li]
ref|XP_009352433.1|  PREDICTED: heat shock 70 kDa protein 16-like       280   3e-83    Pyrus x bretschneideri [bai li]
ref|XP_009372707.1|  PREDICTED: heat shock 70 kDa protein 16-like...    280   3e-83    Pyrus x bretschneideri [bai li]
ref|XP_008226915.1|  PREDICTED: heat shock 70 kDa protein 16            278   1e-82    Prunus mume [ume]
ref|XP_002317001.1|  hypothetical protein POPTR_0011s14240g             278   1e-82    Populus trichocarpa [western balsam poplar]
ref|XP_011030786.1|  PREDICTED: heat shock 70 kDa protein 16-like...    277   2e-82    Populus euphratica
ref|XP_007213641.1|  hypothetical protein PRUPE_ppa001697mg             276   7e-82    Prunus persica
ref|XP_004294376.1|  PREDICTED: heat shock 70 kDa protein 16            276   9e-82    Fragaria vesca subsp. vesca
ref|XP_002522946.1|  Heat-shock protein 105 kDa, putative               275   2e-81    
ref|XP_007020850.1|  Heat shock protein 70 family protein               275   2e-81    
ref|XP_011030785.1|  PREDICTED: heat shock 70 kDa protein 16-like...    275   3e-81    Populus euphratica
ref|XP_010278704.1|  PREDICTED: heat shock 70 kDa protein 16            273   8e-81    Nelumbo nucifera [Indian lotus]
ref|XP_010931798.1|  PREDICTED: heat shock 70 kDa protein 16            273   1e-80    Elaeis guineensis
ref|XP_002278262.1|  PREDICTED: heat shock 70 kDa protein 16            270   2e-79    Vitis vinifera
ref|XP_007020851.1|  Heat shock protein 70 family protein               269   3e-79    
ref|XP_008806738.1|  PREDICTED: heat shock 70 kDa protein 16 isof...    268   1e-78    Phoenix dactylifera
ref|XP_010092150.1|  Heat shock 70 kDa protein 16                       266   3e-78    
ref|XP_008806739.1|  PREDICTED: heat shock 70 kDa protein 16 isof...    266   6e-78    Phoenix dactylifera
emb|CDP04389.1|  unnamed protein product                                265   9e-78    Coffea canephora [robusta coffee]
ref|XP_006475182.1|  PREDICTED: heat shock 70 kDa protein 16-like...    262   4e-77    
gb|AIL24130.1|  heat shock protein 2                                    247   1e-76    Tamarix hispida
ref|XP_008365284.1|  PREDICTED: heat shock 70 kDa protein 16            260   1e-76    
ref|XP_006452327.1|  hypothetical protein CICLE_v10007538mg             262   1e-76    Citrus clementina [clementine]
gb|KCW67010.1|  hypothetical protein EUGRSUZ_F00767                     261   2e-76    Eucalyptus grandis [rose gum]
gb|KCW67009.1|  hypothetical protein EUGRSUZ_F00767                     260   2e-76    Eucalyptus grandis [rose gum]
ref|XP_010060358.1|  PREDICTED: heat shock 70 kDa protein 16            261   4e-76    Eucalyptus grandis [rose gum]
ref|XP_008366399.1|  PREDICTED: heat shock 70 kDa protein 16-like       259   2e-75    
gb|KHG25442.1|  Heat shock 70 kDa 16 -like protein                      258   4e-75    Gossypium arboreum [tree cotton]
ref|XP_009352450.1|  PREDICTED: heat shock 70 kDa protein 16-like       256   1e-74    Pyrus x bretschneideri [bai li]
ref|XP_004151979.1|  PREDICTED: heat shock 70 kDa protein 16            256   2e-74    Cucumis sativus [cucumbers]
ref|XP_008465078.1|  PREDICTED: heat shock 70 kDa protein 16            254   9e-74    Cucumis melo [Oriental melon]
gb|KJB22068.1|  hypothetical protein B456_004G027900                    254   1e-73    Gossypium raimondii
ref|XP_003563414.2|  PREDICTED: heat shock 70 kDa protein 16            253   2e-73    Brachypodium distachyon [annual false brome]
ref|XP_009614255.1|  PREDICTED: heat shock 70 kDa protein 16            251   1e-72    Nicotiana tomentosiformis
gb|KHM99573.1|  Heat shock 70 kDa protein 16                            251   1e-72    Glycine soja [wild soybean]
gb|AII99889.1|  heat shock protein                                      251   1e-72    Cicer arietinum [garbanzo]
ref|XP_003532123.1|  PREDICTED: heat shock 70 kDa protein 16-like       251   1e-72    Glycine max [soybeans]
gb|KDO75458.1|  hypothetical protein CISIN_1g004211mg                   249   2e-72    Citrus sinensis [apfelsine]
ref|XP_004491392.1|  PREDICTED: heat shock 70 kDa protein 16-like       251   2e-72    Cicer arietinum [garbanzo]
ref|XP_006468028.1|  PREDICTED: heat shock 70 kDa protein 16-like       250   3e-72    Citrus sinensis [apfelsine]
ref|XP_006449032.1|  hypothetical protein CICLE_v10014383mg             247   5e-72    
ref|XP_006417329.1|  hypothetical protein EUTSA_v10006883mg             249   6e-72    Eutrema salsugineum [saltwater cress]
emb|CDY49794.1|  BnaCnng18070D                                          249   9e-72    Brassica napus [oilseed rape]
ref|XP_004966217.1|  PREDICTED: heat shock 70 kDa protein 16-like       248   1e-71    
ref|XP_006595737.1|  PREDICTED: heat shock 70 kDa protein 16-like...    248   1e-71    Glycine max [soybeans]
ref|XP_006449031.1|  hypothetical protein CICLE_v10014383mg             247   3e-71    
ref|XP_009760615.1|  PREDICTED: heat shock 70 kDa protein 16            247   4e-71    Nicotiana sylvestris
ref|XP_003553093.1|  PREDICTED: heat shock 70 kDa protein 16-like       247   4e-71    Glycine max [soybeans]
emb|CAN63915.1|  hypothetical protein VITISV_004852                     248   6e-71    Vitis vinifera
ref|XP_010476099.1|  PREDICTED: heat shock 70 kDa protein 16            247   6e-71    Camelina sativa [gold-of-pleasure]
ref|XP_009420545.1|  PREDICTED: heat shock 70 kDa protein 16            247   6e-71    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007146461.1|  hypothetical protein PHAVU_006G042400g             246   7e-71    Phaseolus vulgaris [French bean]
ref|XP_010533816.1|  PREDICTED: heat shock 70 kDa protein 16            246   1e-70    Tarenaya hassleriana [spider flower]
ref|XP_010458573.1|  PREDICTED: heat shock 70 kDa protein 16-like       246   1e-70    Camelina sativa [gold-of-pleasure]
gb|KHN45217.1|  Heat shock 70 kDa protein 16                            246   1e-70    Glycine soja [wild soybean]
ref|XP_006348107.1|  PREDICTED: heat shock 70 kDa protein 16-like...    245   2e-70    Solanum tuberosum [potatoes]
gb|EYU27798.1|  hypothetical protein MIMGU_mgv1a001740mg                244   3e-70    Erythranthe guttata [common monkey flower]
ref|XP_002889885.1|  hypothetical protein ARALYDRAFT_888478             245   3e-70    
gb|EYU27799.1|  hypothetical protein MIMGU_mgv1a001740mg                244   4e-70    Erythranthe guttata [common monkey flower]
ref|XP_008648938.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    245   4e-70    
ref|XP_011096072.1|  PREDICTED: heat shock 70 kDa protein 16            243   8e-70    Sesamum indicum [beniseed]
ref|NP_172631.2|  heat shock protein 70 (Hsp 70) family protein         243   1e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004232717.1|  PREDICTED: heat shock 70 kDa protein 16            243   1e-69    Solanum lycopersicum
ref|XP_008644888.1|  PREDICTED: heat shock 70 kDa protein 16 isof...    242   2e-69    Zea mays [maize]
ref|XP_006657253.1|  PREDICTED: heat shock 70 kDa protein 16-like       242   2e-69    Oryza brachyantha
ref|XP_006306833.1|  hypothetical protein CARUB_v10008380mg             242   3e-69    
gb|AET00484.2|  heat shock 70 kDa protein                               242   5e-69    Medicago truncatula
ref|XP_006306834.1|  hypothetical protein CARUB_v10008380mg             241   6e-69    Capsella rubella
ref|XP_007142281.1|  hypothetical protein PHAVU_008G267400g             236   8e-69    Phaseolus vulgaris [French bean]
dbj|BAD45483.1|  putative heat-shock protein                            241   9e-69    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010493114.1|  PREDICTED: heat shock 70 kDa protein 16-like       239   3e-68    Camelina sativa [gold-of-pleasure]
gb|KJB69295.1|  hypothetical protein B456_011G014900                    239   3e-68    Gossypium raimondii
ref|XP_002305580.2|  hypothetical protein POPTR_0004s01640g             239   5e-68    
dbj|BAK01312.1|  predicted protein                                      238   7e-68    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002969191.1|  hypothetical protein SELMODRAFT_440676             238   1e-67    
ref|XP_007142282.1|  hypothetical protein PHAVU_008G267400g             237   3e-67    Phaseolus vulgaris [French bean]
ref|XP_003617525.1|  97 kDa heat shock protein                          237   4e-67    
ref|XP_011037663.1|  PREDICTED: heat shock 70 kDa protein 16            236   5e-67    Populus euphratica
ref|XP_002973871.1|  hypothetical protein SELMODRAFT_267697             234   3e-66    
ref|XP_004500055.1|  PREDICTED: heat shock 70 kDa protein 16-like       231   2e-65    Cicer arietinum [garbanzo]
gb|AII99893.1|  heat shock protein                                      231   4e-65    Cicer arietinum [garbanzo]
ref|XP_009610837.1|  PREDICTED: heat shock 70 kDa protein 14-like...    229   1e-64    Nicotiana tomentosiformis
ref|XP_010665569.1|  PREDICTED: heat shock 70 kDa protein 16            227   1e-63    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002949519.1|  heat shock protein Hsp70E                          223   4e-62    Volvox carteri f. nagariensis
ref|XP_008644889.1|  PREDICTED: heat shock 70 kDa protein 16 isof...    222   6e-62    Zea mays [maize]
emb|CEF99759.1|  Heat shock protein 70 family                           221   1e-61    Ostreococcus tauri
gb|ERN19664.1|  hypothetical protein AMTR_s00062p00170870               217   2e-61    Amborella trichopoda
gb|EPS74057.1|  hypothetical protein M569_00693                         219   6e-61    Genlisea aurea
ref|XP_003600064.1|  Heat shock 70 kDa protein 4L                       219   1e-60    Medicago truncatula
ref|XP_002505210.1|  heat shock protein 70                              211   1e-57    Micromonas commoda
emb|CDX97975.1|  BnaA06g07260D                                          210   1e-57    
ref|XP_009148495.1|  PREDICTED: heat shock 70 kDa protein 16            210   2e-57    Brassica rapa
gb|AAH65970.1|  Heat shock protein 4                                    202   1e-54    Danio rerio [leopard danio]
ref|NP_956151.1|  heat shock protein 4b                                 202   1e-54    Danio rerio [leopard danio]
ref|XP_004073389.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    200   6e-54    Oryzias latipes [Japanese rice fish]
ref|XP_011478585.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    200   7e-54    Oryzias latipes [Japanese rice fish]
ref|XP_004076160.1|  PREDICTED: heat shock 70 kDa protein 4-like        199   1e-53    
ref|XP_005642775.1|  heat shock protein 70E                             199   1e-53    Coccomyxa subellipsoidea C-169
ref|NP_989252.1|  heat shock 70kDa protein 4                            199   2e-53    Xenopus tropicalis [western clawed frog]
ref|XP_005795394.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    197   5e-53    Xiphophorus maculatus
ref|XP_007548463.1|  PREDICTED: heat shock 70 kDa protein 4             196   2e-52    Poecilia formosa
ref|XP_005795395.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    195   3e-52    
ref|XP_006595736.1|  PREDICTED: heat shock 70 kDa protein 16-like...    194   5e-52    Glycine max [soybeans]
ref|XP_007258636.1|  PREDICTED: heat shock 70 kDa protein 4-like        194   6e-52    
ref|XP_008418275.1|  PREDICTED: heat shock 70 kDa protein 4             194   1e-51    Poecilia reticulata
ref|XP_001597692.1|  hypothetical protein SS1G_01888                    192   2e-51    Sclerotinia sclerotiorum 1980 UF-70
ref|XP_006872974.1|  PREDICTED: heat shock 70 kDa protein 4             192   2e-51    Chrysochloris asiatica
ref|XP_007941940.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    192   3e-51    Orycteropus afer afer
ref|XP_003390556.1|  PREDICTED: heat shock 70 kDa protein 4-like        192   3e-51    Amphimedon queenslandica
ref|XP_006781602.1|  PREDICTED: heat shock 70 kDa protein 4-like        192   3e-51    Neolamprologus brichardi [lyretail cichlid]
ref|XP_002119191.1|  PREDICTED: heat shock 70 kDa protein 4L            192   4e-51    Ciona intestinalis [sea vase]
ref|NP_001083317.1|  heat shock 70kDa protein 4                         192   4e-51    Xenopus laevis [clawed frog]
ref|XP_005921284.1|  PREDICTED: heat shock 70 kDa protein 4-like        192   4e-51    Haplochromis burtoni
ref|XP_002790451.1|  heat shock protein Hsp88                           191   4e-51    Paracoccidioides lutzii Pb01
ref|XP_005719833.1|  PREDICTED: heat shock 70 kDa protein 4-like        192   4e-51    Pundamilia nyererei
ref|XP_006631870.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    192   5e-51    
gb|EEH17811.2|  hypothetical protein PABG_00374                         191   6e-51    Paracoccidioides brasiliensis Pb03
ref|XP_006631871.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    192   6e-51    Lepisosteus oculatus
ref|XP_005022582.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    191   7e-51    
ref|XP_010758132.1|  hypothetical protein PADG_02785                    191   7e-51    Paracoccidioides brasiliensis Pb18
ref|XP_002800758.1|  PREDICTED: heat shock protein 105 kDa-like i...    191   7e-51    
ref|XP_005585648.1|  PREDICTED: heat shock protein 105 kDa isofor...    191   8e-51    Macaca fascicularis [crab eating macaque]
ref|XP_002800756.1|  PREDICTED: heat shock protein 105 kDa-like i...    191   9e-51    
gb|EHH58512.1|  hypothetical protein EGM_08381                          191   9e-51    Macaca fascicularis [crab eating macaque]
gb|EHH28932.1|  hypothetical protein EGK_09220                          191   9e-51    Macaca mulatta [rhesus macaque]
gb|EOA99140.1|  Heat shock 70 kDa protein 4                             191   1e-50    Anas platyrhynchos [duck]
ref|XP_002800757.1|  PREDICTED: heat shock protein 105 kDa-like i...    191   1e-50    
ref|XP_005022581.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    191   1e-50    
ref|XP_010172479.1|  PREDICTED: heat shock 70 kDa protein 4             190   1e-50    
ref|XP_008493678.1|  PREDICTED: heat shock 70 kDa protein 4             190   1e-50    Calypte anna
ref|XP_009696800.1|  PREDICTED: heat shock 70 kDa protein 4             190   1e-50    Cariama cristata
ref|XP_011746917.1|  PREDICTED: heat shock protein 105 kDa isofor...    191   1e-50    Macaca nemestrina [pigtail macaque]
ref|XP_011746918.1|  PREDICTED: heat shock protein 105 kDa isofor...    191   1e-50    Macaca nemestrina [pigtail macaque]
ref|XP_005467885.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    191   1e-50    Oreochromis niloticus
gb|KFZ64341.1|  Heat shock 70 kDa protein 4                             191   1e-50    Antrostomus carolinensis
ref|XP_007941939.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    191   1e-50    
gb|KFP57786.1|  Heat shock 70 kDa protein 4                             190   1e-50    
ref|XP_010588220.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    190   2e-50    
ref|XP_003455212.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    190   2e-50    
gb|KFP02118.1|  Heat shock 70 kDa protein 4                             190   2e-50    
ref|XP_003405063.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    190   2e-50    
ref|XP_004541000.1|  PREDICTED: heat shock 70 kDa protein 4-like        190   2e-50    
ref|XP_004321099.1|  PREDICTED: heat shock protein 105 kDa-like i...    190   2e-50    
ref|XP_008590210.1|  PREDICTED: heat shock protein 105 kDa              189   3e-50    
ref|XP_008282581.1|  PREDICTED: heat shock 70 kDa protein 4             189   3e-50    
ref|XP_004384781.1|  PREDICTED: heat shock 70 kDa protein 4             189   3e-50    
ref|XP_011823233.1|  PREDICTED: heat shock protein 105 kDa isofor...    189   4e-50    
ref|XP_003913779.1|  PREDICTED: heat shock protein 105 kDa isofor...    189   5e-50    
ref|XP_007941941.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    189   5e-50    
ref|XP_007958257.1|  PREDICTED: heat shock protein 105 kDa isofor...    189   5e-50    
gb|KDN44571.1|  putative heat shock protein Hsp88                       189   5e-50    
ref|XP_011823229.1|  PREDICTED: heat shock protein 105 kDa isofor...    189   5e-50    
gb|KFV06465.1|  Heat shock 70 kDa protein 4                             188   5e-50    
ref|XP_007958255.1|  PREDICTED: heat shock protein 105 kDa isofor...    189   5e-50    
gb|KFA61575.1|  hypothetical protein S40285_03995                       188   6e-50    
ref|XP_004420257.1|  PREDICTED: heat shock 70 kDa protein 4             189   6e-50    
gb|KFP87183.1|  Heat shock 70 kDa protein 4                             188   6e-50    
gb|KFP46148.1|  Heat shock 70 kDa protein 4                             188   6e-50    
ref|XP_008331073.1|  PREDICTED: heat shock protein 105 kDa isofor...    188   7e-50    
ref|XP_009677183.1|  PREDICTED: heat shock 70 kDa protein 4             188   7e-50    
dbj|BAG63634.1|  unnamed protein product                                187   7e-50    
ref|XP_010192521.1|  PREDICTED: heat shock 70 kDa protein 4             187   7e-50    
ref|XP_010197025.1|  PREDICTED: heat shock 70 kDa protein 4             188   7e-50    
gb|KFP10115.1|  Heat shock 70 kDa protein 4                             188   7e-50    
ref|XP_011920030.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    189   7e-50    
ref|XP_005317131.1|  PREDICTED: heat shock protein 105 kDa isofor...    187   8e-50    
ref|XP_009999526.1|  PREDICTED: heat shock 70 kDa protein 4             187   9e-50    
dbj|BAD32191.1|  mKIAA0201 protein                                      186   9e-50    
ref|XP_004054390.1|  PREDICTED: heat shock protein 105 kDa isoform 4    188   9e-50    
ref|XP_010717537.1|  PREDICTED: heat shock 70 kDa protein 4             187   9e-50    
ref|XP_011533190.1|  PREDICTED: heat shock protein 105 kDa isofor...    188   9e-50    
dbj|BAG57329.1|  unnamed protein product                                187   9e-50    
ref|NP_001273434.1|  heat shock protein 105 kDa isoform 4               187   1e-49    
ref|XP_004657122.1|  PREDICTED: heat shock 70 kDa protein 4L            187   1e-49    
ref|XP_011569422.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    187   1e-49    
ref|XP_009564490.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    187   1e-49    
ref|XP_008331072.1|  PREDICTED: heat shock protein 105 kDa isofor...    188   1e-49    
ref|XP_005317129.1|  PREDICTED: heat shock protein 105 kDa isofor...    188   1e-49    
ref|XP_006189652.1|  PREDICTED: heat shock protein 105 kDa isofor...    187   1e-49    
ref|XP_009645410.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    188   1e-49    
gb|KFQ96406.1|  Heat shock 70 kDa protein 4                             188   1e-49    
gb|KFP24986.1|  Heat shock 70 kDa protein 4                             187   1e-49    
ref|XP_011533189.1|  PREDICTED: heat shock protein 105 kDa isofor...    188   1e-49    
gb|KFV73528.1|  Heat shock 70 kDa protein 4                             187   1e-49    
gb|KFQ73484.1|  Heat shock 70 kDa protein 4                             187   1e-49    
ref|XP_001362128.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    187   1e-49    
ref|XP_009807225.1|  PREDICTED: heat shock 70 kDa protein 4             187   1e-49    
ref|XP_008536519.1|  PREDICTED: heat shock 70 kDa protein 4             187   1e-49    
gb|EAX08482.1|  heat shock 105kDa/110kDa protein 1, isoform CRA_d       187   1e-49    
ref|XP_006209038.1|  PREDICTED: heat shock protein 105 kDa isofor...    187   1e-49    
ref|XP_414655.2|  PREDICTED: heat shock 70 kDa protein 4 isoformX2      187   1e-49    
ref|XP_009871602.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    187   1e-49    
ref|XP_009961534.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    187   1e-49    
ref|XP_009462626.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    187   1e-49    
ref|NP_001126639.1|  heat shock protein 105 kDa                         188   1e-49    
ref|XP_004054389.1|  PREDICTED: heat shock protein 105 kDa isoform 3    188   1e-49    
ref|XP_010753054.1|  PREDICTED: heat shock 70 kDa protein 4             187   1e-49    
ref|XP_010577107.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    187   1e-49    
gb|KFU92311.1|  Heat shock 70 kDa protein 4                             187   1e-49    
ref|XP_007495546.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    187   2e-49    
ref|XP_001918259.1|  PREDICTED: heat shock 70 kDa protein 4             187   2e-49    
dbj|BAE38016.1|  unnamed protein product                                187   2e-49    
ref|NP_001273433.1|  heat shock protein 105 kDa isoform 3               187   2e-49    
ref|XP_004285543.1|  PREDICTED: heat shock protein 105 kDa isoform 2    187   2e-49    
ref|XP_009284223.1|  PREDICTED: heat shock 70 kDa protein 4             187   2e-49    
ref|NP_006635.2|  heat shock protein 105 kDa isoform 1                  187   2e-49    
gb|KFQ04337.1|  Heat shock 70 kDa protein 4                             187   2e-49    
gb|AAC18044.1|  antigen NY-CO-25                                        187   2e-49    
ref|XP_008950457.1|  PREDICTED: heat shock protein 105 kDa isofor...    187   2e-49    
ref|XP_011569420.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    187   2e-49    
ref|XP_009089806.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    187   2e-49    
ref|XP_006209037.1|  PREDICTED: heat shock protein 105 kDa isofor...    187   2e-49    
ref|XP_004321098.1|  PREDICTED: heat shock protein 105 kDa-like i...    187   2e-49    
ref|XP_007428681.1|  PREDICTED: heat shock 70 kDa protein 4-like        187   2e-49    
ref|XP_006189651.1|  PREDICTED: heat shock protein 105 kDa isofor...    187   2e-49    
ref|XP_009959027.1|  PREDICTED: heat shock 70 kDa protein 4             187   2e-49    
ref|XP_011569419.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    187   2e-49    
ref|XP_010365378.1|  PREDICTED: heat shock protein 105 kDa isofor...    187   2e-49    
gb|KFV41558.1|  Heat shock 70 kDa protein 4                             187   2e-49    
gb|KFA49562.1|  hypothetical protein S40293_02868                       186   2e-49    
gb|KEY70870.1|  hypothetical protein S7711_00716                        186   2e-49    
gb|KFM12115.1|  Heat shock 70 kDa protein 4                             187   2e-49    
ref|XP_009089808.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    187   2e-49    
ref|XP_004406698.1|  PREDICTED: heat shock protein 105 kDa isoform 3    186   2e-49    
ref|XP_006023612.1|  PREDICTED: heat shock 70 kDa protein 4             187   2e-49    
ref|XP_006209035.1|  PREDICTED: heat shock protein 105 kDa isofor...    187   2e-49    
ref|XP_004321097.1|  PREDICTED: heat shock protein 105 kDa-like i...    187   2e-49    
ref|XP_010196950.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    186   2e-49    
ref|XP_010141782.1|  PREDICTED: heat shock 70 kDa protein 4             186   2e-49    
ref|XP_005302898.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    187   2e-49    
ref|XP_005302899.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    187   2e-49    
gb|KFO70037.1|  Heat shock 70 kDa protein 4                             187   3e-49    
ref|XP_010577102.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    187   3e-49    
ref|XP_010086248.1|  PREDICTED: heat shock 70 kDa protein 4             187   3e-49    
ref|XP_010577101.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    187   3e-49    
ref|XP_010365375.1|  PREDICTED: heat shock protein 105 kDa isofor...    187   3e-49    
ref|XP_006504978.1|  PREDICTED: heat shock protein 105 kDa isofor...    186   3e-49    
ref|XP_005493118.1|  PREDICTED: heat shock 70 kDa protein 4             187   3e-49    
ref|XP_009089807.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    187   3e-49    
gb|KFU97482.1|  Heat shock 70 kDa protein 4                             186   3e-49    
ref|XP_010949829.1|  PREDICTED: heat shock protein 105 kDa isofor...    187   3e-49    
ref|XP_009894254.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    187   3e-49    
ref|XP_007109658.1|  PREDICTED: heat shock protein 105 kDa isofor...    186   3e-49    
gb|KFO84045.1|  Heat shock 70 kDa protein 4                             186   3e-49    
ref|XP_010007215.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    186   3e-49    
ref|XP_010365374.1|  PREDICTED: heat shock protein 105 kDa isofor...    187   3e-49    
ref|XP_009560725.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    187   3e-49    
ref|XP_006888134.1|  PREDICTED: heat shock 70 kDa protein 4-like        186   3e-49    
ref|XP_001551499.1|  hypothetical protein BC1G_09769                    186   3e-49    
ref|XP_008943163.1|  PREDICTED: heat shock 70 kDa protein 4             186   4e-49    
dbj|BAA13192.2|  KIAA0201                                               187   4e-49    
ref|XP_009579841.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    186   4e-49    
ref|XP_010075291.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    186   4e-49    
gb|EOB04289.1|  Heat shock 70 kDa protein 4L                            186   4e-49    
ref|XP_007109657.1|  PREDICTED: heat shock protein 105 kDa isofor...    186   4e-49    
ref|XP_007109659.1|  PREDICTED: heat shock protein 105 kDa isofor...    186   4e-49    
ref|XP_002748998.1|  PREDICTED: heat shock protein 105 kDa isofor...    186   4e-49    
ref|XP_006128594.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    185   4e-49    
ref|XP_009570693.1|  PREDICTED: heat shock 70 kDa protein 4             186   4e-49    
ref|XP_008823260.1|  PREDICTED: heat shock protein 105 kDa              186   4e-49    
ref|XP_009579843.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    186   4e-49    
gb|EJW79681.1|  hypothetical protein WUBG_09411                         184   5e-49    
gb|KFQ34044.1|  Heat shock 70 kDa protein 4                             186   5e-49    
ref|XP_010895430.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    186   5e-49    
ref|XP_009900614.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    186   5e-49    
gb|KFV89956.1|  Heat shock 70 kDa protein 4                             186   5e-49    
ref|XP_006504979.1|  PREDICTED: heat shock protein 105 kDa isofor...    186   5e-49    
gb|KFW08265.1|  Heat shock 70 kDa protein 4L                            186   5e-49    
ref|NP_038587.2|  heat shock protein 105 kDa                            186   5e-49    
dbj|BAC38797.1|  unnamed protein product                                186   5e-49    
gb|KFV68743.1|  Heat shock 70 kDa protein 4                             186   5e-49    
gb|EPY77468.1|  heat shock protein isoform 5                            185   5e-49    
ref|XP_004406696.1|  PREDICTED: heat shock protein 105 kDa isoform 1    186   6e-49    
ref|XP_001896095.1|  Hypothetical 86.9 kDa protein C30C11.4 in ch...    186   6e-49    
ref|XP_002193589.1|  PREDICTED: heat shock 70 kDa protein 4             186   6e-49    
ref|XP_005015634.1|  PREDICTED: heat shock 70 kDa protein 4L            186   6e-49    
ref|XP_008102922.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    185   6e-49    
ref|XP_008053199.1|  PREDICTED: heat shock protein 105 kDa              185   6e-49    
gb|EDL05869.1|  heat shock protein 110, isoform CRA_a                   186   6e-49    
ref|XP_009699266.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    185   6e-49    
ref|XP_005523757.1|  PREDICTED: heat shock 70 kDa protein 4             186   6e-49    
ref|XP_005440738.1|  PREDICTED: heat shock 70 kDa protein 4             185   6e-49    
ref|XP_010332582.1|  PREDICTED: heat shock protein 105 kDa              186   6e-49    
ref|XP_009467012.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    185   7e-49    
ref|XP_011802308.1|  PREDICTED: heat shock protein 105 kDa isofor...    185   7e-49    
ref|XP_003217430.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    186   7e-49    
ref|XP_006158496.1|  PREDICTED: heat shock protein 105 kDa              186   7e-49    
gb|KFP53341.1|  Heat shock 70 kDa protein 4L                            185   8e-49    
ref|XP_007522471.1|  PREDICTED: heat shock protein 105 kDa isofor...    184   8e-49    
ref|XP_009990106.1|  PREDICTED: heat shock 70 kDa protein 4             184   8e-49    
ref|XP_009919926.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    185   8e-49    
gb|KEZ40976.1|  hypothetical protein SAPIO_CDS6996                      185   8e-49    
ref|XP_010122402.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    185   9e-49    
ref|XP_007063691.1|  PREDICTED: heat shock 70 kDa protein 4             185   9e-49    
ref|XP_006189653.1|  PREDICTED: heat shock protein 105 kDa isofor...    184   1e-48    
ref|XP_006629695.1|  PREDICTED: heat shock 70 kDa protein 4L-like...    185   1e-48    
ref|XP_009647629.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    184   1e-48    
gb|KFP08093.1|  Heat shock 70 kDa protein 4L                            185   1e-48    
ref|XP_006128593.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    185   1e-48    
ref|XP_009900615.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    185   1e-48    
ref|XP_002914798.1|  PREDICTED: heat shock protein 105 kDa isofor...    185   1e-48    
ref|XP_007522468.1|  PREDICTED: heat shock protein 105 kDa isofor...    184   1e-48    
gb|ETE71100.1|  Heat shock 70 kDa protein 4                             185   1e-48    
ref|XP_008141623.1|  PREDICTED: heat shock 70 kDa protein 4L            185   1e-48    
ref|XP_001493567.1|  PREDICTED: heat shock protein 105 kDa isoform 1    185   1e-48    
ref|XP_010308330.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    184   1e-48    
ref|XP_010834211.1|  PREDICTED: heat shock protein 105 kDa isofor...    185   1e-48    
ref|XP_006212284.1|  PREDICTED: heat shock 70 kDa protein 4L            185   1e-48    
ref|XP_005213633.1|  PREDICTED: heat shock protein 105 kDa isofor...    184   1e-48    
ref|XP_011802304.1|  PREDICTED: heat shock protein 105 kDa isofor...    185   1e-48    
ref|XP_011802305.1|  PREDICTED: heat shock protein 105 kDa isofor...    185   1e-48    
ref|XP_006747419.1|  PREDICTED: heat shock protein 105 kDa-like         184   1e-48    
gb|KEQ95101.1|  hypothetical protein AUEXF2481DRAFT_40367               184   1e-48    
ref|XP_006209036.1|  PREDICTED: heat shock protein 105 kDa isofor...    184   2e-48    
gb|KID80618.1|  Heat shock protein Hsp88                                184   2e-48    
ref|XP_010127319.1|  PREDICTED: heat shock 70 kDa protein 4L            184   2e-48    
ref|XP_009564489.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    184   2e-48    
gb|KHN97875.1|  Heat shock protein Hsp88                                184   2e-48    
ref|XP_010789398.1|  PREDICTED: heat shock 70 kDa protein 4-like        184   2e-48    
ref|XP_010196949.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    184   2e-48    
ref|XP_009647627.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    184   2e-48    
ref|XP_011998294.1|  PREDICTED: heat shock protein 105 kDa isofor...    184   2e-48    
ref|XP_010147843.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    184   2e-48    
ref|XP_006629694.1|  PREDICTED: heat shock 70 kDa protein 4L-like...    184   2e-48    
gb|KFP38582.1|  Heat shock 70 kDa protein 4L                            184   2e-48    
ref|XP_010075288.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    184   2e-48    
gb|KFV09881.1|  Heat shock 70 kDa protein 4L                            184   2e-48    
gb|KFP11552.1|  Heat shock 70 kDa protein 4L                            184   2e-48    
ref|XP_004604598.1|  PREDICTED: heat shock protein 105 kDa isofor...    184   2e-48    
ref|XP_004604597.1|  PREDICTED: heat shock protein 105 kDa isofor...    184   2e-48    
ref|XP_009287772.1|  PREDICTED: heat shock 70 kDa protein 4L            184   2e-48    
ref|XP_009888964.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    184   2e-48    
ref|XP_007522466.1|  PREDICTED: heat shock protein 105 kDa isofor...    184   2e-48    
ref|XP_009488257.1|  PREDICTED: heat shock 70 kDa protein 4             184   2e-48    
ref|XP_010147845.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    184   2e-48    
ref|XP_006927258.1|  PREDICTED: heat shock protein 105 kDa              184   2e-48    
ref|XP_005585649.1|  PREDICTED: heat shock protein 105 kDa isofor...    184   2e-48    
ref|XP_009889730.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    183   2e-48    
gb|KFV92449.1|  Heat shock 70 kDa protein 4L                            184   2e-48    
ref|XP_011746919.1|  PREDICTED: heat shock protein 105 kDa isofor...    184   2e-48    
ref|XP_004285542.1|  PREDICTED: heat shock protein 105 kDa isoform 1    184   2e-48    
ref|XP_009930700.1|  PREDICTED: heat shock 70 kDa protein 4             184   2e-48    
gb|KFQ54906.1|  Heat shock 70 kDa protein 4                             184   3e-48    
ref|XP_005053752.1|  PREDICTED: heat shock 70 kDa protein 4             184   3e-48    
ref|XP_004604599.1|  PREDICTED: heat shock protein 105 kDa isofor...    184   3e-48    
ref|XP_005512495.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    183   3e-48    
dbj|BAE27367.1|  unnamed protein product                                184   3e-48    
ref|XP_011802307.1|  PREDICTED: heat shock protein 105 kDa isofor...    184   3e-48    
ref|XP_010308329.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    183   3e-48    
gb|KFQ43170.1|  Heat shock 70 kDa protein 4                             184   3e-48    
ref|XP_010017009.1|  PREDICTED: heat shock 70 kDa protein 4             183   3e-48    
gb|KFM01823.1|  Heat shock 70 kDa protein 4L                            184   3e-48    
ref|XP_006003281.1|  PREDICTED: heat shock 70 kDa protein 4             183   3e-48    
ref|XP_009560733.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    184   3e-48    
ref|XP_011530046.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    184   3e-48    
gb|KFR01038.1|  Heat shock 70 kDa protein 4L                            184   3e-48    



>ref|XP_011080863.1| PREDICTED: heat shock 70 kDa protein 14-like [Sesamum indicum]
Length=856

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/357 (84%), Positives = 327/357 (92%), Gaps = 4/357 (1%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQISIPILERVKKPLEKA+AEAGL VENIHS+EV+GSGSRVPAI+KILTEFFGKEPRR
Sbjct  302   EFEQISIPILERVKKPLEKALAEAGLTVENIHSVEVVGSGSRVPAIMKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV+KGCALQCAILSPTFKVR+FQV ESFPFPIALSWK P+ DAQNG+ +NQQST
Sbjct  362   TMNASECVAKGCALQCAILSPTFKVREFQVTESFPFPIALSWKVPASDAQNGSTDNQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPSVKALTFYRSGTF++DVQYADVSELQAP+KISTYTIGPFQS KGERAKLK
Sbjct  422   VVFPKGNPIPSVKALTFYRSGTFTLDVQYADVSELQAPAKISTYTIGPFQSTKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIP----PQDSSETDVNM  709
             VKVRLNLHGIVS+ESATLLEEEE+EVPVV E  KESTKMETD++P    P  ++E+DVNM
Sbjct  482   VKVRLNLHGIVSIESATLLEEEEIEVPVVNESSKESTKMETDEVPADPAPASTTESDVNM  541

Query  710   QDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKA  889
             QD K    A+EN V E GDKPVQMETD K EAPKKKVKKTNVPVSE+VYG L+ ADVQKA
Sbjct  542   QDAKPDGAAAENGVPELGDKPVQMETDGKVEAPKKKVKKTNVPVSEIVYGGLAAADVQKA  601

Query  890   VEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             VEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL+DKY EFV +SE+EQ IA+LQE
Sbjct  602   VEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLHDKYHEFVKESEREQFIARLQE  658



>ref|XP_009610834.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009610835.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009610836.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Nicotiana 
tomentosiformis]
Length=856

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/359 (84%), Positives = 328/359 (91%), Gaps = 6/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQISIPILERVKKPLE A+AEAG   ENIH++EV+GS SRVPAI++ILTEFFGKEPRR
Sbjct  302   EFEQISIPILERVKKPLENALAEAGFTTENIHAVEVVGSSSRVPAIMRILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV+KGCALQCAILSPTFKVR+FQVNESFPFPIALSWKGP+PDAQNGA EN QST
Sbjct  362   TMNASECVAKGCALQCAILSPTFKVREFQVNESFPFPIALSWKGPAPDAQNGALENHQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRSGTF+IDVQYADVSELQAP+KISTYTIGPFQS KGERAKLK
Sbjct  422   IVFPKGNPIPSVKALTFYRSGTFTIDVQYADVSELQAPAKISTYTIGPFQSAKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETD----DIPPQDSSETDVNM  709
             VKVRLNLHGIVSV+SATLLEEEEVEVPVVKE +KE  +METD    D  P  +SE+DVNM
Sbjct  482   VKVRLNLHGIVSVDSATLLEEEEVEVPVVKEAVKEPAEMETDEASGDAAPSTTSESDVNM  541

Query  710   QDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD K   DAS  EN V ESGDKPV+METDAK EAPKKKVKKT+VPV+E+VYGA++ ADVQ
Sbjct  542   QDAKGAGDASVAENDVPESGDKPVKMETDAKVEAPKKKVKKTSVPVTEIVYGAMAAADVQ  601

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DKYQEFV+DSE+EQ +AKLQE
Sbjct  602   KAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLSDKYQEFVIDSEREQFMAKLQE  660



>ref|XP_009624163.1| PREDICTED: heat shock 70 kDa protein 15-like [Nicotiana tomentosiformis]
Length=854

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/359 (84%), Positives = 327/359 (91%), Gaps = 6/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQISIPILERVKKPLEKA+AEAGL  ENIH++EV+GS SRVPAI++ILTEFFGKEPRR
Sbjct  302   EFEQISIPILERVKKPLEKALAEAGLTTENIHAVEVVGSSSRVPAIMRILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV+KGCALQCAILSPTFKVR+FQVNESFPFPIALSWKGP+PDAQNGA EN QST
Sbjct  362   TMNASECVAKGCALQCAILSPTFKVREFQVNESFPFPIALSWKGPAPDAQNGALENHQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRSGTF+IDVQYADVSELQAP+KISTYTIGPFQS KGERAKLK
Sbjct  422   IVFPKGNPIPSVKALTFYRSGTFTIDVQYADVSELQAPAKISTYTIGPFQSAKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETD----DIPPQDSSETDVNM  709
             VKVRLNLHGIVSV+SATLLEEEEVEVPVVKE +KE  KMETD    D     +SE+DVNM
Sbjct  482   VKVRLNLHGIVSVDSATLLEEEEVEVPVVKEAVKEPAKMETDEASGDAAAPTTSESDVNM  541

Query  710   QDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD K   DAS  EN V E GD+PV+METDAK E PKKKVKKT++PV+E+VYGA++ ADVQ
Sbjct  542   QDAKGAGDASGAENGVPEFGDRPVKMETDAKVEVPKKKVKKTSIPVTEIVYGAMAAADVQ  601

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DKYQEFV+DSE+EQ IAKLQE
Sbjct  602   KAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLSDKYQEFVIDSEREQFIAKLQE  660



>ref|XP_009801414.1| PREDICTED: heat shock 70 kDa protein 15-like [Nicotiana sylvestris]
Length=846

 Score =   533 bits (1374),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 282/358 (79%), Positives = 307/358 (86%), Gaps = 9/358 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQI IPILERVKKPLEKA+ EAGL  +N+HS+EV+GS SRVPA+++ILTEFFGKEPRR
Sbjct  302   EFEQICIPILERVKKPLEKALLEAGLTTDNVHSVEVVGSSSRVPAMMRILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV+KGCALQCAILSPTFKVR+FQVNESFPFPIALSWKG +PDAQNGAAENQQST
Sbjct  362   TMNASECVAKGCALQCAILSPTFKVREFQVNESFPFPIALSWKGSAPDAQNGAAENQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPSVKALTFYRSGTF+ DVQYADVSELQAP+KISTYTIGPFQS K ERAKLK
Sbjct  422   VVFPKGNPIPSVKALTFYRSGTFTTDVQYADVSELQAPAKISTYTIGPFQSTKSERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETD----DIPPQDSSETDVNM  709
             VKVRLNLHGI    S       E E   V    +E  KM+TD    D  P  ++ETD NM
Sbjct  482   VKVRLNLHGI---VSVESATLLEEEEVEVPIVKEEPIKMDTDNFSADAAPSTTAETDENM  538

Query  710   QDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD K  +DAS  EN V ESGDKPV+M TD KAE PKKKVKKTNVPV+ELVYGAL+ ADVQ
Sbjct  539   QDAKGAADASGVENDVPESGDKPVEMATDTKAEVPKKKVKKTNVPVTELVYGALAAADVQ  598

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQ  1057
             KAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL+DKYQEFVVDSE+EQ IAKLQ
Sbjct  599   KAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLHDKYQEFVVDSEREQFIAKLQ  656



>ref|XP_009587742.1| PREDICTED: heat shock 70 kDa protein 15-like [Nicotiana tomentosiformis]
Length=844

 Score =   531 bits (1368),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 284/358 (79%), Positives = 308/358 (86%), Gaps = 9/358 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQI IPILERVKKPLEKA+ EAGL  ENIHS+EV+GS SRVPA++KILTEFFGKEPRR
Sbjct  302   EFEQICIPILERVKKPLEKALLEAGLTTENIHSVEVVGSSSRVPAMMKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV+KGCALQCAILSPTFKVR+FQVNESFPFPIALSWKG +PDAQNGAAENQQST
Sbjct  362   TMNASECVAKGCALQCAILSPTFKVREFQVNESFPFPIALSWKGSAPDAQNGAAENQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPSVKALTFYRSGTF+ DVQYADVSELQAP+KIS YTIGPFQS KGER+KLK
Sbjct  422   VVFPKGNPIPSVKALTFYRSGTFTTDVQYADVSELQAPAKISAYTIGPFQSNKGERSKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETD----DIPPQDSSETDVNM  709
             VKVRLNLHGI    S   +   E E   V    +E  KM+TD    D     ++ETD NM
Sbjct  482   VKVRLNLHGI---VSVESVTLLEEEEVEVPIVKEEPIKMDTDNASADAAAPTTAETDENM  538

Query  710   QDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD K  +DAS  EN V ESGDKPV+M TD KAEAPKKKVKKTNVPV+ELVYGAL+ ADVQ
Sbjct  539   QDAKGAADASGVENGVPESGDKPVEMATDTKAEAPKKKVKKTNVPVTELVYGALAAADVQ  598

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQ  1057
             KAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL+DKYQEFVVDSE+EQ IAKLQ
Sbjct  599   KAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLHDKYQEFVVDSEREQFIAKLQ  656



>emb|CDO98063.1| unnamed protein product [Coffea canephora]
Length=858

 Score =   531 bits (1369),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 297/359 (83%), Positives = 327/359 (91%), Gaps = 6/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQISIPILERVKKPLE A+AEAGL VE+IH++EV+GSGSRVPA+IKILT+FFGKEPRR
Sbjct  302   EFEQISIPILERVKKPLEMALAEAGLGVESIHAVEVVGSGSRVPAMIKILTDFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV+KG ALQCAILSPTFKVR+FQVNESFPF IALSWKG +PDAQNGAA+NQQST
Sbjct  362   TMNASECVAKGAALQCAILSPTFKVREFQVNESFPFAIALSWKGSAPDAQNGAADNQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRSGTF++DV YADVSELQAP+KISTYTIGPFQ+ KGERAKLK
Sbjct  422   IVFPKGNPIPSVKALTFYRSGTFTVDVHYADVSELQAPAKISTYTIGPFQATKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIP----PQDSSETDVNM  709
             VKVRLNLHGIVSVESATLLEEEEVEVPV KE  KE+ KMETD++P    P  S+ETDVNM
Sbjct  482   VKVRLNLHGIVSVESATLLEEEEVEVPVTKEPAKETAKMETDEVPSDAAPPSSTETDVNM  541

Query  710   QDDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD K  ++A  +EN V +SGDKPVQMETD+KAEAPKKKVKKTN+PVSELVYG L+ ADVQ
Sbjct  542   QDTKGAAEAPGAENGVPDSGDKPVQMETDSKAEAPKKKVKKTNIPVSELVYGGLAAADVQ  601

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL D+Y EFV+D E+ Q  AKLQE
Sbjct  602   KAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLNDRYHEFVMDPERGQFAAKLQE  660



>ref|XP_006346577.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006346578.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X2 [Solanum 
tuberosum]
Length=849

 Score =   531 bits (1367),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 300/359 (84%), Positives = 324/359 (90%), Gaps = 6/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQISIPILERVKKPLEKA+AEAGL  ENIH++EVIGS SRVPAI++ILTEFFGKEPRR
Sbjct  302   EFEQISIPILERVKKPLEKALAEAGLTTENIHAVEVIGSSSRVPAIMRILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV+KG ALQCAILSPTFKVR+F+VNESFPFPIALSWKGP+PDAQNGA EN QST
Sbjct  362   TMNASECVAKGAALQCAILSPTFKVREFKVNESFPFPIALSWKGPAPDAQNGALENHQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRSGTF+IDVQYADVSELQAP+KISTYTIGPFQS KGERAKLK
Sbjct  422   IVFPKGNPIPSVKALTFYRSGTFTIDVQYADVSELQAPAKISTYTIGPFQSTKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETD----DIPPQDSSETDVNM  709
             VKVRLNLHGIVSVESATLLEEEEVEVPVVKE  KE  KMETD    D  P  +SE+DVNM
Sbjct  482   VKVRLNLHGIVSVESATLLEEEEVEVPVVKETAKEPAKMETDEASVDAAPSTTSESDVNM  541

Query  710   QD--DKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD      +  +EN V ESGDKPVQMETDAK EAPKKKVKKT+VPV+E+VYGA++ ADVQ
Sbjct  542   QDAKGAAAASGAENGVPESGDKPVQMETDAKVEAPKKKVKKTSVPVTEIVYGAMAAADVQ  601

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKEFEMALQDR+MEETKDKKNAVE+YVYDMRNKL DKYQEFV DSE+EQ +A LQE
Sbjct  602   KAVEKEFEMALQDRVMEETKDKKNAVESYVYDMRNKLSDKYQEFVTDSEREQFMAVLQE  660



>ref|XP_004252334.1| PREDICTED: heat shock 70 kDa protein 15-like [Solanum lycopersicum]
 ref|XP_010314276.1| PREDICTED: heat shock 70 kDa protein 15-like [Solanum lycopersicum]
Length=852

 Score =   527 bits (1358),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 298/359 (83%), Positives = 324/359 (90%), Gaps = 6/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQISIPILERVKKPLEKA+AEAGL  ENIH++EVIGS SRVPAI++ILTEFFGKEPRR
Sbjct  302   EFEQISIPILERVKKPLEKALAEAGLTTENIHAVEVIGSSSRVPAIMRILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV+KG ALQCAILSPTFKVR+F+VNESFPFPIALSWKGP+PDAQNGA EN QST
Sbjct  362   TMNASECVAKGAALQCAILSPTFKVREFKVNESFPFPIALSWKGPAPDAQNGALENHQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRSGTF+IDVQYADVSELQAP+KISTYTIGPFQS KGERAKLK
Sbjct  422   IVFPKGNPIPSVKALTFYRSGTFTIDVQYADVSELQAPAKISTYTIGPFQSMKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETD----DIPPQDSSETDVNM  709
             VKVRLNLHGIVSVESATLLEEEEVEVPVVKE  KE  KMETD    +  P  ++E+DVNM
Sbjct  482   VKVRLNLHGIVSVESATLLEEEEVEVPVVKETAKEPAKMETDESSVNAAPSTTAESDVNM  541

Query  710   QD--DKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD      +  +EN V ESGDKPVQMETDAK EAPKKKVKKT+VPV+E+VYGA++ ADVQ
Sbjct  542   QDAKGAAAASGAENGVPESGDKPVQMETDAKVEAPKKKVKKTSVPVTEIVYGAMAAADVQ  601

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKEFEMALQDR+MEETKDKKNAVE+YVYDMRNKL DKYQEFV DSE+EQ +A LQE
Sbjct  602   KAVEKEFEMALQDRVMEETKDKKNAVESYVYDMRNKLSDKYQEFVTDSEREQFMAVLQE  660



>ref|XP_002528199.1| Heat shock 70 kDa protein, putative [Ricinus communis]
 gb|EEF34206.1| Heat shock 70 kDa protein, putative [Ricinus communis]
Length=849

 Score =   525 bits (1351),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 292/359 (81%), Positives = 321/359 (89%), Gaps = 7/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQISIPILERVKKPLEKA+ +A L +EN+H +EV+GSGSRVPAIIKILTEFFGKEPRR
Sbjct  302   EFEQISIPILERVKKPLEKALQDAKLTIENVHMVEVVGSGSRVPAIIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNESFPF IALSWKG +PDAQ+GAA+NQQST
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNESFPFSIALSWKGAAPDAQSGAADNQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRSGTF++DVQYADVSELQ P++ISTYTIGPFQS   ERAK+K
Sbjct  422   IVFPKGNPIPSVKALTFYRSGTFTVDVQYADVSELQVPARISTYTIGPFQSSTSERAKVK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETD----DIPPQDSSETDVNM  709
             VK RLNLHGIVSV+SATLLEEEEVEVPV KE  KE+ KMETD    D  P +SSE DVNM
Sbjct  482   VKARLNLHGIVSVDSATLLEEEEVEVPVSKEPSKEAAKMETDETSTDAAPPNSSEADVNM  541

Query  710   QDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD K T++AS  EN V ESGDKP QMETD K EAPKKKVKKTN+PV+ELVYG +SPADVQ
Sbjct  542   QDAK-TAEASGAENGVPESGDKPAQMETDTKVEAPKKKVKKTNIPVAELVYGGMSPADVQ  600

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KA+EKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DK+QEFV DSE+E   AKLQE
Sbjct  601   KALEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLSDKFQEFVTDSEREDFTAKLQE  659



>ref|XP_010254149.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
 ref|XP_010254150.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
 ref|XP_010254151.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
Length=851

 Score =   525 bits (1351),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 293/359 (82%), Positives = 319/359 (89%), Gaps = 6/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS PILERVK PLEKA++EAGL VENIHS+EV+GSGSRVPAII+ILTEFFGKEPRR
Sbjct  302   EFEQISTPILERVKGPLEKALSEAGLTVENIHSVEVVGSGSRVPAIIRILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNESFP PIALSWKG +PD+QNGA E+QQST
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNESFPSPIALSWKGAAPDSQNGATEHQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALT YR GTF+IDV YADVS+LQAP+KISTYT+GPFQS KGERAKLK
Sbjct  422   IVFPKGNPIPSVKALTIYRWGTFTIDVHYADVSQLQAPAKISTYTVGPFQSTKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIP----PQDSSETDVNM  709
             VKVRLNLHGIVSVESATLLEEEEVEVPVVKE  KE TKMETD+ P    P  + E DVNM
Sbjct  482   VKVRLNLHGIVSVESATLLEEEEVEVPVVKEPAKEDTKMETDEAPNDAAPAGTVENDVNM  541

Query  710   QDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD K  +DA   EN V E+GDKP+QMETD K +APKKKVKKTNVPV+ELVYG ++P DVQ
Sbjct  542   QDAKGATDAPGVENGVPETGDKPMQMETDVKVDAPKKKVKKTNVPVAELVYGGMAPIDVQ  601

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DKY  FV DSE+E L AKLQE
Sbjct  602   KAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLNDKYHGFVTDSERETLTAKLQE  660



>ref|XP_011072334.1| PREDICTED: heat shock 70 kDa protein 15-like [Sesamum indicum]
 ref|XP_011072335.1| PREDICTED: heat shock 70 kDa protein 15-like [Sesamum indicum]
Length=845

 Score =   524 bits (1349),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 286/353 (81%), Positives = 320/353 (91%), Gaps = 1/353 (0%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FEQISIPILERVKKPLEKA+ EAGL +E+IHS+EV+GSGSRVPAIIKILTEFFGKEPRR
Sbjct  302   DFEQISIPILERVKKPLEKALVEAGLTIESIHSVEVVGSGSRVPAIIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV+KG AL+CAILSPTFKVR+FQVNESFPF IALSWKG SPD QNGA++NQQST
Sbjct  362   TMNASECVAKGSALECAILSPTFKVREFQVNESFPFSIALSWKGSSPDVQNGASDNQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPSVKALTFYRSGTF++DVQYADVSELQ P+KISTYTIGPFQS KGERAKLK
Sbjct  422   LVFPKGNPIPSVKALTFYRSGTFTVDVQYADVSELQGPAKISTYTIGPFQSTKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQDDK  721
             VKVRLNLHGIVS+ESATLLEEEEV+VPVVK+  K +TKMETD+ PP  ++ TD NMQD K
Sbjct  482   VKVRLNLHGIVSIESATLLEEEEVDVPVVKDSQKNATKMETDEAPPS-TAGTDENMQDAK  540

Query  722   VTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVEKE  901
                  +EN V ESGDK  +M+TD+K EAPKKKVKKTNVPVSE+VYG L   DVQKAVEKE
Sbjct  541   NDGAGAENGVPESGDKTSEMDTDSKVEAPKKKVKKTNVPVSEVVYGGLGATDVQKAVEKE  600

Query  902   FEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             FEMALQDR+MEETKDKKNAVEAYVYDMRNKL+DKY EFV +S+++QLI+KLQE
Sbjct  601   FEMALQDRVMEETKDKKNAVEAYVYDMRNKLHDKYHEFVTESDRDQLISKLQE  653



>gb|EYU21549.1| hypothetical protein MIMGU_mgv1a001311mg [Erythranthe guttata]
Length=842

 Score =   522 bits (1345),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 275/355 (77%), Positives = 307/355 (86%), Gaps = 8/355 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS PILERVKKPLEKA+AEAGL VENIHS+EV+GSGSRVPA+ KILT+FFGKEPRR
Sbjct  302   EFEQISSPILERVKKPLEKALAEAGLTVENIHSVEVVGSGSRVPAVFKILTDFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV+KG AL+CAILSPTFKVR+FQVNESFPFPIALSWKG +PD QNGAA+NQQST
Sbjct  362   TMNASECVAKGSALECAILSPTFKVREFQVNESFPFPIALSWKGSAPDTQNGAADNQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPSVKALTFYRSGTF+IDVQYADVSELQAP+KISTYT+GPFQS K ERAKLK
Sbjct  422   VVFPKGNPIPSVKALTFYRSGTFTIDVQYADVSELQAPAKISTYTVGPFQSTKSERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQ--DSSETDVNMQD  715
             VKVRLNLHGI     +        E  V    +KE+TKMETD+ P     ++ETDVNMQD
Sbjct  482   VKVRLNLHGI----VSIESATLLEEEEVEVPVVKEATKMETDEAPGATPSTTETDVNMQD  537

Query  716   DKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVE  895
              K  +D +EN V ESGDK  QMETD K EAPKKKVKKT+VPVSE+VYG ++ ADVQKAVE
Sbjct  538   AK--TDGAENGVPESGDKTAQMETDVKVEAPKKKVKKTSVPVSEIVYGGMAAADVQKAVE  595

Query  896   KEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KEFEMALQDR+MEETKDKKNAVEAYVY+MRNKL DKY EFV +S+KEQLI++LQE
Sbjct  596   KEFEMALQDRVMEETKDKKNAVEAYVYEMRNKLNDKYHEFVTESDKEQLISRLQE  650



>ref|XP_009794901.1| PREDICTED: heat shock 70 kDa protein 15-like, partial [Nicotiana 
sylvestris]
Length=371

 Score =   505 bits (1301),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 280/336 (83%), Positives = 308/336 (92%), Gaps = 6/336 (2%)
 Frame = +2

Query  71    AGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRRTMNASECVSKGCALQCAILSPTF  250
             AGL +ENIH++EV+GS SRVPAI++ILTEFFGKEPRRTMNASECV+KGCALQCAILSPTF
Sbjct  1     AGLTIENIHAVEVVGSSSRVPAIMRILTEFFGKEPRRTMNASECVAKGCALQCAILSPTF  60

Query  251   KVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQSTIVFPKGNPIPSVKALTFYRSGTF  430
             KVR+FQVNESFPFPIALSWKGP+PDAQNGA EN QST+VFPKGNPIPSVKALTFYRSGTF
Sbjct  61    KVREFQVNESFPFPIALSWKGPAPDAQNGALENHQSTVVFPKGNPIPSVKALTFYRSGTF  120

Query  431   SIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeee  610
             +IDVQYADVSELQAP+KISTYTIGPFQS KGERAKLKVKVRLNLHGIVSV+SATLLEEEE
Sbjct  121   TIDVQYADVSELQAPAKISTYTIGPFQSAKGERAKLKVKVRLNLHGIVSVDSATLLEEEE  180

Query  611   vevpvvkeqlkeSTKMETD----DIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKP  772
             VEVPVVKE +KE  +METD    D  P  +SE+DVNMQD K   DAS  EN V ESGDKP
Sbjct  181   VEVPVVKEAVKEPAEMETDEASGDAAPSTTSESDVNMQDAKGAGDASGAENGVPESGDKP  240

Query  773   VQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKK  952
             V+METDAK EAPKKKVKKT+VPV+E+VYGA++ ADVQKAVEKEFEMALQDR+MEETKDKK
Sbjct  241   VKMETDAKVEAPKKKVKKTSVPVTEIVYGAMAAADVQKAVEKEFEMALQDRVMEETKDKK  300

Query  953   NAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             NAVEAYVYDMRNKL DKYQEFV+D+E+EQ +AKLQE
Sbjct  301   NAVEAYVYDMRNKLSDKYQEFVIDTEREQFMAKLQE  336



>ref|XP_008228510.1| PREDICTED: heat shock 70 kDa protein 15-like [Prunus mume]
Length=855

 Score =   521 bits (1343),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 288/359 (80%), Positives = 321/359 (89%), Gaps = 6/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS+PILERVK PLEKA+ +A L++ENIH++EV+GSGSRVPAIIKILT+FF KEPRR
Sbjct  302   EFEQISVPILERVKGPLEKALLDAQLSIENIHTVEVVGSGSRVPAIIKILTDFFKKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNESFPF IALSWKG  PD QNGAA+N QST
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNESFPFSIALSWKGSGPDTQNGAADNNQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPS+KALTFYRSGTFS+DVQYADVS+LQAP+KISTYTIGPFQS KGERAKLK
Sbjct  422   IVFPKGNPIPSIKALTFYRSGTFSVDVQYADVSDLQAPAKISTYTIGPFQSTKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIP----PQDSSETDVNM  709
             VK RLNLHGIVSV+SATLLEEEE+EVPV KEQ KE  KMETD+ P    P  ++ETDVNM
Sbjct  482   VKARLNLHGIVSVDSATLLEEEEIEVPVTKEQPKEGAKMETDEAPSDAAPPSTNETDVNM  541

Query  710   QDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD K T+DAS  EN V ESGDKPVQMETD KA+APK+KVKKTN+PV ELVYG + P+DVQ
Sbjct  542   QDAKGTADASGAENGVPESGDKPVQMETDTKADAPKRKVKKTNIPVVELVYGGMPPSDVQ  601

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KA+EKEFEMALQDR+MEETKDKKNAVEAYVYD RNKL DKYQEFV + E+E  IA+LQE
Sbjct  602   KAIEKEFEMALQDRVMEETKDKKNAVEAYVYDTRNKLNDKYQEFVTEPEREAFIARLQE  660



>ref|XP_010521527.1| PREDICTED: heat shock 70 kDa protein 15 [Tarenaya hassleriana]
Length=832

 Score =   521 bits (1341),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 276/358 (77%), Positives = 307/358 (86%), Gaps = 6/358 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQISIPILERVK+PLE A+A+AGL VEN+H +EV+GSGSRVPAIIKILTEFFGKEPRR
Sbjct  302   EFEQISIPILERVKRPLENALADAGLTVENVHMVEVVGSGSRVPAIIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNESFPF IALSWKG +PDA+NG AENQQST
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNESFPFSIALSWKGSTPDAENGGAENQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPSVKALTFYRSGTFSIDVQYADV++LQAP KISTYTIGPFQS KGERAKLK
Sbjct  422   VVFPKGNPIPSVKALTFYRSGTFSIDVQYADVTDLQAPPKISTYTIGPFQSSKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQD---SSETDVNMQ  712
             VK RLNLHGI     +  L EEE     V ++ +E TKM+TD  P +    S  +DVNMQ
Sbjct  482   VKARLNLHGI-VSVESATLLEEEEVEVPVTKEQEEPTKMDTDKAPGETDPASGGSDVNMQ  540

Query  713   DDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             D K   DA+  EN V ES DKPVQMETD K EAPKKKVKKTNVPVSELVYGA+   DVQK
Sbjct  541   DAKGAGDATGAENGVPESVDKPVQMETDMKTEAPKKKVKKTNVPVSELVYGAMQSVDVQK  600

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             AVEKEFEMALQDR+MEETKD+KNAVEAYVYDMRNKL DKYQE+++DS++E  +AKLQE
Sbjct  601   AVEKEFEMALQDRVMEETKDRKNAVEAYVYDMRNKLSDKYQEYIIDSDREAFLAKLQE  658



>ref|XP_007217050.1| hypothetical protein PRUPE_ppa001317mg [Prunus persica]
 gb|EMJ18249.1| hypothetical protein PRUPE_ppa001317mg [Prunus persica]
Length=855

 Score =   520 bits (1338),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 285/359 (79%), Positives = 321/359 (89%), Gaps = 6/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS+PILERVK PLEKA+ +A L++ENIH++EV+GSGSRVPAIIKILT+FF KEPRR
Sbjct  302   EFEQISVPILERVKGPLEKALLDAQLSIENIHTVEVVGSGSRVPAIIKILTDFFKKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNESFP  IALSWKG  PD QNGA +N QST
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNESFPCSIALSWKGSGPDTQNGAVDNNQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPS+KALTFYRSGTFS+DVQYADVS+LQAP+KISTYTIGPFQS KGERAKLK
Sbjct  422   IVFPKGNPIPSIKALTFYRSGTFSVDVQYADVSDLQAPAKISTYTIGPFQSTKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIP----PQDSSETDVNM  709
             VK RLNLHGIVS++SATLLEEEE+EVPV KEQ KE+ KMETD+ P    P  ++ETDVNM
Sbjct  482   VKARLNLHGIVSIDSATLLEEEEIEVPVTKEQPKEAAKMETDEAPSDAAPPSTNETDVNM  541

Query  710   QDDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD K T+DA  +EN V ESGDKPVQMETD KA+APK+KVKKTN+PV ELVYG + P+DVQ
Sbjct  542   QDAKATADALDAENGVPESGDKPVQMETDTKADAPKRKVKKTNIPVVELVYGGMPPSDVQ  601

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KA+EKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DKYQEFV + E+E  IA+LQE
Sbjct  602   KAIEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLNDKYQEFVTEPEREAFIARLQE  660



>ref|XP_010249783.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
 ref|XP_010249784.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
Length=850

 Score =   519 bits (1336),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 291/359 (81%), Positives = 319/359 (89%), Gaps = 6/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+IS+PILERVK PLEKA++EAGL  ENIH++EV+GSGSRVPAII+ILTE FGKEPRR
Sbjct  302   EFEKISVPILERVKGPLEKALSEAGLTAENIHAVEVVGSGSRVPAIIRILTEVFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNESFPFPIALSWKG +PDAQNGA + QQST
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNESFPFPIALSWKGSAPDAQNGAVDQQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNP PSVKALTFYRSGTF++DV Y DVSEL+A +KISTYTIGPFQS KGERAKLK
Sbjct  422   IVFPKGNPFPSVKALTFYRSGTFTVDVHYPDVSELKALAKISTYTIGPFQSAKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIP----PQDSSETDVNM  709
             VK+RLNLHGIVSVESATLLEEEEVEVPVVKE LKE+ KMETD++P    P  + E DVNM
Sbjct  482   VKIRLNLHGIVSVESATLLEEEEVEVPVVKEPLKEAAKMETDEVPSDAAPTGTGENDVNM  541

Query  710   QDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD K  ++AS  EN   ESGDKPVQMETDAK EAPKKKVKKTNVPV+ELVYG + PADVQ
Sbjct  542   QDAKDATNASGVENGAPESGDKPVQMETDAKVEAPKKKVKKTNVPVAELVYGGMVPADVQ  601

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DKY EFV  SE+E   AKLQE
Sbjct  602   KAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLNDKYHEFVTASEREDFTAKLQE  660



>ref|XP_004252333.1| PREDICTED: heat shock 70 kDa protein 15-like [Solanum lycopersicum]
Length=846

 Score =   517 bits (1332),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 292/359 (81%), Positives = 321/359 (89%), Gaps = 8/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQISIPILERVKKPLEKA+AEAGL  ENIH++EV+GS SRVPAI++ILTEFFGKEPRR
Sbjct  302   EFEQISIPILERVKKPLEKALAEAGLTTENIHAVEVVGSSSRVPAIMRILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV+KG ALQCAILSPTFKVR+F+VNESFPF IALSWKGPSPDAQNG  EN QST
Sbjct  362   TMNASECVAKGAALQCAILSPTFKVREFKVNESFPFSIALSWKGPSPDAQNG--ENHQST  419

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRSGTF+ DVQYADVSELQA +KISTYTIGPFQS KGERAKLK
Sbjct  420   IVFPKGNPIPSVKALTFYRSGTFTTDVQYADVSELQASAKISTYTIGPFQSSKGERAKLK  479

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETD----DIPPQDSSETDVNM  709
             VKVRL LHGIVSVESATLLEEEEV+VPVVKE  K   +METD    D  P  +SE+DVNM
Sbjct  480   VKVRLTLHGIVSVESATLLEEEEVDVPVVKETAKGPARMETDEASADAAPSTTSESDVNM  539

Query  710   QDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             +D K T+ AS  EN V ESGD+PVQME+DAK EAPKK+VKKT+VPV+E+VYGA++ ADVQ
Sbjct  540   EDAKGTAAASGAENGVPESGDEPVQMESDAKVEAPKKRVKKTSVPVTEIVYGAMAAADVQ  599

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKEFEMALQDR+MEETKDKKNAVE+YVYDMRNKL DKYQEFV DSE+EQ +A LQE
Sbjct  600   KAVEKEFEMALQDRVMEETKDKKNAVESYVYDMRNKLSDKYQEFVTDSEREQFMAVLQE  658



>ref|XP_010098045.1| Heat shock 70 kDa protein 15 [Morus notabilis]
 gb|EXB74482.1| Heat shock 70 kDa protein 15 [Morus notabilis]
Length=860

 Score =   516 bits (1330),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 284/359 (79%), Positives = 318/359 (89%), Gaps = 6/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQI +PILERVKKPLEKA+A+AGL++EN+H +EV+GS SR+PAI+KILTEFF KEPRR
Sbjct  302   EFEQICVPILERVKKPLEKALADAGLSIENVHMVEVVGSASRIPAIVKILTEFFKKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMN+SECV++GCAL+CAILSPTFKVR+FQVNE FPFPIALSWKG +PDAQNG AENQQST
Sbjct  362   TMNSSECVARGCALECAILSPTFKVREFQVNECFPFPIALSWKGSAPDAQNGGAENQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGN +PSVKALTFYR GTFS+DVQYAD SELQAP+KISTYTIGPFQS K ER+KLK
Sbjct  422   VVFPKGNSLPSVKALTFYRFGTFSVDVQYADTSELQAPAKISTYTIGPFQSTKSERSKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETD----DIPPQDSSETDVNM  709
             VKVRLNLHGIVSVESATLLEEEEVEVPV KE  KE+ KMETD    D  P  S++ DVNM
Sbjct  482   VKVRLNLHGIVSVESATLLEEEEVEVPVTKEAPKEANKMETDEASSDATPPSSTDADVNM  541

Query  710   QDDKVTSD--ASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD K   D  A+EN V ESGDKPVQMET+ K +APKKKVKKTN+PV+ELVYG L+PAD+Q
Sbjct  542   QDAKGAGDAPAAENGVPESGDKPVQMETEQKPDAPKKKVKKTNIPVTELVYGGLTPADLQ  601

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DKY+EFV  SEKE+  AKLQE
Sbjct  602   KAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLSDKYEEFVTPSEKEEFFAKLQE  660



>ref|XP_002887853.1| hypothetical protein ARALYDRAFT_896005 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64112.1| hypothetical protein ARALYDRAFT_896005 [Arabidopsis lyrata subsp. 
lyrata]
Length=830

 Score =   510 bits (1314),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 284/358 (79%), Positives = 320/358 (89%), Gaps = 5/358 (1%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+ISIPILERVK+PLEKA+++AGL VE++H +EVIGSGSRVPA+IKILTEFFGKEPRR
Sbjct  302   EFEEISIPILERVKRPLEKALSDAGLTVEDVHMVEVIGSGSRVPAMIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVR+FQV+ESFPF I+L+WKG + DAQNG AENQQST
Sbjct  362   TMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSISLAWKGAASDAQNGRAENQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRSGTFS+DVQY DV++LQAP KISTYTIG FQS KGERAKLK
Sbjct  422   IVFPKGNPIPSVKALTFYRSGTFSVDVQYGDVNDLQAPPKISTYTIGTFQSSKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQ---DSSETDVNMQ  712
             VKVRLNLHGIVSVESATLLEEEEVEVPV K+Q  E+TKM+TD    +    S ++DVNMQ
Sbjct  482   VKVRLNLHGIVSVESATLLEEEEVEVPVTKDQSVETTKMDTDKASAEAAPASGDSDVNMQ  541

Query  713   DDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             D K TSDA  S+N V ES +KPVQMETD KAEAPKKKVKKTNVP+SELVYGAL   +V K
Sbjct  542   DAKDTSDAAGSDNGVAESAEKPVQMETDLKAEAPKKKVKKTNVPLSELVYGALKSVEVDK  601

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             AVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DKYQE++ D+E+E  +AKLQE
Sbjct  602   AVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDKYQEYITDAEREAFLAKLQE  659



>emb|CBI36157.3| unnamed protein product [Vitis vinifera]
Length=784

 Score =   509 bits (1310),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 283/358 (79%), Positives = 316/358 (88%), Gaps = 8/358 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS+PILERVK PLE+A+++AGL+ ENIH++EV+GSGSRVPAII+ILTEFFGKEPRR
Sbjct  238   EFEQISVPILERVKGPLEEALSDAGLSAENIHAVEVVGSGSRVPAIIRILTEFFGKEPRR  297

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV+KGCALQCAILSPTFKVR+FQVNESFPF IAL+WKG   DAQNGAA+NQQ+T
Sbjct  298   TMNASECVAKGCALQCAILSPTFKVREFQVNESFPFTIALTWKG---DAQNGAADNQQNT  354

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPSVKALTFYRSGTFS+DV YAD SE+Q   KISTYTIGPFQS K ERAKLK
Sbjct  355   VVFPKGNPIPSVKALTFYRSGTFSVDVVYADASEIQGQVKISTYTIGPFQSTKVERAKLK  414

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIP-----PQDSSETDVN  706
             VKVRLNLHGIVSVESATLLEEEEVE+PVVKE  K++TKM+TD+ P     P  +SETD N
Sbjct  415   VKVRLNLHGIVSVESATLLEEEEVEIPVVKEPAKDATKMDTDETPGDAAAPPGTSETDAN  474

Query  707   MQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             MQD K  +   EN V ESGDK VQMETD K E PKKKVKKTN+PVSELVYG + PADVQK
Sbjct  475   MQDAKGDAPGVENGVPESGDKSVQMETDTKVEVPKKKVKKTNIPVSELVYGTMVPADVQK  534

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             AVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL+DKYQ+FV  SE+++  AKLQE
Sbjct  535   AVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLHDKYQDFVTSSERDEFTAKLQE  592



>ref|XP_006346576.1| PREDICTED: heat shock 70 kDa protein 15-like [Solanum tuberosum]
Length=847

 Score =   510 bits (1314),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 289/359 (81%), Positives = 318/359 (89%), Gaps = 8/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQISIPILERVKKPLEKA+AEAGL  ENIH++EV+GS SRVPAI++ILTEFFGKEPRR
Sbjct  302   EFEQISIPILERVKKPLEKALAEAGLTTENIHAVEVVGSSSRVPAIMRILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV+KG ALQCAILSPTFKVR+F+VNESFPF IALSWKGPSPDAQNG  E+ QST
Sbjct  362   TMNASECVAKGTALQCAILSPTFKVREFKVNESFPFSIALSWKGPSPDAQNG--EHHQST  419

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRSGTF+ DVQYADVSELQAP+KISTYTIGPFQS KGERAKLK
Sbjct  420   IVFPKGNPIPSVKALTFYRSGTFTTDVQYADVSELQAPAKISTYTIGPFQSSKGERAKLK  479

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETD----DIPPQDSSETDVNM  709
             VKVRL LHGIVSVESATLLEEEEV+VPVVKE  K   +METD    D  P  +SE DVNM
Sbjct  480   VKVRLTLHGIVSVESATLLEEEEVDVPVVKETAKGPARMETDEGSADAAPSTTSENDVNM  539

Query  710   QD--DKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             +D      +  +EN V ESGD+PVQME+DAK EAPKKKVKKT+VPV+E+VYGA++ ADVQ
Sbjct  540   EDAKGAAAASGAENGVPESGDEPVQMESDAKVEAPKKKVKKTSVPVTEIVYGAMAAADVQ  599

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKEFEMALQDR+MEETKDKKNAVE+YVYDMRNKL DKYQEFV DSE+EQ +A LQE
Sbjct  600   KAVEKEFEMALQDRVMEETKDKKNAVESYVYDMRNKLSDKYQEFVTDSEREQFMAVLQE  658



>gb|KDO51190.1| hypothetical protein CISIN_1g003056mg [Citrus sinensis]
Length=726

 Score =   506 bits (1303),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 283/365 (78%), Positives = 317/365 (87%), Gaps = 15/365 (4%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS PILERVK+PLEKA+AE GL+VE++H +EV+GS SRVPAIIKILTEFFGKEPRR
Sbjct  302   EFEQISAPILERVKRPLEKALAETGLSVEDVHMVEVVGSSSRVPAIIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNESFPF I+LSWKG +P+AQN   +NQQST
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNESFPFSISLSWKGSAPEAQNETGDNQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
              VFPKGNPIPSVKALTFYRSGTF++DVQYADVSEL+AP+KISTYTIGPFQS K ERAK+K
Sbjct  422   TVFPKGNPIPSVKALTFYRSGTFTVDVQYADVSELRAPAKISTYTIGPFQSTKSERAKVK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIP----PQDSSETDVNM  709
             VKVRLN+HGIVS+ESATLLEEEEVEVPV KE  KE+ KMETD++P    P  SSETDVNM
Sbjct  482   VKVRLNMHGIVSIESATLLEEEEVEVPVTKEPEKEAAKMETDEVPSDAAPPSSSETDVNM  541

Query  710   QDDKVTSDA--------SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGAL  865
             QD K T+DA        +EN V ESGDKP QMET    + PKKKVKKTN+PVSELVYG +
Sbjct  542   QDAKGTADAQGTTDAPGAENGVPESGDKPTQMET---DKTPKKKVKKTNIPVSELVYGGM  598

Query  866   SPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLI  1045
              P DVQKAVEKEFEMALQDR+MEETKD+KNAVEAYVYDMRNKL DKYQ+FV DSE+E   
Sbjct  599   LPVDVQKAVEKEFEMALQDRVMEETKDRKNAVEAYVYDMRNKLCDKYQDFVTDSERELFT  658

Query  1046  AKLQE  1060
             +KLQE
Sbjct  659   SKLQE  663



>ref|NP_850984.4| Heat shock protein 70 [Arabidopsis thaliana]
 sp|F4HQD4.1|HSP7P_ARATH RecName: Full=Heat shock 70 kDa protein 15; AltName: Full=Heat 
shock protein 70-15; Short=AtHsp70-15 [Arabidopsis thaliana]
 gb|AEE36325.1| Heat shock protein 70 [Arabidopsis thaliana]
Length=831

 Score =   509 bits (1312),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 281/358 (78%), Positives = 321/358 (90%), Gaps = 5/358 (1%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+ISIPILERVK+PLEKA+++AGL VE++H +EV+GSGSRVPA+IKILTEFFGKEPRR
Sbjct  302   EFEEISIPILERVKRPLEKALSDAGLTVEDVHMVEVVGSGSRVPAMIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVR+FQV+ESFPF I+L+WKG + DAQNG  ENQQST
Sbjct  362   TMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSISLAWKGAATDAQNGGTENQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRSGTFSIDVQY+DV++LQAP KISTYTIGPFQS KGERAKLK
Sbjct  422   IVFPKGNPIPSVKALTFYRSGTFSIDVQYSDVNDLQAPPKISTYTIGPFQSSKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQ---DSSETDVNMQ  712
             VKVRLNLHGIVSVESATLLEEEEVEV V K+Q +E+ KM+TD    +    S ++DVNMQ
Sbjct  482   VKVRLNLHGIVSVESATLLEEEEVEVSVTKDQSEETAKMDTDKASAEAAPASGDSDVNMQ  541

Query  713   DDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             D K TSDA  ++N V ES +KPVQMETD+KAEAPKKKVKKTNVP+SELVYGAL   +V+K
Sbjct  542   DAKDTSDATGTDNGVPESAEKPVQMETDSKAEAPKKKVKKTNVPLSELVYGALKTVEVEK  601

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             AVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DKYQE++ DSE+E  +A LQE
Sbjct  602   AVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDKYQEYITDSEREAFLANLQE  659



>gb|AAL38353.1| putative heat-shock protein [Arabidopsis thaliana]
Length=831

 Score =   509 bits (1312),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 281/358 (78%), Positives = 321/358 (90%), Gaps = 5/358 (1%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+ISIPILERVK+PLEKA+++AGL VE++H +EV+GSGSRVPA+IKILTEFFGKEPRR
Sbjct  302   EFEEISIPILERVKRPLEKALSDAGLTVEDVHMVEVVGSGSRVPAMIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVR+FQV+ESFPF I+L+WKG + DAQNG  ENQQST
Sbjct  362   TMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSISLAWKGAATDAQNGGTENQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRSGTFSIDVQY+DV++LQAP KISTYTIGPFQS KGERAKLK
Sbjct  422   IVFPKGNPIPSVKALTFYRSGTFSIDVQYSDVNDLQAPPKISTYTIGPFQSSKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQ---DSSETDVNMQ  712
             VKVRLNLHGIVSVESATLLEEEEVEV V K+Q +E+ KM+TD    +    S ++DVNMQ
Sbjct  482   VKVRLNLHGIVSVESATLLEEEEVEVSVTKDQSEETAKMDTDKASAEAAPASGDSDVNMQ  541

Query  713   DDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             D K TSDA  ++N V ES +KPVQMETD+KAEAPKKKVKKTNVP+SELVYGAL   +V+K
Sbjct  542   DAKDTSDATGTDNGVPESAEKPVQMETDSKAEAPKKKVKKTNVPLSELVYGALKTVEVEK  601

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             AVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DKYQE++ DSE+E  +A LQE
Sbjct  602   AVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDKYQEYITDSEREAFLANLQE  659



>ref|NP_001031305.1| heat shock protein 91 [Arabidopsis thaliana]
 dbj|BAE98929.1| putative heat shock protein [Arabidopsis thaliana]
 gb|AEE36328.1| heat shock protein 91 [Arabidopsis thaliana]
Length=789

 Score =   508 bits (1309),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 282/358 (79%), Positives = 322/358 (90%), Gaps = 5/358 (1%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+ISIPILERVK+PLEKA+++AGL VE++H +EVIGSGSRVPA+IKILTEFFGKEPRR
Sbjct  302   EFEEISIPILERVKRPLEKALSDAGLTVEDVHMVEVIGSGSRVPAMIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVR+FQV+ESFPF I+L+WKG + +AQNG AENQQST
Sbjct  362   TMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSISLAWKGAASEAQNGGAENQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRSGTFS+DVQY+DV++LQAP KISTYTIGPFQS KGERAKLK
Sbjct  422   IVFPKGNPIPSVKALTFYRSGTFSVDVQYSDVNDLQAPPKISTYTIGPFQSSKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQ---DSSETDVNMQ  712
             VKVRLNLHGIVSVESATLLEEEEVEVPV KE  +E+TKM++D    +    S + DVNMQ
Sbjct  482   VKVRLNLHGIVSVESATLLEEEEVEVPVTKEHSEETTKMDSDKASAEAAPASGDCDVNMQ  541

Query  713   DDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             D K TSDA  ++N V ES +KPVQMETD+KAEAPKKKVKKTNVP+SELVYGAL   +V+K
Sbjct  542   DAKDTSDATGTDNGVPESAEKPVQMETDSKAEAPKKKVKKTNVPLSELVYGALKTVEVEK  601

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             AVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DKYQE++ DSE+E  +A LQE
Sbjct  602   AVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDKYQEYITDSEREAFLANLQE  659



>ref|XP_008371663.1| PREDICTED: heat shock 70 kDa protein 15-like [Malus domestica]
Length=855

 Score =   510 bits (1313),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 281/359 (78%), Positives = 320/359 (89%), Gaps = 6/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQISIPILERVK PLEKA+ +A L++E+IH++EV+GSGSRVPAIIKILT+FF KEPRR
Sbjct  302   EFEQISIPILERVKGPLEKALLDAQLSIEDIHTVEVVGSGSRVPAIIKILTDFFKKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNESFPF I+LSWKG  PDAQNGAAEN Q+T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNESFPFSISLSWKGSGPDAQNGAAENNQNT  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPS+KALTF RSGTFS+DVQYADVS+LQAP+KISTYTIGPFQS K ERAKLK
Sbjct  422   LVFPKGNPIPSIKALTFXRSGTFSVDVQYADVSDLQAPAKISTYTIGPFQSVKSERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETD----DIPPQDSSETDVNM  709
             VK RLNLHGIVSV+SATLLEEEE+EVPV KEQ KE+ KMETD    D+ P  + ETDV+M
Sbjct  482   VKARLNLHGIVSVDSATLLEEEEIEVPVTKEQTKEAAKMETDEAPSDVAPPSTKETDVSM  541

Query  710   QDDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD K T+DA  +EN V ESG+KPVQMETDAKA+A K KV+KTN+PV+ELVYG + P +VQ
Sbjct  542   QDAKDTADAPGAENVVPESGEKPVQMETDAKADAKKIKVRKTNIPVTELVYGGMPPNEVQ  601

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KA+EKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DKY EFV +SE+E  IA+LQE
Sbjct  602   KAIEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLNDKYHEFVTESEREAFIARLQE  660



>ref|XP_012073334.1| PREDICTED: heat shock 70 kDa protein 15-like [Jatropha curcas]
 gb|KDP37205.1| hypothetical protein JCGZ_06261 [Jatropha curcas]
Length=847

 Score =   509 bits (1312),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 284/359 (79%), Positives = 316/359 (88%), Gaps = 7/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS+PILERVK+PLEKA+ +A L V+N+H +EV+GSGSR+PAIIKIL+EFFGKEPRR
Sbjct  302   EFEQISVPILERVKRPLEKALQDAKLTVDNVHMVEVVGSGSRIPAIIKILSEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNESFPF IALSWKG +PD+QNGAA+NQQST
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNESFPFTIALSWKGAAPDSQNGAADNQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRSGTF++DVQYADVSELQ P+KISTYTIGPFQS   +RAK+K
Sbjct  422   IVFPKGNPIPSVKALTFYRSGTFTVDVQYADVSELQVPAKISTYTIGPFQSSTSDRAKVK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIP----PQDSSETDVNM  709
             VKVRLNLHGIV+VESATLLEEEEVEVPV KE  KE  KM+TD+      P  S++ DVNM
Sbjct  482   VKVRLNLHGIVAVESATLLEEEEVEVPVTKEPAKEE-KMDTDEASNEATPPSSNDADVNM  540

Query  710   QDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD K T DAS  EN V ESGDKP QMET+ K E PKKKVKKTN+PV+E+VYG L PADVQ
Sbjct  541   QDAKGTGDASGAENGVPESGDKPTQMETETKVEVPKKKVKKTNIPVAEVVYGGLPPADVQ  600

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DKYQEFV D E+E   AKLQE
Sbjct  601   KAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLSDKYQEFVTDPEREDFTAKLQE  659



>ref|NP_178110.6| Heat shock protein 70 [Arabidopsis thaliana]
 gb|AEE36326.1| Heat shock protein 70 [Arabidopsis thaliana]
Length=831

 Score =   509 bits (1310),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 280/358 (78%), Positives = 321/358 (90%), Gaps = 5/358 (1%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+ISIPILERVK+PLEKA+++AGL VE++H +EV+GSGSRVPA+IKILTEFFGKEPRR
Sbjct  302   EFEEISIPILERVKRPLEKALSDAGLTVEDVHMVEVVGSGSRVPAMIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVR+FQV+ESFPF I+L+WKG + DAQNG  ENQQST
Sbjct  362   TMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSISLAWKGAATDAQNGGTENQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRSGTFSIDVQY+DV++LQAP KISTYTIGPFQS KGERAKLK
Sbjct  422   IVFPKGNPIPSVKALTFYRSGTFSIDVQYSDVNDLQAPPKISTYTIGPFQSSKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQ---DSSETDVNMQ  712
             VKVRLNLHGIVSVESATLLEEEEVEV V K+Q +E+ KM+TD    +    S ++DVNMQ
Sbjct  482   VKVRLNLHGIVSVESATLLEEEEVEVSVTKDQSEETAKMDTDKASAEAAPASGDSDVNMQ  541

Query  713   DDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             D K TSDA  ++N V ES +KPVQMETD+KA+APKKKVKKTNVP+SELVYGAL   +V+K
Sbjct  542   DAKDTSDATGTDNGVPESAEKPVQMETDSKAKAPKKKVKKTNVPLSELVYGALKTVEVEK  601

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             AVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DKYQE++ DSE+E  +A LQE
Sbjct  602   AVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDKYQEYITDSEREAFLANLQE  659



>ref|XP_009147592.1| PREDICTED: heat shock 70 kDa protein 14 [Brassica rapa]
 ref|XP_009147593.1| PREDICTED: heat shock 70 kDa protein 14 [Brassica rapa]
Length=818

 Score =   508 bits (1308),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 264/355 (74%), Positives = 304/355 (86%), Gaps = 12/355 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+IS+PILERVK+PLEKA+A+AGL+VE++H +EV+GSGSRVPAIIKILTEFFGKEPRR
Sbjct  302   EFEEISVPILERVKRPLEKALADAGLSVEDVHMVEVVGSGSRVPAIIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVR+FQV+ESFPF I+L+WKG + DAQNG AENQQST
Sbjct  362   TMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSISLAWKGAAADAQNGGAENQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRSGTFS+DVQY+DV++LQAP+KISTYTIGPFQS KGERAK+K
Sbjct  422   IVFPKGNPIPSVKALTFYRSGTFSVDVQYSDVTDLQAPAKISTYTIGPFQSSKGERAKVK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQDDK  721
             VKVRL LHGI        +E   +      E    + +M+TD    + S ETDVNMQD K
Sbjct  482   VKVRLTLHGI------VSVESATLLEEEEVEVPVTTEQMDTD----KASGETDVNMQDAK  531

Query  722   VTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVE  895
              TSDA  ++N V ES DKPVQMETD+KAEAPKKKVKKTNVP+SELVYGAL   DVQKAVE
Sbjct  532   ETSDAAGADNGVAESADKPVQMETDSKAEAPKKKVKKTNVPLSELVYGALQSVDVQKAVE  591

Query  896   KEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KE+EMALQDR+MEETKDKKNAVE+YVYDMRNKL DK  E++ +SE+E  +AKLQE
Sbjct  592   KEYEMALQDRVMEETKDKKNAVESYVYDMRNKLSDKLHEYITESEREAFLAKLQE  646



>ref|XP_002279789.2| PREDICTED: heat shock 70 kDa protein 14-like [Vitis vinifera]
 ref|XP_010654673.1| PREDICTED: heat shock 70 kDa protein 14-like [Vitis vinifera]
 ref|XP_010654674.1| PREDICTED: heat shock 70 kDa protein 14-like [Vitis vinifera]
Length=848

 Score =   509 bits (1310),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 283/358 (79%), Positives = 316/358 (88%), Gaps = 8/358 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS+PILERVK PLE+A+++AGL+ ENIH++EV+GSGSRVPAII+ILTEFFGKEPRR
Sbjct  302   EFEQISVPILERVKGPLEEALSDAGLSAENIHAVEVVGSGSRVPAIIRILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV+KGCALQCAILSPTFKVR+FQVNESFPF IAL+WKG   DAQNGAA+NQQ+T
Sbjct  362   TMNASECVAKGCALQCAILSPTFKVREFQVNESFPFTIALTWKG---DAQNGAADNQQNT  418

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPSVKALTFYRSGTFS+DV YAD SE+Q   KISTYTIGPFQS K ERAKLK
Sbjct  419   VVFPKGNPIPSVKALTFYRSGTFSVDVVYADASEIQGQVKISTYTIGPFQSTKVERAKLK  478

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIP-----PQDSSETDVN  706
             VKVRLNLHGIVSVESATLLEEEEVE+PVVKE  K++TKM+TD+ P     P  +SETD N
Sbjct  479   VKVRLNLHGIVSVESATLLEEEEVEIPVVKEPAKDATKMDTDETPGDAAAPPGTSETDAN  538

Query  707   MQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             MQD K  +   EN V ESGDK VQMETD K E PKKKVKKTN+PVSELVYG + PADVQK
Sbjct  539   MQDAKGDAPGVENGVPESGDKSVQMETDTKVEVPKKKVKKTNIPVSELVYGTMVPADVQK  598

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             AVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL+DKYQ+FV  SE+++  AKLQE
Sbjct  599   AVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLHDKYQDFVTSSERDEFTAKLQE  656



>ref|XP_006842242.1| PREDICTED: heat shock 70 kDa protein 14 [Amborella trichopoda]
 ref|XP_011622541.1| PREDICTED: heat shock 70 kDa protein 14 [Amborella trichopoda]
 ref|XP_011622542.1| PREDICTED: heat shock 70 kDa protein 14 [Amborella trichopoda]
 ref|XP_011622543.1| PREDICTED: heat shock 70 kDa protein 14 [Amborella trichopoda]
 gb|ERN03917.1| hypothetical protein AMTR_s00078p00190750 [Amborella trichopoda]
Length=855

 Score =   509 bits (1310),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 283/365 (78%), Positives = 319/365 (87%), Gaps = 12/365 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FEQ+S+PILERVK+PL+KA+ +AGLAVENIHS+EV+GSGSRVPAIIKILTEFFGKEPRR
Sbjct  302   DFEQLSVPILERVKRPLQKALLDAGLAVENIHSVEVVGSGSRVPAIIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++G ALQCAILSPTFKVR+FQV+ESFPFPIALSWKGP+PD+QNGA ++QQST
Sbjct  362   TMNASECVARGAALQCAILSPTFKVREFQVHESFPFPIALSWKGPAPDSQNGATDHQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRS TF++DV YADVSELQAP  IS+YTIGPFQS KGERAK+K
Sbjct  422   IVFPKGNPIPSVKALTFYRSSTFTVDVVYADVSELQAPPLISSYTIGPFQSAKGERAKVK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvv-----keqlkeSTKMETDDIP----PQDSSE  694
             VKVRLNLHGIVSVESATLLEEEEVEVPV       ++ KE+TKMETDD+P    P  S E
Sbjct  482   VKVRLNLHGIVSVESATLLEEEEVEVPVSPVKEPVKETKEATKMETDDVPSESGPPPSDE  541

Query  695   TDVNMQDDKVTSDA---SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGAL  865
              +VNM D K   DA    EN + ESGDKPVQMETDAK EA KKKV+K NVPVSE+VYGA+
Sbjct  542   NEVNMADAKPAGDAPGGPENGIPESGDKPVQMETDAKPEASKKKVRKINVPVSEVVYGAM  601

Query  866   SPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLI  1045
               AD+QK +EKEFEMALQDR+MEETKD+KNAVEAYVYDMRNKLYDKYQEFV +SE+E   
Sbjct  602   VTADLQKVIEKEFEMALQDRVMEETKDRKNAVEAYVYDMRNKLYDKYQEFVTESEREAFS  661

Query  1046  AKLQE  1060
              KLQE
Sbjct  662   QKLQE  666



>ref|XP_009358190.1| PREDICTED: heat shock 70 kDa protein 15-like [Pyrus x bretschneideri]
Length=855

 Score =   509 bits (1310),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 279/359 (78%), Positives = 319/359 (89%), Gaps = 6/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQISIPILERVK PLEKA+ +A L++E+IH++EV+GSGSRVPAIIKILT+FF KEPRR
Sbjct  302   EFEQISIPILERVKGPLEKALLDAQLSIEDIHTVEVVGSGSRVPAIIKILTDFFKKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNESFPF I+LSWKG  PDAQNGAAEN Q+T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNESFPFSISLSWKGSGPDAQNGAAENNQNT  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPS+KALTFYRSGTFS+DVQYADVS+LQAP+KISTYTIGPFQS K ERAKLK
Sbjct  422   LVFPKGNPIPSIKALTFYRSGTFSVDVQYADVSDLQAPAKISTYTIGPFQSVKSERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIP----PQDSSETDVNM  709
             VK RLNLHGIVSV+SATLLEEEE+EVPV KEQ KE+ KMETD+ P    P  + ETDVNM
Sbjct  482   VKARLNLHGIVSVDSATLLEEEEIEVPVTKEQTKEAAKMETDEAPSDAAPPSTKETDVNM  541

Query  710   QDDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD K T+DA  +E  V ESGDKP QMETDAKA+A K KV+KTN+PV+ELVYG + P ++Q
Sbjct  542   QDAKDTADAPGAETGVPESGDKPAQMETDAKADAKKIKVRKTNIPVTELVYGGMPPNELQ  601

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KA+EKEFEMALQDR+MEETKDKKNAVEAYVY+MR+KL DKY EFV +SE+E  IA+LQE
Sbjct  602   KAIEKEFEMALQDRVMEETKDKKNAVEAYVYNMRSKLNDKYHEFVTESEREAFIARLQE  660



>ref|NP_178111.1| heat shock protein 91 [Arabidopsis thaliana]
 sp|Q9S7C0.1|HSP7O_ARATH RecName: Full=Heat shock 70 kDa protein 14; AltName: Full=Heat 
shock protein 70-14; Short=AtHsp70-14; AltName: Full=Heat 
shock protein 91 [Arabidopsis thaliana]
 gb|AAD55461.1|AC009322_1 Heat-shock protein [Arabidopsis thaliana]
 gb|AAG52240.1|AC011717_8 putative heat-shock protein; 37113-40399 [Arabidopsis thaliana]
 gb|AAL84971.1| At1g79930/F19K16_11 [Arabidopsis thaliana]
 gb|AAO11541.1| At1g79930/F19K16_11 [Arabidopsis thaliana]
 gb|AEE36327.1| heat shock protein 91 [Arabidopsis thaliana]
Length=831

 Score =   508 bits (1308),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 282/358 (79%), Positives = 322/358 (90%), Gaps = 5/358 (1%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+ISIPILERVK+PLEKA+++AGL VE++H +EVIGSGSRVPA+IKILTEFFGKEPRR
Sbjct  302   EFEEISIPILERVKRPLEKALSDAGLTVEDVHMVEVIGSGSRVPAMIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVR+FQV+ESFPF I+L+WKG + +AQNG AENQQST
Sbjct  362   TMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSISLAWKGAASEAQNGGAENQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRSGTFS+DVQY+DV++LQAP KISTYTIGPFQS KGERAKLK
Sbjct  422   IVFPKGNPIPSVKALTFYRSGTFSVDVQYSDVNDLQAPPKISTYTIGPFQSSKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQ---DSSETDVNMQ  712
             VKVRLNLHGIVSVESATLLEEEEVEVPV KE  +E+TKM++D    +    S + DVNMQ
Sbjct  482   VKVRLNLHGIVSVESATLLEEEEVEVPVTKEHSEETTKMDSDKASAEAAPASGDCDVNMQ  541

Query  713   DDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             D K TSDA  ++N V ES +KPVQMETD+KAEAPKKKVKKTNVP+SELVYGAL   +V+K
Sbjct  542   DAKDTSDATGTDNGVPESAEKPVQMETDSKAEAPKKKVKKTNVPLSELVYGALKTVEVEK  601

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             AVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DKYQE++ DSE+E  +A LQE
Sbjct  602   AVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDKYQEYITDSEREAFLANLQE  659



>gb|EYU24688.1| hypothetical protein MIMGU_mgv1a001324mg [Erythranthe guttata]
Length=840

 Score =   508 bits (1308),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 280/353 (79%), Positives = 314/353 (89%), Gaps = 5/353 (1%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+ISIPILERVKKPLEKA+ EAGL +ENIHS+EV+GSGSRVPAII+ILTEFFGKEPRR
Sbjct  302   EFEEISIPILERVKKPLEKALVEAGLTIENIHSVEVVGSGSRVPAIIRILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV+KG AL+CAILSPTFKVR+FQVNESFPFPIALSWK  + D+QN AA+NQQST
Sbjct  362   TMNASECVAKGTALECAILSPTFKVREFQVNESFPFPIALSWKVSASDSQNAAADNQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPSVKALTFYRSGTF++DVQYADVSELQAP+KISTYTIGPFQS KGERAKLK
Sbjct  422   VVFPKGNPIPSVKALTFYRSGTFTLDVQYADVSELQAPAKISTYTIGPFQSAKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQDDK  721
             VKVRLNLHGIVSVESATLLEEEE EVPVVK   +ESTKMETD++    +  +    +D  
Sbjct  482   VKVRLNLHGIVSVESATLLEEEETEVPVVKGSSQESTKMETDELAADSAPPSTTETED--  539

Query  722   VTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVEKE  901
                  +EN V ESGDK VQMETDAK +APKKKVKKTNVPVSE++YG L+  DVQKAVEKE
Sbjct  540   ---AGAENGVEESGDKSVQMETDAKVDAPKKKVKKTNVPVSEVIYGGLAAVDVQKAVEKE  596

Query  902   FEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             FEMALQDR+MEETKDKKNAVEAYVY+MRNKL DKY +FV++SE+EQ IA+LQE
Sbjct  597   FEMALQDRVMEETKDKKNAVEAYVYEMRNKLNDKYHDFVMESEREQFIARLQE  649



>emb|CDY24089.1| BnaA06g00870D [Brassica napus]
Length=858

 Score =   507 bits (1306),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 264/355 (74%), Positives = 304/355 (86%), Gaps = 12/355 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+IS+PILERVK+PLEKA+A+AGL+VE++H +EV+GSGSRVPAIIKILTEFFGKEPRR
Sbjct  342   EFEEISVPILERVKRPLEKALADAGLSVEDVHMVEVVGSGSRVPAIIKILTEFFGKEPRR  401

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVR+FQV+ESFPF I+L+WKG + DAQNG AENQQST
Sbjct  402   TMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSISLAWKGAAADAQNGGAENQQST  461

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRSGTFS+DVQY+DV++LQAP+KISTYTIGPFQS KGERAK+K
Sbjct  462   IVFPKGNPIPSVKALTFYRSGTFSVDVQYSDVTDLQAPAKISTYTIGPFQSSKGERAKVK  521

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQDDK  721
             VKVRL LHGI        +E   +      E    + +M+TD    + S ETDVNMQD K
Sbjct  522   VKVRLTLHGI------VSVESATLLEEEEVEVPVTTEQMDTD----KASGETDVNMQDAK  571

Query  722   VTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVE  895
              TSDA  ++N V ES DKPVQMETD+KAEAPKKKVKKTNVP+SELVYGAL   DVQKAVE
Sbjct  572   ETSDAAGADNGVAESADKPVQMETDSKAEAPKKKVKKTNVPLSELVYGALQSVDVQKAVE  631

Query  896   KEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KE+EMALQDR+MEETKDKKNAVE+YVYDMRNKL DK  E++ +SE+E  +AKLQE
Sbjct  632   KEYEMALQDRVMEETKDKKNAVESYVYDMRNKLSDKLHEYITESEREAFLAKLQE  686



>ref|XP_009358191.1| PREDICTED: heat shock 70 kDa protein 15-like [Pyrus x bretschneideri]
 ref|XP_009358192.1| PREDICTED: heat shock 70 kDa protein 15-like [Pyrus x bretschneideri]
Length=855

 Score =   507 bits (1306),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 278/359 (77%), Positives = 318/359 (89%), Gaps = 6/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQISIPILERVK PLEKA+ +A L++E+IH++EV+GSGSRVPAIIKILT+FF KEPRR
Sbjct  302   EFEQISIPILERVKGPLEKALLDAQLSIEDIHTVEVVGSGSRVPAIIKILTDFFNKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNESFPF I+LSWKG  PDAQNGAAEN Q+T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNESFPFSISLSWKGSGPDAQNGAAENNQNT  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPS+KALTFYRSGTFS+DVQYADVS+LQAP+KISTYTIGPFQS K ERAKLK
Sbjct  422   LVFPKGNPIPSIKALTFYRSGTFSVDVQYADVSDLQAPAKISTYTIGPFQSVKSERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIP----PQDSSETDVNM  709
             VK RLNLHGIVSV+SATLLEEEE+EVPV KEQ KE+ KMETD+ P    P  + ETDVNM
Sbjct  482   VKARLNLHGIVSVDSATLLEEEEIEVPVTKEQTKEAAKMETDEAPSDAAPPSTKETDVNM  541

Query  710   QDDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD K  +DA  +E  V ESGDKP QMETDAKA+A K KV+KTN+PV+ELVYG + P ++Q
Sbjct  542   QDAKDNADAPGAETGVPESGDKPAQMETDAKADAKKIKVRKTNIPVTELVYGGMPPNELQ  601

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KA+EKEFEMALQDR+MEETKDKKNAVEAYVY+MR+KL DKY EFV +SE+E  IA+LQE
Sbjct  602   KAIEKEFEMALQDRVMEETKDKKNAVEAYVYNMRSKLNDKYHEFVTESEREAFIARLQE  660



>ref|XP_006427039.1| hypothetical protein CICLE_v10024883mg [Citrus clementina]
 gb|ESR40279.1| hypothetical protein CICLE_v10024883mg [Citrus clementina]
Length=852

 Score =   507 bits (1305),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 283/365 (78%), Positives = 317/365 (87%), Gaps = 15/365 (4%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS PILERVK+PLEKA+AE GL+VE++H +EV+GS SRVPAIIKILTEFFGKEPRR
Sbjct  302   EFEQISAPILERVKRPLEKALAETGLSVEDVHMVEVVGSSSRVPAIIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNESFPF I+LSWKG +P+AQN   +NQQST
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNESFPFSISLSWKGSAPEAQNETGDNQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
              VFPKGNPIPSVKALTFYRSGTF++DVQYADVSEL+AP+KISTYTIGPFQS K ERAK+K
Sbjct  422   TVFPKGNPIPSVKALTFYRSGTFTVDVQYADVSELRAPAKISTYTIGPFQSTKSERAKVK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIP----PQDSSETDVNM  709
             VKVRLN+HGIVS+ESATLLEEEEVEVPV KE  KE+ KMETD++P    P  SSETDVNM
Sbjct  482   VKVRLNMHGIVSIESATLLEEEEVEVPVTKEPEKEAAKMETDEVPSDTAPPSSSETDVNM  541

Query  710   QDDKVTSDA--------SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGAL  865
             QD K T+DA        +EN V ESGDKP QMET    + PKKKVKKTN+PVSELVYG +
Sbjct  542   QDAKGTADAQGTTDAPGAENGVPESGDKPTQMET---DKTPKKKVKKTNIPVSELVYGGM  598

Query  866   SPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLI  1045
              P DVQKAVEKEFEMALQDR+MEETKD+KNAVEAYVYDMRNKL DKYQ+FV DSE+E   
Sbjct  599   LPVDVQKAVEKEFEMALQDRVMEETKDRKNAVEAYVYDMRNKLCDKYQDFVTDSERELFT  658

Query  1046  AKLQE  1060
             +KLQE
Sbjct  659   SKLQE  663



>ref|XP_006392781.1| hypothetical protein EUTSA_v10011242mg [Eutrema salsugineum]
 gb|ESQ30067.1| hypothetical protein EUTSA_v10011242mg [Eutrema salsugineum]
Length=829

 Score =   506 bits (1303),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 280/358 (78%), Positives = 320/358 (89%), Gaps = 5/358 (1%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+ISIPILERVK+PLEKA+++AGL +E++H +EV+GSGSRVPAIIKILTEFFGKEPRR
Sbjct  302   EFEEISIPILERVKRPLEKALSDAGLTIEDVHMVEVVGSGSRVPAIIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVR+FQV+ESFPF I+L+WKG + DAQNG AENQQST
Sbjct  362   TMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSISLAWKGATSDAQNGGAENQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGN IPSVKALTFYRSGTFS+DVQY+DV++LQAP KISTYTIGPFQS KGERAKLK
Sbjct  422   IVFPKGNSIPSVKALTFYRSGTFSVDVQYSDVTDLQAPPKISTYTIGPFQSSKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQD---SSETDVNMQ  712
             VKVRL LHGIVSVESATLLEEEEVEVPV KEQ  E+TKM+TD    +    S E+DVNM+
Sbjct  482   VKVRLTLHGIVSVESATLLEEEEVEVPVTKEQSGEATKMDTDKASAETAPASGESDVNMR  541

Query  713   DDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             D   TSDA  ++N V ES DKPVQMETD+KAEAPKKKVKKTNVP+SELVYGA+   +VQK
Sbjct  542   DSNETSDAAGTDNGVPESADKPVQMETDSKAEAPKKKVKKTNVPLSELVYGAMQSGEVQK  601

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             AVEKE+EMALQDR+MEETKD+KNAVE+YVYDMRNKL DKY E++ +SE+E  +AKLQE
Sbjct  602   AVEKEYEMALQDRVMEETKDRKNAVESYVYDMRNKLSDKYHEYITESEREAFLAKLQE  659



>gb|KDO51189.1| hypothetical protein CISIN_1g003056mg [Citrus sinensis]
Length=852

 Score =   507 bits (1305),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 283/365 (78%), Positives = 317/365 (87%), Gaps = 15/365 (4%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS PILERVK+PLEKA+AE GL+VE++H +EV+GS SRVPAIIKILTEFFGKEPRR
Sbjct  302   EFEQISAPILERVKRPLEKALAETGLSVEDVHMVEVVGSSSRVPAIIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNESFPF I+LSWKG +P+AQN   +NQQST
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNESFPFSISLSWKGSAPEAQNETGDNQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
              VFPKGNPIPSVKALTFYRSGTF++DVQYADVSEL+AP+KISTYTIGPFQS K ERAK+K
Sbjct  422   TVFPKGNPIPSVKALTFYRSGTFTVDVQYADVSELRAPAKISTYTIGPFQSTKSERAKVK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIP----PQDSSETDVNM  709
             VKVRLN+HGIVS+ESATLLEEEEVEVPV KE  KE+ KMETD++P    P  SSETDVNM
Sbjct  482   VKVRLNMHGIVSIESATLLEEEEVEVPVTKEPEKEAAKMETDEVPSDAAPPSSSETDVNM  541

Query  710   QDDKVTSDA--------SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGAL  865
             QD K T+DA        +EN V ESGDKP QMET    + PKKKVKKTN+PVSELVYG +
Sbjct  542   QDAKGTADAQGTTDAPGAENGVPESGDKPTQMET---DKTPKKKVKKTNIPVSELVYGGM  598

Query  866   SPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLI  1045
              P DVQKAVEKEFEMALQDR+MEETKD+KNAVEAYVYDMRNKL DKYQ+FV DSE+E   
Sbjct  599   LPVDVQKAVEKEFEMALQDRVMEETKDRKNAVEAYVYDMRNKLCDKYQDFVTDSERELFT  658

Query  1046  AKLQE  1060
             +KLQE
Sbjct  659   SKLQE  663



>ref|XP_006465548.1| PREDICTED: heat shock 70 kDa protein 14-like [Citrus sinensis]
Length=852

 Score =   506 bits (1304),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 283/365 (78%), Positives = 317/365 (87%), Gaps = 15/365 (4%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS PILERVK+PLEKA+AE GL+VE++H +EV+GS SRVPAIIKILTEFFGKEPRR
Sbjct  302   EFEQISAPILERVKRPLEKALAETGLSVEDVHMVEVVGSSSRVPAIIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNESFPF I+LSWKG +P+AQN   +NQQST
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNESFPFSISLSWKGSAPEAQNETGDNQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
              VFPKGNPIPSVKALTFYRSGTF++DVQYADVSEL+AP+KISTYTIGPFQS K ERAK+K
Sbjct  422   TVFPKGNPIPSVKALTFYRSGTFTVDVQYADVSELRAPAKISTYTIGPFQSTKSERAKVK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIP----PQDSSETDVNM  709
             VKVRLN+HGIVS+ESATLLEEEEVEVPV KE  KE+ KMETD++P    P  SSETDVNM
Sbjct  482   VKVRLNMHGIVSIESATLLEEEEVEVPVTKEPEKEAAKMETDEVPSDAAPPSSSETDVNM  541

Query  710   QDDKVTSDA--------SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGAL  865
             QD K T+DA        +EN V ESGDKP QMET    + PKKKVKKTN+PVSELVYG +
Sbjct  542   QDAKGTADAQGTTDAPGAENGVPESGDKPTQMET---DKTPKKKVKKTNIPVSELVYGGM  598

Query  866   SPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLI  1045
              P DVQKAVEKEFEMALQDR+MEETKD+KNAVEAYVYDMRNKL DKYQ+FV DSE+E   
Sbjct  599   LPVDVQKAVEKEFEMALQDRVMEETKDRKNAVEAYVYDMRNKLCDKYQDFVTDSERELFT  658

Query  1046  AKLQE  1060
             +KLQE
Sbjct  659   SKLQE  663



>emb|CAA94389.1| heat-shock protein [Arabidopsis thaliana]
Length=831

 Score =   506 bits (1302),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 281/358 (78%), Positives = 320/358 (89%), Gaps = 5/358 (1%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+ISIPILERVK+PLEKA+++AGL VE++H +EVIGSGSRVPA+IKILTEFFGKEPRR
Sbjct  302   EFEEISIPILERVKRPLEKALSDAGLTVEDVHMVEVIGSGSRVPAMIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVR+FQV+ESFPF I+L+WKG + +AQNG AENQQST
Sbjct  362   TMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSISLAWKGAASEAQNGGAENQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRSGTFS+D QY+DV++LQAP KISTYTIGPFQS KGERAKLK
Sbjct  422   IVFPKGNPIPSVKALTFYRSGTFSVDAQYSDVNDLQAPPKISTYTIGPFQSSKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQ---DSSETDVNMQ  712
             VKVRLNLHGIVSVESATLLEEEEVEVPV KE  +E+TKM++D    +    S + DVNMQ
Sbjct  482   VKVRLNLHGIVSVESATLLEEEEVEVPVTKEHSEETTKMDSDKASAEAAPASGDCDVNMQ  541

Query  713   DDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             D K TSDA  ++N V ES +KPVQMETD+KAEAPKKKVKKTNVP+SELVYGAL   +V+K
Sbjct  542   DAKDTSDATSTDNGVPESAEKPVQMETDSKAEAPKKKVKKTNVPLSELVYGALKTVEVEK  601

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             AVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DKYQE++ DSE E  +A LQE
Sbjct  602   AVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDKYQEYITDSETEAFLANLQE  659



>ref|XP_010473008.1| PREDICTED: heat shock 70 kDa protein 15-like [Camelina sativa]
Length=830

 Score =   503 bits (1296),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 279/358 (78%), Positives = 322/358 (90%), Gaps = 5/358 (1%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+ISIPILERVK+PLEKA+++AGL VE++H +EV+GSGSRVPA+IKILTEFFGKEPRR
Sbjct  302   EFEEISIPILERVKRPLEKALSDAGLTVEDVHMVEVVGSGSRVPAMIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVR+FQV+ESFPF I+L+WKG + DAQNG +EN QST
Sbjct  362   TMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSISLAWKGAASDAQNGGSENLQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGN IPSVKALTFYRSGTFS+DVQY+DV +LQAP KISTYTIGPFQS KGERAKLK
Sbjct  422   IVFPKGNSIPSVKALTFYRSGTFSVDVQYSDVKDLQAPPKISTYTIGPFQSLKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQ---DSSETDVNMQ  712
             VKVRLNLHG+VSVESATLLEEEEVEVPV KE+ +E+ KM+TD    +    S ++DVNMQ
Sbjct  482   VKVRLNLHGVVSVESATLLEEEEVEVPVSKEKSQETAKMDTDKASSEAAPASGDSDVNMQ  541

Query  713   DDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             D K T+DA  +EN V ES DKPVQMETD+KAEAPKKKVKKTNVP+SE+VYGAL   +V+K
Sbjct  542   DAKETTDAGSTENGVPESADKPVQMETDSKAEAPKKKVKKTNVPLSEVVYGALKSLEVEK  601

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             AVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DKYQE+++DSE+E  +AKLQE
Sbjct  602   AVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDKYQEYIIDSEREAFLAKLQE  659



>ref|XP_010539495.1| PREDICTED: heat shock 70 kDa protein 15-like [Tarenaya hassleriana]
Length=866

 Score =   504 bits (1298),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 267/358 (75%), Positives = 300/358 (84%), Gaps = 6/358 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQISIPILERVK+PLE A+++AGL VEN+H +EV+GSGSRVPAIIKILTEFFGKEPRR
Sbjct  322   EFEQISIPILERVKRPLENALSDAGLTVENVHMVEVVGSGSRVPAIIKILTEFFGKEPRR  381

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQV+ESFPF IALSWKG SPD +NG +EN+ ST
Sbjct  382   TMNASECVARGCALQCAILSPTFKVREFQVHESFPFSIALSWKGSSPDTENGGSENEHST  441

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPSVKALTFYRSGTFS+DVQYADVS LQAP+KISTYTIGPFQS K ERAKLK
Sbjct  442   VVFPKGNPIPSVKALTFYRSGTFSVDVQYADVSGLQAPAKISTYTIGPFQSAKAERAKLK  501

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQD---SSETDVNMQ  712
             VK RLNLHGI     +  L EEE     V ++ +E+TKM+TD  P      S E DVNMQ
Sbjct  502   VKARLNLHGI-VSVESATLLEEEEVEVPVTKESEEATKMDTDKAPVDTVPASGEHDVNMQ  560

Query  713   DDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             D K   DA  +EN V ES  KPV +ETD K EAPKKKVKKT +PVSELVYGAL   DVQK
Sbjct  561   DAKEPGDAPGAENGVQESASKPVHIETDTKVEAPKKKVKKTTIPVSELVYGALQSVDVQK  620

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             AVEKEFEMALQDR+MEETKD+KNAVEAYVYDMRNKL DKYQE++ DS++E  +AKLQE
Sbjct  621   AVEKEFEMALQDRVMEETKDRKNAVEAYVYDMRNKLSDKYQEYITDSDREAFLAKLQE  678



>ref|XP_010430044.1| PREDICTED: heat shock 70 kDa protein 15 [Camelina sativa]
Length=830

 Score =   503 bits (1294),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 278/358 (78%), Positives = 321/358 (90%), Gaps = 5/358 (1%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+ISIPILERVK+PLEKA+++AGL VE++H +EV+GSGSRVPA+IKILTEFFGKEPRR
Sbjct  302   EFEEISIPILERVKRPLEKALSDAGLTVEDVHMVEVVGSGSRVPAMIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVR+FQV+ESFPF I+L+WKG + DAQNG AENQQST
Sbjct  362   TMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSISLAWKGAASDAQNGGAENQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGN IPSVKALTFYRSGTFS+DVQY+DV +L AP KISTYT GPFQS KGER+KLK
Sbjct  422   IVFPKGNLIPSVKALTFYRSGTFSVDVQYSDVKDLHAPPKISTYTNGPFQSSKGERSKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQ---DSSETDVNMQ  712
             VKVRLNLHG+VSVESATLLEEEEVEVPV KE+ +E+ KM+TD    +    S ++DVNMQ
Sbjct  482   VKVRLNLHGVVSVESATLLEEEEVEVPVSKEKSQETAKMDTDKASAEAAPASGDSDVNMQ  541

Query  713   DDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             D K T+DA  +EN V ES DKPVQMETD+KAEAPKKKVKKTNVP+SE+VYGAL   +V+K
Sbjct  542   DAKETTDATSTENGVPESADKPVQMETDSKAEAPKKKVKKTNVPLSEVVYGALKSLEVEK  601

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             AVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DKYQE+++DSE+E  +AKLQE
Sbjct  602   AVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDKYQEYIIDSEREAFLAKLQE  659



>ref|XP_006300740.1| hypothetical protein CARUB_v10019803mg [Capsella rubella]
 gb|EOA33638.1| hypothetical protein CARUB_v10019803mg [Capsella rubella]
Length=828

 Score =   501 bits (1291),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 279/357 (78%), Positives = 322/357 (90%), Gaps = 5/357 (1%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+ISIPILERVK+PLEKA+++AGL VE++H +EV+GSGSRVPA+IKILTEFFGKEPRR
Sbjct  302   EFEEISIPILERVKRPLEKALSDAGLTVEDVHMVEVVGSGSRVPAMIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVR+FQV+ESFPF I+L+WKG + DAQNG AENQQST
Sbjct  362   TMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSISLAWKGLASDAQNGGAENQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRSGTFS+DVQY+DV+ELQAP KISTY+IGPFQS KGERAKLK
Sbjct  422   IVFPKGNPIPSVKALTFYRSGTFSVDVQYSDVNELQAPPKISTYSIGPFQSSKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMET--DDIPPQDSSETDVNMQD  715
             VKVRLNLHGIVSVESATLLEEEEVEVPV K+Q +E+ KMET   +  P  S ++DVNMQD
Sbjct  482   VKVRLNLHGIVSVESATLLEEEEVEVPVSKDQSEETAKMETASAETAPA-SGDSDVNMQD  540

Query  716   DKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKA  889
              K TSDA  ++N   ES DKPVQMETD+KAEAPKKKVKKTNVP+SE+VYGAL   +V+KA
Sbjct  541   AKGTSDAAGTDNGAPESADKPVQMETDSKAEAPKKKVKKTNVPLSEVVYGALKSVEVEKA  600

Query  890   VEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             VEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DKY+E++ D+++E  + KLQE
Sbjct  601   VEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDKYEEYITDADREAFLVKLQE  657



>ref|XP_008362708.1| PREDICTED: heat shock 70 kDa protein 15-like [Malus domestica]
Length=855

 Score =   502 bits (1293),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 278/359 (77%), Positives = 317/359 (88%), Gaps = 6/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQISIPILERVK PLEKA+ +A L++E+IH++EV+GSGSRVPAIIKILT+FF KEPRR
Sbjct  302   EFEQISIPILERVKGPLEKALLDAQLSIEDIHTVEVVGSGSRVPAIIKILTDFFKKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNESFPF I+LSWKG  PDAQNGAAEN Q+T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNESFPFSISLSWKGSGPDAQNGAAENNQNT  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPS+KALTFYRS TFS+DVQYADVS+LQAP+KISTYTIGPF S K ERAKLK
Sbjct  422   LVFPKGNPIPSIKALTFYRSXTFSVDVQYADVSDLQAPAKISTYTIGPFPSVKSERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETD----DIPPQDSSETDVNM  709
             VK RLNLHGIVSV+SATLLEEEE+EVPV KEQ KE+ KMETD    D+ P  + ETDV+M
Sbjct  482   VKARLNLHGIVSVDSATLLEEEEIEVPVTKEQTKEAAKMETDEAPSDVAPPSTEETDVSM  541

Query  710   QDDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD K T+DA  +EN V ESG+KP QMETDAKA+A K KV+KTN+PV+ELVYG +   +VQ
Sbjct  542   QDAKDTADAPGAENVVPESGEKPAQMETDAKADAKKIKVRKTNIPVTELVYGGMPLNEVQ  601

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KA+EKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DKY EFV +SE+E  IA+LQE
Sbjct  602   KAIEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLNDKYHEFVTESEREAFIARLQE  660



>ref|XP_010538015.1| PREDICTED: heat shock 70 kDa protein 14 [Tarenaya hassleriana]
 ref|XP_010538016.1| PREDICTED: heat shock 70 kDa protein 14 [Tarenaya hassleriana]
Length=829

 Score =   501 bits (1291),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 265/358 (74%), Positives = 305/358 (85%), Gaps = 6/358 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQISIPILERVK+PLE A+A+AG  VEN+H +EV+GSGSRVPAIIKILTEFFGKEPRR
Sbjct  302   EFEQISIPILERVKRPLETALADAGFTVENVHMVEVVGSGSRVPAIIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQV+ESFPF IALSWKG + DA+NG AENQQST
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVHESFPFSIALSWKGSTSDAENGGAENQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPSVKALTFYR+GTF++DVQY D S+LQ P +ISTYTIGPFQS KGERAKLK
Sbjct  422   VVFPKGNPIPSVKALTFYRTGTFTVDVQYTDPSDLQVPPQISTYTIGPFQSSKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDD---IPPQDSSETDVNMQ  712
             VK RLNLHGI     +  L EEE     V ++  E+TKM+TD+        SS++DVNMQ
Sbjct  482   VKARLNLHGI-VSIESATLLEEEEVEVPVTKEHVEATKMDTDNAPAEAAPASSDSDVNMQ  540

Query  713   DDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             D K T DA  +EN V ES DKPVQMETD+K +APKKKVKKTNVPVSE+VYGA+  ADVQK
Sbjct  541   DAKGTGDAPGAENGVPESTDKPVQMETDSKVKAPKKKVKKTNVPVSEMVYGAMQSADVQK  600

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             AVEKEFEMALQDR+MEETKD+KNAVEAYVYDMRNKL DKYQE++ ++++E  +AKLQE
Sbjct  601   AVEKEFEMALQDRVMEETKDRKNAVEAYVYDMRNKLSDKYQEYITETDREAFLAKLQE  658



>ref|XP_010430043.1| PREDICTED: heat shock 70 kDa protein 15-like [Camelina sativa]
Length=829

 Score =   500 bits (1288),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 280/357 (78%), Positives = 321/357 (90%), Gaps = 5/357 (1%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE++SIPILERVK+PLEKA+++AGL VE++H +EV+GSGSRVPA+IKILTEFFGKEPRR
Sbjct  302   EFEEVSIPILERVKRPLEKALSDAGLTVEDVHMVEVVGSGSRVPAMIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVR+FQV+ESFPF I+L+WKG + D+QNG  ENQQST
Sbjct  362   TMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSISLAWKGLASDSQNGGTENQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRSGTFS+DVQY+DV+ELQAP KISTYTIGPFQS KGERAKLK
Sbjct  422   IVFPKGNPIPSVKALTFYRSGTFSVDVQYSDVNELQAPPKISTYTIGPFQSSKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMET--DDIPPQDSSETDVNMQD  715
             VKVRLNLHGIVSVESATLLEEEEVEVPV KEQ +E+TKMET   +  P  S ++DVNMQD
Sbjct  482   VKVRLNLHGIVSVESATLLEEEEVEVPVSKEQSEETTKMETAPAETAPA-SGDSDVNMQD  540

Query  716   DKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKA  889
              K + DA  ++N   ES DKPVQMETD+KAEAPKKKVKKTNVP+SE+VYGAL   +V+KA
Sbjct  541   AKESVDAAGTDNGAPESTDKPVQMETDSKAEAPKKKVKKTNVPLSEVVYGALKSVEVEKA  600

Query  890   VEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             VEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DKYQE++ D E+E  +AKLQE
Sbjct  601   VEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDKYQEYITDVEREAFLAKLQE  657



>ref|XP_010473009.1| PREDICTED: heat shock 70 kDa protein 15-like [Camelina sativa]
Length=829

 Score =   500 bits (1287),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 281/357 (79%), Positives = 321/357 (90%), Gaps = 5/357 (1%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+ISIPILERVK+PLEKA+++AGL VE++H +EV+GSGSRVPA+IKILTEFFGKEPRR
Sbjct  302   EFEEISIPILERVKRPLEKALSDAGLTVEDVHMVEVVGSGSRVPAMIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVR+FQV+ESFPF I+L+WKG + DAQNG +EN QST
Sbjct  362   TMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSISLAWKGLASDAQNGGSENLQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRSGTFS+DVQY+DV+ELQAP KISTYTIGPFQS KGERAKLK
Sbjct  422   IVFPKGNPIPSVKALTFYRSGTFSVDVQYSDVNELQAPPKISTYTIGPFQSSKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMET--DDIPPQDSSETDVNMQD  715
             VKVRLNLHGIVSVESATLLEEEEVEVPV KEQ +E+TKMET   +  P  S ++DVNMQD
Sbjct  482   VKVRLNLHGIVSVESATLLEEEEVEVPVSKEQSEETTKMETASAETAPA-SGDSDVNMQD  540

Query  716   DKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKA  889
              K + DA  ++N   ES DKPVQMETD+KAEAPKKKVKKTNVP+SE+VYGAL   +V+KA
Sbjct  541   AKESVDAAGTDNGAPESTDKPVQMETDSKAEAPKKKVKKTNVPLSEVVYGALKSVEVEKA  600

Query  890   VEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             VEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DKYQE++ D E+E  +AKLQE
Sbjct  601   VEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDKYQEYITDVEREAFLAKLQE  657



>emb|CDY45119.1| BnaC06g06400D [Brassica napus]
Length=956

 Score =   503 bits (1296),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 261/355 (74%), Positives = 303/355 (85%), Gaps = 12/355 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+IS+PILERVK+PLEKA+A+AGL+VE++H +EV+GSGSRVPAIIKILTEFFGKEPRR
Sbjct  442   EFEEISVPILERVKRPLEKALADAGLSVEDVHMVEVVGSGSRVPAIIKILTEFFGKEPRR  501

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVR+FQV+ESFPF ++L+WKG + DAQNG AENQQST
Sbjct  502   TMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSVSLAWKGAAADAQNGGAENQQST  561

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPSVKALTFYRSGTFS+DVQY+DV++LQAP+KISTYTIGPFQS KGERAK+K
Sbjct  562   VVFPKGNPIPSVKALTFYRSGTFSVDVQYSDVTDLQAPAKISTYTIGPFQSSKGERAKVK  621

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQDDK  721
             VKVRL LHGI        +E   +      E    + +M+TD    + S ETDVNMQD K
Sbjct  622   VKVRLTLHGI------VSVESATLLEEEEVEVPVTTEQMDTD----KASGETDVNMQDAK  671

Query  722   VTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVE  895
              TSDA  ++N V E  DKPVQMETD+KAEAPKKKVKKTNVP+SELVYGAL   DVQKAVE
Sbjct  672   ETSDAAGADNGVTEPADKPVQMETDSKAEAPKKKVKKTNVPLSELVYGALQSVDVQKAVE  731

Query  896   KEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KE+EMALQDR+MEETKDKKNAVE+YVYDMRNKL DK  E++ +SE+E  +AKLQE
Sbjct  732   KEYEMALQDRVMEETKDKKNAVESYVYDMRNKLSDKLHEYITESEREAFLAKLQE  786



>ref|XP_010417776.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Camelina 
sativa]
Length=829

 Score =   499 bits (1286),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 281/357 (79%), Positives = 321/357 (90%), Gaps = 5/357 (1%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+ISIPILERVK+PLEKA+++AGL VE++H +EV+GSGSRVPA+IKILTEFFGKEPRR
Sbjct  302   EFEEISIPILERVKRPLEKALSDAGLTVEDVHMVEVVGSGSRVPAMIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVR+FQV+ESFPF I+L+WKG + DAQNG +ENQQST
Sbjct  362   TMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSISLAWKGLASDAQNGGSENQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRSGTFS+DVQY+DV+ELQAP KISTYTIGPFQS KGERAKLK
Sbjct  422   IVFPKGNPIPSVKALTFYRSGTFSVDVQYSDVNELQAPPKISTYTIGPFQSSKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMET--DDIPPQDSSETDVNMQD  715
             VKVRLNLHGIVSVESATLLEEEEVEVPV KEQL+E++KMET   +  P  S ++DVNMQD
Sbjct  482   VKVRLNLHGIVSVESATLLEEEEVEVPVSKEQLEETSKMETASSETAPA-SGDSDVNMQD  540

Query  716   DKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKA  889
              K   DA  ++N   ES DKPV METD+KAEAPKKKVKKTNVP+SE+VYGAL   +V+KA
Sbjct  541   AKEAIDAAGTDNGAPESTDKPVHMETDSKAEAPKKKVKKTNVPLSEVVYGALKSVEVEKA  600

Query  890   VEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             VEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DKYQE++ D E+E  +AKLQE
Sbjct  601   VEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDKYQEYITDVEREAFLAKLQE  657



>ref|XP_010417777.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X2 [Camelina 
sativa]
Length=829

 Score =   499 bits (1284),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 280/357 (78%), Positives = 320/357 (90%), Gaps = 5/357 (1%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+ISIPILERVK+PLEKA+++AGL VE++H +EV+GSGSRVPA+IKILTEFFGKEPRR
Sbjct  302   EFEEISIPILERVKRPLEKALSDAGLTVEDVHMVEVVGSGSRVPAMIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVR+FQV+ESFPF I+L+WKG + DAQNG AENQQST
Sbjct  362   TMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSISLAWKGAASDAQNGGAENQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRSGTFS+DVQY+DV +LQAP KISTYTIGPFQS KGERAKLK
Sbjct  422   IVFPKGNPIPSVKALTFYRSGTFSVDVQYSDVKDLQAPPKISTYTIGPFQSSKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMET--DDIPPQDSSETDVNMQD  715
             VKVRLNLHG+VSVESATLLEEEEVEVPV KEQL+E++KMET   +  P  S ++DVNMQD
Sbjct  482   VKVRLNLHGVVSVESATLLEEEEVEVPVSKEQLEETSKMETASSETAPA-SGDSDVNMQD  540

Query  716   DKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKA  889
              K   DA  ++N   ES DKPV METD+KAEAPKKKVKKTNVP+SE+VYGAL   +V+KA
Sbjct  541   AKEAIDAAGTDNGAPESTDKPVHMETDSKAEAPKKKVKKTNVPLSEVVYGALKSVEVEKA  600

Query  890   VEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             VEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DKYQE++ D E+E  +AKLQE
Sbjct  601   VEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDKYQEYITDVEREAFLAKLQE  657



>ref|XP_008354139.1| PREDICTED: heat shock 70 kDa protein 15-like [Malus domestica]
Length=834

 Score =   498 bits (1283),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 277/359 (77%), Positives = 316/359 (88%), Gaps = 6/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQISIPILERVK PLEKA+ +A L++E+IH++EV+GSGSRVPAIIKILT+FF KEPRR
Sbjct  302   EFEQISIPILERVKGPLEKALLDAQLSIEDIHTVEVVGSGSRVPAIIKILTDFFKKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNESFPF I+LSWKG  PDAQNGAAEN Q+T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNESFPFSISLSWKGSGPDAQNGAAENNQNT  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPS+KALTF RS TFS+DVQYADVS+LQAP+KISTYTIGPF S K ERAKLK
Sbjct  422   LVFPKGNPIPSIKALTFXRSXTFSVDVQYADVSDLQAPAKISTYTIGPFXSVKSERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETD----DIPPQDSSETDVNM  709
             VK RLNLHGIVSV+SATLLEEEE+EVPV KEQ KE+ KMETD    D+ P  + ETDV+M
Sbjct  482   VKARLNLHGIVSVDSATLLEEEEIEVPVTKEQTKEAAKMETDEAPSDVAPPSTXETDVSM  541

Query  710   QDDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD K T+DA  +EN V ESG+KP QMETDAKA+A K KV+KTN+PV+ELVYG +   +VQ
Sbjct  542   QDAKDTADAPGAENVVPESGEKPXQMETDAKADAKKIKVRKTNIPVTELVYGGMPXNEVQ  601

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KA+EKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DKY EFV +SE+E  IA+LQE
Sbjct  602   KAIEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLNDKYHEFVTESEREAFIARLQE  660



>ref|XP_006287070.1| hypothetical protein CARUB_v10000229mg [Capsella rubella]
 gb|EOA19968.1| hypothetical protein CARUB_v10000229mg [Capsella rubella]
Length=828

 Score =   498 bits (1282),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 278/357 (78%), Positives = 320/357 (90%), Gaps = 5/357 (1%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+ISIPILERVK+PLEKA+++AGL VE++H +EV+GSGSRVPA+IKILTEFFGKEPRR
Sbjct  302   EFEEISIPILERVKRPLEKALSDAGLTVEDVHMVEVVGSGSRVPAMIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVR+FQV+ESFPF I+L+ KG + DAQNG AENQQST
Sbjct  362   TMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSISLARKGLASDAQNGGAENQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRSGTFS+DVQY+DV+ELQAP KISTY+IGPFQS KGERAKLK
Sbjct  422   IVFPKGNPIPSVKALTFYRSGTFSVDVQYSDVNELQAPPKISTYSIGPFQSSKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETD--DIPPQDSSETDVNMQD  715
             VKVRLNLHGIVSVESATLLEEE+VEV V KEQ +E+TKMET   +  P  S ++DVNMQD
Sbjct  482   VKVRLNLHGIVSVESATLLEEEQVEVHVSKEQSEETTKMETTSAETAPA-SGDSDVNMQD  540

Query  716   DKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKA  889
              K  SDA  ++N   ES DKPVQMETD+KAEAPKKKVKKTNVP+SE+VYGAL   +V+KA
Sbjct  541   AKEISDAAGTDNGAPESADKPVQMETDSKAEAPKKKVKKTNVPLSEVVYGALKSVEVEKA  600

Query  890   VEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             VEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DKYQE++ D+++E  + KLQE
Sbjct  601   VEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDKYQEYITDADREAFLVKLQE  657



>ref|XP_003546366.1| PREDICTED: heat shock 70 kDa protein 14-like [Glycine max]
 gb|KHM98765.1| Heat shock 70 kDa protein 14 [Glycine soja]
Length=863

 Score =   496 bits (1278),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 282/362 (78%), Positives = 310/362 (86%), Gaps = 9/362 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQ+S+PILERVK PLEKA+AEAGL VEN+H +EV+GSGSRVPAI KILTEFF KEPRR
Sbjct  302   EFEQLSLPILERVKGPLEKALAEAGLTVENVHMVEVVGSGSRVPAINKILTEFFKKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNESFPF I+LSWKGPS DAQ     N Q T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNESFPFSISLSWKGPSSDAQESGPNNTQRT  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPSVKALT YRSGTFSIDVQY DVSELQ P+KISTYTIGPFQS   E+AK+K
Sbjct  422   LVFPKGNPIPSVKALTIYRSGTFSIDVQYDDVSELQTPAKISTYTIGPFQSTITEKAKVK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIP-----PQDSSETDVN  706
             VKVRLNLHGIVSVESATLLEEEE+EVPV KE   E+TKMETD+ P     P  +++ DVN
Sbjct  482   VKVRLNLHGIVSVESATLLEEEEIEVPVSKEPAGENTKMETDEAPANVAAPPSTNDNDVN  541

Query  707   MQD--DKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPA  874
             MQD   K T+DA  SEN   E+GDKPVQM+TD K EAPKKKVKK N+PV ELVYGA++ A
Sbjct  542   MQDANSKATADAPGSENGTPEAGDKPVQMDTDTKVEAPKKKVKKINIPVVELVYGAMAAA  601

Query  875   DVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKL  1054
             DVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYD RNKL DKYQEFVVDSE+E   AKL
Sbjct  602   DVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDTRNKLNDKYQEFVVDSERESFTAKL  661

Query  1055  QE  1060
             QE
Sbjct  662   QE  663



>ref|XP_007024112.1| Heat shock protein 91 isoform 1 [Theobroma cacao]
 gb|EOY26734.1| Heat shock protein 91 isoform 1 [Theobroma cacao]
Length=860

 Score =   495 bits (1275),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 281/359 (78%), Positives = 315/359 (88%), Gaps = 8/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS+PIL+RVK PLEKA+A+AGLAVEN+H++EV+GS SRVPA++KILTEFFGKEPRR
Sbjct  302   EFEQISVPILQRVKSPLEKALADAGLAVENVHTVEVVGSASRVPAMLKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV+KGCALQCAILSPTFKVR+FQVNESFP PI+LSWKG + DAQN  AE QQ  
Sbjct  362   TMNASECVAKGCALQCAILSPTFKVREFQVNESFPLPISLSWKGSASDAQNEGAEQQQ--  419

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGN IPSVKA+TF+++ TFS+DVQY+DVSELQ P+KISTYTIGPF + + ER KLK
Sbjct  420   LVFPKGNSIPSVKAVTFHKTSTFSVDVQYSDVSELQVPAKISTYTIGPFPTIRSERPKLK  479

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSS----ETDVNM  709
             VKVRLNLHGIVS+ESATLLEEEEVEVPV KE +KE TKMETD+IP   ++    ETDVNM
Sbjct  480   VKVRLNLHGIVSLESATLLEEEEVEVPVSKEPVKEDTKMETDEIPSDAAAPCANETDVNM  539

Query  710   QDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD K T+DA   EN V ESGDKPVQMETD K EAPKKKVKKTNVPV+ELVYGA+ PADVQ
Sbjct  540   QDAKGTADAEGVENGVPESGDKPVQMETDTKVEAPKKKVKKTNVPVAELVYGAMFPADVQ  599

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKL DKY +FV   EKE+  AKLQE
Sbjct  600   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLSDKYHDFVTAPEKEEFTAKLQE  658



>ref|XP_004302913.1| PREDICTED: heat shock 70 kDa protein 15-like [Fragaria vesca 
subsp. vesca]
Length=848

 Score =   494 bits (1273),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 278/358 (78%), Positives = 310/358 (87%), Gaps = 7/358 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS PILERVK PLEKA+ +A L++ENIH++EV+GSGSRVPAII+ILTEFF KEPRR
Sbjct  302   EFEQISAPILERVKGPLEKALLDANLSIENIHTVEVVGSGSRVPAIIRILTEFFKKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNESFPF IALSWKG  PDAQNG  +  Q+T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNESFPFSIALSWKGSGPDAQNGGPD--QTT  419

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPS KALTFYRSGTFS+DVQY DV +LQAP+KISTYTIGPFQS KGER+K+K
Sbjct  420   LVFPKGNPIPSTKALTFYRSGTFSVDVQYTDVGDLQAPAKISTYTIGPFQSTKGERSKVK  479

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETD----DIPPQDSSETDVNM  709
             V+ RLN HGIVSV+SATLLEEEEVEVPV KEQ KE+TKMETD    D+PP  S   DVNM
Sbjct  480   VRARLNYHGIVSVDSATLLEEEEVEVPVTKEQPKEATKMETDEAPSDVPPPSSEAADVNM  539

Query  710   QDDKVTSDAS-ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             QD      AS EN V ESGDKPVQMETDAKA+APK+KVKKTN+PV ELVYG ++ ADVQK
Sbjct  540   QDANSNDAASAENGVPESGDKPVQMETDAKADAPKRKVKKTNIPVVELVYGGMAAADVQK  599

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             A+E E+EMALQDR+MEETKDKKNAVEAYVYDMRNKL DK QEFV DSE+E  I KLQE
Sbjct  600   AIESEYEMALQDRVMEETKDKKNAVEAYVYDMRNKLSDKLQEFVTDSEREAFITKLQE  657



>gb|KJB70511.1| hypothetical protein B456_011G076800 [Gossypium raimondii]
Length=749

 Score =   491 bits (1265),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 274/359 (76%), Positives = 317/359 (88%), Gaps = 8/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS PIL+RVK+PLEKA+A+AGLAVEN+H +EV+GS SRVPA++KILTEFFGKEPRR
Sbjct  302   EFEQISAPILQRVKRPLEKALADAGLAVENVHMVEVVGSASRVPAMLKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCAL+CAILSPTFKVR+FQVNESFPFP++LSWKG  PD+Q G AE QQ  
Sbjct  362   TMNASECVARGCALECAILSPTFKVREFQVNESFPFPVSLSWKGSGPDSQAGGAEQQQ--  419

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPS+KA+TF++S TF++DVQY+DVS+LQAP KISTYTIGPF + + ER KLK
Sbjct  420   LVFPKGNPIPSIKAVTFHKSSTFTVDVQYSDVSDLQAPPKISTYTIGPFPTIRSERPKLK  479

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIP----PQDSSETDVNM  709
             VKVRLNLHGIVSVESATLLEEEEVEVPV KE  K+++KMETD+ P       ++ETDVNM
Sbjct  480   VKVRLNLHGIVSVESATLLEEEEVEVPVSKEPEKDNSKMETDEAPGGTAAPSANETDVNM  539

Query  710   QDDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD K T+DA  ++N V +SGDKPV+METD K EAPKKKVKKTNVPV+ELVYGA+ PADVQ
Sbjct  540   QDAKGTADAAGADNGVAKSGDKPVKMETDTKVEAPKKKVKKTNVPVAELVYGAMLPADVQ  599

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DKY +FV   EKE+L AKLQE
Sbjct  600   KAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLSDKYHDFVTAPEKEELTAKLQE  658



>ref|XP_010033884.1| PREDICTED: heat shock 70 kDa protein 14-like [Eucalyptus grandis]
 gb|KCW53736.1| hypothetical protein EUGRSUZ_J02991 [Eucalyptus grandis]
Length=874

 Score =   495 bits (1274),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 277/365 (76%), Positives = 315/365 (86%), Gaps = 12/365 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS PILERVK PL++A+AEAGLAVEN+H +EV+GSGSRVPA+IKILTEFFGKEPRR
Sbjct  302   EFEQISAPILERVKGPLQEALAEAGLAVENVHMVEVVGSGSRVPAVIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCA+LSPTFKVR+FQV+ESFPF I LSWK  +P+ Q+ AA+NQQ+T
Sbjct  362   TMNASECVARGCALQCAMLSPTFKVREFQVHESFPFAIGLSWKNSTPETQDAAADNQQAT  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPS+KALTFYRSGTF++DV Y D SELQA SKIS+YTIGPFQ  KGERAKLK
Sbjct  422   IVFPKGNPIPSIKALTFYRSGTFTVDVHYVDGSELQASSKISSYTIGPFQCSKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDI----------PPQDSS  691
             VKVRLNLHGIVSVESATL+EEEEVEVPV K+  +E+ KM+TD+            P  S+
Sbjct  482   VKVRLNLHGIVSVESATLMEEEEVEVPVTKDAAQEANKMDTDETPSDAAPPSDAAPPASA  541

Query  692   ETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGAL  865
             E DVNMQD K  +DA   EN V E+G+KPVQMETD K EAPKKKVKKTN+PV E+VYGAL
Sbjct  542   EADVNMQDAKGAADAPGVENGVPETGEKPVQMETDIKTEAPKKKVKKTNIPVVEVVYGAL  601

Query  866   SPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLI  1045
             S  D+QKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DKY +FV DSE+E+LI
Sbjct  602   SSGDLQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLNDKYHDFVTDSEREELI  661

Query  1046  AKLQE  1060
             AKLQE
Sbjct  662   AKLQE  666



>gb|AAG52244.1|AC011717_12 putative heat-shock protein; 41956-44878 [Arabidopsis thaliana]
Length=736

 Score =   490 bits (1261),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 271/341 (79%), Positives = 308/341 (90%), Gaps = 5/341 (1%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+ISIPILERVK+PLEKA+++AGL VE++H +EV+GSGSRVPA+IKILTEFFGKEPRR
Sbjct  302   EFEEISIPILERVKRPLEKALSDAGLTVEDVHMVEVVGSGSRVPAMIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVR+FQV+ESFPF I+L+WKG + DAQNG  ENQQST
Sbjct  362   TMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSISLAWKGAATDAQNGGTENQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRSGTFSIDVQY+DV++LQAP KISTYTIGPFQS KGERAKLK
Sbjct  422   IVFPKGNPIPSVKALTFYRSGTFSIDVQYSDVNDLQAPPKISTYTIGPFQSSKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQ---DSSETDVNMQ  712
             VKVRLNLHGIVSVESATLLEEEEVEV V K+Q +E+ KM+TD    +    S ++DVNMQ
Sbjct  482   VKVRLNLHGIVSVESATLLEEEEVEVSVTKDQSEETAKMDTDKASAEAAPASGDSDVNMQ  541

Query  713   DDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             D K TSDA  ++N V ES +KPVQMETD+KA+APKKKVKKTNVP+SELVYGAL   +V+K
Sbjct  542   DAKDTSDATGTDNGVPESAEKPVQMETDSKAKAPKKKVKKTNVPLSELVYGALKTVEVEK  601

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQ  1009
             AVEKEFEMALQDR+MEETKD+KNAVE+YVYDMRNKL DKYQ
Sbjct  602   AVEKEFEMALQDRVMEETKDRKNAVESYVYDMRNKLSDKYQ  642



>emb|CDX76065.1| BnaA04g03290D [Brassica napus]
Length=814

 Score =   491 bits (1265),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 258/355 (73%), Positives = 300/355 (85%), Gaps = 16/355 (5%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+IS+PILERVK+PLEKA+++AGLA+E++H +EV+GSGSRVPAIIKILTEFFGKEPRR
Sbjct  302   EFEEISVPILERVKRPLEKALSDAGLAIEDVHMVEVVGSGSRVPAIIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVR+FQV+ESFPF I+L+WKG + DAQNG AENQQST
Sbjct  362   TMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSISLAWKGAAADAQNGGAENQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGN IPSVKALTFYRSGTFS+DVQY+D ++LQAP KISTYTIGPFQS KGERAKLK
Sbjct  422   IVFPKGNSIPSVKALTFYRSGTFSVDVQYSDATDLQAPPKISTYTIGPFQSSKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQDDK  721
             VKVRL LHGI        +E   +      E    + +M+TD    + S E+DVNMQD K
Sbjct  482   VKVRLTLHGI------VSVESATLLEEEEVEVKVTTEQMDTD----KASGESDVNMQDAK  531

Query  722   VTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVE  895
              TSDA  ++N V E    PVQMETD+KAEAPKKKVKKTNVP+SELVYGAL   +VQKAVE
Sbjct  532   ETSDAAGTDNGVPE----PVQMETDSKAEAPKKKVKKTNVPLSELVYGALQSVEVQKAVE  587

Query  896   KEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KE+EMALQDR+MEETKDKKNAVE+YVYDMRNKL DKY E++++SE+E  +AKLQE
Sbjct  588   KEYEMALQDRVMEETKDKKNAVESYVYDMRNKLSDKYHEYIIESEREAFLAKLQE  642



>gb|KJB70509.1| hypothetical protein B456_011G076800 [Gossypium raimondii]
 gb|KJB70510.1| hypothetical protein B456_011G076800 [Gossypium raimondii]
Length=855

 Score =   493 bits (1268),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 274/359 (76%), Positives = 317/359 (88%), Gaps = 8/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS PIL+RVK+PLEKA+A+AGLAVEN+H +EV+GS SRVPA++KILTEFFGKEPRR
Sbjct  302   EFEQISAPILQRVKRPLEKALADAGLAVENVHMVEVVGSASRVPAMLKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCAL+CAILSPTFKVR+FQVNESFPFP++LSWKG  PD+Q G AE QQ  
Sbjct  362   TMNASECVARGCALECAILSPTFKVREFQVNESFPFPVSLSWKGSGPDSQAGGAEQQQ--  419

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPS+KA+TF++S TF++DVQY+DVS+LQAP KISTYTIGPF + + ER KLK
Sbjct  420   LVFPKGNPIPSIKAVTFHKSSTFTVDVQYSDVSDLQAPPKISTYTIGPFPTIRSERPKLK  479

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIP----PQDSSETDVNM  709
             VKVRLNLHGIVSVESATLLEEEEVEVPV KE  K+++KMETD+ P       ++ETDVNM
Sbjct  480   VKVRLNLHGIVSVESATLLEEEEVEVPVSKEPEKDNSKMETDEAPGGTAAPSANETDVNM  539

Query  710   QDDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD K T+DA  ++N V +SGDKPV+METD K EAPKKKVKKTNVPV+ELVYGA+ PADVQ
Sbjct  540   QDAKGTADAAGADNGVAKSGDKPVKMETDTKVEAPKKKVKKTNVPVAELVYGAMLPADVQ  599

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DKY +FV   EKE+L AKLQE
Sbjct  600   KAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLSDKYHDFVTAPEKEELTAKLQE  658



>ref|XP_002299641.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE84446.1| heat shock protein 70 [Populus trichocarpa]
Length=852

 Score =   491 bits (1264),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 275/359 (77%), Positives = 314/359 (87%), Gaps = 7/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQISIPILERVK+PLEKA+ +AGLAVEN+H++EV+GS SRVPAI+KILTEFFGKEPRR
Sbjct  302   EFEQISIPILERVKRPLEKALQDAGLAVENVHTVEVVGSASRVPAIMKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMN+SE VS+GCALQCAILSPTFKVR+FQV+E FPF IA+SWKG +PD+QNGAA+NQQST
Sbjct  362   TMNSSESVSRGCALQCAILSPTFKVREFQVHECFPFSIAVSWKGAAPDSQNGAADNQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPS+KALTFYRSGTFSIDVQYADVSELQAP+KISTYTIGPFQS K ERAK+K
Sbjct  422   IVFPKGNPIPSIKALTFYRSGTFSIDVQYADVSELQAPAKISTYTIGPFQSTKSERAKVK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSS----ETDVNM  709
             VKVRLNLHGIVSVESATLLEEEEVEVPV KE  KE  KM+TD+ P   ++    E D NM
Sbjct  482   VKVRLNLHGIVSVESATLLEEEEVEVPVTKEPAKEPAKMDTDEAPSDAATKGPKEADANM  541

Query  710   QDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             +++K  +D S  EN V E+ DKP QMETD K E PKKKVKKTN+PVSE+VYG +  A+V+
Sbjct  542   EEEKSAADVSGAENGVPEA-DKPTQMETDTKVEVPKKKVKKTNIPVSEVVYGGILAAEVE  600

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             K +EKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKL D+YQEFV D E+E   AKLQE
Sbjct  601   KLLEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLSDRYQEFVTDPEREGFTAKLQE  659



>ref|XP_009139126.1| PREDICTED: heat shock 70 kDa protein 15 [Brassica rapa]
 ref|XP_009139127.1| PREDICTED: heat shock 70 kDa protein 15 [Brassica rapa]
Length=814

 Score =   489 bits (1259),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 257/355 (72%), Positives = 300/355 (85%), Gaps = 16/355 (5%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+IS+PILERVK+PLEKA+++AGL++E++H +EV+GSGSRVPAIIKILTEFFGKEPRR
Sbjct  302   EFEEISVPILERVKRPLEKALSDAGLSIEDVHMVEVVGSGSRVPAIIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVR+FQV+ESFPF I+L+WKG + DAQNG AENQQST
Sbjct  362   TMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSISLAWKGAAADAQNGGAENQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGN IPSVKALTFYRSGTFS+DVQY+D ++LQAP KISTYTIGPFQS KGERAKLK
Sbjct  422   IVFPKGNSIPSVKALTFYRSGTFSVDVQYSDATDLQAPPKISTYTIGPFQSSKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQDDK  721
             VKVRL LHGI        +E   +      E    + +M+TD    + S E+DVNMQD K
Sbjct  482   VKVRLTLHGI------VSVESATLLEEEEVEVKVTAEQMDTD----KASGESDVNMQDAK  531

Query  722   VTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVE  895
              TSDA  ++N V E    PVQMETD+KAEAPKKKVKKTNVP+SELVYGAL   +VQKAVE
Sbjct  532   ETSDAAGTDNGVPE----PVQMETDSKAEAPKKKVKKTNVPLSELVYGALQSVEVQKAVE  587

Query  896   KEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KE+EMALQDR+MEETKDKKNAVE+YVYDMRNKL DKY E++++SE+E  +AKLQE
Sbjct  588   KEYEMALQDRVMEETKDKKNAVESYVYDMRNKLSDKYHEYIIESEREAFLAKLQE  642



>ref|XP_011013254.1| PREDICTED: heat shock 70 kDa protein 15-like [Populus euphratica]
Length=852

 Score =   489 bits (1259),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 276/359 (77%), Positives = 314/359 (87%), Gaps = 7/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQISIPILERVK+PLEKA+ +AGLAVEN+H++EV+GS SRVPAI+KILTEFFGKEPRR
Sbjct  302   EFEQISIPILERVKRPLEKALQDAGLAVENVHTVEVVGSASRVPAIMKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMN+SE VS+GCALQCAILSPTFKVR+FQV+E FPF IA+SWKG +PD+QNGAA+NQQST
Sbjct  362   TMNSSESVSRGCALQCAILSPTFKVREFQVHECFPFSIAVSWKGAAPDSQNGAADNQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPS+KALTFYRSGTFSIDVQYADVSELQAP+KISTYTIGPFQS K ERAK+K
Sbjct  422   IVFPKGNPIPSIKALTFYRSGTFSIDVQYADVSELQAPAKISTYTIGPFQSTKSERAKVK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSS----ETDVNM  709
             VKVRLNLHGIVSVESATLLEEEEVEVPV KE  KE  KM+TD+ P   ++    E D NM
Sbjct  482   VKVRLNLHGIVSVESATLLEEEEVEVPVTKEPAKEPAKMDTDEAPSDAATKGPEEADANM  541

Query  710   QDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             ++ K  +D S  EN V E+ DKP QMETD K EAPKKKVKKTN+PVSE+VYG +  A+V+
Sbjct  542   EEAKPAADVSGAENGVPEA-DKPTQMETDTKVEAPKKKVKKTNIPVSEVVYGGILAAEVE  600

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             K +EKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKL D+YQEFV D E+E   AKLQE
Sbjct  601   KLLEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLSDRYQEFVTDPEREGFTAKLQE  659



>gb|KHG16619.1| Heat shock 70 kDa 15 -like protein [Gossypium arboreum]
Length=855

 Score =   489 bits (1259),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 273/359 (76%), Positives = 316/359 (88%), Gaps = 8/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS PIL+RVK+PLEKA+A+AGLAVEN+H +EV+GS SRVPA++KILTEFFGKEPRR
Sbjct  302   EFEQISAPILQRVKRPLEKALADAGLAVENVHMVEVVGSASRVPAMLKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCAL+CAILSPTFKVR+FQVNESFPFP++LSWKG  PD+Q G AE QQ  
Sbjct  362   TMNASECVARGCALECAILSPTFKVREFQVNESFPFPVSLSWKGSGPDSQAGGAEQQQ--  419

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPS+KA+TF++S TF++DVQY+DVS+LQAP KISTYTIGPF + + E+ KLK
Sbjct  420   LVFPKGNPIPSIKAVTFHKSSTFTVDVQYSDVSDLQAPPKISTYTIGPFPTIRSEQPKLK  479

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQ----DSSETDVNM  709
             VKVRLNLHGIVSVESATLLEEEEVEVPV KE  K+++KM TD+ P       ++ETDVNM
Sbjct  480   VKVRLNLHGIVSVESATLLEEEEVEVPVSKEPEKDNSKMVTDEAPSGTAAPSANETDVNM  539

Query  710   QDDKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD K T+DA  +EN V ESGDKPV+METD K EAPKKKVKKTNVPV+ELVYGA+ PADVQ
Sbjct  540   QDAKGTADAAGAENGVAESGDKPVKMETDTKVEAPKKKVKKTNVPVAELVYGAMLPADVQ  599

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DKY++FV   EKE+  AKLQE
Sbjct  600   KAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLSDKYRDFVTAPEKEEFTAKLQE  658



>ref|XP_002304187.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE79166.1| heat shock protein 70 [Populus trichocarpa]
Length=858

 Score =   488 bits (1257),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 278/359 (77%), Positives = 311/359 (87%), Gaps = 7/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS PILERVK+PLEKA+ +AGLAVEN+H +EV+GS SR+PA++KILTEFFGKEPRR
Sbjct  302   EFEQISTPILERVKRPLEKALQDAGLAVENVHMVEVVGSASRIPAVMKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVRDFQV+E FPF IA+SWKG + D+QNGAA++QQ T
Sbjct  362   TMNASECVSRGCALQCAILSPTFKVRDFQVHECFPFSIAVSWKGGALDSQNGAADHQQGT  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPS+KALTFYRSGTFSIDVQY+DVSELQAP+KISTYTIGPFQ  K ERAK+K
Sbjct  422   IVFPKGNPIPSIKALTFYRSGTFSIDVQYSDVSELQAPAKISTYTIGPFQCTKSERAKVK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETD----DIPPQDSSETDVNM  709
             VKVRL+LHGIVSVESATLLEEEEVEVPVVKE  KE TKM+TD    D      +E D NM
Sbjct  482   VKVRLSLHGIVSVESATLLEEEEVEVPVVKEPAKEPTKMDTDESLSDATTTGPNEADDNM  541

Query  710   QDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD+K  +DAS  EN V ES DKP QMETD K EAPKKKVKKTN+PVSE+VYG +  A+VQ
Sbjct  542   QDEKAAADASGTENGVPES-DKPTQMETDTKVEAPKKKVKKTNIPVSEVVYGGIPAAEVQ  600

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             K +EKE+EMALQDR+MEETKDKKNAVEAYVYDMRNKL DKY EFV D E+E   AKLQE
Sbjct  601   KLLEKEYEMALQDRVMEETKDKKNAVEAYVYDMRNKLSDKYHEFVPDLEREGFTAKLQE  659



>ref|XP_010915054.1| PREDICTED: heat shock 70 kDa protein 14-like [Elaeis guineensis]
Length=853

 Score =   488 bits (1255),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 269/359 (75%), Positives = 308/359 (86%), Gaps = 6/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS PIL+RVK PLEKA+ EAGL  ENIH++EV+GSGSRVPAIIKIL EFFGKEPRR
Sbjct  302   EFEQISAPILQRVKGPLEKALLEAGLTTENIHAVEVVGSGSRVPAIIKILMEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQV++SFPF IALSWKGP+PD+QN A ENQQS+
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVHDSFPFSIALSWKGPAPDSQNVAMENQQSS  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGN IPSVKALTFYRS TF++DV YADV +LQ P+KIS+YTIGPF+S KGERAKLK
Sbjct  422   VVFPKGNLIPSVKALTFYRSSTFTVDVMYADVGDLQVPAKISSYTIGPFKSSKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevev--pvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             +KVRLNLHGIVS+ESA +LEEEEVEV     KE  KE+TKMETD+      +E D NMQD
Sbjct  482   LKVRLNLHGIVSIESAIMLEEEEVEVPVSDAKEPSKEATKMETDETSDPSRTENDENMQD  541

Query  716   DKVTSDAS----ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
              K  ++ S    EN   E+ +KPVQMETDAK E PKKKVKKTN+PVSELVYG +   D+Q
Sbjct  542   VKTAAENSGAGVENGAPEAEEKPVQMETDAKVEVPKKKVKKTNIPVSELVYGGMLAEDLQ  601

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVE+EFEMALQDR+MEETKDKKNAVEAYVYDMRNKLYDKYQ+FV  +EK++LIAKLQE
Sbjct  602   KAVEREFEMALQDRVMEETKDKKNAVEAYVYDMRNKLYDKYQDFVTATEKDELIAKLQE  660



>ref|XP_010033879.1| PREDICTED: heat shock 70 kDa protein 14-like [Eucalyptus grandis]
 gb|KCW53729.1| hypothetical protein EUGRSUZ_J02987 [Eucalyptus grandis]
 gb|KCW53730.1| hypothetical protein EUGRSUZ_J02987 [Eucalyptus grandis]
Length=851

 Score =   488 bits (1255),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 274/360 (76%), Positives = 310/360 (86%), Gaps = 7/360 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS PILERVK PL+KA+AEAGLAVEN+H +EV+GSGSRVPAIIKILTEFFGKEPRR
Sbjct  302   EFEQISAPILERVKGPLQKALAEAGLAVENVHMVEVVGSGSRVPAIIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQV+ESFP  + LSWK   P++Q+GAA+N Q+T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVHESFPSSVGLSWKSSVPESQDGAADNHQTT  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGN IPS+KALTFYRSGTF++DV Y D SE QA SKIS+YTIGPFQ  K ERAKLK
Sbjct  422   IVFPKGNAIPSIKALTFYRSGTFAVDVHYTDGSEQQASSKISSYTIGPFQCAKSERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeST-KMETDDI----PPQDSSETDVN  706
             VKVRLNLHGIVS+ESATLLEEEEVEVPV ++   + T KM+TD+      P  S E DVN
Sbjct  482   VKVRLNLHGIVSIESATLLEEEEVEVPVTQDAAAQETNKMDTDETSNAAAPPTSGEADVN  541

Query  707   MQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADV  880
             MQD K  +DAS  EN V E+G+KPVQ ETD+KAEAPKKKVKKTNVPV+ELVYGALS  D+
Sbjct  542   MQDAKGATDASGVENGVPETGEKPVQTETDSKAEAPKKKVKKTNVPVTELVYGALSSGDL  601

Query  881   QKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             QKA+EKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DKY +FV D E+EQLI+ LQE
Sbjct  602   QKAIEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLNDKYYDFVTDPEREQLISTLQE  661



>ref|XP_011000832.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X2 [Populus 
euphratica]
Length=789

 Score =   484 bits (1246),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 276/359 (77%), Positives = 310/359 (86%), Gaps = 7/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS PILERVK+PLEKA+ +AGL VEN+H +EV+GS SR+PAI+KILTEFFGKEPRR
Sbjct  302   EFEQISTPILERVKRPLEKALQDAGLVVENVHMVEVVGSASRIPAIMKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVRDFQV+E FPF IA+SWKG + D+QNGAA++QQ T
Sbjct  362   TMNASECVSRGCALQCAILSPTFKVRDFQVHECFPFSIAVSWKGVALDSQNGAADHQQGT  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPS+KALTFYRSGTFSIDVQYADVS+LQAP+KISTYTIGPFQ  K ERAK+K
Sbjct  422   IVFPKGNPIPSIKALTFYRSGTFSIDVQYADVSDLQAPAKISTYTIGPFQCTKSERAKVK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETD----DIPPQDSSETDVNM  709
             VKVRL+LHG+VSVESATLLEEEEVEVPVVKE  KE TKM+TD    D      +E D NM
Sbjct  482   VKVRLSLHGVVSVESATLLEEEEVEVPVVKEPAKEPTKMDTDESLSDAATTGPNEADDNM  541

Query  710   QDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             Q++K  +DAS  EN V ES DKP QMETD K EAPKKKVKKTN+PVSE+VYG +  A+VQ
Sbjct  542   QEEKAAADASGAENGVPES-DKPTQMETDTKVEAPKKKVKKTNIPVSEVVYGGIPAAEVQ  600

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             K +EKE+EMALQDR+MEETKDKKNAVEAYVYDMRNKL DKY EFV D E+E   AKLQE
Sbjct  601   KLLEKEYEMALQDRVMEETKDKKNAVEAYVYDMRNKLSDKYHEFVPDLEREGFTAKLQE  659



>ref|XP_007150665.1| hypothetical protein PHAVU_005G171400g [Phaseolus vulgaris]
 gb|ESW22659.1| hypothetical protein PHAVU_005G171400g [Phaseolus vulgaris]
Length=865

 Score =   486 bits (1252),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 275/364 (76%), Positives = 309/364 (85%), Gaps = 11/364 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQ+S+PILERVK PLEKA+AEAGL V+NIH +EV+GSGSRVPAI KILT+FF KEPRR
Sbjct  302   EFEQLSLPILERVKGPLEKALAEAGLTVDNIHVVEVVGSGSRVPAINKILTDFFKKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV+KGCALQCAILSPTFKVR+FQVNESFPF I+LSWKG S DAQ    +++QST
Sbjct  362   TMNASECVAKGCALQCAILSPTFKVREFQVNESFPFSISLSWKGSSSDAQESGPDSKQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPS KALT YR GTFSIDVQY DVS LQ P+KISTYTIGPFQS KGE+AK+K
Sbjct  422   LVFPKGNPIPSFKALTIYRQGTFSIDVQYDDVSGLQTPAKISTYTIGPFQSTKGEKAKIK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIP-----PQDSSETDVN  706
             V+VRLNLHGIVS+ESATLLEEEE+EVPV KE   E+TKMETD+       P  +++ DVN
Sbjct  482   VRVRLNLHGIVSIESATLLEEEEIEVPVSKESAGENTKMETDEAAADTATPPSANDNDVN  541

Query  707   MQDDKVTSDAS------ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALS  868
             MQD  V ++ S      EN   E+GDKPVQM+TD KAEAPKKKVKK NVPV E+VYGA+S
Sbjct  542   MQDANVNANPSADVTGAENGTPEAGDKPVQMDTDTKAEAPKKKVKKINVPVVEVVYGAMS  601

Query  869   PADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIA  1048
              ADVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DKYQEFV+DSE+E    
Sbjct  602   VADVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLNDKYQEFVIDSEREAFTT  661

Query  1049  KLQE  1060
             KLQE
Sbjct  662   KLQE  665



>ref|XP_008775317.1| PREDICTED: heat shock 70 kDa protein 14-like [Phoenix dactylifera]
Length=852

 Score =   486 bits (1251),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 269/359 (75%), Positives = 307/359 (86%), Gaps = 6/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS+PILERVK PLEKA+AEA L+VENIHSIEV+GSGSRVPAII+ILTEFFGKEPRR
Sbjct  302   EFEQISVPILERVKGPLEKALAEANLSVENIHSIEVVGSGSRVPAIIRILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTF+VR+FQV+ESFPFPIA SWKG +P+ QNG  EN QS+
Sbjct  362   TMNASECVARGCALQCAILSPTFRVREFQVHESFPFPIAFSWKGSAPETQNGTTENLQSS  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGN IPSVKALTFYRS TFS+DV YADV +LQ P+KISTYTIGPFQ   GERAKLK
Sbjct  422   IVFPKGNAIPSVKALTFYRSSTFSVDVHYADVGDLQVPAKISTYTIGPFQLTTGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeql--keSTKMETDDIPPQDSSETDVNMQD  715
             VKVRLNLHGI+SVESAT+LE+EEVEVPV   +   KESTKM+TD+      +E DVNMQD
Sbjct  482   VKVRLNLHGIISVESATMLEDEEVEVPVSATKEPPKESTKMDTDEATNNSVTENDVNMQD  541

Query  716   DKVTSDASENHVLE----SGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
              K T++ S+  V      S +K VQMETDAK E  KKKVKKT+VPV+EL+YG L+ A++Q
Sbjct  542   AKSTTEVSDAGVQNGEPVSEEKLVQMETDAKVEPSKKKVKKTDVPVAELIYGGLAAAELQ  601

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKE EMALQDR+MEETKDKKNAVE YVYDMRNKL+DKYQ+FV +SE+EQ  AKLQE
Sbjct  602   KAVEKELEMALQDRVMEETKDKKNAVETYVYDMRNKLHDKYQDFVTESEREQFTAKLQE  660



>ref|XP_010925584.1| PREDICTED: heat shock 70 kDa protein 14-like [Elaeis guineensis]
 ref|XP_010932975.1| PREDICTED: heat shock 70 kDa protein 14-like [Elaeis guineensis]
Length=852

 Score =   485 bits (1249),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 269/359 (75%), Positives = 305/359 (85%), Gaps = 6/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS+PILERVK PLEKA+A+A L VENIHS+EV+GSGSRVPAII+ILTEFFGKEPRR
Sbjct  302   EFEQISVPILERVKGPLEKALADANLTVENIHSVEVVGSGSRVPAIIRILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTF+VR+FQV+ESFPFPIALSWKG +P+ QNGA EN QS+
Sbjct  362   TMNASECVARGCALQCAILSPTFRVREFQVHESFPFPIALSWKGSAPETQNGATENLQSS  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGN IPSVKALTFYRS TF +DV YADV +LQ P+KISTYTIGPFQS  G RAKLK
Sbjct  422   IVFPKGNAIPSVKALTFYRSSTFPVDVHYADVGDLQVPAKISTYTIGPFQSTTGARAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeql--keSTKMETDDIPPQDSSETDVNMQD  715
             VKVRLNLHGI+SVESAT+LE+EEVEVPV   +   KESTKM+TD+      +E   NMQD
Sbjct  482   VKVRLNLHGIISVESATMLEDEEVEVPVSAAKEPPKESTKMDTDEATNNSVTENGANMQD  541

Query  716   DKVTSDAS----ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
              K T++ S    EN    SG+K VQMETDAK E  KKKVKKT+V V+ELVYG L+  D+Q
Sbjct  542   AKSTTEVSDAGVENGASVSGEKCVQMETDAKVEPSKKKVKKTDVQVAELVYGGLAADDLQ  601

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKE EMALQDR+MEETKDKKNAVEAYVYDMRNKL+DKYQ+FV +SE+EQ  AKLQE
Sbjct  602   KAVEKELEMALQDRVMEETKDKKNAVEAYVYDMRNKLHDKYQDFVTESEREQFTAKLQE  660



>ref|XP_011000830.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Populus 
euphratica]
 ref|XP_011000831.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Populus 
euphratica]
Length=859

 Score =   484 bits (1247),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 276/359 (77%), Positives = 310/359 (86%), Gaps = 7/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS PILERVK+PLEKA+ +AGL VEN+H +EV+GS SR+PAI+KILTEFFGKEPRR
Sbjct  302   EFEQISTPILERVKRPLEKALQDAGLVVENVHMVEVVGSASRIPAIMKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVRDFQV+E FPF IA+SWKG + D+QNGAA++QQ T
Sbjct  362   TMNASECVSRGCALQCAILSPTFKVRDFQVHECFPFSIAVSWKGVALDSQNGAADHQQGT  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPS+KALTFYRSGTFSIDVQYADVS+LQAP+KISTYTIGPFQ  K ERAK+K
Sbjct  422   IVFPKGNPIPSIKALTFYRSGTFSIDVQYADVSDLQAPAKISTYTIGPFQCTKSERAKVK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETD----DIPPQDSSETDVNM  709
             VKVRL+LHG+VSVESATLLEEEEVEVPVVKE  KE TKM+TD    D      +E D NM
Sbjct  482   VKVRLSLHGVVSVESATLLEEEEVEVPVVKEPAKEPTKMDTDESLSDAATTGPNEADDNM  541

Query  710   QDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             Q++K  +DAS  EN V ES DKP QMETD K EAPKKKVKKTN+PVSE+VYG +  A+VQ
Sbjct  542   QEEKAAADASGAENGVPES-DKPTQMETDTKVEAPKKKVKKTNIPVSEVVYGGIPAAEVQ  600

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             K +EKE+EMALQDR+MEETKDKKNAVEAYVYDMRNKL DKY EFV D E+E   AKLQE
Sbjct  601   KLLEKEYEMALQDRVMEETKDKKNAVEAYVYDMRNKLSDKYHEFVPDLEREGFTAKLQE  659



>ref|XP_008793460.1| PREDICTED: heat shock 70 kDa protein 14-like [Phoenix dactylifera]
Length=854

 Score =   484 bits (1246),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 270/360 (75%), Positives = 309/360 (86%), Gaps = 7/360 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+IS PIL+RVK PLE A+ EA L  ENIH++EV+GSGSRVPAIIKILTEFFGKEPRR
Sbjct  302   EFERISAPILQRVKGPLETALLEARLTTENIHAVEVVGSGSRVPAIIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQV++SFPF IALSWKG +PD+QNGA ENQQS+
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVHDSFPFSIALSWKGSAPDSQNGAMENQQSS  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGN IPSVKALTFYRS TF++DV YADV +LQ P++IS+YTIGPFQS KGERAKLK
Sbjct  422   IVFPKGNSIPSVKALTFYRSSTFTVDVMYADVGDLQVPARISSYTIGPFQSSKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevev--pvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             VKVRLNLHGIVS+ESAT+LEEEEVEV     KE  KE+TKM+TD+      +E   NMQD
Sbjct  482   VKVRLNLHGIVSIESATMLEEEEVEVPVSDAKEPSKEATKMDTDETSDSSRTENHENMQD  541

Query  716   DK-VTSDAS----ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADV  880
              K V +D S    EN   E+ +KPVQMETDAK E PKKKVKKTN+PVSELVYG +S  D+
Sbjct  542   VKTVAADNSGAGVENGAPEAEEKPVQMETDAKVEVPKKKVKKTNIPVSELVYGGMSAEDL  601

Query  881   QKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             QKAVE+EFEMALQDR+MEETKDKKNAVEAYVYDMRNKL+DKYQ+FV  SEK++LIAKLQ+
Sbjct  602   QKAVEREFEMALQDRVMEETKDKKNAVEAYVYDMRNKLHDKYQDFVTASEKDELIAKLQD  661



>ref|XP_003529646.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Glycine 
max]
 ref|XP_006582999.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X2 [Glycine 
max]
 gb|KHN39337.1| Heat shock 70 kDa protein 14 [Glycine soja]
Length=857

 Score =   483 bits (1244),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 264/360 (73%), Positives = 309/360 (86%), Gaps = 7/360 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQ+S+PILERVK PLEKA+AEAGL VEN+H++EV+GSGSRVPAI KILTEFF KEPRR
Sbjct  302   EFEQLSLPILERVKGPLEKALAEAGLTVENVHTVEVVGSGSRVPAINKILTEFFKKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCAL+CAILSPTFKVR+FQVNES PF I+LSWK   PDAQ+   ENQQS+
Sbjct  362   TMNASECVARGCALECAILSPTFKVREFQVNESLPFSISLSWKSSGPDAQDNGPENQQSS  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPS+KALTFYRSGTFS+DVQ+ DVS LQ P+KISTYTIGPFQ+  GE+AK+K
Sbjct  422   LVFPKGNPIPSIKALTFYRSGTFSVDVQFGDVSGLQTPAKISTYTIGPFQTTNGEKAKVK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIP-----PQDSSETDVN  706
             VKVRLNLHGIVS+ESATLLEEEEV+VPV KE   E+TKM+ D++P     P  S++T  N
Sbjct  482   VKVRLNLHGIVSLESATLLEEEEVDVPVSKEAAGENTKMDIDEVPAEAAAPPSSNDTGAN  541

Query  707   MQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADV  880
             M++ K + DAS  E+ + ESG KP+Q +TD K +APKKKVKKTN+PV EL+YGA+ P DV
Sbjct  542   MENGKASIDASGVEDGIPESGGKPLQTDTDTKVQAPKKKVKKTNIPVVELIYGAMVPVDV  601

Query  881   QKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             QKA+EKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DKYQEFV  SE++   AKLQE
Sbjct  602   QKALEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLNDKYQEFVTASERDDFTAKLQE  661



>emb|CDY43337.1| BnaC04g25190D [Brassica napus]
Length=889

 Score =   484 bits (1247),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 256/355 (72%), Positives = 299/355 (84%), Gaps = 16/355 (5%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+ISIPILERVK+PLEKA+++AGL++E++H +EV+GSGSRVPAIIKILTEFFGKEPRR
Sbjct  377   EFEEISIPILERVKRPLEKALSDAGLSIEDVHMVEVVGSGSRVPAIIKILTEFFGKEPRR  436

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECVS+GCALQCAILSPTFKVR+FQV+ESFPF I+L+WKG + DAQNG AENQQST
Sbjct  437   TMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSISLAWKGAAADAQNGGAENQQST  496

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGN IPSVKALTFYRSGTFS+DVQY+D ++L+AP KISTYTIGPFQS KGERAKLK
Sbjct  497   IVFPKGNSIPSVKALTFYRSGTFSVDVQYSDATDLKAPPKISTYTIGPFQSSKGERAKLK  556

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQDDK  721
             VKVRL LHGI        +E   +      E    + +M+TD    + S E+DVNMQD K
Sbjct  557   VKVRLTLHGI------VSVESATLLEEEEVEVKVTAEQMDTD----KASGESDVNMQDAK  606

Query  722   VTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVE  895
              TSDA  ++N V E    PVQMETD+KAEAPKKKVKKTNVP+SELVYGAL   +VQKAVE
Sbjct  607   ETSDAAGTDNGVPE----PVQMETDSKAEAPKKKVKKTNVPLSELVYGALQSVEVQKAVE  662

Query  896   KEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KE+EMALQDR+MEETKDKKNAVE+YVYDMRNKL +KY E++ +SE+E  +AKLQE
Sbjct  663   KEYEMALQDRVMEETKDKKNAVESYVYDMRNKLSEKYHEYMTESEREAFLAKLQE  717



>gb|KJB35056.1| hypothetical protein B456_006G098500 [Gossypium raimondii]
 gb|KJB35058.1| hypothetical protein B456_006G098500 [Gossypium raimondii]
Length=856

 Score =   482 bits (1241),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 273/359 (76%), Positives = 313/359 (87%), Gaps = 8/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS PIL+RVK PLEKA+A+AGLAV ++H +EV+GS SR+P+I+KILTEFFGKEPRR
Sbjct  302   EFEQISAPILQRVKAPLEKALADAGLAVGDVHMVEVVGSASRIPSILKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV +GCALQCAILSPTFKVR+FQVNESFPFPI+LSWKG  PDAQNG AE +Q  
Sbjct  362   TMNASECVGRGCALQCAILSPTFKVREFQVNESFPFPISLSWKGSVPDAQNGEAEQEQ--  419

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPSVKA+TF+++ TFS+DVQY+DVS+LQAP+KISTY IGPF + + E+ KLK
Sbjct  420   LVFPKGNPIPSVKAVTFHKTSTFSVDVQYSDVSDLQAPAKISTYMIGPFPTLRSEKPKLK  479

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSS----ETDVNM  709
             VKVRLNLHGIVSVESATLLEEEEVEVPV KE  KE  KMETD+ P   S+    ETDVNM
Sbjct  480   VKVRLNLHGIVSVESATLLEEEEVEVPVSKEPAKEDAKMETDEKPNDTSAPGANETDVNM  539

Query  710   QDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD K T++A+  EN V +SGDKPVQMETD K EAPKKKVKKTNVPV+ELVYGA+   D+Q
Sbjct  540   QDAKGTAEAAGVENGVPQSGDKPVQMETDTKVEAPKKKVKKTNVPVAELVYGAMVSGDLQ  599

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DKY +FV  S+KE+L+AKLQE
Sbjct  600   KAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLCDKYHDFVTASDKEELMAKLQE  658



>gb|KHG16198.1| Heat shock 70 kDa 15 -like protein [Gossypium arboreum]
Length=856

 Score =   481 bits (1239),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 272/359 (76%), Positives = 313/359 (87%), Gaps = 8/359 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS PIL+RVK PLEKA+A+A LAV ++H +EV+GS SR+P+I+KILTEFFGKEPRR
Sbjct  302   EFEQISAPILQRVKAPLEKALADAVLAVGDVHMVEVVGSASRIPSILKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV +GCALQCAILSPTFKVR+FQVNESFPFPI+LSWKG  PDAQNG AE +Q  
Sbjct  362   TMNASECVGRGCALQCAILSPTFKVREFQVNESFPFPISLSWKGSVPDAQNGGAEQEQ--  419

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPSVKA+TF+++ TFS+DVQY+DVS+LQAP+KISTYTIGPF + + E+ KLK
Sbjct  420   LVFPKGNPIPSVKAVTFHKTSTFSVDVQYSDVSDLQAPAKISTYTIGPFPTLRSEKPKLK  479

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSS----ETDVNM  709
             VKVRLNLHGIVSV+SATLLEEEEVEVPV KE  KE  KMETD+ P   S+    ETDVNM
Sbjct  480   VKVRLNLHGIVSVDSATLLEEEEVEVPVSKELAKEDAKMETDEKPNDTSAPGANETDVNM  539

Query  710   QDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             QD K T++A+  EN V +SGDKPVQMETD K EAPKKKVKKTNVPV+ELVYGA+   D+Q
Sbjct  540   QDAKGTAEAAGVENGVPQSGDKPVQMETDTKVEAPKKKVKKTNVPVAELVYGAMLSGDLQ  599

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DKY +FV  S+KE+L+AKLQE
Sbjct  600   KAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLCDKYHDFVTASDKEELMAKLQE  658



>ref|XP_009399777.1| PREDICTED: heat shock 70 kDa protein 14-like [Musa acuminata 
subsp. malaccensis]
Length=851

 Score =   478 bits (1230),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 273/360 (76%), Positives = 317/360 (88%), Gaps = 7/360 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS+PILERVK+PLEKA++EAGL++ENIHS+EV+GSGSRVPAII+ILTEFFGKEPRR
Sbjct  302   EFEQISVPILERVKQPLEKALSEAGLSLENIHSVEVVGSGSRVPAIIRILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GC+LQCAILSPTFKVR+FQV+ESFPFPIALSWKG + D+QNG  ENQQST
Sbjct  362   TMNASECVARGCSLQCAILSPTFKVREFQVHESFPFPIALSWKGSASDSQNGGTENQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNP+PSVKALTF+RS TF++D  YAD +++Q P+KISTYTIGPFQS KGER KLK
Sbjct  422   IVFPKGNPLPSVKALTFFRSSTFTVDAVYADTADVQVPAKISTYTIGPFQSSKGERVKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeql--keSTKMETDDIPPQDS-SETDVNMQ  712
             VKVRL+LHGI+SVESA +LEEEEVEVPV       KESTKM+TD+   + S +ETD+NM+
Sbjct  482   VKVRLSLHGIISVESAVMLEEEEVEVPVSAAPELPKESTKMDTDEAVNEASKTETDLNME  541

Query  713   DDKVTSDAS----ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADV  880
             D K  S++S    +N V ES DKPV+METD K EA KKKVKKTNVPV ELVYG +S  ++
Sbjct  542   DAKSASNSSASGVDNGVPESNDKPVEMETDNKVEATKKKVKKTNVPVVELVYGGMSAEEL  601

Query  881   QKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             QKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKLYDKYQEFV  SEK++LIAKLQ+
Sbjct  602   QKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLYDKYQEFVTPSEKDELIAKLQQ  661



>ref|XP_003531683.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X1 [Glycine 
max]
Length=852

 Score =   478 bits (1230),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 262/360 (73%), Positives = 307/360 (85%), Gaps = 7/360 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQ+S+PILERVK PLEKA+AEAGL VEN+H++EV+GSGSRVPAI KILTEFF KEPRR
Sbjct  302   EFEQLSLPILERVKGPLEKALAEAGLTVENVHTVEVVGSGSRVPAINKILTEFFKKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCAL+CAILSPTFKVR+FQVNES PF I+LSWKG  PDAQ+  +ENQQS+
Sbjct  362   TMNASECVARGCALECAILSPTFKVREFQVNESLPFSISLSWKGSGPDAQDNGSENQQSS  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPS+KALTF R+GTFS+DV Y D S LQ P+KISTYTIGPFQ+  GERAK+K
Sbjct  422   LVFPKGNPIPSIKALTFCRAGTFSVDVLYDDASGLQTPAKISTYTIGPFQTTNGERAKVK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDI-----PPQDSSETDVN  706
             VKVRLNLHGIVS+ESATLLEEE+V VPV KE   E+TKM+ D++      P  S++T  N
Sbjct  482   VKVRLNLHGIVSLESATLLEEEKVGVPVTKEAAGENTKMDIDEVPAEAAAPPASNDTGAN  541

Query  707   MQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADV  880
             M+  K ++DAS  EN + E GDKP+Q +TD K +APKKKVKKTN+PV+ELVYGA+ P DV
Sbjct  542   MEGAKASTDASGVENGIPEGGDKPLQKDTDTKVQAPKKKVKKTNIPVAELVYGAMVPVDV  601

Query  881   QKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             QKA+EKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL D+YQEFV  SE++   AKLQE
Sbjct  602   QKALEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLNDEYQEFVTASERDDFTAKLQE  661



>ref|XP_003543647.1| PREDICTED: heat shock 70 kDa protein 14-like [Glycine max]
Length=863

 Score =   478 bits (1230),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 271/366 (74%), Positives = 307/366 (84%), Gaps = 13/366 (4%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQ+S+PILERVK PLEKA+AEAGL VEN+H +EV+GSGSRVPAI KILTEFF KEPRR
Sbjct  302   EFEQLSLPILERVKGPLEKALAEAGLTVENVHMVEVVGSGSRVPAINKILTEFFKKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNESFPF I+LSWK PS DAQ    +N+QST
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNESFPFSISLSWKAPSSDAQESGPDNKQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPSVKALT YRSGTFSIDVQY DVS LQ P+KISTYTIGPFQS K E+AK+K
Sbjct  422   LVFPKGNPIPSVKALTIYRSGTFSIDVQYDDVSGLQTPAKISTYTIGPFQSTKNEKAKVK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevp-vvkeqlkeSTKMETDDIPPQ--------DSSE  694
             VKVRLN+HGI+SVESATLLEEEE     V KE   E++KMETD+ P           +++
Sbjct  482   VKVRLNVHGIISVESATLLEEEEEIEVPVYKEPAGENSKMETDEAPADAAAAAATPSTND  541

Query  695   TDVNMQD--DKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGA  862
              DV+MQD   K T++A  +EN   E+GDKPVQM+TD K EAPKKKVKK N+PV ELVYGA
Sbjct  542   NDVSMQDANTKATANAPGAENGTPEAGDKPVQMDTDTKVEAPKKKVKKINIPVVELVYGA  601

Query  863   LSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQL  1042
             ++  DVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DKYQEFV+DSE+E  
Sbjct  602   MAATDVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLNDKYQEFVIDSEREAF  661

Query  1043  IAKLQE  1060
              AKLQE
Sbjct  662   TAKLQE  667



>gb|KHN47807.1| Heat shock 70 kDa protein 14 [Glycine soja]
Length=816

 Score =   476 bits (1226),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 263/360 (73%), Positives = 307/360 (85%), Gaps = 7/360 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQ+S+PILERVK PLEKA+AEAGL VEN+H++EV+GSGSRVPAI KILTEFF KEPRR
Sbjct  266   EFEQLSLPILERVKGPLEKALAEAGLTVENVHTVEVVGSGSRVPAINKILTEFFKKEPRR  325

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCAL+CAILSPTFKVR+FQVNES PF I+LSWKG  PDAQ+   ENQQS+
Sbjct  326   TMNASECVARGCALECAILSPTFKVREFQVNESLPFSISLSWKGSGPDAQDNGPENQQSS  385

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPS+KALTF R+GTFS+DV Y D S LQ P+KISTYTIGPFQ+  GERAK+K
Sbjct  386   LVFPKGNPIPSIKALTFCRAGTFSVDVLYDDASGLQTPAKISTYTIGPFQTTNGERAKVK  445

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDI-----PPQDSSETDVN  706
             VKVRLNLHGIVS+ESATLLEEE+VEVPV KE   E+TKM+ D++      P  S++T  N
Sbjct  446   VKVRLNLHGIVSLESATLLEEEKVEVPVTKEAAGENTKMDIDEVPAEAAAPPASNDTGAN  505

Query  707   MQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADV  880
             M+  K ++DAS  EN + E GDKP+Q +TD K +APKKKVKKTN+PV+ELVYGA+ P DV
Sbjct  506   MEGAKASTDASGVENGIPEGGDKPLQKDTDTKVQAPKKKVKKTNIPVAELVYGAMVPVDV  565

Query  881   QKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             QKA+EKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL D+YQEFV  SE++   AKLQE
Sbjct  566   QKALEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLNDEYQEFVTASERDDFTAKLQE  625



>ref|XP_008786326.1| PREDICTED: heat shock 70 kDa protein 15-like [Phoenix dactylifera]
Length=854

 Score =   475 bits (1223),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 270/360 (75%), Positives = 312/360 (87%), Gaps = 7/360 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQISIPIL+RVK PLEKA+ EAGL+ E+IH++E++GSGSRVPAIIKILTEFFGKEPRR
Sbjct  302   EFEQISIPILQRVKGPLEKALLEAGLSTESIHAVEIVGSGSRVPAIIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQV++SFPFPIALSWKG +PD+QN A ENQQS+
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVHDSFPFPIALSWKGSAPDSQNSATENQQSS  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRS TF++DV +AD  +LQAP+KIS+ TIGPFQS K ERAKLK
Sbjct  422   IVFPKGNPIPSVKALTFYRSSTFTVDVMFADAGDLQAPAKISSCTIGPFQSSKEERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeql--keSTKMETDDIPPQDSSETDVNMQD  715
             VKVRLN+HGIVS+ESAT+LEEEE+EVPV   +   KE+ KM+TD+      +E DVNMQD
Sbjct  482   VKVRLNIHGIVSIESATMLEEEEIEVPVTAAKEPPKEAAKMDTDETSVSSRTEADVNMQD  541

Query  716   DKV-TSDAS----ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADV  880
              K  T+D S    EN   E+ +KP QMETDAK E PKKKVKKTNVPVS LVYG +S  D+
Sbjct  542   AKTATTDNSGSGVENGAPEAEEKPAQMETDAKVEVPKKKVKKTNVPVSVLVYGGMSAEDL  601

Query  881   QKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             QKAVEKEFE+ALQDR+MEETKDKKNAVEAYVYDMRNKLYDKYQ+FV  +EK++LIAKLQE
Sbjct  602   QKAVEKEFELALQDRVMEETKDKKNAVEAYVYDMRNKLYDKYQDFVTATEKDELIAKLQE  661



>ref|XP_004141777.1| PREDICTED: heat shock 70 kDa protein 15-like [Cucumis sativus]
 gb|KGN45354.1| hypothetical protein Csa_7G446710 [Cucumis sativus]
Length=843

 Score =   474 bits (1221),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 256/359 (71%), Positives = 295/359 (82%), Gaps = 13/359 (4%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQISIPILERVK PLE+A+AEAGL +ENIH +EV+GSGSRVPAIIKILT+FF KEPRR
Sbjct  302   EFEQISIPILERVKGPLEQALAEAGLTIENIHVVEVVGSGSRVPAIIKILTDFFKKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++G ALQCAILSPTFKVR+FQVNE FPF IALSWKG + D+QNGA +NQQST
Sbjct  362   TMNASECVARGSALQCAILSPTFKVREFQVNEHFPFNIALSWKGAASDSQNGAVDNQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPSVKALTFYRSGTFS+DV Y D S+ QA  KISTYTIGPFQS KG R+K+K
Sbjct  422   VVFPKGNPIPSVKALTFYRSGTFSVDVHYTD-SDQQA--KISTYTIGPFQSSKGGRSKVK  478

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIP-----PQDSSETDVN  706
             VKVRLNLHGI    S       E E   +    ++  KMETD+ P     P  S+E DVN
Sbjct  479   VKVRLNLHGI---VSVESATLLEEEDVDIPVTREQPAKMETDEAPAETAAPPSSNENDVN  535

Query  707   MQDDKVTSDA-SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             MQD K T+DA +EN   ES +  VQMETD+K EA KKKVKKTN+PV E++YG L+ ADVQ
Sbjct  536   MQDAKGTTDAGAENGSAES-EHSVQMETDSKVEAQKKKVKKTNIPVVEMIYGGLAAADVQ  594

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKEFEMALQDR+MEETK+KKNAVEAYVY+MRNKL+DKYQ+FV +S++E+L AKLQE
Sbjct  595   KAVEKEFEMALQDRVMEETKEKKNAVEAYVYEMRNKLHDKYQDFVTESQREELSAKLQE  653



>ref|XP_010691292.1| PREDICTED: heat shock 70 kDa protein 15-like [Beta vulgaris subsp. 
vulgaris]
Length=850

 Score =   474 bits (1220),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 269/364 (74%), Positives = 312/364 (86%), Gaps = 11/364 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS+PILERVK+PLEKA+AEAGL V++IH++EV+GSGSR+PA+ KILTEFFGK+PRR
Sbjct  302   EFEQISLPILERVKRPLEKALAEAGLTVDDIHTVEVVGSGSRIPAVFKILTEFFGKDPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV+KGCALQCAILSPTFKV++FQVNE FPF I+LSWK  + D  NGAAE QQST
Sbjct  362   TMNASECVAKGCALQCAILSPTFKVKEFQVNERFPFSISLSWKAVAADGHNGAAEGQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IV PKG+PIP +KA+T  RSGTF++DVQYADVSELQAP+KIS+YTIGPFQS  G+RAKLK
Sbjct  422   IVIPKGSPIPCLKAVTIIRSGTFTVDVQYADVSELQAPAKISSYTIGPFQSSGGDRAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSS-ETDVNMQD-  715
             V+VRLNLHGIV++ESATLLEEEEVEVPVVKE  KE+TKMETDD P + S+ E DVNMQD 
Sbjct  482   VRVRLNLHGIVAIESATLLEEEEVEVPVVKETTKEATKMETDDAPNETSTGEADVNMQDA  541

Query  716   -DKVTSDASENHVLESG--------DKPVQMETDakaeapkkkvkkTNVPVSELVYGALS  868
              D   + ++EN   ESG        +KPVQM+TDAKA+A KKKVKKT VP+SE VYG LS
Sbjct  542   RDAAGAPSAENGAPESGEKSTPEADEKPVQMDTDAKADALKKKVKKTTVPLSETVYGGLS  601

Query  869   PADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIA  1048
               DVQKAVEKEFEMALQDR+MEETKD+KNAVEAYVYDMRNKL DK  EFV  ++K+Q IA
Sbjct  602   QGDVQKAVEKEFEMALQDRVMEETKDRKNAVEAYVYDMRNKLNDKLYEFVTPADKDQFIA  661

Query  1049  KLQE  1060
             +LQE
Sbjct  662   RLQE  665



>ref|XP_010925328.1| PREDICTED: heat shock 70 kDa protein 14-like [Elaeis guineensis]
Length=851

 Score =   474 bits (1220),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 268/360 (74%), Positives = 306/360 (85%), Gaps = 7/360 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQISIPIL+RVK PLEKA+ E GL+ E+IH++EV+GSGSRVPAIIKILTEFFGKEPRR
Sbjct  302   EFEQISIPILQRVKGPLEKALLETGLSTESIHAVEVVGSGSRVPAIIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQV++SFPFPIALSWKG +PD+QN A ENQQS+
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVHDSFPFPIALSWKGSAPDSQNSATENQQSS  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPSVKALTFYRS TF++DV +ADV +LQ P+KIS  TIGPFQS K ERAKLK
Sbjct  422   IVFPKGNPIPSVKALTFYRSSTFTVDVMFADVGDLQVPAKISACTIGPFQSSKDERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeql--keSTKMETDDIPPQDSSETDVNMQD  715
             VKVRLN+HGI+++ESAT+LEEEEVEVPV       KE+TKMETD+      +E DVNMQD
Sbjct  482   VKVRLNIHGILTIESATMLEEEEVEVPVSAAMEPPKEATKMETDETSDSSRTEADVNMQD  541

Query  716   DKV-----TSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADV  880
              K      +    EN   E+  KP QMETDAK E PKKKVKKTNVPVS LVYG +S  D+
Sbjct  542   AKTAATDNSGSGVENGAPEAEGKPAQMETDAKVEVPKKKVKKTNVPVSVLVYGGVSAEDL  601

Query  881   QKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             QKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKLY+KYQ+FV  +EK++LIAKLQE
Sbjct  602   QKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLYEKYQDFVTATEKDELIAKLQE  661



>ref|XP_006585595.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X2 [Glycine 
max]
Length=850

 Score =   473 bits (1218),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 261/360 (73%), Positives = 306/360 (85%), Gaps = 9/360 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQ+S+PILERVK PLEKA+AEAGL VEN+H++EV+GSGSRVPAI KILTEFF KEPRR
Sbjct  302   EFEQLSLPILERVKGPLEKALAEAGLTVENVHTVEVVGSGSRVPAINKILTEFFKKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCAL+CAILSPTFKVR+FQVNES PF I+LSWKG  PDAQ+  +ENQQS+
Sbjct  362   TMNASECVARGCALECAILSPTFKVREFQVNESLPFSISLSWKGSGPDAQDNGSENQQSS  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPS+KALTF R+GTFS+DV Y D S LQ P+KISTYTIGPFQ+  GERAK+K
Sbjct  422   LVFPKGNPIPSIKALTFCRAGTFSVDVLYDDASGLQTPAKISTYTIGPFQTTNGERAKVK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDI-----PPQDSSETDVN  706
             VKVRLNLHGIVS+ESATLLEEE+V VPV KE   E+TKM+ D++      P  S++T  N
Sbjct  482   VKVRLNLHGIVSLESATLLEEEKVGVPVTKEAAGENTKMDIDEVPAEAAAPPASNDTGAN  541

Query  707   MQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADV  880
             M+  K ++DAS  EN + E GDKP+Q +TD   +APKKKVKKTN+PV+ELVYGA+ P DV
Sbjct  542   MEGAKASTDASGVENGIPEGGDKPLQKDTD--TKAPKKKVKKTNIPVAELVYGAMVPVDV  599

Query  881   QKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             QKA+EKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL D+YQEFV  SE++   AKLQE
Sbjct  600   QKALEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLNDEYQEFVTASERDDFTAKLQE  659



>ref|XP_008462146.1| PREDICTED: heat shock 70 kDa protein 15-like [Cucumis melo]
 ref|XP_008462147.1| PREDICTED: heat shock 70 kDa protein 15-like [Cucumis melo]
Length=844

 Score =   473 bits (1217),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 257/359 (72%), Positives = 295/359 (82%), Gaps = 12/359 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQISIPILERVK PLE+A+AEAGL VENIH +EV+GSGSRVPAIIKILT+FF KEPRR
Sbjct  302   EFEQISIPILERVKGPLEQALAEAGLTVENIHVVEVVGSGSRVPAIIKILTDFFKKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++G ALQCAILSPTFKVR+FQVNE FPF IALSWKG + D+QNGA +NQQST
Sbjct  362   TMNASECVARGSALQCAILSPTFKVREFQVNEHFPFSIALSWKGAASDSQNGALDNQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPSVKALTFYRSGTFS+DV Y D S+ Q   KISTYTIGPFQS KG R+K+K
Sbjct  422   VVFPKGNPIPSVKALTFYRSGTFSVDVHYTD-SDQQG--KISTYTIGPFQSSKGGRSKVK  478

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDD-----IPPQDSSETDVN  706
             VKVRLNLHGI    S       E E   +    ++  KMETD+       P  S+E DVN
Sbjct  479   VKVRLNLHGI---VSVESATLLEEEDVDIPVTKEQPAKMETDEAPADAAAPPSSNENDVN  535

Query  707   MQDDKVTSDA-SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             MQD K T+DA +EN   ESG++ VQMETD+K EAPKKKVKKTN+PV EL+YG L+ ADVQ
Sbjct  536   MQDAKGTTDAGAENGSAESGEQSVQMETDSKVEAPKKKVKKTNIPVVELIYGGLAAADVQ  595

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKEFEMALQDR+MEETK+KKNAVEAYVY+MRNKL+DKYQ+FV +S++E+L  KLQE
Sbjct  596   KAVEKEFEMALQDRVMEETKEKKNAVEAYVYEMRNKLHDKYQDFVTESQREELSGKLQE  654



>gb|KHN32604.1| Heat shock 70 kDa protein 14 [Glycine soja]
Length=862

 Score =   473 bits (1217),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 268/365 (73%), Positives = 303/365 (83%), Gaps = 12/365 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQ+S+PILERVK PLEKA+AEAGL VEN+H +EV+GSGSRVPAI KILTEFF KEPRR
Sbjct  302   EFEQLSLPILERVKGPLEKALAEAGLTVENVHMVEVVGSGSRVPAINKILTEFFKKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNESFPF I+LSWK PS DAQ    +N+QST
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNESFPFSISLSWKAPSSDAQESGPDNKQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPSVKALT YRSGTFSIDVQY DVS LQ P+KISTYTIGPFQS K E+AK+K
Sbjct  422   LVFPKGNPIPSVKALTIYRSGTFSIDVQYDDVSGLQTPAKISTYTIGPFQSTKNEKAKVK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevp-vvkeqlkeSTKME-------TDDIPPQDSSET  697
             VKVRLN+HGI+SVESATLLEEEE     V KE   E++KME               +++ 
Sbjct  482   VKVRLNVHGIISVESATLLEEEEEIEVPVYKEPAGENSKMETDEAPADAAAAATPSTNDN  541

Query  698   DVNMQD--DKVTSDA--SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGAL  865
             DV+MQD   K T++A  +EN   E+GDKPVQM+TD K EAPKKKVKK N+PV ELVYGA+
Sbjct  542   DVSMQDANTKATANAPGAENGTPEAGDKPVQMDTDTKVEAPKKKVKKINIPVVELVYGAM  601

Query  866   SPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLI  1045
             +  DVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DKYQEFV+DSE+E   
Sbjct  602   AATDVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLNDKYQEFVIDSEREAFT  661

Query  1046  AKLQE  1060
             AKLQE
Sbjct  662   AKLQE  666



>ref|XP_004506857.1| PREDICTED: heat shock 70 kDa protein 15-like [Cicer arietinum]
Length=849

 Score =   473 bits (1216),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 259/362 (72%), Positives = 305/362 (84%), Gaps = 10/362 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE++S+PILERVK PLEK +AEAGL+V++IH +EV+GSGSRVPAI KILTEFF KEPRR
Sbjct  302   EFEELSLPILERVKGPLEKGLAEAGLSVDDIHMVEVVGSGSRVPAINKILTEFFKKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV+KGCAL+CAILSPTFKVR+FQVNESFPF I+LSWKG  PDAQ+   +N+QS+
Sbjct  362   TMNASECVAKGCALECAILSPTFKVREFQVNESFPFSISLSWKGSGPDAQDSGPDNKQSS  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPS+KALTFYRSGTFSIDVQY DVS LQ P++ISTYTIGPF++ + E+AK+K
Sbjct  422   LVFPKGNPIPSIKALTFYRSGTFSIDVQYGDVSGLQTPARISTYTIGPFETKQNEKAKVK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPP-------QDSSETD  700
             VK RLN+HGIVSV+ ATLLEEEEVEV V KE  +E+TK + D+ P         + ++ D
Sbjct  482   VKARLNVHGIVSVDLATLLEEEEVEVSVSKESARETTKTDADETPADVAAPPTSNDNDAD  541

Query  701   VNMQDDKVTSD--ASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPA  874
             VNMQD K  +D    EN V E+GDKPVQM+ D   +APKKKVKKTNVP++ELVYGA++P 
Sbjct  542   VNMQDAKANADNPGVENGVPETGDKPVQMDVD-DTKAPKKKVKKTNVPIAELVYGAMAPV  600

Query  875   DVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKL  1054
             DVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYD RNKL DKY +FV  SE+E L AKL
Sbjct  601   DVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDTRNKLNDKYHDFVTASEREDLTAKL  660

Query  1055  QE  1060
             QE
Sbjct  661   QE  662



>ref|XP_009389931.1| PREDICTED: heat shock 70 kDa protein 14-like [Musa acuminata 
subsp. malaccensis]
Length=849

 Score =   471 bits (1211),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 264/360 (73%), Positives = 308/360 (86%), Gaps = 7/360 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+ISIPILERV+ PLEKA++E+GL+VENIH++EV+GSGSRVPAIIKILTEFFGKEPRR
Sbjct  302   EFEKISIPILERVRGPLEKALSESGLSVENIHTVEVVGSGSRVPAIIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++G ALQCAILSPTFKVR+FQV+ESFPFPIALSWKG   D+QNG  E QQST
Sbjct  362   TMNASECVARGSALQCAILSPTFKVREFQVHESFPFPIALSWKGSGTDSQNGGTEKQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNP+PSVKA+TF+RS T ++D  Y D S++Q P+KISTYTIGPF S KGE+AKLK
Sbjct  422   VVFPKGNPLPSVKAITFFRSSTITVDAVYTDSSDVQVPAKISTYTIGPFLSSKGEKAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeql--keSTKMETDDIPPQDS-SETDVNMQ  712
             VKV LNLHGIVS+ESAT+LEEEEVEVPV       KESTKM+ D++    S +ETDV M+
Sbjct  482   VKVHLNLHGIVSIESATMLEEEEVEVPVSAAVEPPKESTKMDMDELTNDVSKTETDVKME  541

Query  713   DDKVTSDAS----ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADV  880
             D K  ++ S    +  V ES +KP QMETD K EAP+KKVKKTNVPV ELVYG +S  D+
Sbjct  542   DSKNAANNSSGEVDTAVPESDEKPAQMETDNKVEAPRKKVKKTNVPVVELVYGGMSAEDL  601

Query  881   QKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             QKAVEKEFEMALQDR+MEETK+KKNAVEAYVYD+RNKLYDKYQEFV+ SEK++LIAKLQE
Sbjct  602   QKAVEKEFEMALQDRVMEETKEKKNAVEAYVYDIRNKLYDKYQEFVMPSEKDELIAKLQE  661



>ref|XP_007135698.1| hypothetical protein PHAVU_010G150800g [Phaseolus vulgaris]
 ref|XP_007135699.1| hypothetical protein PHAVU_010G150800g [Phaseolus vulgaris]
 gb|ESW07692.1| hypothetical protein PHAVU_010G150800g [Phaseolus vulgaris]
 gb|ESW07693.1| hypothetical protein PHAVU_010G150800g [Phaseolus vulgaris]
Length=841

 Score =   469 bits (1207),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 255/357 (71%), Positives = 303/357 (85%), Gaps = 6/357 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQ+S+PILERV+ PLE+A+AEAGL +EN+H++EV+GSGSRVPA+ KILTEFF KEPRR
Sbjct  302   EFEQLSLPILERVRGPLERALAEAGLTIENVHTVEVVGSGSRVPAVNKILTEFFKKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV+KGCAL+CAILSPTFKVR+FQ+NES PF I+L+WKG  PDAQ+ A ENQQS+
Sbjct  362   TMNASECVAKGCALECAILSPTFKVREFQINESLPFSISLTWKGTGPDAQDNAPENQQSS  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPS+KALTFYRSGTFS+DV Y DVSELQ P+KISTYTIGPFQ+   ER K+K
Sbjct  422   LVFPKGNPIPSIKALTFYRSGTFSVDVHYGDVSELQTPAKISTYTIGPFQTANSERTKVK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDI---PPQDSSETDVNMQ  712
             VKVRLN+HGIVS+ESA LLEE+EVEVP+ KE   E+TK     +    P  S++T  N+Q
Sbjct  482   VKVRLNIHGIVSLESAMLLEEKEVEVPITKEAAGENTKPNEAPVEVATPPASNDTSANVQ  541

Query  713   DDKV-TSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKA  889
             D+KV T+  +EN V E+GDKP Q  TD   +APKKKVKKT++ +SE+VYGA+ P DVQKA
Sbjct  542   DEKVSTASGAENGVPENGDKPSQTNTD--TKAPKKKVKKTSISISEVVYGAMVPLDVQKA  599

Query  890   VEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             +EKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DKYQEFV+ SE+E   AKLQE
Sbjct  600   IEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLNDKYQEFVIASEREDFTAKLQE  656



>ref|XP_004506856.1| PREDICTED: heat shock 70 kDa protein 15-like [Cicer arietinum]
Length=851

 Score =   469 bits (1208),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 257/362 (71%), Positives = 309/362 (85%), Gaps = 10/362 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE++S+PILERVK PLE A+AEAGL+V+++H +EV+GSGSRVPAI KILTEFF KEPRR
Sbjct  302   EFEELSLPILERVKGPLENALAEAGLSVDDVHMVEVVGSGSRVPAINKILTEFFKKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV+KGCAL+CAILSPTFKVR+FQVN+SFPF I+LSWKG  PDAQ+  ++N+QS+
Sbjct  362   TMNASECVAKGCALECAILSPTFKVREFQVNDSFPFSISLSWKGSGPDAQDSGSDNKQSS  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPS+KALTFYRSGTFSIDVQY DVS LQ PS+ISTYTIGPF++ + E+AK+K
Sbjct  422   LVFPKGNPIPSIKALTFYRSGTFSIDVQYGDVSGLQKPSRISTYTIGPFETKQNEKAKVK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPP-------QDSSETD  700
             VK RLN+HGIVSV+ ATLLEEEEVEV V KE  +E+TK+  D+ P         ++S+ D
Sbjct  482   VKARLNVHGIVSVDLATLLEEEEVEVSVSKESARETTKINADEAPADASAPPTSNNSDGD  541

Query  701   VNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPA  874
             VNMQD K ++D    EN V E+G+KPVQM+ D + +APKKKVKKTNVP++ELVYGA++P 
Sbjct  542   VNMQDAKASADTPVVENGVPETGEKPVQMDVD-ETKAPKKKVKKTNVPIAELVYGAMAPV  600

Query  875   DVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKL  1054
             DVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVY+ RNKL DKY +FV  SE+E L AKL
Sbjct  601   DVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYETRNKLNDKYHDFVTASEREDLTAKL  660

Query  1055  QE  1060
             QE
Sbjct  661   QE  662



>ref|XP_009408938.1| PREDICTED: heat shock 70 kDa protein 15-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408939.1| PREDICTED: heat shock 70 kDa protein 15-like [Musa acuminata 
subsp. malaccensis]
Length=852

 Score =   467 bits (1201),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 263/368 (71%), Positives = 304/368 (83%), Gaps = 15/368 (4%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE IS PILERVK PLEKA+AEAGL+VENIHS+EV+GSGSRVPAII+ILTEFFGKEPRR
Sbjct  302   EFEHISAPILERVKGPLEKALAEAGLSVENIHSVEVVGSGSRVPAIIRILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQV+ESFPF IALSWKG +PD+Q   +ENQQS+
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVHESFPFSIALSWKGSAPDSQTVGSENQQSS  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPSVKAL FYRS TF++DV YADV +LQ P++ISTYTIGPFQ+ KGERAKLK
Sbjct  422   VVFPKGNPIPSVKALAFYRSRTFTVDVVYADVGDLQVPAEISTYTIGPFQTSKGERAKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDS-----------  688
             VKVRLNLHGIVS+ESAT+LEEEEVEV V          M+ D+     S           
Sbjct  482   VKVRLNLHGIVSIESATMLEEEEVEVAVSDTAEVTKESMDMDEATKFSSKTENDENGSSK  541

Query  689   SETDVNMQDDKVTSDAS----ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVY  856
             +E DV+MQ+ + T+D S    EN   ++G+KPVQM+TD+K E  KKKVKKTNVPV+ELVY
Sbjct  542   TENDVDMQEAEGTTDNSSAGFENGAPKAGEKPVQMDTDSKVEVSKKKVKKTNVPVTELVY  601

Query  857   GALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKE  1036
             G +   ++QKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKLYDKYQ+FV  +EKE
Sbjct  602   GGMLAEELQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLYDKYQDFVTPTEKE  661

Query  1037  QLIAKLQE  1060
              LI KLQE
Sbjct  662   ALIMKLQE  669



>gb|KEH28782.1| heat shock 70 kDa protein [Medicago truncatula]
Length=851

 Score =   467 bits (1201),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 258/360 (72%), Positives = 303/360 (84%), Gaps = 8/360 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE++S+PILERVK PLE+A+AEAGL+V++IH +EV+GSGSRVPAI KILTEFF KEPRR
Sbjct  302   EFEELSLPILERVKGPLERALAEAGLSVDDIHMVEVVGSGSRVPAINKILTEFFKKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV+KG ALQCAILSPTFKVR+FQVNESFPF I+L+WKG  PDAQ+   +NQQS+
Sbjct  362   TMNASECVAKGAALQCAILSPTFKVREFQVNESFPFSISLAWKGSGPDAQDSGPDNQQSS  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPS+KALTFYRSGTFSID QY+DV+  Q P++ISTYTIGPF++ + E+AK+K
Sbjct  422   LVFPKGNPIPSIKALTFYRSGTFSIDAQYSDVNGQQTPARISTYTIGPFEAKQSEKAKVK  481

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM-----ETDDIPPQDSSETDVN  706
             VKVRLN+HGI SV+ AT+LEEEEVE  V KE  KE TKM       D   P + ++ DVN
Sbjct  482   VKVRLNVHGIASVDLATVLEEEEVEASVSKESAKEPTKMEADEAPADPAAPPNGNDADVN  541

Query  707   MQDDKVTSD--ASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADV  880
             MQD K  +D    EN V E+GDKP QM+ D   +APKKKVKKTNVPV+ELVYGA++P DV
Sbjct  542   MQDAKANADTPGVENGVPETGDKPAQMDVD-DTKAPKKKVKKTNVPVAELVYGAMAPVDV  600

Query  881   QKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             QKAVEKE+EMALQDR+MEETKDKKNAVEAYVYDMRNKL DKYQEFV+ SE+E L AKLQE
Sbjct  601   QKAVEKEYEMALQDRVMEETKDKKNAVEAYVYDMRNKLNDKYQEFVIASEREGLTAKLQE  660



>gb|KDO51188.1| hypothetical protein CISIN_1g003056mg [Citrus sinensis]
Length=833

 Score =   462 bits (1188),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 267/365 (73%), Positives = 299/365 (82%), Gaps = 34/365 (9%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS PILERVK+PLEKA+AE GL+VE++H +EV+GS SRVPAIIKILTEFFGKEPRR
Sbjct  302   EFEQISAPILERVKRPLEKALAETGLSVEDVHMVEVVGSSSRVPAIIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNESFPF I+LSWKG +P+AQN   +NQQST
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNESFPFSISLSWKGSAPEAQNETGDNQQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
              VFPKGNPIPSVKALTFYRSGTF++DVQYADVSE                    ERAK+K
Sbjct  422   TVFPKGNPIPSVKALTFYRSGTFTVDVQYADVSEF-------------------ERAKVK  462

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIP----PQDSSETDVNM  709
             VKVRLN+HGIVS+ESATLLEEEEVEVPV KE  KE+ KMETD++P    P  SSETDVNM
Sbjct  463   VKVRLNMHGIVSIESATLLEEEEVEVPVTKEPEKEAAKMETDEVPSDAAPPSSSETDVNM  522

Query  710   QDDKVTSDA--------SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGAL  865
             QD K T+DA        +EN V ESGDKP QMET    + PKKKVKKTN+PVSELVYG +
Sbjct  523   QDAKGTADAQGTTDAPGAENGVPESGDKPTQMET---DKTPKKKVKKTNIPVSELVYGGM  579

Query  866   SPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLI  1045
              P DVQKAVEKEFEMALQDR+MEETKD+KNAVEAYVYDMRNKL DKYQ+FV DSE+E   
Sbjct  580   LPVDVQKAVEKEFEMALQDRVMEETKDRKNAVEAYVYDMRNKLCDKYQDFVTDSERELFT  639

Query  1046  AKLQE  1060
             +KLQE
Sbjct  640   SKLQE  644



>gb|KFK42397.1| hypothetical protein AALP_AA2G250600 [Arabis alpina]
Length=481

 Score =   448 bits (1152),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 237/330 (72%), Positives = 267/330 (81%), Gaps = 30/330 (9%)
 Frame = +2

Query  101   IEVIGSGSRVPAIIKILTEFFGKEPRRTMNASECVSKGCALQCAILSPTFKVRDFQVNES  280
             +EV+GSGSRVPAIIKILTEFFGKEPRRTMNASECVS+GCALQCAILSPTFKVR+FQV+ES
Sbjct  2     VEVVGSGSRVPAIIKILTEFFGKEPRRTMNASECVSRGCALQCAILSPTFKVREFQVHES  61

Query  281   FPFPIALSWKGPSPDAQNGAAENQQSTIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVS  460
             FPF I+L+WKG + D QNG AENQQSTIVFPKGNPIPS+KALTFYRSGTFS+DVQYADV+
Sbjct  62    FPFSISLAWKGAASDGQNGGAENQQSTIVFPKGNPIPSIKALTFYRSGTFSVDVQYADVT  121

Query  461   ELQAPSKISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeql  640
             ELQAP KISTYTIGPFQS KGERAKLKVKVRLNLHGI                      +
Sbjct  122   ELQAPPKISTYTIGPFQSSKGERAKLKVKVRLNLHGI--------------------VSV  161

Query  641   keSTKMETDDIP---PQDSSETDVNMQDDKV-----TSDA--SENHVLESGDKPVQMETD  790
             + +T +E D+I     ++ SE  ++M  DK      +SDA  + N   ES DKPVQMETD
Sbjct  162   ESATLLEEDEIEVPVSKEQSEETIDMDTDKAPASGDSSDAAGTNNGAPESADKPVQMETD  221

Query  791   akaeapkkkvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAY  970
              KAEAPKKKVKKTNVP+SELVYGAL   DVQKAVEKEFEMALQDR+MEETKDKKNAVE+Y
Sbjct  222   TKAEAPKKKVKKTNVPLSELVYGALQSVDVQKAVEKEFEMALQDRVMEETKDKKNAVESY  281

Query  971   VYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             VYDMRNKL DKYQE+++DSE+E  +A LQE
Sbjct  282   VYDMRNKLSDKYQEYIIDSEREAFLATLQE  311



>ref|XP_006643833.1| PREDICTED: heat shock 70 kDa protein 14-like [Oryza brachyantha]
Length=843

 Score =   458 bits (1179),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 257/358 (72%), Positives = 296/358 (83%), Gaps = 11/358 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS PILERVK PLEKA+AEAGL  EN+H +EV+GSGSRVPAIIKILTEFFGKEPRR
Sbjct  302   EFEQISAPILERVKGPLEKALAEAGLTTENVHFVEVVGSGSRVPAIIKILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCAL+CAILSPTFKVR+FQVN+ FPF IA+SWK   PD+QNG   + Q T
Sbjct  362   TMNASECVARGCALECAILSPTFKVREFQVNDGFPFSIAMSWK---PDSQNG---DYQQT  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNP+PSVKALTFYRS TF+IDV Y D  +LQ   KISTYTIGPF   KG++AKLK
Sbjct  416   VVFPKGNPMPSVKALTFYRSNTFTIDVTYVDTGDLQISPKISTYTIGPFHPSKGDKAKLK  475

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlke-STKMETDDIPPQDSSETDVNMQDD  718
             VKVRLN+HG+VSVESAT+LEEEEVE+PVV     + STKMETD+ P + ++ TDVNMQ+ 
Sbjct  476   VKVRLNIHGVVSVESATMLEEEEVEIPVVATTEAKDSTKMETDEAPNEAAAGTDVNMQEA  535

Query  719   KVTSDA----SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             K ++DA    +EN    S +K V METDAK E  KKKVKK NVPV+ELVYGAL   ++ K
Sbjct  536   KTSADAAAEGAENGTTNSEEKSVPMETDAKVEPSKKKVKKINVPVAELVYGALGTKELDK  595

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             AVEKEFEMALQDR+MEETKDKKNAVE+YVYDMRNKLYDKY +FV   +KE LIAKLQE
Sbjct  596   AVEKEFEMALQDRVMEETKDKKNAVESYVYDMRNKLYDKYNDFVTSEDKEALIAKLQE  653



>ref|XP_003597778.1| 97 kDa heat shock protein [Medicago truncatula]
 ref|XP_003597784.1| 97 kDa heat shock protein [Medicago truncatula]
 gb|AES68029.1| heat shock 70 kDa protein [Medicago truncatula]
Length=858

 Score =   458 bits (1178),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 261/361 (72%), Positives = 305/361 (84%), Gaps = 10/361 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FEQ+S+PILERVK PLEKA+AEAGL VENIH +EV+GSGSRVPAI KILTEFF KEPRR
Sbjct  302   DFEQLSLPILERVKGPLEKALAEAGLTVENIHMVEVVGSGSRVPAINKILTEFFKKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++G ALQCAILSPTFKVR+FQVNESFPF ++LSWK    DA +  ++N+QST
Sbjct  362   TMNASECVARGAALQCAILSPTFKVREFQVNESFPFSVSLSWKYSGSDAPDSESDNKQST  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGNPIPS K LTF+R+GTFS+DVQ  D+SE   P+KISTYTIGPFQ+  G++ K+K
Sbjct  422   IVFPKGNPIPSSKVLTFFRTGTFSVDVQCHDLSE--TPTKISTYTIGPFQTKNGDKGKVK  479

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDD------IPPQDSSETDV  703
              KVRLNLHGIVSVESATL EEEE+EVPV KE  +E+ KMETD+       PP  S++ DV
Sbjct  480   AKVRLNLHGIVSVESATLFEEEEIEVPVTKEFAEENAKMETDEAPADAAAPPPSSNDNDV  539

Query  704   NMQDDKVTSD--ASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPAD  877
             NMQD K T+D   +EN + ++GDKPVQM+TD K EAPKKKVKKTN+PV+E+VYGA++  D
Sbjct  540   NMQDAKATADTPGAENGLPDAGDKPVQMDTDTKVEAPKKKVKKTNIPVAEVVYGAMATVD  599

Query  878   VQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQ  1057
             VQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL DKYQEFVV SE++  I KLQ
Sbjct  600   VQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLNDKYQEFVVASERDGFITKLQ  659

Query  1058  E  1060
             E
Sbjct  660   E  660



>ref|XP_009388669.1| PREDICTED: heat shock 70 kDa protein 14-like [Musa acuminata 
subsp. malaccensis]
Length=847

 Score =   452 bits (1163),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 249/361 (69%), Positives = 296/361 (82%), Gaps = 10/361 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS PILERVK+PLEKA+ EAGL+VENIHS+EV+GSGSRVPAII+ILTEFFGKEPRR
Sbjct  302   EFEQISAPILERVKRPLEKALVEAGLSVENIHSVEVVGSGSRVPAIIRILTEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GC+LQCAILSPTFKVR+FQV+ESFP  IALSWKG +PD+Q G +E+QQS+
Sbjct  362   TMNASECVARGCSLQCAILSPTFKVREFQVHESFPLSIALSWKGSTPDSQKGESESQQSS  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPSVKALTFYRS TF++D+ Y D  +LQ PSKISTY IGPFQSGKG   KLK
Sbjct  422   VVFPKGNPIPSVKALTFYRSITFTVDIIYTDGGDLQVPSKISTYAIGPFQSGKGGIVKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeeve--vpvvkeqlkeSTKMETDDIPPQDSSET--DVNM  709
             VKVR+NLHGIVSVESAT+LEEEEV+  V    E   E+T M+ D+    DSS+T  DVNM
Sbjct  482   VKVRMNLHGIVSVESATMLEEEEVDVPVSSATELTMEATNMDMDE-ATNDSSKTENDVNM  540

Query  710   QDDKV----TSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPAD  877
             Q+ K     +S   EN   E  +  V+METD       +KVKKTNVP++ELVYG +   +
Sbjct  541   QEAKGSVGNSSGGIENGTSEIEENAVRMETD-TKVEVPRKVKKTNVPITELVYGGMLAEE  599

Query  878   VQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQ  1057
             +QKAVE+EFEMALQD++MEETKD+KN VEAYVYDMRNKL+DKYQ+FV  +EK++ IAKLQ
Sbjct  600   LQKAVEQEFEMALQDKVMEETKDRKNTVEAYVYDMRNKLHDKYQDFVTSTEKKEFIAKLQ  659

Query  1058  E  1060
             E
Sbjct  660   E  660



>ref|NP_001042210.1| Os01g0180800 [Oryza sativa Japonica Group]
 dbj|BAB32902.1| putative heat shock protein [Oryza sativa Japonica Group]
 dbj|BAB33024.1| putative heat shock protein [Oryza sativa Japonica Group]
 dbj|BAF04124.1| Os01g0180800 [Oryza sativa Japonica Group]
 gb|EAZ10794.1| hypothetical protein OsJ_00630 [Oryza sativa Japonica Group]
 gb|ADR66977.1| 70 kDa heat shock protein [Oryza sativa Japonica Group]
Length=845

 Score =   444 bits (1143),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 254/359 (71%), Positives = 294/359 (82%), Gaps = 12/359 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+IS  ILERVK PLEKA+AEAGL  EN+H +EV+GSGSRVPAIIKILT+FFGKEPRR
Sbjct  302   EFEKISASILERVKGPLEKALAEAGLTTENVHFVEVVGSGSRVPAIIKILTDFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCAL+CAILSPTFKVR+FQVN+ FPF IA+SWK   PD+QNG  +NQQ T
Sbjct  362   TMNASECVARGCALECAILSPTFKVREFQVNDGFPFSIAMSWK---PDSQNG--DNQQ-T  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNP+PSVKALTFYRS TF +DV Y D  +LQ   KISTYT+GPF  GKG++AKLK
Sbjct  416   VVFPKGNPLPSVKALTFYRSNTFQVDVTYVDTGDLQISPKISTYTVGPFNPGKGDKAKLK  475

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeql--keSTKMETDDIPPQDSSETDVNMQD  715
             VKVRLN+HG+V+VESAT+LEEEEVEVPV       K+S KMETDD P + +S TDVNMQ+
Sbjct  476   VKVRLNIHGVVTVESATMLEEEEVEVPVAATTEPPKDSAKMETDDAPNEAASGTDVNMQE  535

Query  716   ----DKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
                     +D +EN    S +K V METDAK E  KKKVKKTNVPV+ELVYGAL   ++Q
Sbjct  536   AKAPADAAADGAENGAPNSEEKSVPMETDAKVEPSKKKVKKTNVPVAELVYGALGTTELQ  595

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKE+EMALQDR+MEETKDKKNAVE+YVYDMRNKLYDKY +FV   +KE  IAKLQE
Sbjct  596   KAVEKEYEMALQDRVMEETKDKKNAVESYVYDMRNKLYDKYNDFVTAEDKEAFIAKLQE  654



>ref|XP_004960855.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Setaria 
italica]
Length=845

 Score =   444 bits (1143),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 257/358 (72%), Positives = 294/358 (82%), Gaps = 11/358 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FEQIS P+LERVK PLEKA+AEAGL  EN+H +EV+GSGSRVPAIIKI+TEFFGKEPRR
Sbjct  302   DFEQISAPVLERVKGPLEKALAEAGLTTENVHFVEVVGSGSRVPAIIKIITEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVN+ FPF IALSWK   PDAQN   E QQ T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNDGFPFTIALSWK---PDAQNN--ETQQ-T  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             I+FPKGN IPSVKALTFYR+ TF++DV   D ++ Q   KISTYTIGPFQS  GE+AKLK
Sbjct  416   IIFPKGNAIPSVKALTFYRANTFAVDVVNVDANDAQIEPKISTYTIGPFQSSNGEKAKLK  475

Query  542   VKVRLNLHGIvsvesatlleeeevev--pvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             +KVRLN+HGIVSVESAT+LEEEEVEV      E  KE+TKM+TDD P   +S TDVNMQ+
Sbjct  476   LKVRLNIHGIVSVESATMLEEEEVEVPVSATNEAQKEATKMDTDDAPNDPASGTDVNMQE  535

Query  716   DKVTSD---ASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
              K  +D    +EN    S +K V M+TDAKAE  KKKVKKTNVPVSELVYGAL  A++ K
Sbjct  536   SKGATDTAEGAENGAPTSEEKTVPMDTDAKAEPSKKKVKKTNVPVSELVYGALGAAELDK  595

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             AVEKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYDKY +FV   +KE LI+KLQE
Sbjct  596   AVEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDKYGDFVTPEDKEGLISKLQE  653



>ref|XP_002440718.1| hypothetical protein SORBIDRAFT_09g005570 [Sorghum bicolor]
 gb|EES19148.1| hypothetical protein SORBIDRAFT_09g005570 [Sorghum bicolor]
Length=851

 Score =   441 bits (1135),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 246/359 (69%), Positives = 283/359 (79%), Gaps = 12/359 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS P+LERVK PLEKA+AEAGL  EN+H +EV+GSGSRVPAIIKI+TEFFGKEPRR
Sbjct  302   EFEQISAPVLERVKGPLEKALAEAGLTTENVHFVEVVGSGSRVPAIIKIITEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVN+ FPF IALSWK      Q+      Q T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNDGFPFSIALSWK------QDSQTSVPQQT  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKGN IPS+KALTFY+S TF +DV Y D  + Q P KISTYTIGPFQ  KGE+AKLK
Sbjct  416   IVFPKGNAIPSIKALTFYKSSTFEVDVLYVDTGDSQIPQKISTYTIGPFQPSKGEKAKLK  475

Query  542   VKVRLNLHGIvsvesatlleeeeve-vpvvkeqlkeSTKMETDDIPPQDSSETDVNMQDD  718
             VKVRLN+HGIV+V+SAT+LEE+    V    E  K++TKM+TDD P    S TDVNM + 
Sbjct  476   VKVRLNIHGIVTVDSATMLEEDVEVPVSSANEAPKDTTKMDTDDAPSDPVSGTDVNMHEP  535

Query  719   KV-----TSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             K       + A+EN   +  +K V METDAK E  K+KVKKT+VPV ELVYGAL+  D+Q
Sbjct  536   KSADTTEAAPAAENGAQDPEEKSVPMETDAKVEPSKRKVKKTSVPVHELVYGALAAVDLQ  595

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYDKY +FV   EKE LIAKLQE
Sbjct  596   KAVEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDKYSDFVTSEEKEGLIAKLQE  654



>emb|CCM07272.1| Putative 97 kDa heat shock protein [Musa balbisiana]
Length=845

 Score =   441 bits (1133),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 242/360 (67%), Positives = 291/360 (81%), Gaps = 8/360 (2%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS PILERVK+PLEKA+AEAGL+VENIHS+EV+GS SRVPAII+ILTEFF KEPRR
Sbjct  302   EFEQISAPILERVKRPLEKALAEAGLSVENIHSVEVVGSCSRVPAIIRILTEFFRKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GC+LQCAILSPTFKVR+FQV+ESFP  IALSWKG +PD+QNG +E+QQS+
Sbjct  362   TMNASECVARGCSLQCAILSPTFKVREFQVHESFPLSIALSWKGSTPDSQNGESESQQSS  421

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPSVKALTFYRS TF++D+   D  +LQ PSKI+TY IGPFQSGKG   KLK
Sbjct  422   VVFPKGNPIPSVKALTFYRSNTFTVDIICTDGGDLQVPSKITTYAIGPFQSGKGGIVKLK  481

Query  542   VKVRLNLHGIvsvesatlleeeeve--vpvvkeqlkeSTKMETDDIPPQDS-SETDVNMQ  712
             VKVR+NLHGIVSVESAT+LEEEEV+  V    E   E+T M+ D+     S +E D+N Q
Sbjct  482   VKVRMNLHGIVSVESATMLEEEEVDVPVSSATELTMEATNMDMDEATNDSSKTENDINTQ  541

Query  713   DDKVT----SDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADV  880
             + + +    S   EN   E  +  V+METD       +KVKKTN+P++ELVYG +   ++
Sbjct  542   EARGSVGNYSGGIENGTSEIEENAVRMETD-TKVEVPRKVKKTNIPITELVYGGMLAEEL  600

Query  881   QKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             QKAVEKEFEMALQD++MEETKD+KN VEAYVYDMRNKL DKYQ+FV  ++KE+ IAKLQE
Sbjct  601   QKAVEKEFEMALQDKVMEETKDRKNTVEAYVYDMRNKLDDKYQDFVTSTKKEEFIAKLQE  660



>ref|XP_004960853.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X2 [Setaria 
italica]
Length=850

 Score =   436 bits (1122),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 251/361 (70%), Positives = 290/361 (80%), Gaps = 15/361 (4%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS P+LERVK PLEKA+AEAGL  EN+H +EV+GSGSRVPAIIKI+TEFFGKEPRR
Sbjct  302   EFEQISAPVLERVKGPLEKALAEAGLTTENVHFVEVVGSGSRVPAIIKIITEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVN+ FPF IALSWK   PD+Q+G+    Q T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNDGFPFSIALSWK---PDSQDGSP---QQT  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGN IPSVKALTFYRS TF +DV Y D  + Q   KISTYTIGPFQ  KGE+AKLK
Sbjct  416   VVFPKGNAIPSVKALTFYRSSTFEVDVLYVDTGDSQISQKISTYTIGPFQPSKGEKAKLK  475

Query  542   VKVRLNLHGIvsvesatlleeeeve--vpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             VKVRLN+HGIV+V+SA +LEE++VE  V  V E  K++TKM+TDD P   SS TDVNMQ+
Sbjct  476   VKVRLNIHGIVTVDSALMLEEDDVEVPVSSVNEAPKDATKMDTDDAPSDPSSGTDVNMQE  535

Query  716   DKVTSDASENHVLESG------DKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPAD  877
              K ++D +E             +K V METDAK E  KKKVKKT VPV ELVYGAL  A+
Sbjct  536   PK-SADTTEGAAAAENGAQDPEEKSVPMETDAKVEPSKKKVKKTAVPVHELVYGALPAAE  594

Query  878   VQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQ  1057
             ++KAVEKE+EMALQDRIMEETK+KKNAVEAYVYDMRNKLYDKY +FV   EKE LI++LQ
Sbjct  595   LEKAVEKEYEMALQDRIMEETKEKKNAVEAYVYDMRNKLYDKYNDFVTPEEKEGLISRLQ  654

Query  1058  E  1060
             E
Sbjct  655   E  655



>ref|XP_004960852.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X1 [Setaria 
italica]
Length=878

 Score =   436 bits (1121),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 251/361 (70%), Positives = 290/361 (80%), Gaps = 15/361 (4%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS P+LERVK PLEKA+AEAGL  EN+H +EV+GSGSRVPAIIKI+TEFFGKEPRR
Sbjct  302   EFEQISAPVLERVKGPLEKALAEAGLTTENVHFVEVVGSGSRVPAIIKIITEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVN+ FPF IALSWK   PD+Q+G+    Q T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNDGFPFSIALSWK---PDSQDGSP---QQT  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGN IPSVKALTFYRS TF +DV Y D  + Q   KISTYTIGPFQ  KGE+AKLK
Sbjct  416   VVFPKGNAIPSVKALTFYRSSTFEVDVLYVDTGDSQISQKISTYTIGPFQPSKGEKAKLK  475

Query  542   VKVRLNLHGIvsvesatlleeeeve--vpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             VKVRLN+HGIV+V+SA +LEE++VE  V  V E  K++TKM+TDD P   SS TDVNMQ+
Sbjct  476   VKVRLNIHGIVTVDSALMLEEDDVEVPVSSVNEAPKDATKMDTDDAPSDPSSGTDVNMQE  535

Query  716   DKVTSDASENHVLESG------DKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPAD  877
              K ++D +E             +K V METDAK E  KKKVKKT VPV ELVYGAL  A+
Sbjct  536   PK-SADTTEGAAAAENGAQDPEEKSVPMETDAKVEPSKKKVKKTAVPVHELVYGALPAAE  594

Query  878   VQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQ  1057
             ++KAVEKE+EMALQDRIMEETK+KKNAVEAYVYDMRNKLYDKY +FV   EKE LI++LQ
Sbjct  595   LEKAVEKEYEMALQDRIMEETKEKKNAVEAYVYDMRNKLYDKYNDFVTPEEKEGLISRLQ  654

Query  1058  E  1060
             E
Sbjct  655   E  655



>ref|NP_001151579.1| heat shock 70 kDa protein 4 [Zea mays]
 gb|ACN33614.1| unknown [Zea mays]
Length=848

 Score =   435 bits (1118),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 241/356 (68%), Positives = 281/356 (79%), Gaps = 9/356 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE IS P+L RVK PLEKA+AEAGL  EN+H +EV+GSGSRVPAIIKI+T+FFGKEPRR
Sbjct  302   EFEHISAPVLVRVKGPLEKALAEAGLTTENVHFVEVVGSGSRVPAIIKIITDFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVN+ FPF IALSWK    D+QN A    Q T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNDGFPFSIALSWK---QDSQNSAP---QQT  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGN IPS+KALTFY+S TF +DV Y D  + Q P KISTYTIGPFQ  KGERAKLK
Sbjct  416   LVFPKGNVIPSIKALTFYKSSTFEVDVLYVDTCDSQIPQKISTYTIGPFQPSKGERAKLK  475

Query  542   VKVRLNLHGIvsvesatlleeeeve-vpvvkeqlkeSTKMETDDIPPQDSSETDVNMQDD  718
             VKVRLN+HGIV+V+SA +LEE+    V    E  K++TKM+TDD P    S TDVN+ + 
Sbjct  476   VKVRLNIHGIVTVDSAMMLEEDVAVPVSSANEAPKDTTKMDTDDAPSDPVSGTDVNVHEP  535

Query  719   KVT--SDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
               T  + A+EN      +K V METDAK E  K+KVK+T+VPV  LVYGAL+ AD+QKAV
Sbjct  536   DTTEAAPAAENGTQNPEEKSVPMETDAKVEPSKRKVKRTSVPVHALVYGALAAADLQKAV  595

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             EKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYD+Y +FV   EKE LI KLQE
Sbjct  596   EKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDRYNDFVTPEEKEGLIGKLQE  651



>gb|ACG43420.1| heat shock 70 kDa protein 4 [Zea mays]
 gb|ACL52695.1| unknown [Zea mays]
 gb|AFW81562.1| heat shock protein 4 [Zea mays]
Length=848

 Score =   435 bits (1118),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 241/356 (68%), Positives = 281/356 (79%), Gaps = 9/356 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE IS P+L RVK PLEKA+AEAGL  EN+H +EV+GSGSRVPAIIKI+T+FFGKEPRR
Sbjct  302   EFEHISAPVLVRVKGPLEKALAEAGLTTENVHFVEVVGSGSRVPAIIKIITDFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVN+ FPF IALSWK    D+QN A    Q T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNDGFPFSIALSWK---QDSQNSAP---QQT  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGN IPS+KALTFY+S TF +DV Y D  + Q P KISTYTIGPFQ  KGERAKLK
Sbjct  416   LVFPKGNVIPSIKALTFYKSSTFEVDVLYVDTCDSQIPQKISTYTIGPFQPSKGERAKLK  475

Query  542   VKVRLNLHGIvsvesatlleeeeve-vpvvkeqlkeSTKMETDDIPPQDSSETDVNMQDD  718
             VKVRLN+HGIV+V+SA +LEE+    V    E  K++TKM+TDD P    S TDVN+ + 
Sbjct  476   VKVRLNIHGIVTVDSAMMLEEDVAVPVSSANEAPKDTTKMDTDDAPSDPVSGTDVNVHEP  535

Query  719   KVT--SDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
               T  + A+EN      +K V METDAK E  K+KVK+T+VPV  LVYGAL+ AD+QKAV
Sbjct  536   DTTEAAPAAENGTQNPEEKSVPMETDAKVEPSKRKVKRTSVPVHALVYGALAAADLQKAV  595

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             EKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYD+Y +FV   EKE LI KLQE
Sbjct  596   EKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDRYNDFVTPEEKEGLIGKLQE  651



>ref|XP_008655087.1| PREDICTED: heat shock 70 kDa protein 4 isoform X1 [Zea mays]
Length=875

 Score =   435 bits (1118),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 241/356 (68%), Positives = 281/356 (79%), Gaps = 9/356 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE IS P+L RVK PLEKA+AEAGL  EN+H +EV+GSGSRVPAIIKI+T+FFGKEPRR
Sbjct  302   EFEHISAPVLVRVKGPLEKALAEAGLTTENVHFVEVVGSGSRVPAIIKIITDFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVN+ FPF IALSWK    D+QN A    Q T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNDGFPFSIALSWK---QDSQNSAP---QQT  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGN IPS+KALTFY+S TF +DV Y D  + Q P KISTYTIGPFQ  KGERAKLK
Sbjct  416   LVFPKGNVIPSIKALTFYKSSTFEVDVLYVDTCDSQIPQKISTYTIGPFQPSKGERAKLK  475

Query  542   VKVRLNLHGIvsvesatlleeeeve-vpvvkeqlkeSTKMETDDIPPQDSSETDVNMQDD  718
             VKVRLN+HGIV+V+SA +LEE+    V    E  K++TKM+TDD P    S TDVN+ + 
Sbjct  476   VKVRLNIHGIVTVDSAMMLEEDVAVPVSSANEAPKDTTKMDTDDAPSDPVSGTDVNVHEP  535

Query  719   KVT--SDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
               T  + A+EN      +K V METDAK E  K+KVK+T+VPV  LVYGAL+ AD+QKAV
Sbjct  536   DTTEAAPAAENGTQNPEEKSVPMETDAKVEPSKRKVKRTSVPVHALVYGALAAADLQKAV  595

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             EKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYD+Y +FV   EKE LI KLQE
Sbjct  596   EKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDRYNDFVTPEEKEGLIGKLQE  651



>ref|XP_010231644.1| PREDICTED: heat shock 70 kDa protein 15-like [Brachypodium distachyon]
Length=836

 Score =   433 bits (1113),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 244/357 (68%), Positives = 291/357 (82%), Gaps = 15/357 (4%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS P+LERVK PL+KA+AEAGL  E++H +EV+GSGSRVPAI+KI+TEFFGKEPRR
Sbjct  302   EFEQISGPVLERVKGPLDKALAEAGLTTESVHFVEVVGSGSRVPAIMKIITEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNE FPF +ALSWK  SP          Q T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNEGFPFSVALSWKPDSP------GNEAQQT  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPS+KALTFYRS TF++DV   D  ++Q   KISTYTIGPFQS KG++AKLK
Sbjct  416   VVFPKGNPIPSIKALTFYRSNTFAVDVLNVDTDDMQITQKISTYTIGPFQSSKGDKAKLK  475

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQDDK  721
             VKVRLN+HGIVS+ESAT+LEEEEVEVPV  E  K++TKM+TD     D++ TDVNMQ+ K
Sbjct  476   VKVRLNIHGIVSLESATMLEEEEVEVPVTSEVPKDATKMDTD-----DATGTDVNMQESK  530

Query  722   VTSD----ASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKA  889
               +D    A+EN   +S +K V M+TD K E  KKKVKKTNVPV+ELVYGA+S A+++KA
Sbjct  531   GATDTAEGAAENGAQDSEEKSVPMDTDTKVEPSKKKVKKTNVPVTELVYGAMSAAELEKA  590

Query  890   VEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             VEKE+EMALQDR+MEETKDKKN+VEAYVYDMRNKL +KY +FV+  + E L  KLQE
Sbjct  591   VEKEYEMALQDRVMEETKDKKNSVEAYVYDMRNKLSEKYNDFVMSEDMEGLRVKLQE  647



>gb|EMT31029.1| Heat shock 70 kDa protein 4L [Aegilops tauschii]
Length=842

 Score =   432 bits (1112),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 243/359 (68%), Positives = 294/359 (82%), Gaps = 12/359 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS P+LERVK PLEKA++EAGL  E++H +EV+GSGSRVPA++KI+TEFFGKEPRR
Sbjct  302   EFEQISAPVLERVKGPLEKALSEAGLTTESLHFVEVVGSGSRVPAVMKIITEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNE FPF +ALSWK   PDAQN   E+QQ T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNEGFPFSVALSWK---PDAQNN--ESQQ-T  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNP+PS+KALTFYRS TF++DV   D  +LQ   KISTYTIGPFQS KGE+AKLK
Sbjct  416   VVFPKGNPMPSIKALTFYRSSTFAVDVLNVDTDDLQITHKISTYTIGPFQSSKGEKAKLK  475

Query  542   VKVRLNLHGIvsvesatlleeeevev--pvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             VKVRLN+HGIVS+ESAT+LEEEEVEV      E  K++T+METDD P   +S    +MQ+
Sbjct  476   VKVRLNIHGIVSLESATMLEEEEVEVPVSSTSEVPKDATRMETDDAPQDPASSAGDHMQE  535

Query  716   DKVTSD----ASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
              K  +D    A+EN   +S +K V M+TD K E  KKKVKKTNVPV+ELVYGA+   +++
Sbjct  536   PKGAADPAEGAAENGAQDSEEKTVPMDTDTKVEPSKKKVKKTNVPVAELVYGAMGTVELE  595

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKE+EMALQDR+MEETKDKKN+VEAYVYDMRNK+++KY +FV+  + E L+AKLQE
Sbjct  596   KAVEKEYEMALQDRVMEETKDKKNSVEAYVYDMRNKIHEKYNDFVMSEDIEGLMAKLQE  654



>dbj|BAJ90753.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=835

 Score =   431 bits (1109),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 247/359 (69%), Positives = 287/359 (80%), Gaps = 20/359 (6%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS P+LERVK PLEKA+AEAGL  E++H +EV+GSGSRVPAII+I+TEFFGKEPRR
Sbjct  302   EFEQISAPVLERVKGPLEKALAEAGLTTESVHFVEVVGSGSRVPAIIRIITEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNE FPF IALSWK   PD+QN      Q T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNEGFPFSIALSWK---PDSQNN---EPQQT  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPSVKALTFYRS TF++DV      + Q   KISTYTIGPFQS KGE+AKLK
Sbjct  416   VVFPKGNPIPSVKALTFYRSNTFAVDVLNVKTEDSQETQKISTYTIGPFQSSKGEKAKLK  475

Query  542   VKVRLNLHGIvsvesatlleeeevev--pvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             VKVRLN+H IVS+ESAT+LEEEEVEV      E  K++ KMETD         TDVNMQ+
Sbjct  476   VKVRLNIHAIVSLESATMLEEEEVEVPVSATSEVPKDANKMETD--------VTDVNMQE  527

Query  716   DKVTSDA----SENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
              K T+D     +EN   +S +KP  M+TDAK E  KKKVKKTNVPV ELVYGA+  A+++
Sbjct  528   PKGTTDTAEGVTENGAQDSEEKPASMDTDAKTELAKKKVKKTNVPVVELVYGAMGAAELE  587

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKLY+KY ++V   +KE L+AKLQE
Sbjct  588   KAVEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYEKYSDYVTSEDKEALMAKLQE  646



>ref|XP_008647466.1| PREDICTED: uncharacterized protein LOC100217188 isoform X1 [Zea 
mays]
 gb|AFW77385.1| heat shock protein 4 [Zea mays]
Length=841

 Score =   429 bits (1102),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 238/359 (66%), Positives = 277/359 (77%), Gaps = 13/359 (4%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS  +LERVK PLEKA+AEAGL  EN+H +EV+GSGSRVPAIIKI+T+FFGKEPRR
Sbjct  302   EFEQISASVLERVKGPLEKALAEAGLTTENVHFVEVVGSGSRVPAIIKIITDFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVN+ FPF IALSW G   D+QN      Q T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNDGFPFSIALSWNG---DSQN----TPQQT  414

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGN IPS K LTF++S TF +DV Y D + LQ P KISTYTIGPFQ+ KGE+AKLK
Sbjct  415   LVFPKGNAIPSTKVLTFFKSSTFEVDVLYVDPNGLQIPQKISTYTIGPFQTSKGEKAKLK  474

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeST-KMETDDIPPQDSSETDVNMQDD  718
             VKVRLN+HG V+V+SA +LE++         +    T KM+TDD P   +  +DVNMQ+ 
Sbjct  475   VKVRLNIHGTVTVDSAIMLEDDVEVPVSSANEAPNDTMKMDTDDAPSDPAVASDVNMQEP  534

Query  719   KVTSDASENHVLESG-----DKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
             K    A   H  E+G     +K V METDAK E  KKKVKK  VPV ELVYGAL+ AD+Q
Sbjct  535   KSADTAEAAHAAENGPQDTEEKSVPMETDAKVEPSKKKVKKITVPVHELVYGALAAADLQ  594

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYDKY +FV   +KE LIAKLQE
Sbjct  595   KAVEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDKYSDFVTSEDKEGLIAKLQE  653



>gb|EMS61926.1| Heat shock 70 kDa protein 4L [Triticum urartu]
Length=841

 Score =   426 bits (1096),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 245/359 (68%), Positives = 288/359 (80%), Gaps = 20/359 (6%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS P+LERVK PLEKA+AEAGL  E++H +EV+GSGSRVPAII+I+TEFFGKEPRR
Sbjct  302   EFEQISAPVLERVKGPLEKALAEAGLTTESVHFVEVVGSGSRVPAIIRIITEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNE FPF IALSWK   PD+QN      Q T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNEGFPFSIALSWK---PDSQNN---EPQQT  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPSVKALTFYRS TF++DV   +  + Q   KISTYTIGPFQS KGE+AKLK
Sbjct  416   VVFPKGNPIPSVKALTFYRSNTFAVDVLNVETEDSQVTQKISTYTIGPFQSSKGEKAKLK  475

Query  542   VKVRLNLHGIvsvesatlleeeevev--pvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             VKVRLN+HGIVS+ESAT+LEEEEVEV      E  K++ KMETD         TDVNMQ+
Sbjct  476   VKVRLNIHGIVSLESATMLEEEEVEVPVSATSEVPKDANKMETD--------ATDVNMQE  527

Query  716   DKVTSDASE----NHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
              K T+D +E    +   +S +K   M+TDAK E  KKKVKKTNVPV+ELVYGA+  A+++
Sbjct  528   PKGTTDTAEGATGDGAQDSEEKSAPMDTDAKTEPSKKKVKKTNVPVAELVYGAMGSAELE  587

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKE+EMALQDR+MEETK+KKN+VEAYVYDMRNKLY+KY ++V   +KE L AKLQE
Sbjct  588   KAVEKEYEMALQDRVMEETKEKKNSVEAYVYDMRNKLYEKYSDYVTWEDKETLTAKLQE  646



>gb|EMT09857.1| Heat shock 70 kDa protein 4L [Aegilops tauschii]
Length=901

 Score =   426 bits (1096),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 240/358 (67%), Positives = 284/358 (79%), Gaps = 19/358 (5%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS P+LERVK PLEKA+AEAGL  E++H +EV+GSGSRVPAII+I+TEFFGKEPRR
Sbjct  302   EFEQISAPVLERVKGPLEKALAEAGLTTESVHFVEVVGSGSRVPAIIRIITEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNE FPF IALSWK   PD+QN      Q T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNEGFPFSIALSWK---PDSQNN---EPQQT  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNPIPSVKALTFYRS TF++DV   +  +LQ   KISTY IGPFQS KGE+AKLK
Sbjct  416   VVFPKGNPIPSVKALTFYRSNTFAVDVLNVETEDLQVTQKISTYMIGPFQSSKGEKAKLK  475

Query  542   VKVRLNLHGIvsvesatlleeeeve-vpvvkeqlkeSTKMETDDIPPQDSSETDVNMQDD  718
             VKVRLN+HGIVS+ESAT+LEEE    V    E  K++ KMETD          DVNMQ+ 
Sbjct  476   VKVRLNIHGIVSLESATMLEEEVEVPVSTTSEVPKDANKMETD--------AADVNMQEP  527

Query  719   KVTSDASE----NHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             K T+D +E    +   +S +K   M+TDAK E  K+KVKKTNVPV+ELVYGA+  A+++K
Sbjct  528   KGTTDTAEGATGDGAQDSEEKSAPMDTDAKTEPSKRKVKKTNVPVAELVYGAMGSAELEK  587

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             AVEKE+EMALQDR+MEETK+KKN+VEAYVYDMRNKLY+KY ++V   +KE L AKLQE
Sbjct  588   AVEKEYEMALQDRVMEETKEKKNSVEAYVYDMRNKLYEKYSDYVTSEDKETLTAKLQE  645



>ref|XP_008649434.1| PREDICTED: heat shock 70 kDa protein 14-like [Zea mays]
 gb|AFW77407.1| hypothetical protein ZEAMMB73_835876 [Zea mays]
Length=843

 Score =   422 bits (1085),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 234/357 (66%), Positives = 278/357 (78%), Gaps = 10/357 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE IS P+LERVK PLEKA+ EAGL  EN+H +EV+GSGSRVPAIIKI+TEFFGKEPRR
Sbjct  302   EFEHISAPVLERVKGPLEKALTEAGLTTENVHIVEVVGSGSRVPAIIKIITEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCA+LSPTFKVR+FQVN+ FPF +ALSWK    ++QN A    Q T
Sbjct  362   TMNASECVARGCALQCAMLSPTFKVREFQVNDGFPFSVALSWK---QESQNSAP---QQT  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGN IPS+K+LTFY+  TF +DV Y    + Q P KISTYTIGPFQ  K E+ KLK
Sbjct  416   LVFPKGNAIPSIKSLTFYKLSTFEVDVLYVGTGDSQIPQKISTYTIGPFQPSKCEKTKLK  475

Query  542   VKVRLNLHGIvsvesatlleeeeve-vpvvkeqlkeSTKMETDDIPPQDSSETDVNMQDD  718
             VKV L++HGIV+V+SA +LEE+    V    E LK++TKM+TDD P    S TD NM + 
Sbjct  476   VKVCLSIHGIVTVDSAMMLEEDVEVPVSSANEALKDTTKMDTDDAPSDHVSGTDANMHEH  535

Query  719   K---VTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKA  889
             +    T   +EN   +S +K V METDAK E  K+K+KKT+VP+ ELVYGALS  D+QKA
Sbjct  536   RSADTTEAPAENGAQDSEEKSVPMETDAKVEPSKRKIKKTSVPIHELVYGALSATDLQKA  595

Query  890   VEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             VEKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYDKY +FV   EKE LIAKLQE
Sbjct  596   VEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDKYNDFVTPEEKEGLIAKLQE  652



>ref|XP_010231645.1| PREDICTED: heat shock 70 kDa protein 14-like [Brachypodium distachyon]
Length=843

 Score =   420 bits (1080),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 237/359 (66%), Positives = 289/359 (81%), Gaps = 12/359 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS P+LERVK PLEKA+AEAGL  E++H +EV+GSGSRVPAI++I+TEFFGKEPRR
Sbjct  302   EFEQISGPVLERVKGPLEKALAEAGLTTESVHFVEVVGSGSRVPAIMRIITEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNE FPF IALSWK    DAQ+   E+QQ T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNEGFPFSIALSWKS---DAQSN--ESQQ-T  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNP+PS+KALTFYRS TF++DV   D  +LQ   KISTYTIGPFQ   GE+AK+K
Sbjct  416   VVFPKGNPMPSIKALTFYRSNTFAVDVLNVDTDDLQITQKISTYTIGPFQPSNGEKAKVK  475

Query  542   VKVRLNLHGIvsvesatlleeeeve--vpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             VKVRLN+HGIVS+ESAT+LEE+EVE  V    E  K++TKM+TDD     +S  DVNM+D
Sbjct  476   VKVRLNIHGIVSLESATMLEEDEVEVPVSSASEVPKDATKMDTDDAQRDPASGNDVNMED  535

Query  716   DKVTSD----ASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
              K  +D    A EN   +S +K V M+TD K +  KK+VKKTNVP++ELVYG L   +++
Sbjct  536   SKGATDTAEGAVENGAHDSEEKSVPMDTDTKVQPSKKRVKKTNVPIAELVYGTLGADELE  595

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKE+EMALQDR+MEETK+KKN+VEAYVY+MRNKL +KY +FV+  + E L+AKLQE
Sbjct  596   KAVEKEYEMALQDRVMEETKEKKNSVEAYVYEMRNKLSEKYNDFVMSEDMEVLMAKLQE  654



>ref|XP_002439385.1| hypothetical protein SORBIDRAFT_09g005580 [Sorghum bicolor]
 gb|EES17815.1| hypothetical protein SORBIDRAFT_09g005580 [Sorghum bicolor]
Length=842

 Score =   418 bits (1074),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 243/360 (68%), Positives = 284/360 (79%), Gaps = 14/360 (4%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS  +LERVK PLEKA+AEAGL  EN+H +EV+GSGSRVPAIIKI+TEFFGKEPRR
Sbjct  302   EFEQISASVLERVKGPLEKALAEAGLTTENVHFVEVVGSGSRVPAIIKIITEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVN+ FPF IALSW G   D+QN      Q T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNDGFPFSIALSWNG---DSQNIP----QQT  414

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGN IPS KALTF++S TF +DV Y D  + Q   KISTYTIGPFQ+ KGE+AKLK
Sbjct  415   LVFPKGNAIPSTKALTFFKSSTFEVDVLYVDPDDSQISQKISTYTIGPFQTSKGEKAKLK  474

Query  542   VKVRLNLHGIvsvesatlleeeeve--vpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             VKVRLN+HG V+V+SA +LEEE+VE  V    E  K++ KM+TDD P   ++ +DVNMQ+
Sbjct  475   VKVRLNIHGTVTVDSAMMLEEEDVEVPVSSANEAPKDTMKMDTDDAPSDAAAGSDVNMQE  534

Query  716   DK-----VTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADV  880
              K       + A+EN   ++  K V METDAK E  KKKVKKT VPV ELVYGAL+  D+
Sbjct  535   PKSAETTEAAPAAENGAQDTEQKSVPMETDAKVELSKKKVKKTTVPVHELVYGALAAIDL  594

Query  881   QKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             QKAVEKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYDKY +FV   +KE LIAKLQE
Sbjct  595   QKAVEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDKYSDFVTPEDKEGLIAKLQE  654



>gb|EMS52665.1| Heat shock 70 kDa protein 4L [Triticum urartu]
Length=1269

 Score =   426 bits (1095),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 241/359 (67%), Positives = 293/359 (82%), Gaps = 12/359 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS P+LERVK PLEKA++EAGL  E++H +EV+GSGSRVPA++KI+TEFFGKEPRR
Sbjct  462   EFEQISAPVLERVKGPLEKALSEAGLTTESLHFVEVVGSGSRVPAVMKIITEFFGKEPRR  521

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVNE FPF +ALSWK   PDAQN   E+QQ T
Sbjct  522   TMNASECVARGCALQCAILSPTFKVREFQVNEGFPFSVALSWK---PDAQNN--ESQQ-T  575

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNP+PS+KALTFYRS TF++DV   D  +LQ   KISTYTIGPFQS KGE+AKLK
Sbjct  576   VVFPKGNPMPSIKALTFYRSSTFAVDVLNVDTDDLQITHKISTYTIGPFQSSKGEKAKLK  635

Query  542   VKVRLNLHGIvsvesatlleeeeve--vpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             VKVRLN+HGIVS+ESAT+LEEEEVE  V    E  K++T+METDD P   +S    + Q+
Sbjct  636   VKVRLNIHGIVSLESATMLEEEEVEVPVSSTSEVPKDATRMETDDAPQDPASSAGDHTQE  695

Query  716   DKVTSD----ASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
              K  +D    A+EN   +S +K V M+TD K E  KKKVKKTNVPV+E+VYGA+   +++
Sbjct  696   PKGAADPAEGAAENGAQDSEEKTVPMDTDTKVEPSKKKVKKTNVPVAEMVYGAMGTVELE  755

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KAVEKE+EMALQDR+MEETKDKKN+VEAYVYDMRNK+++KY +FV+  + E L+AKLQE
Sbjct  756   KAVEKEYEMALQDRVMEETKDKKNSVEAYVYDMRNKIHEKYNDFVMLEDIEGLMAKLQE  814



>ref|XP_008654914.1| PREDICTED: heat shock 70 kDa protein 4 isoform X1 [Zea mays]
Length=833

 Score =   416 bits (1068),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 230/354 (65%), Positives = 271/354 (77%), Gaps = 11/354 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS  +LERVK PLEKA+AEAGL  EN+H +EV+GSGSRVPAIIKI+T+FFGKEPRR
Sbjct  302   EFEQISASVLERVKGPLEKALAEAGLTTENVHFVEVVGSGSRVPAIIKIITDFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVN+ FPF IALSW G   D+QN      Q T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNDGFPFSIALSWNG---DSQNAP----QQT  414

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VF KGN IPS KALT ++S TF +DV Y D    Q P KISTYTIGPFQ+  GE+AKLK
Sbjct  415   LVFQKGNAIPSTKALTIFKSSTFEVDVLYVDPDNSQIPQKISTYTIGPFQTSNGEKAKLK  474

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeST-KMETDDIPPQDSSETDVNMQDD  718
             VKVRLN+HG V+V+S  +LEE+         +    T KM+TDD+P   ++ +DV MQ+ 
Sbjct  475   VKVRLNIHGTVTVDSVIMLEEDVEVPVSSANEAPNDTMKMDTDDVPSDPAAGSDVTMQEQ  534

Query  719   KVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVEK  898
                  A+ N   ++ +K V METDAK    KKKVKKT VPV ELVYGAL+ AD+QKAVEK
Sbjct  535   ---PPAAGNGAQDNEEKSVSMETDAKVXXXKKKVKKTTVPVHELVYGALAAADLQKAVEK  591

Query  899   EFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             E+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYDKY +FV   +KE LI KLQE
Sbjct  592   EYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDKYSDFVTPEDKEGLIGKLQE  645



>ref|NP_001147805.1| heat shock 70 kDa protein 4 [Zea mays]
 gb|ACG28747.1| heat shock 70 kDa protein 4 [Zea mays]
Length=833

 Score =   415 bits (1067),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 231/354 (65%), Positives = 272/354 (77%), Gaps = 11/354 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS  +LERVK PLEKA+AEAGL  EN+H +EV+GSGSRVPAIIKI+T+FFGKEPRR
Sbjct  302   EFEQISASVLERVKGPLEKALAEAGLTTENVHFVEVVGSGSRVPAIIKIITDFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVR+FQVN+ FPF IALSW G   D+QN      Q T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVREFQVNDGFPFSIALSWNG---DSQNAP----QQT  414

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VF KGN IPS KALT ++S TF +DV Y D    Q P KISTYTIGPFQ+  GE+AKLK
Sbjct  415   LVFQKGNAIPSTKALTIFKSSTFEVDVLYVDPDNSQIPQKISTYTIGPFQTSNGEKAKLK  474

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeST-KMETDDIPPQDSSETDVNMQDD  718
             VKVRLN+HG V+V+S  +LEE+         +    T KM+TDD+P   ++ +DV MQ+ 
Sbjct  475   VKVRLNIHGTVTVDSVIMLEEDVEVPVSSANEAPNDTMKMDTDDVPSDPAAGSDVTMQEQ  534

Query  719   KVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVEK  898
                  A+ N   ++ +K V METDAK E  KKKVKKT VPV ELVYGAL+ AD+QKAVEK
Sbjct  535   ---PPAAGNGAQDNEEKSVSMETDAKVEPSKKKVKKTTVPVHELVYGALAAADLQKAVEK  591

Query  899   EFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             E+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYDKY +FV   +KE LI KLQE
Sbjct  592   EYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDKYSDFVTPEDKEGLIGKLQE  645



>gb|AFW77408.1| hypothetical protein ZEAMMB73_835876 [Zea mays]
Length=1186

 Score =   421 bits (1082),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 234/357 (66%), Positives = 278/357 (78%), Gaps = 10/357 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE IS P+LERVK PLEKA+ EAGL  EN+H +EV+GSGSRVPAIIKI+TEFFGKEPRR
Sbjct  645   EFEHISAPVLERVKGPLEKALTEAGLTTENVHIVEVVGSGSRVPAIIKIITEFFGKEPRR  704

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCA+LSPTFKVR+FQVN+ FPF +ALSWK    ++QN A    Q T
Sbjct  705   TMNASECVARGCALQCAMLSPTFKVREFQVNDGFPFSVALSWK---QESQNSAP---QQT  758

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGN IPS+K+LTFY+  TF +DV Y    + Q P KISTYTIGPFQ  K E+ KLK
Sbjct  759   LVFPKGNAIPSIKSLTFYKLSTFEVDVLYVGTGDSQIPQKISTYTIGPFQPSKCEKTKLK  818

Query  542   VKVRLNLHGIvsvesatlleeeeve-vpvvkeqlkeSTKMETDDIPPQDSSETDVNMQDD  718
             VKV L++HGIV+V+SA +LEE+    V    E LK++TKM+TDD P    S TD NM + 
Sbjct  819   VKVCLSIHGIVTVDSAMMLEEDVEVPVSSANEALKDTTKMDTDDAPSDHVSGTDANMHEH  878

Query  719   K---VTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKA  889
             +    T   +EN   +S +K V METDAK E  K+K+KKT+VP+ ELVYGALS  D+QKA
Sbjct  879   RSADTTEAPAENGAQDSEEKSVPMETDAKVEPSKRKIKKTSVPIHELVYGALSATDLQKA  938

Query  890   VEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             VEKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYDKY +FV   EKE LIAKLQE
Sbjct  939   VEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDKYNDFVTPEEKEGLIAKLQE  995



>gb|EAY72790.1| hypothetical protein OsI_00654 [Oryza sativa Indica Group]
Length=813

 Score =   395 bits (1016),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 227/357 (64%), Positives = 261/357 (73%), Gaps = 40/357 (11%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+IS PILERVK PLEKA+AEAGL  EN+H +EV+GSGSRVPAIIKILT+FFGKEPRR
Sbjct  302   EFEKISAPILERVKGPLEKALAEAGLTTENVHFVEVVGSGSRVPAIIKILTDFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCAL+CAILSPTFKVR+FQVN+ FPF IA+SWK   PD+QNG  +NQQ T
Sbjct  362   TMNASECVARGCALECAILSPTFKVREFQVNDGFPFSIAMSWK---PDSQNG--DNQQ-T  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             +VFPKGNP+PSVKALTFYRS TF +DV Y D  +LQ   KISTYT+              
Sbjct  416   VVFPKGNPLPSVKALTFYRSNTFQVDVTYVDTGDLQISPKISTYTM--------------  461

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD--  715
                                EE EV V    E  K+S KMETDD P + +S TDVNMQ+  
Sbjct  462   ----------------LEEEEVEVPVAATTEPPKDSAKMETDDAPNEAASGTDVNMQEAK  505

Query  716   --DKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKA  889
                   +D +EN    S +K V METDAK E  KKKVKKTNVPV+ELVYGAL   ++QKA
Sbjct  506   APADAAADGAENGAPNSEEKSVPMETDAKVEPSKKKVKKTNVPVAELVYGALGTTELQKA  565

Query  890   VEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             VEKE+EMALQDR+MEETKDKKNAVE+YVYDMRNKLYDKY +FV   +KE  IAKLQE
Sbjct  566   VEKEYEMALQDRVMEETKDKKNAVESYVYDMRNKLYDKYNDFVTAEDKEAFIAKLQE  622



>gb|EYU24689.1| hypothetical protein MIMGU_mgv1a001324mg [Erythranthe guttata]
Length=573

 Score =   381 bits (979),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 208/263 (79%), Positives = 231/263 (88%), Gaps = 5/263 (2%)
 Frame = +2

Query  2    EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
            EFE+ISIPILERVKKPLEKA+ EAGL +ENIHS+EV+GSGSRVPAII+ILTEFFGKEPRR
Sbjct  302  EFEEISIPILERVKKPLEKALVEAGLTIENIHSVEVVGSGSRVPAIIRILTEFFGKEPRR  361

Query  182  TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
            TMNASECV+KG AL+CAILSPTFKVR+FQVNESFPFPIALSWK  + D+QN AA+NQQST
Sbjct  362  TMNASECVAKGTALECAILSPTFKVREFQVNESFPFPIALSWKVSASDSQNAAADNQQST  421

Query  362  IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
            +VFPKGNPIPSVKALTFYRSGTF++DVQYADVSELQAP+KISTYTIGPFQS KGERAKLK
Sbjct  422  VVFPKGNPIPSVKALTFYRSGTFTLDVQYADVSELQAPAKISTYTIGPFQSAKGERAKLK  481

Query  542  VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQDDK  721
            VKVRLNLHGIVSVESATLLEEEE EVPVVK   +ESTKMETD++    +  +    +D  
Sbjct  482  VKVRLNLHGIVSVESATLLEEEETEVPVVKGSSQESTKMETDELAADSAPPSTTETED--  539

Query  722  VTSDASENHVLESGDKPVQMETD  790
                 +EN V ESGDK VQMETD
Sbjct  540  ---AGAENGVEESGDKSVQMETD  559



>ref|XP_006654112.1| PREDICTED: heat shock 70 kDa protein 15-like [Oryza brachyantha]
Length=856

 Score =   379 bits (973),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 224/358 (63%), Positives = 278/358 (78%), Gaps = 11/358 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS P+L+RVK PLEKA++EAGL  EN+H +EV+GSGSRVPAIIKI+TEFFGKEPRR
Sbjct  302   EFEQISAPVLQRVKGPLEKALSEAGLTTENVHFVEVVGSGSRVPAIIKIITEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCAILSPTFKVRDF+VN+ FPF I LS   P PD++N   E+QQ T
Sbjct  362   TMNASECVARGCALQCAILSPTFKVRDFEVNDRFPFSIVLS---PKPDSEN--TESQQ-T  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQ-APSKISTYTIGPFQSGKGERAKL  538
             + FPKG+P+PS    TF+RS TF++DV      +LQ AP+ ISTYTIGPFQS K ++A+L
Sbjct  416   LAFPKGSPVPSAITATFFRSNTFTVDVVNVCDDDLQMAPNIISTYTIGPFQSSKFKKAEL  475

Query  539   KVKVRLNLHGIvsvesatlleeeeve-vpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
              VK  L++HGIVSVESA +LEEE    V    E +K++TKM+TDD P   +S T  NM++
Sbjct  476   NVKACLDIHGIVSVESAMMLEEEVEVPVASTNETVKDATKMDTDDAPTDPASGTGGNMEE  535

Query  716   DKVTSD---ASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
              K  +D   A+EN   +S +    M+TDAK E PKK VK+ +VPV  LVYGA+   +++K
Sbjct  536   SKCAADAHGAAENGGPDSEETSSPMDTDAKVEPPKKNVKRISVPVFGLVYGAMGAEELEK  595

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             AVE E+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYDKY +FV+   K++LIAKLQE
Sbjct  596   AVENEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDKYNDFVMPEYKDELIAKLQE  653



>ref|XP_007024113.1| Heat shock protein 91 isoform 2 [Theobroma cacao]
 gb|EOY26735.1| Heat shock protein 91 isoform 2 [Theobroma cacao]
Length=575

 Score =   367 bits (943),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 205/269 (76%), Positives = 235/269 (87%), Gaps = 8/269 (3%)
 Frame = +2

Query  2    EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
            EFEQIS+PIL+RVK PLEKA+A+AGLAVEN+H++EV+GS SRVPA++KILTEFFGKEPRR
Sbjct  302  EFEQISVPILQRVKSPLEKALADAGLAVENVHTVEVVGSASRVPAMLKILTEFFGKEPRR  361

Query  182  TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
            TMNASECV+KGCALQCAILSPTFKVR+FQVNESFP PI+LSWKG + DAQN  AE QQ  
Sbjct  362  TMNASECVAKGCALQCAILSPTFKVREFQVNESFPLPISLSWKGSASDAQNEGAEQQQ--  419

Query  362  IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
            +VFPKGN IPSVKA+TF+++ TFS+DVQY+DVSELQ P+KISTYTIGPF + + ER KLK
Sbjct  420  LVFPKGNSIPSVKAVTFHKTSTFSVDVQYSDVSELQVPAKISTYTIGPFPTIRSERPKLK  479

Query  542  VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSS----ETDVNM  709
            VKVRLNLHGIVS+ESATLLEEEEVEVPV KE +KE TKMETD+IP   ++    ETDVNM
Sbjct  480  VKVRLNLHGIVSLESATLLEEEEVEVPVSKEPVKEDTKMETDEIPSDAAAPCANETDVNM  539

Query  710  QDDKVTSDAS--ENHVLESGDKPVQMETD  790
            QD K T+DA   EN V ESGDKPVQMETD
Sbjct  540  QDAKGTADAEGVENGVPESGDKPVQMETD  568



>ref|NP_001054812.1| Os05g0181000 [Oryza sativa Japonica Group]
 gb|AAW57812.1| putative heat shock protein Hsp70 [Oryza sativa Japonica Group]
 dbj|BAF16726.1| Os05g0181000 [Oryza sativa Japonica Group]
 gb|EEE62549.1| hypothetical protein OsJ_17347 [Oryza sativa Japonica Group]
Length=853

 Score =   374 bits (960),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 219/358 (61%), Positives = 266/358 (74%), Gaps = 11/358 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS P+L+RVK PLEKA+AEAGL  EN+H +EV+GSGSRVPAII+I+TEFFGKEPRR
Sbjct  302   EFEQISSPVLQRVKAPLEKALAEAGLTTENVHFVEVVGSGSRVPAIIRIITEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCA+LSPTFKVR+F+VN+ FPF IALS K   PD++N  +E    T
Sbjct  362   TMNASECVARGCALQCAVLSPTFKVREFEVNDGFPFSIALSCK---PDSENTESEQ---T  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVFPKG+P+PS K +TFYRS TF++DV   D  +LQ   KIS+YTIGPFQS K E+AK+ 
Sbjct  416   IVFPKGSPVPSAKTVTFYRSNTFAVDVVSVDADDLQMAKKISSYTIGPFQSSKPEKAKVN  475

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQD-SSETDVNMQDD  718
             VK  LN+HGIVS+ESA +LEEE         +  +       D    D +S TD NMQ+ 
Sbjct  476   VKACLNIHGIVSIESAMMLEEEVDVPVATTNETLKDDTKMDTDDALGDPASGTDENMQES  535

Query  719   KVTSDAS----ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             K ++DA+    EN   +S +    M+TDAK E   K VKK +VPVS LVYGAL   ++ K
Sbjct  536   KCSADATHGAAENGKPDSEEISAPMDTDAKVEPLIKNVKKIDVPVSGLVYGALGSEELVK  595

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             A E E+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYDKY +FV+   KE  IAKLQE
Sbjct  596   ASENEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDKYNDFVMSEYKEGFIAKLQE  653



>gb|KJB35057.1| hypothetical protein B456_006G098500 [Gossypium raimondii]
Length=628

 Score =   366 bits (940),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 216/290 (74%), Positives = 249/290 (86%), Gaps = 8/290 (3%)
 Frame = +2

Query  2    EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
            EFEQIS PIL+RVK PLEKA+A+AGLAV ++H +EV+GS SR+P+I+KILTEFFGKEPRR
Sbjct  302  EFEQISAPILQRVKAPLEKALADAGLAVGDVHMVEVVGSASRIPSILKILTEFFGKEPRR  361

Query  182  TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
            TMNASECV +GCALQCAILSPTFKVR+FQVNESFPFPI+LSWKG  PDAQNG AE +Q  
Sbjct  362  TMNASECVGRGCALQCAILSPTFKVREFQVNESFPFPISLSWKGSVPDAQNGEAEQEQ--  419

Query  362  IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
            +VFPKGNPIPSVKA+TF+++ TFS+DVQY+DVS+LQAP+KISTY IGPF + + E+ KLK
Sbjct  420  LVFPKGNPIPSVKAVTFHKTSTFSVDVQYSDVSDLQAPAKISTYMIGPFPTLRSEKPKLK  479

Query  542  VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSS----ETDVNM  709
            VKVRLNLHGIVSVESATLLEEEEVEVPV KE  KE  KMETD+ P   S+    ETDVNM
Sbjct  480  VKVRLNLHGIVSVESATLLEEEEVEVPVSKEPAKEDAKMETDEKPNDTSAPGANETDVNM  539

Query  710  QDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELV  853
            QD K T++A+  EN V +SGDKPVQMETD K EAPKKKVKKTNVPV+E  
Sbjct  540  QDAKGTAEAAGVENGVPQSGDKPVQMETDTKVEAPKKKVKKTNVPVAEFC  589



>ref|XP_006389708.1| hypothetical protein EUTSA_v100181451mg, partial [Eutrema salsugineum]
 gb|ESQ26994.1| hypothetical protein EUTSA_v100181451mg, partial [Eutrema salsugineum]
Length=569

 Score =   363 bits (932),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 200/260 (77%), Positives = 232/260 (89%), Gaps = 5/260 (2%)
 Frame = +2

Query  2    EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
            EFE+ISIPILERVK+PL+KA+++AGLAVE++H +EV+GSGSRVPA+IKILTEFFGKEPRR
Sbjct  302  EFEEISIPILERVKRPLQKALSDAGLAVEDVHMVEVVGSGSRVPAMIKILTEFFGKEPRR  361

Query  182  TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
            TMNASECVS+GCALQCAILSPTFKVR+FQV+ESFPF I+L+WKG + D+QNG AE QQST
Sbjct  362  TMNASECVSRGCALQCAILSPTFKVREFQVHESFPFSISLAWKGAAVDSQNGGAEKQQST  421

Query  362  IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
            IVFPKGNPIPSVKALTFYRSGTFS+DVQY DV+ELQAP KISTYTIGPFQS KGERAKLK
Sbjct  422  IVFPKGNPIPSVKALTFYRSGTFSVDVQYGDVTELQAPPKISTYTIGPFQSSKGERAKLK  481

Query  542  VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQ---DSSETDVNMQ  712
            VKVRLNLHGIVSVESATLLEEEEVEVPV KEQ +E+ K+++D    +    S ++DVNMQ
Sbjct  482  VKVRLNLHGIVSVESATLLEEEEVEVPVSKEQPEETIKIDSDKATAEAAPASGDSDVNMQ  541

Query  713  DDKVTSDA--SENHVLESGD  766
            D K +SDA  ++N V +S D
Sbjct  542  DAKESSDAAGTDNGVPDSAD  561



>ref|XP_002986462.1| hypothetical protein SELMODRAFT_124091 [Selaginella moellendorffii]
 gb|EFJ12319.1| hypothetical protein SELMODRAFT_124091 [Selaginella moellendorffii]
Length=774

 Score =   368 bits (945),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 198/357 (55%), Positives = 261/357 (73%), Gaps = 18/357 (5%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FEQ++ P+L R K PLEKA+ E+ + +E I+S+EV+GSGSR+PAI++IL  FF KEP R
Sbjct  302   DFEQLAAPLLNRFKSPLEKALVESKIPLEKINSVEVVGSGSRIPAILRILASFFNKEPGR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NASEC+++GCALQCA+LSPTFKVRDF+V +SFPFPIALSWKGP+P++++    +  ++
Sbjct  362   TLNASECIARGCALQCAMLSPTFKVRDFEVQDSFPFPIALSWKGPAPESED----DNPNS  417

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQA--PSKISTYTIGPFQSGKGERAK  535
             IVF KGN IPS K LTF+RSGTF+IDV YAD SEL A    KIST+TIGPF   + E+AK
Sbjct  418   IVFVKGNLIPSTKMLTFFRSGTFAIDVMYADTSELPAGVGPKISTFTIGPFTPTRSEKAK  477

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             +KVK+RLNLHGI     +        E  V     KE T METD    ++  + DV M++
Sbjct  478   IKVKIRLNLHGI----VSVESATMVEEEEVEVPVTKEPTAMETD----KEDDKGDVPMEE  529

Query  716   DKVTSDASENHVLESGDKPVQ--METDakaeapkkkvkkTNVPVSELVYGALSPADVQKA  889
                  +++E    ++G  P++  +ET       KKK K+T+VPV+E V   L PA++QKA
Sbjct  530   GDAKVESAEG--TDNGAPPMEEPVETQKAEPVKKKKTKRTDVPVTETVPCGLPPAELQKA  587

Query  890   VEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             VEKE+E ALQDR+MEETKD+KNAVEAYVYDMRNKLY+K  ++V D EKE+L AKLQ+
Sbjct  588   VEKEYEYALQDRVMEETKDRKNAVEAYVYDMRNKLYEKLHDYVTDFEKEELTAKLQQ  644



>ref|XP_008354138.1| PREDICTED: heat shock 70 kDa protein 15-like [Malus domestica]
Length=558

 Score =   361 bits (927),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 197/249 (79%), Positives = 223/249 (90%), Gaps = 4/249 (2%)
 Frame = +2

Query  2    EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
            EFEQISIPILERVK PLEKA+ +A L++E+IH++EV+GSGSRVPAIIKILT+FF KEPRR
Sbjct  302  EFEQISIPILERVKGPLEKALLDAQLSIEDIHTVEVVGSGSRVPAIIKILTDFFKKEPRR  361

Query  182  TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
            TMNASECV++GCALQCAILSPTFKVR+FQVNESFPF I+LSWKG  PDAQNGAAEN Q+T
Sbjct  362  TMNASECVARGCALQCAILSPTFKVREFQVNESFPFSISLSWKGSGPDAQNGAAENNQNT  421

Query  362  IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
            +VFPKGNPIPS+KALTFYRS TFS+DVQYADVS+LQAP+KISTYTIGPF S K ERAKLK
Sbjct  422  LVFPKGNPIPSIKALTFYRSSTFSVDVQYADVSDLQAPAKISTYTIGPFPSVKSERAKLK  481

Query  542  VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETD----DIPPQDSSETDVNM  709
            VK RLNLHGIVSV+SATLLEEEE+EVPV KEQ KE+ KMETD    D+ P  + ETDV+M
Sbjct  482  VKARLNLHGIVSVDSATLLEEEEIEVPVTKEQTKEAAKMETDEAPSDVAPPSTEETDVSM  541

Query  710  QDDKVTSDA  736
            QD K T+DA
Sbjct  542  QDAKDTADA  550



>ref|XP_002978946.1| hypothetical protein SELMODRAFT_109750 [Selaginella moellendorffii]
 gb|EFJ19903.1| hypothetical protein SELMODRAFT_109750 [Selaginella moellendorffii]
Length=779

 Score =   365 bits (938),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 198/357 (55%), Positives = 259/357 (73%), Gaps = 16/357 (4%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FEQ++ P+L R K PLEKA+ E+ + +E I+S+EV+GSGSR+PAI++IL  FF KEP R
Sbjct  302   DFEQLAAPLLNRFKSPLEKALVESKIPLEKINSVEVVGSGSRIPAILRILASFFNKEPGR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NASEC+++GCALQCA+LSPTFKVRDF+V +SFPFPIALSWKGP+P++++    +  ++
Sbjct  362   TLNASECIARGCALQCAMLSPTFKVRDFEVQDSFPFPIALSWKGPAPESED----DNPNS  417

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQA--PSKISTYTIGPFQSGKGERAK  535
             IVF KGN IPS K LTF+RSGTF+IDV YAD+SEL A    KIST+TIGPF   + E+AK
Sbjct  418   IVFVKGNLIPSTKMLTFFRSGTFAIDVMYADMSELPAGVGPKISTFTIGPFTPTRSEKAK  477

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ-  712
             +KVK+RLNLHGI     +        E  V     KE   METD    ++  + DV M+ 
Sbjct  478   IKVKIRLNLHGI----VSVESATMVEEEEVEVPVTKEPIAMETD----KEDDKGDVPMEE  529

Query  713   -DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKA  889
              D KV S    ++     ++PV+ +        KKK K+T+VPV+E V   L PA++QKA
Sbjct  530   GDAKVESAEGTDNGAPPMEEPVETQKVCAEPVKKKKTKRTDVPVTETVPCGLPPAELQKA  589

Query  890   VEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             VEKE+E ALQDR+MEETKD+KNAVEAYVYDMRNKLY+K  ++V D EKE+L AKLQ+
Sbjct  590   VEKEYEYALQDRVMEETKDRKNAVEAYVYDMRNKLYEKLHDYVTDFEKEELTAKLQQ  646



>gb|EAY96776.1| hypothetical protein OsI_18700 [Oryza sativa Indica Group]
Length=853

 Score =   367 bits (941),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 216/358 (60%), Positives = 263/358 (73%), Gaps = 11/358 (3%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQIS P+L+RVK PLEKA+AEAGL  EN+H +EV+GSGSRVPAII+I+TEFFGKEPRR
Sbjct  302   EFEQISSPVLQRVKAPLEKALAEAGLTTENVHFVEVVGSGSRVPAIIRIITEFFGKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASECV++GCALQCA+LSPTFKVR+F+VN+ FPF IALS K   PD++N  +E    T
Sbjct  362   TMNASECVARGCALQCAVLSPTFKVREFEVNDGFPFSIALSCK---PDSENTESEQ---T  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
             IVF KG+P+PS K +TFYRS TF++DV   D  +LQ   KIS+YTIGPFQS   E+AK+ 
Sbjct  416   IVFSKGSPVPSAKTVTFYRSNTFAVDVVSVDADDLQMAKKISSYTIGPFQSSNPEKAKVN  475

Query  542   VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQD-SSETDVNMQDD  718
             VK  LN+HGIVS+ESA +LEEE         +  +       D    D +  TD NMQ+ 
Sbjct  476   VKACLNIHGIVSIESAMMLEEEVDVPVATTNETLKDDTKMDTDDALGDPAPGTDENMQES  535

Query  719   KVTSDAS----ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             K ++DA+    EN   +S +    M+TDAK E   K VKK +VPVS LVYGAL   ++ K
Sbjct  536   KCSADATHGAAENGKPDSEEISAPMDTDAKVEPLIKNVKKIDVPVSGLVYGALGSEELVK  595

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             A E E+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYDKY +FV+   KE  IAKLQE
Sbjct  596   ASENEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDKYTDFVMSEYKEGFIAKLQE  653



>ref|XP_001755636.1| predicted protein [Physcomitrella patens]
 gb|EDQ79696.1| predicted protein [Physcomitrella patens]
Length=770

 Score =   352 bits (904),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 187/355 (53%), Positives = 249/355 (70%), Gaps = 16/355 (5%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++ PILE+V+ P E+A+A + L+++ I+++EV+GSGSRVPAI+KIL+  FGKEP R
Sbjct  302   EFEELAKPILEKVRGPCERALASSKLSIDKIYAVEVVGSGSRVPAILKILSSVFGKEPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASEC+++GC LQCA+LSPTF+VRDF+V +SFPF I LSWKG +P+  +G  E   + 
Sbjct  362   TMNASECIARGCTLQCAMLSPTFRVRDFEVQDSFPFAIGLSWKGAAPET-DGEEEVSSNN  420

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERAK  535
             IVF KGNP+PS K LTFYRS TFSID  YA+ SEL      +I+T+TIGPF     E+AK
Sbjct  421   IVFVKGNPVPSTKLLTFYRSSTFSIDAFYAETSELPPNMSLRIATFTIGPFTPTVAEKAK  480

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             +KVK+RLNLHG+             +E   + E+ +    +   DI   DS E      D
Sbjct  481   IKVKIRLNLHGV-----------VSLEAATMIEEEEVEVPVTKKDISKDDSGEKASAPTD  529

Query  716   DKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVE  895
             DK    A  +    S + PV+MET+A     KKK K+T+VPV E++YG L   ++ KAVE
Sbjct  530   DKPEDAAGVDS--SSTEGPVKMETEAPKAEVKKKTKRTDVPVHEVIYGGLPQPELTKAVE  587

Query  896   KEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KE+EMALQDR+MEETK+ KNAVEAYVY MRNKLY+K Q +V + E+E++ A+LQE
Sbjct  588   KEYEMALQDRVMEETKESKNAVEAYVYSMRNKLYEKLQSYVTEFEREEMSARLQE  642



>gb|EPS59607.1| hypothetical protein M569_15197, partial [Genlisea aurea]
Length=534

 Score =   337 bits (865),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 187/225 (83%), Positives = 207/225 (92%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
            EFE+IS+PILERVK PLEKA++ AGL  E+IHS+EV+GSGSRVPAIIKILTEFFGKEPRR
Sbjct  307  EFERISVPILERVKNPLEKALSNAGLTTESIHSVEVVGSGSRVPAIIKILTEFFGKEPRR  366

Query  182  TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
            TMNASECV+KGCALQCAILSPTFKVR+FQVNESFPFPI+LSW   S DA NGAAENQQST
Sbjct  367  TMNASECVAKGCALQCAILSPTFKVREFQVNESFPFPISLSWSSTSSDAANGAAENQQST  426

Query  362  IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
            IVFPKGNPIPSVKALTFYRSGTFS+D+QYAD SELQ  ++IS+YTIGPF + K +R KLK
Sbjct  427  IVFPKGNPIPSVKALTFYRSGTFSVDLQYADTSELQTTARISSYTIGPFHTNKSDRTKLK  486

Query  542  VKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIP  676
            VKVRLNLHGIVSVESATLLEEEE+EVPVVKE  +ESTKMETD+IP
Sbjct  487  VKVRLNLHGIVSVESATLLEEEEIEVPVVKESDRESTKMETDEIP  531



>ref|XP_001760080.1| predicted protein [Physcomitrella patens]
 gb|EDQ75205.1| predicted protein [Physcomitrella patens]
Length=816

 Score =   343 bits (881),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 185/357 (52%), Positives = 249/357 (70%), Gaps = 23/357 (6%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++ PILE+V+ P EKA+A + L ++ I+++EV+GSGSRVPAI+KIL+  FGKEP R
Sbjct  302   EFEELAKPILEKVRGPCEKALAASKLTLDKIYAVEVVGSGSRVPAILKILSSVFGKEPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASEC+++GC LQCA+LSPTF+VRDF+V +SFPF I LSWKG +P+ + G  E   + 
Sbjct  362   TMNASECIARGCTLQCAMLSPTFRVRDFEVQDSFPFAIGLSWKGAAPETE-GEEEVSSNN  420

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERAK  535
             IVF KGNP+PS K LTFYR+ TF+ID  YA+ S+L      KI+T+TIGPF     E+AK
Sbjct  421   IVFVKGNPVPSTKLLTFYRASTFAIDAFYAETSDLPPNINPKIATFTIGPFTPTMTEKAK  480

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             +KVK+RLNLHG+        +  E   +   +E    +TK +  +   + S  TD   +D
Sbjct  481   IKVKIRLNLHGV--------VSLEAATMIEEEEVEVPTTKKDESE---KASPPTDAKPED  529

Query  716   DKVTSDASENHVLESGDKPVQMETDa--kaeapkkkvkkTNVPVSELVYGALSPADVQKA  889
               V  +        + D P +METDA       KKK K+T+VPV E+++G L   ++ KA
Sbjct  530   AAVAENG-------AADVPAKMETDAPKPEVVKKKKTKRTDVPVHEVIHGGLPQPELTKA  582

Query  890   VEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             VEKEFEMALQDR+MEETK+ KNAVEAYVY MRNKLY+K Q +V +SE+E++ A+LQE
Sbjct  583   VEKEFEMALQDRVMEETKESKNAVEAYVYSMRNKLYEKLQNYVTESEREEMTARLQE  639



>ref|NP_001137020.1| uncharacterized protein LOC100217188 [Zea mays]
 gb|ACF83092.1| unknown [Zea mays]
Length=479

 Score =   328 bits (841),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 190/298 (64%), Positives = 222/298 (74%), Gaps = 13/298 (4%)
 Frame = +2

Query  185   MNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQSTI  364
             MNASECV++GCALQCAILSPTFKVR+FQVN+ FPF IALSW G   D+QN      Q T+
Sbjct  1     MNASECVARGCALQCAILSPTFKVREFQVNDGFPFSIALSWNG---DSQN----TPQQTL  53

Query  365   VFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLKV  544
             VFPKGN IPS K LTF++S TF +DV Y D + LQ P KISTYTIGPFQ+ KGE+AKLKV
Sbjct  54    VFPKGNAIPSTKVLTFFKSSTFEVDVLYVDPNGLQIPQKISTYTIGPFQTSKGEKAKLKV  113

Query  545   KVRLNLHGIvsvesatlleeeevevpvvkeqlkeST-KMETDDIPPQDSSETDVNMQDDK  721
             KVRLN+HG V+V+SA +LE++         +    T KM+TDD P   +  +DVNMQ+ K
Sbjct  114   KVRLNIHGTVTVDSAIMLEDDVEVPVSSANEAPNDTMKMDTDDAPSDPAVASDVNMQEPK  173

Query  722   VTSDASENHVLESG-----DKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
                 A   H  E+G     +K V METDAK E  KKKVKK  VPV ELVYGAL+ AD+QK
Sbjct  174   SADTAEAAHAAENGPQDTEEKSVPMETDAKVEPSKKKVKKITVPVHELVYGALAAADLQK  233

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             AVEKE+EMALQDR+MEETK+KKNAVEAYVYDMRNKLYDKY +FV   +KE LIAKLQE
Sbjct  234   AVEKEYEMALQDRVMEETKEKKNAVEAYVYDMRNKLYDKYSDFVTSEDKEGLIAKLQE  291



>gb|AFA36608.1| 70 kDa heat shock protein, partial [Lolium perenne]
Length=289

 Score =   321 bits (823),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 195/300 (65%), Positives = 231/300 (77%), Gaps = 17/300 (6%)
 Frame = +2

Query  29   LERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRRTMNASECVS  208
            LERVK PLEKA+ EAGL  E++H +EV+GSGSRVPA++KI+TEFFGKEPRRTMNASECV+
Sbjct  1    LERVKGPLEKALVEAGLTTEDVHFVEVVGSGSRVPAVMKIITEFFGKEPRRTMNASECVA  60

Query  209  KGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQSTIVFPKGNPI  388
            +GCALQCAILSPTFKVR+FQVNE FPF +ALSWK   PDAQN      Q T+VFPKGNPI
Sbjct  61   RGCALQCAILSPTFKVREFQVNEGFPFSVALSWK---PDAQNN---EPQQTVVFPKGNPI  114

Query  389  PSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLKVKVRLNLHG  568
            PS+KALTFYRS TF +DV   D  ++Q   KISTYTIGPFQ  KGE+AKLKVKVRLN+HG
Sbjct  115  PSIKALTFYRSTTFPVDVLNVDTDDMQITQKISTYTIGPFQPSKGEKAKLKVKVRLNIHG  174

Query  569  Ivsvesatlleeeeve--vpvvkeqlkeSTKMETDDIPPQDSSETDVNMQDDKVTSD---  733
            IVS+ESA +LEEEEVE  V    E  K++TKM+T      D+   D NMQ+ K  SD   
Sbjct  175  IVSLESAMMLEEEEVEVPVSATSEVPKDATKMDT-----DDAPRDDDNMQESKGASDTAE  229

Query  734  -ASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVEKEFEM  910
             A+EN   +S +K V M+TD K E  KKKVKKTNVPV+E VYGA++  ++ KAVEKE+EM
Sbjct  230  GAAENGAGDSEEKTVPMDTDTKVEPSKKKVKKTNVPVAETVYGAMAADELAKAVEKEYEM  289



>ref|XP_001764380.1| predicted protein [Physcomitrella patens]
 gb|EDQ70934.1| predicted protein [Physcomitrella patens]
Length=820

 Score =   333 bits (855),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 181/358 (51%), Positives = 249/358 (70%), Gaps = 23/358 (6%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  IL++VK P E+A+A + L+++ I+++EV+GSGSRVPAI+KILT  FGKEP R
Sbjct  302   EFEELAKTILDKVKGPCERALAASKLSLDKIYAVEVVGSGSRVPAILKILTSVFGKEPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMNASEC+++GC LQCA+LSPTF+VRDF+V +SFPF I LSWKG +P+ + G  E   + 
Sbjct  362   TMNASECIARGCTLQCAMLSPTFRVRDFEVQDSFPFAIGLSWKGAAPETE-GEEEVSSNN  420

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERAK  535
             IVF KGNP+PS K LTFYRS TF+ID  YA+ SEL      +I+T+TIGPF     E+AK
Sbjct  421   IVFVKGNPVPSTKLLTFYRSSTFAIDAYYAETSELPPNMNPRIATFTIGPFTPTVAEKAK  480

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDD-IPPQDSSETDVNMQ  712
             +KVK+RLNLHG+       +  E    +   + ++  + K ET+   PP D+   D    
Sbjct  481   IKVKIRLNLHGV-------VSLEAATMIEDEEVEVPVTKKDETEKAAPPADAKPEDAG--  531

Query  713   DDKVTSDASENHVLESGDKPVQMETDa--kaeapkkkvkkTNVPVSELVYGALSPADVQK  886
                  + ++EN    + D    METDA       KKK K+T++ V E+++G L   ++ K
Sbjct  532   -----TSSAENG---AADGVANMETDAPKPEVVKKKKAKRTDISVHEVIHGGLPQPELTK  583

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             AVEKE+EMALQDR+MEETK+ KNAVEAYVY MR+KLY+K Q++V +SE+E + A+LQE
Sbjct  584   AVEKEYEMALQDRVMEETKESKNAVEAYVYSMRSKLYEKLQDYVTESEREDMSARLQE  641



>gb|AFW81561.1| hypothetical protein ZEAMMB73_352123 [Zea mays]
Length=564

 Score =   315 bits (806),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 173/266 (65%), Positives = 203/266 (76%), Gaps = 9/266 (3%)
 Frame = +2

Query  2    EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
            EFE IS P+L RVK PLEKA+AEAGL  EN+H +EV+GSGSRVPAIIKI+T+FFGKEPRR
Sbjct  302  EFEHISAPVLVRVKGPLEKALAEAGLTTENVHFVEVVGSGSRVPAIIKIITDFFGKEPRR  361

Query  182  TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
            TMNASECV++GCALQCAILSPTFKVR+FQVN+ FPF IALSWK    D+QN A    Q T
Sbjct  362  TMNASECVARGCALQCAILSPTFKVREFQVNDGFPFSIALSWK---QDSQNSAP---QQT  415

Query  362  IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGKGERAKLK  541
            +VFPKGN IPS+KALTFY+S TF +DV Y D  + Q P KISTYTIGPFQ  KGERAKLK
Sbjct  416  LVFPKGNVIPSIKALTFYKSSTFEVDVLYVDTCDSQIPQKISTYTIGPFQPSKGERAKLK  475

Query  542  VKVRLNLHGIvsvesatlleeeeve-vpvvkeqlkeSTKMETDDIPPQDSSETDVNMQDD  718
            VKVRLN+HGIV+V+SA +LEE+    V    E  K++TKM+TDD P    S TDVN+ + 
Sbjct  476  VKVRLNIHGIVTVDSAMMLEEDVAVPVSSANEAPKDTTKMDTDDAPSDPVSGTDVNVHEP  535

Query  719  KVT--SDASENHVLESGDKPVQMETD  790
              T  + A+EN      +K V METD
Sbjct  536  DTTEAAPAAENGTQNPEEKSVPMETD  561



>ref|XP_012070816.1| PREDICTED: heat shock 70 kDa protein 16 [Jatropha curcas]
 gb|KDP39123.1| hypothetical protein JCGZ_00880 [Jatropha curcas]
Length=771

 Score =   289 bits (740),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 162/361 (45%), Positives = 232/361 (64%), Gaps = 37/361 (10%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  +L+R+  P  KA+AE+ ++V  IHSIE++GSGSR+PAI K+LT  FG+EPRR
Sbjct  302   EFERLASGLLDRITVPCRKALAESRISVGKIHSIELVGSGSRIPAIGKLLTSLFGREPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VR+++V +SFPF I  S  +GP     NG       
Sbjct  362   TLNASECVARGCALQCAMLSPVFRVREYEVQDSFPFSIGFSLNEGPVGTGSNG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERA  532
              ++FPKG PIPS+K LTF RS  F ++  YA+ +EL     S+IS++TIGPF     E+A
Sbjct  415   -VLFPKGQPIPSIKVLTFQRSNLFHMEAFYANPNELPPGVSSQISSFTIGPFPGSCSEKA  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KVKV LNLHGIV+VESA L+E+             E  K+E D +      E   N  
Sbjct  474   RIKVKVLLNLHGIVTVESAMLMEDHAEGHARRGNAHPEVDKIEVDSVASSTKLE---NGD  530

Query  713   DDKVT-----SDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPAD  877
             DD +T     SDAS N + +   + ++                  +PVSE VYG ++ ++
Sbjct  531   DDDLTIHARSSDASANGMKDKASRRLE------------------IPVSEKVYGGITESE  572

Query  878   VQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQ  1057
             + +A EKEF++A QD+I+E+ KD+KNA+E+YVY+ RNKL++ Y+ F  D E+E +   LQ
Sbjct  573   LSEAKEKEFQLAQQDKIVEQAKDQKNALESYVYETRNKLFNTYRSFASDREREGISRNLQ  632

Query  1058  E  1060
             E
Sbjct  633   E  633



>ref|XP_011628468.1| PREDICTED: heat shock 70 kDa protein 16 [Amborella trichopoda]
Length=768

 Score =   284 bits (727),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 158/370 (43%), Positives = 230/370 (62%), Gaps = 46/370 (12%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE++S  ++ERV+ P EKA+ +AGL +E +HS+E++GSGSR+PAI ++L  FF +EP R
Sbjct  302   EFEKLSAGLIERVQVPCEKALNDAGLGLERVHSVELVGSGSRIPAIARMLASFFKREPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NASECV++GCALQCA+LSP ++VRD++V + FPF IA S       +  G      S 
Sbjct  362   TLNASECVARGCALQCAMLSPIYRVRDYEVQDIFPFSIAFS-------SDEGPVSTPSSN  414

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERAK  535
             I+FPKG PIPSVK LTF+RSGTF ++  YA+ S L      KIS++ IGPFQ+   +++K
Sbjct  415   ILFPKGQPIPSVKMLTFHRSGTFCLEAFYANQSGLPPGTCQKISSFMIGPFQAS-SDKSK  473

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             +KV++RLNLHGI                        ES  +  DDI   D+  T     D
Sbjct  474   VKVRLRLNLHGI---------------------VTVESAYLIEDDIDATDARGTAPLSTD  512

Query  716   D-------KVTSDASENHVLESGD-KPVQME-------TDakaeapkkkvkkTNVPVSEL  850
             D       +V+SD+  N   ++ D  PV  E       ++ +     K  ++  +PV+E 
Sbjct  513   DHEAHFPSRVSSDSVPNGGEKASDYAPVSTESAAEVQHSNFEGNRKGKPSRRAEIPVNET  572

Query  851   VYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSE  1030
             V G +S A++ +  E E ++A QDR+ME TKD+KNA+EAYVY++RNKL+DKY+ +  +SE
Sbjct  573   VSGCMSKAELAQVHEIELQLAHQDRVMELTKDRKNALEAYVYEIRNKLFDKYRSYASESE  632

Query  1031  KEQLIAKLQE  1060
             +E +   LQ+
Sbjct  633   REGISRSLQQ  642



>ref|XP_009372708.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X2 [Pyrus 
x bretschneideri]
Length=718

 Score =   280 bits (716),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 158/356 (44%), Positives = 224/356 (63%), Gaps = 24/356 (7%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE ++  +L+R+  P  KA+A+AGL  + IHS+E++GSGSR+PA+ +IL   F  EPRR
Sbjct  302   DFEMLASGLLDRIGVPCSKALADAGLTADKIHSVELVGSGSRIPAVARILASVFRNEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIA-LSWKGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VR+++V +S PF IA L  + P     NG       
Sbjct  362   TLNASECVARGCALQCAMLSPVFRVREYEVQDSIPFSIAFLIDEAPICTGTNG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQA--PSKISTYTIGPFQSGKGERA  532
              I+FPKG PIPSVK LTF RS  F +   YA+ +E+ A   S I  +TIGPFQ    E+ 
Sbjct  415   -ILFPKGQPIPSVKVLTFQRSSLFHLKAFYANPTEVPAGVSSDICCFTIGPFQCSHSEKT  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KVKV LNLHG+VSVESA ++EE   +         +   M+TD +    S+E    + 
Sbjct  474   RVKVKVVLNLHGVVSVESAMVMEEHGDDSSTRGLTNSKMDPMDTDYVTASGSTEA---VA  530

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             D    S    N    SGD               K  ++  +PVSE +YG ++ A++ +A+
Sbjct  531   DGFEKSTMQHNSSHTSGDP----------RRNNKASRRLEIPVSESIYGGMTRAELSEAL  580

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             +KE ++A QDRIME+TKDKKNA+E+YVY+MRNKL++ Y+ F  D E+E +   LQ+
Sbjct  581   DKELQLAQQDRIMEQTKDKKNALESYVYEMRNKLFNTYRSFASDQEREGISRSLQQ  636



>ref|XP_009352433.1| PREDICTED: heat shock 70 kDa protein 16-like [Pyrus x bretschneideri]
Length=762

 Score =   280 bits (715),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 159/356 (45%), Positives = 227/356 (64%), Gaps = 24/356 (7%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE ++  +LER+  P  KA+A+AGL  + IHS+E++GSGSR+PA+ +IL   FGKEP R
Sbjct  302   DFEMLASDLLERIGVPCSKALADAGLTADKIHSVELVGSGSRIPAVARILASVFGKEPGR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VR+++V +S PF IAL   + P     +G       
Sbjct  362   TLNASECVARGCALQCAMLSPVFRVREYEVQDSIPFSIALLIDEAPICTGTSG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSK--ISTYTIGPFQSGKGERA  532
              I+FPKG PIPSVK LTF RS  F +   YA+ SE+ A +   I  + IGPFQ   GE+ 
Sbjct  415   -ILFPKGQPIPSVKVLTFRRSSLFHLKAFYANPSEVPAGASPDICCFMIGPFQCSHGEKP  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KVKV L+LHG+VSVESA ++E+   +         +   M+TD +    S+E      
Sbjct  474   RVKVKVMLDLHGVVSVESAMVMEDHRYDSSTRGLAGSKMEPMDTDYVTASGSTEA-----  528

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
                  +D  E    ESG +     T  +A+   K  ++  +PVSE +YG ++ A++ +A 
Sbjct  529   ----VADGFE----ESGMQHNSSHTGGEAKRNNKATRRLEIPVSESIYGGMTKAELSEAQ  580

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             EKE ++A QDRIME+TKDKKNA+E+YVY+MRNKL + Y+ F  D E+E +   LQ+
Sbjct  581   EKELQLAQQDRIMEQTKDKKNALESYVYEMRNKLLNTYRSFASDQEREGISRSLQQ  636



>ref|XP_009372707.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Pyrus 
x bretschneideri]
Length=761

 Score =   280 bits (715),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 158/356 (44%), Positives = 224/356 (63%), Gaps = 24/356 (7%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE ++  +L+R+  P  KA+A+AGL  + IHS+E++GSGSR+PA+ +IL   F  EPRR
Sbjct  302   DFEMLASGLLDRIGVPCSKALADAGLTADKIHSVELVGSGSRIPAVARILASVFRNEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIA-LSWKGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VR+++V +S PF IA L  + P     NG       
Sbjct  362   TLNASECVARGCALQCAMLSPVFRVREYEVQDSIPFSIAFLIDEAPICTGTNG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQA--PSKISTYTIGPFQSGKGERA  532
              I+FPKG PIPSVK LTF RS  F +   YA+ +E+ A   S I  +TIGPFQ    E+ 
Sbjct  415   -ILFPKGQPIPSVKVLTFQRSSLFHLKAFYANPTEVPAGVSSDICCFTIGPFQCSHSEKT  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KVKV LNLHG+VSVESA ++EE   +         +   M+TD +    S+E    + 
Sbjct  474   RVKVKVVLNLHGVVSVESAMVMEEHGDDSSTRGLTNSKMDPMDTDYVTASGSTEA---VA  530

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             D    S    N    SGD               K  ++  +PVSE +YG ++ A++ +A+
Sbjct  531   DGFEKSTMQHNSSHTSGDP----------RRNNKASRRLEIPVSESIYGGMTRAELSEAL  580

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             +KE ++A QDRIME+TKDKKNA+E+YVY+MRNKL++ Y+ F  D E+E +   LQ+
Sbjct  581   DKELQLAQQDRIMEQTKDKKNALESYVYEMRNKLFNTYRSFASDQEREGISRSLQQ  636



>ref|XP_008226915.1| PREDICTED: heat shock 70 kDa protein 16 [Prunus mume]
Length=777

 Score =   278 bits (712),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 157/356 (44%), Positives = 228/356 (64%), Gaps = 24/356 (7%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE +S  +LER+  P  KA+A+AGL  E IHS+E++GSGSR+PA+ ++LT  F KEPRR
Sbjct  302   DFETLSSGLLERIGVPCSKALADAGLTAEKIHSVELVGSGSRIPAVGRVLTSVFRKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIA-LSWKGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VR+++V +S PF I  L  + P     NG       
Sbjct  362   TLNASECVARGCALQCAMLSPVFRVREYEVQDSIPFSIGFLLDEAPICTGSNG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQA--PSKISTYTIGPFQSGKGERA  532
              I+FPKG PIPSVK LTF RS +F ++  YA+ SE+ A   SKIS + IGPFQ    E+A
Sbjct  415   -ILFPKGQPIPSVKVLTFRRSSSFHLEAFYANPSEVPAGVSSKISCFKIGPFQCSHSEKA  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KVK++L+L+G+V VESA ++EE   +             M+ D +    SSE   +  
Sbjct  474   RVKVKIQLDLNGVVFVESAMVIEEHGDDSSTRGVADSMDP-MDIDCVTASGSSEAVADGF  532

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
              +  +  +  +H   SGD     ++           ++  +PV+E +YG ++ A++ +A 
Sbjct  533   QESSSMQSKSSHA--SGDGKRDNKS----------TRRLEIPVTENIYGGMTKAELSEAQ  580

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             EKE ++  QDRIME+TKDKKNA+E+YVYDMRNKL++ Y+ F  D E+E +   LQ+
Sbjct  581   EKELQLGQQDRIMEQTKDKKNALESYVYDMRNKLFNTYRSFASDEEREGISRSLQQ  636



>ref|XP_002317001.1| hypothetical protein POPTR_0011s14240g [Populus trichocarpa]
 gb|EEE97613.1| hypothetical protein POPTR_0011s14240g [Populus trichocarpa]
Length=770

 Score =   278 bits (711),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 158/362 (44%), Positives = 232/362 (64%), Gaps = 40/362 (11%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  +LER+  P  KA+A+AGL+V  IHS+E++GSGSR+PAI K+L+  +GKEP R
Sbjct  302   EFERLASGLLERISVPSRKALADAGLSVRKIHSVELVGSGSRIPAISKLLSSLYGKEPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+N+SECV++GCALQCA+LSP F+VR+++V ++FPF I  S  G    AQ     N    
Sbjct  362   TLNSSECVARGCALQCAMLSPIFRVREYEVQDAFPFSIGFSSDG----AQISTGSN---C  414

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQA--PSKISTYTIGPFQSGKGERAK  535
             I+FPKG P PS K LTF RS    ++  YA+++EL A   + +S++TIGPFQ+   E+A+
Sbjct  415   ILFPKGQPFPSTKVLTFQRSNLLHLEAFYANLNELPAGVSTNMSSFTIGPFQASSNEKAR  474

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeql--keSTKMETDDIPPQDSSETDVNM  709
             +KVKV+LNLHGIV+VESA L+E+   +           + TKM++D       S T+V  
Sbjct  475   IKVKVQLNLHGIVTVESAMLVEDHMDDSARRGNIHPQMDRTKMDSD-------SSTNVAN  527

Query  710   QDDKVT-----SDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPA  874
              +D  T     SDA+ N  L+  DK  Q               +  +PV+E +YG ++  
Sbjct  528   SEDNTTVHSQSSDATGNGTLK--DKANQ---------------RFEIPVNENIYGGMTKD  570

Query  875   DVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKL  1054
             ++ +A EKE  +A  D+ +E+ KD+KNA+E+YVY+MRNKL++ Y+ F  D E+E +   L
Sbjct  571   ELSEAQEKELHLAQHDKAVEQAKDQKNALESYVYEMRNKLFNTYRSFASDMEREGISRSL  630

Query  1055  QE  1060
             QE
Sbjct  631   QE  632



>ref|XP_011030786.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X2 [Populus 
euphratica]
Length=770

 Score =   277 bits (709),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 156/357 (44%), Positives = 230/357 (64%), Gaps = 30/357 (8%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  +LER+  P  KA+A+AGL+V  IHS+E++GSGSR+PAI K+L+  +GKEP R
Sbjct  302   EFERLASGLLERISVPSRKALADAGLSVRKIHSVELVGSGSRIPAISKLLSSLYGKEPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+N+SECV++GCALQCA+LSP F+VR+++V ++FPF I  S  G    AQ     N    
Sbjct  362   TLNSSECVARGCALQCAMLSPIFRVREYEVQDAFPFSIGFSSNG----AQISTGSN---C  414

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQA--PSKISTYTIGPFQSGKGERAK  535
             I+FPKG P PS K LTF RS    ++  YAD++EL A   + +S++TIGPFQ+   E+AK
Sbjct  415   ILFPKGQPFPSTKVLTFQRSNLLHLEAFYADLNELPAGVSTNMSSFTIGPFQASSNEKAK  474

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeql--keSTKMETDDIPPQDSSETDVNM  709
             +KVKV+LNLHGIV+VESA L+E+   +           + TKM++D +    +SE +  +
Sbjct  475   IKVKVQLNLHGIVTVESAMLVEDHLDDSARRGNIHPQMDRTKMDSDSLTNVANSEDNTAV  534

Query  710   QDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKA  889
                  +SDA+ N  L+  DK  Q               +  +PV E + G ++  ++ +A
Sbjct  535   HSQ--SSDATVNGTLK--DKANQ---------------RFEIPVKENISGGMTKDELTEA  575

Query  890   VEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
              EKE  +A  D+ +E+ KD+KNA+E+YVY+MRNKL++ Y+ F  D E+E +   LQE
Sbjct  576   QEKELHLAQHDKAVEQAKDQKNALESYVYEMRNKLFNTYRSFASDKEREGISRSLQE  632



>ref|XP_007213641.1| hypothetical protein PRUPE_ppa001697mg [Prunus persica]
 gb|EMJ14840.1| hypothetical protein PRUPE_ppa001697mg [Prunus persica]
Length=777

 Score =   276 bits (706),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 156/356 (44%), Positives = 227/356 (64%), Gaps = 24/356 (7%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE +S  +LER+  P  KA+A+AGL  E IHS+E++GSGSR+PA+ ++LT  F KEPRR
Sbjct  302   DFEMLSSGLLERIGVPCSKALADAGLTAEKIHSVELVGSGSRIPAVGRVLTSVFRKEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIA-LSWKGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VR+++V +S PF I  L  + P     NG       
Sbjct  362   TLNASECVARGCALQCAMLSPVFRVREYEVQDSIPFSIGFLLDEAPICTGSNG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQA--PSKISTYTIGPFQSGKGERA  532
              I+FPKG PIPSVK LTF RS +F ++  YA+ SE+ A   SKIS + IGPFQ    E+ 
Sbjct  415   -ILFPKGQPIPSVKVLTFRRSSSFHLEAFYANPSEVPAGVSSKISCFKIGPFQCSHSEKT  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KVK++L+L+G+V VESA ++EE   +             M+ D +    SSE   +  
Sbjct  474   RVKVKIQLDLNGVVFVESAMMMEEHGDDSSTRGVADSMDP-MDIDCVTASGSSEAVGDGF  532

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
              +  +  +  +H   SGD     ++           ++  +PV+E +YG ++ A++ +A 
Sbjct  533   QESSSMQSKSSHA--SGDGKRDNKS----------TRRLEIPVTENIYGGMTKAELSEAQ  580

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             EKE ++  QDRIME+TKDKKNA+E+YVYDMRNKL++ Y+ F  D E+E +   LQ+
Sbjct  581   EKELQLGQQDRIMEQTKDKKNALESYVYDMRNKLFNTYRSFASDQEREGISRSLQQ  636



>ref|XP_004294376.1| PREDICTED: heat shock 70 kDa protein 16 [Fragaria vesca subsp. 
vesca]
Length=767

 Score =   276 bits (705),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 156/356 (44%), Positives = 221/356 (62%), Gaps = 34/356 (10%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE ++  +LER++ P  KA+AEAGL  + IHS+E++GSGSR+PAI + L   F +EPRR
Sbjct  302   EFEMLASSLLERIRVPCSKALAEAGLTADMIHSVELVGSGSRIPAIARALVSLFRQEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIA-LSWKGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VR+++V +S PF I  LS +GP     NG       
Sbjct  362   TVNASECVARGCALQCAMLSPVFRVREYEVQDSIPFTIGFLSEEGPIGTGSNG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPS--KISTYTIGPFQSGKGERA  532
              ++FPKG PIPS K LT  RS  F+++  YAD SEL A +  KI  + IGPF     ER 
Sbjct  415   -VMFPKGQPIPSAKVLTLQRSSLFNLEALYADPSELPAGASPKICCFRIGPFHGFNSERT  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KVK++L+LHGIVSV SA ++EE      +          M+TD +    S E   +  
Sbjct  474   RVKVKIQLDLHGIVSVVSARVVEEHGDNSKMD--------PMDTDCVTASVSPEAPADGF  525

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
              + + S +S      +GD      T            + ++P+SE +YG ++ A + +A 
Sbjct  526   QESMKSKSSH----AAGDGRHHKGT-----------SRLDIPISENIYGGMTKAQLSEAQ  570

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
              KE ++A QDR ME+TKDKKNA+E+YVYDMRNKL++ Y+ F  D E+E +   LQ+
Sbjct  571   GKELQLAQQDRAMEQTKDKKNALESYVYDMRNKLFNTYRSFASDQEREAISRSLQQ  626



>ref|XP_002522946.1| Heat-shock protein 105 kDa, putative [Ricinus communis]
 gb|EEF39376.1| Heat-shock protein 105 kDa, putative [Ricinus communis]
Length=740

 Score =   275 bits (702),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 156/356 (44%), Positives = 227/356 (64%), Gaps = 33/356 (9%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  +LERV  P  KA+A++G++V  I+SIE++GSGSR+PAI K+L   FG+EP R
Sbjct  302   EFERLASGLLERVTVPCRKALADSGISVGKINSIELVGSGSRIPAITKLLASVFGREPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
              +NASECV++GCALQCA+LSP F+VR+++V +SFPF I  S  +GP     N        
Sbjct  362   KLNASECVARGCALQCAMLSPVFRVREYEVQDSFPFSIGFSSDEGPIGTGSN--------  413

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERA  532
             +++FPKG  IPS+K LTF RSG F ++  YA+ +EL     SKIS +TIGPF     E+A
Sbjct  414   SVLFPKGQSIPSIKVLTFQRSGLFHLEAFYANPNELPPGVSSKISFFTIGPFPGSHSEKA  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             +LK+KV L+LHGIV++ES  L+E+   +         E  KM   D+   +  E D    
Sbjct  474   RLKIKVHLSLHGIVTIESVMLMEDHMDDPVRRTSAHSEIEKM---DVDSANGDEDDAKFH  530

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
                 +SDAS N  ++  DK  +               +  +PVSE +YG ++ A++ +A 
Sbjct  531   --VRSSDASANGSIK--DKSSR---------------RLEIPVSENIYGGMTEAELSEAK  571

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             EKE +++ QDRI+E+ KD+KNA+E+YVY+MRNKL++ Y+ F  D E+E +   LQE
Sbjct  572   EKELQLSQQDRIVEQAKDQKNALESYVYEMRNKLFNTYRSFANDQEREGISRSLQE  627



>ref|XP_007020850.1| Heat shock protein 70 family protein [Theobroma cacao]
 gb|EOY12375.1| Heat shock protein 70 family protein [Theobroma cacao]
Length=765

 Score =   275 bits (702),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 154/355 (43%), Positives = 225/355 (63%), Gaps = 30/355 (8%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  +LER+  P  KA+A+AGL VE IH++E++GSGSR+PAI + L   F +EP R
Sbjct  302   EFEKLASQLLERINIPCIKALADAGLTVEKIHAVELVGSGSRIPAITRQLASLFRREPGR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NASECV++GCALQCA+LSP F+VRD++V +  PF I  S    SP +Q          
Sbjct  362   TINASECVARGCALQCAMLSPVFRVRDYEVQDCIPFSIGCS-SNESPISQGSDG------  414

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERAK  535
             ++FP+G PIPSVK L   RS  F ++V Y + +EL     SKIS +TIGPFQS   ERA+
Sbjct  415   VLFPRGQPIPSVKVLQLQRSSLFHLEVFYVNPNELPSDVSSKISCFTIGPFQSSHIERAR  474

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             +KVKV+LNLHGIV+VESA L                   +   DD   +  + ++++ ++
Sbjct  475   VKVKVQLNLHGIVTVESAML------------------IEEHIDDSITRKDTHSEMSTKE  516

Query  716   DKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVE  895
              +  ++ SE+       KP    TD   +   K  ++  +P+ E +YGA++ A++ +A +
Sbjct  517   AQHVANGSEDST-SVQSKPSHASTD--GKTNDKATRRLEIPICENIYGAMTKAELIEAQD  573

Query  896   KEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KE ++A  DR ME+TK+KKNA+E+YVY+MRNKL++ Y+ F  D EKE +   LQE
Sbjct  574   KELKLAQHDRTMEQTKEKKNALESYVYEMRNKLFNTYRSFASDKEKEGISMSLQE  628



>ref|XP_011030785.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Populus 
euphratica]
Length=771

 Score =   275 bits (702),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 156/358 (44%), Positives = 231/358 (65%), Gaps = 31/358 (9%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  +LER+  P  KA+A+AGL+V  IHS+E++GSGSR+PAI K+L+  +GKEP R
Sbjct  302   EFERLASGLLERISVPSRKALADAGLSVRKIHSVELVGSGSRIPAISKLLSSLYGKEPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+N+SECV++GCALQCA+LSP F+VR+++V ++FPF I  S  G    AQ     N    
Sbjct  362   TLNSSECVARGCALQCAMLSPIFRVREYEVQDAFPFSIGFSSNG----AQISTGSN---C  414

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQA--PSKISTYTIGPFQSGKGERAK  535
             I+FPKG P PS K LTF RS    ++  YAD++EL A   + +S++TIGPFQ+   E+AK
Sbjct  415   ILFPKGQPFPSTKVLTFQRSNLLHLEAFYADLNELPAGVSTNMSSFTIGPFQASSNEKAK  474

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeql--keSTKMETDDIPPQDSSETDVNM  709
             +KVKV+LNLHGIV+VESA L+E+   +           + TKM++D +    +SE +  +
Sbjct  475   IKVKVQLNLHGIVTVESAMLVEDHLDDSARRGNIHPQMDRTKMDSDSLTNVANSEDNTAV  534

Query  710   QDDKVTSDASE-NHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
                  +SDA++ N  L+  DK  Q               +  +PV E + G ++  ++ +
Sbjct  535   HSQ--SSDATQVNGTLK--DKANQ---------------RFEIPVKENISGGMTKDELTE  575

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             A EKE  +A  D+ +E+ KD+KNA+E+YVY+MRNKL++ Y+ F  D E+E +   LQE
Sbjct  576   AQEKELHLAQHDKAVEQAKDQKNALESYVYEMRNKLFNTYRSFASDKEREGISRSLQE  633



>ref|XP_010278704.1| PREDICTED: heat shock 70 kDa protein 16 [Nelumbo nucifera]
Length=777

 Score =   273 bits (699),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 158/358 (44%), Positives = 229/358 (64%), Gaps = 31/358 (9%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE++S  +LER++ P EKA+A+A L V+ IH++E++GSGSR+PAI + L   F KEP R
Sbjct  302   EFEKMSSNLLERIRLPCEKALADANLTVDKIHAVELVGSGSRIPAITRTLASLFNKEPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VR+++V +SFPF I  S  +GP     NG       
Sbjct  362   TVNASECVARGCALQCAMLSPIFRVREYEVQDSFPFSIGFSSDEGPIHILTNG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPS--KISTYTIGPFQSGKGERA  532
              I+FPKG  IPSVK L+ +R+  F ++  Y D SEL   +  KIS + IGPFQ    E+ 
Sbjct  415   -ILFPKGQSIPSVKILSCHRTNMFHLEAFYGDQSELPPGTSPKISCFKIGPFQVSHTEKT  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             K+KVKV+LNLHGIV+++SA+L E+                  + DD   + ++++ V+ +
Sbjct  474   KVKVKVQLNLHGIVTIDSASLFED------------------QADDPVTRSNTQSKVDTE  515

Query  713   DDKVTSDASENHVLESG-DKPVQMETDakaeapkkk-vkkTNVPVSELVYGALSPADVQK  886
                  SD   N   +    +P  +   A     K + +K+  +PVSE +YG ++ ADV +
Sbjct  516   SVSGPSDVVSNGAKDGCFSQPETLPMSAADGMRKGRFLKRLEMPVSETIYGGMTKADVLE  575

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             A EKE ++A QDR ME+TKDKKNA+E+YVY+MRNKL++ Y+ F  D E+E +   LQ+
Sbjct  576   AQEKELQLAQQDRTMEQTKDKKNALESYVYEMRNKLFNTYRSFATDLEREGISRNLQQ  633



>ref|XP_010931798.1| PREDICTED: heat shock 70 kDa protein 16 [Elaeis guineensis]
Length=784

 Score =   273 bits (699),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 151/355 (43%), Positives = 229/355 (65%), Gaps = 22/355 (6%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  +LERV +P +KA+ +AG  V+ IHS+E++GSGSRVPAI +IL  FF +EP R
Sbjct  303   EFEKLAADLLERVLEPCKKALMDAGQNVDMIHSVELVGSGSRVPAITRILAGFFRREPSR  362

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NASEC+++GCALQCA+LSP F+V++++V +SFPF I  +       +  G      S 
Sbjct  363   TLNASECIARGCALQCAMLSPVFRVKEYEVQDSFPFSIGFA-------SDEGPVSTLSSN  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERAK  535
             I+F KG P PSVK LTF+R+ TF+++  YA+ SEL   A  KIS++ +GPFQ+   E+ K
Sbjct  416   ILFRKGQPFPSVKMLTFHRTNTFTLEAFYANQSELPPGASPKISSFQVGPFQASWSEKPK  475

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             +KV+VRLNLHGIVSVESA+L+E++  +         +  + E     P D+    V    
Sbjct  476   VKVRVRLNLHGIVSVESASLVEDDINDPVSRDRSRMDRVEPEFPSGVPHDTVANTVENGT  535

Query  716   DKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVE  895
                T         E G +P   +        +   ++  + +SE++YG ++  ++ +A E
Sbjct  536   STQT---------EPGSRPSHAD----RIKREGTCRRNELAISEIIYGGMTKEELLEAQE  582

Query  896   KEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
              E  +A QD++ME+TKD+KNA+EAYVY++R+KL+DKY+ F  DSE+E +  +LQ+
Sbjct  583   HEQVLAFQDKVMEQTKDRKNALEAYVYEIRDKLFDKYRCFATDSEREGISGRLQQ  637



>ref|XP_002278262.1| PREDICTED: heat shock 70 kDa protein 16 [Vitis vinifera]
Length=771

 Score =   270 bits (690),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 152/355 (43%), Positives = 224/355 (63%), Gaps = 22/355 (6%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE ++  + ER++ P  +A+++A L V+ IH++E++GSGSR+PAI ++L   F +EPRR
Sbjct  302   EFENLASGLFERIRVPCNQALSDARLTVDKIHAVELVGSGSRIPAISRLLASLFRREPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+N SECV++GCALQCA+LSP F+VRD++V +S PF I  S       +         ++
Sbjct  362   TLNVSECVARGCALQCAMLSPIFRVRDYEVQDSLPFSIGFS-------SDEVPICTMTNS  414

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQA--PSKISTYTIGPFQSGKGERAK  535
             I+FPKG PIPS K LTF RS  F ++  YA+ +EL A  PSKI  +TIGPFQ+  G  AK
Sbjct  415   ILFPKGQPIPSAKILTFQRSSLFHLEAFYANPNELPAGMPSKIGCFTIGPFQASHG--AK  472

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             +KVKV LN+HGIV+VESA+L+E+ E +          S KME + +    SS    N  +
Sbjct  473   VKVKVHLNVHGIVTVESASLIEDHEDDSVTRDHAQLNSDKMEAESVSGSGSSVAVENGVE  532

Query  716   DKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVE  895
             D  ++ +  +    +G       T           ++  +PVSE +YG ++ A++ +A E
Sbjct  533   DGTSTQSKSSQTTSAGGVRKHKST-----------RRHEIPVSENIYGGMTEAELSEAQE  581

Query  896   KEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KE ++  QDR +E+TK+KKNA+E+YVYDMRNKL+  Y+ F  D E+E +   LQ+
Sbjct  582   KEIQLTQQDRTVEQTKEKKNALESYVYDMRNKLFHTYRSFASDQEREGISRSLQQ  636



>ref|XP_007020851.1| Heat shock protein 70 family protein [Theobroma cacao]
 gb|EOY12376.1| Heat shock protein 70 family protein [Theobroma cacao]
Length=764

 Score =   269 bits (688),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 150/355 (42%), Positives = 224/355 (63%), Gaps = 30/355 (8%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  +LER+  P  KA+A+AGL VE IH++E++GSGSR+PAI + L   F +EP R
Sbjct  302   EFEKLASQLLERINIPCIKALADAGLTVEKIHAVELVGSGSRIPAITRQLASLFRREPGR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NASECV++GCALQCA+LSP F+VRD++V +  PF I  S    SP +Q          
Sbjct  362   TINASECVARGCALQCAMLSPVFRVRDYEVQDCIPFSIGFS-SNESPISQGSDG------  414

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQA--PSKISTYTIGPFQSGKGERAK  535
             ++FP+G PIPSVK L   RS  F ++  Y + +EL +   SKI  +TIGPFQS   ERA+
Sbjct  415   VLFPRGQPIPSVKVLQLQRSSLFHLEAFYVNPNELPSGVSSKICCFTIGPFQSSHIERAR  474

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             +KVKV+LNLHGIV+VESA L                   +   DD   ++ + ++++ ++
Sbjct  475   VKVKVQLNLHGIVTVESAIL------------------IEEHVDDSITREDTHSEMSTKE  516

Query  716   DKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVE  895
              +  +++SE+       KP     D       K  ++  +P+ E +YGA++ A++ +A +
Sbjct  517   AQHVTNSSEDSTTVRS-KPSHASAD--GRPNDKATRRLEIPICENIYGAMTKAELIEAQD  573

Query  896   KEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KE ++A  DR ME+TK++KNA+E+YVY+MRNKL++ Y+ F  D EKE +   LQE
Sbjct  574   KELKLAQHDRTMEQTKERKNALESYVYEMRNKLFNSYRSFASDEEKEGISKSLQE  628



>ref|XP_008806738.1| PREDICTED: heat shock 70 kDa protein 16 isoform X1 [Phoenix dactylifera]
Length=783

 Score =   268 bits (684),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 149/355 (42%), Positives = 234/355 (66%), Gaps = 22/355 (6%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  +LER+ +P +KA+ +AGL V+ +HS+E++GSGSR+P I++IL  FF +EP R
Sbjct  303   EFEKLAANLLERILEPCKKALMDAGLNVDMMHSVELVGSGSRIPVIMRILAGFFRREPSR  362

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NASEC+++GCALQCA+LSP F+VR+++V +SFPF I  +       +  G      S 
Sbjct  363   TLNASECIARGCALQCAMLSPVFRVREYEVQDSFPFSIGFA-------SDEGPVSTLSSN  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERAK  535
             I+F KG P PSVK LTF+R+ TF+++  YA+ SEL   A  KIS + +GPFQ+ + E+ K
Sbjct  416   ILFRKGQPFPSVKMLTFHRTNTFTLEAFYANQSELPPGASPKISCFQVGPFQASRSEKPK  475

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             +KV+VRLNLHGIVSVESA+L+E++  +      +  ++ + E     P D++   V    
Sbjct  476   VKVRVRLNLHGIVSVESASLIEDDIDDPVSRDTRRIDTVEPEIASGGPHDTAANTVENGT  535

Query  716   DKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVE  895
                T         E G +P Q +        +   ++  + V+E +YG ++  ++ +A E
Sbjct  536   SAQT---------EPGSRPSQAD----RIKREGTRRRNELAVAETIYGGMTKEELLEAQE  582

Query  896   KEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             +E  +A QD++ME+TKD+KN++EAYVY++R+KL+DKY+ F  DSE+E +  +LQ+
Sbjct  583   QEQALAYQDKVMEQTKDRKNSLEAYVYEIRDKLFDKYRCFATDSEREGISVRLQQ  637



>ref|XP_010092150.1| Heat shock 70 kDa protein 16 [Morus notabilis]
 gb|EXB50301.1| Heat shock 70 kDa protein 16 [Morus notabilis]
Length=749

 Score =   266 bits (680),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 154/356 (43%), Positives = 219/356 (62%), Gaps = 24/356 (7%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  +LER+  P  KA+A+AGL+ + IHS+E++GSGSR+PAI + L   F +EPRR
Sbjct  302   EFEKLTSRLLERIVLPCSKALADAGLSADKIHSVELVGSGSRIPAITRSLASVFKREPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             ++NASECV++GCALQ A+LSP F+VR+++V +S PF I L   + P     NG       
Sbjct  362   SLNASECVARGCALQGAMLSPVFRVREYEVQDSLPFSIGLLLDESPIGTGTNG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPS--KISTYTIGPFQSGKGERA  532
              I+FPKG PIPS+K LTF RS +F ++  YA+  EL   +  KIS +TIGP Q    E+A
Sbjct  415   -ILFPKGQPIPSIKVLTFQRSSSFKLEAFYANPYELPPATSPKISCFTIGPIQGTCSEKA  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KVKV LNLHGIV VESATL+++         E       M+ D       SE   N  
Sbjct  474   RVKVKVHLNLHGIVRVESATLIDDHVGNSVSRGEVHSMDA-MDVDGASVSGGSERVANGV  532

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             +D  +     +H      K             +K  ++  +PVSE +YG ++  ++ +A 
Sbjct  533   EDSASIQTESSHPSAKATK------------EEKSTRRLEIPVSENIYGGMTKVELSEAQ  580

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             EKE ++A QDR MEETK+KKNA+E+YVY+MRNKL+  Y+ F  D E+E +   LQ+
Sbjct  581   EKELQLAQQDRTMEETKNKKNALESYVYEMRNKLFSTYRSFASDQEREGISRSLQQ  636



>ref|XP_008806739.1| PREDICTED: heat shock 70 kDa protein 16 isoform X2 [Phoenix dactylifera]
Length=782

 Score =   266 bits (679),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 150/355 (42%), Positives = 236/355 (66%), Gaps = 23/355 (6%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  +LER+ +P +KA+ +AGL V+ +HS+E++GSGSR+P I++IL  FF +EP R
Sbjct  303   EFEKLAANLLERILEPCKKALMDAGLNVDMMHSVELVGSGSRIPVIMRILAGFFRREPSR  362

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NASEC+++GCALQCA+LSP F+VR+++V +SFPF I  +       +  G      S 
Sbjct  363   TLNASECIARGCALQCAMLSPVFRVREYEVQDSFPFSIGFA-------SDEGPVSTLSSN  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERAK  535
             I+F KG P PSVK LTF+R+ TF+++  YA+ SEL   A  KIS + +GPFQ+ + E+ K
Sbjct  416   ILFRKGQPFPSVKMLTFHRTNTFTLEAFYANQSELPPGASPKISCFQVGPFQASRSEKPK  475

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             +KV+VRLNLHGIVSVESA+L+E++  +      +  ++ + E     P D++   V    
Sbjct  476   VKVRVRLNLHGIVSVESASLIEDDIDDPVSRDTRRIDTVEPEIASGGPHDTAANTV----  531

Query  716   DKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVE  895
             +  TS  +E     S D+  +  T           ++  + V+E +YG ++  ++ +A E
Sbjct  532   ENGTSAQTEPGSRPSADRIKREGT----------RRRNELAVAETIYGGMTKEELLEAQE  581

Query  896   KEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             +E  +A QD++ME+TKD+KN++EAYVY++R+KL+DKY+ F  DSE+E +  +LQ+
Sbjct  582   QEQALAYQDKVMEQTKDRKNSLEAYVYEIRDKLFDKYRCFATDSEREGISVRLQQ  636



>emb|CDP04389.1| unnamed protein product [Coffea canephora]
Length=767

 Score =   265 bits (677),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 147/356 (41%), Positives = 223/356 (63%), Gaps = 29/356 (8%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE++S  +LER+  P  KA+ ++GL +E IH++E++GSGSR+PAI+K+L+  F +EP R
Sbjct  301   DFEKLSSHLLERISFPCRKALLDSGLTLEKIHTVELVGSGSRIPAIMKVLSALFRREPSR  360

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+N SECV++GCALQCA+LSPTF+VR+F+V +SFPF I  S         +G    Q + 
Sbjct  361   TINVSECVARGCALQCAMLSPTFRVREFEVQDSFPFSIGFSL-------SDGPICAQSNC  413

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQ--APSKISTYTIGPFQSGKGERAK  535
             ++FP+G+P PSVK LT  +S TF ++  YA  +EL     +KIS + IGP+Q    E+AK
Sbjct  414   VLFPRGHPFPSVKMLTLQKSNTFQMEAFYAKENELLPCTSTKISDFMIGPYQVSHSEKAK  473

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSE--TDVNM  709
             +KV+V LN+HGIV VESA+L+E+   +          S  MET +     ++    D N 
Sbjct  474   VKVRVHLNIHGIVGVESASLIEDHADDPTSNNCADALSENMETSNHETFYTANGPGDSNS  533

Query  710   QDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKA  889
                K +  A       +GD+     T           ++ ++P+SE + G ++P ++ +A
Sbjct  534   AHSKFSPAA-------AGDERRAKAT-----------RRQDIPISENICGGMTPVELSQA  575

Query  890   VEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQ  1057
              EKE ++A QD  ME TKD+KN++E+YVYD RNKL + Y+ F  D+E+E + + LQ
Sbjct  576   QEKELQLAEQDTKMERTKDRKNSLESYVYDTRNKLLNSYRSFATDAEREGISSSLQ  631



>ref|XP_006475182.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X2 [Citrus 
sinensis]
 gb|KDO62656.1| hypothetical protein CISIN_1g004296mg [Citrus sinensis]
Length=708

 Score =   262 bits (670),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 154/356 (43%), Positives = 221/356 (62%), Gaps = 23/356 (6%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  + E++  P  KA+A+AGL V+ IHS+E++GSGSR+PAI ++LT  FG+EPRR
Sbjct  302   EFEELASGLTEKIAIPCRKALADAGLHVDKIHSVEIVGSGSRIPAITRLLTSLFGREPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             ++NASECV++GCALQCA+LSP F+VR+++V +  P+ I +S  +GP     N   E    
Sbjct  362   SLNASECVARGCALQCAMLSPAFRVREYEVQDCNPYSIGISSDEGPICIGSNTNGE----  417

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERA  532
               VFPKG PIP VK LT  RS  F +++ Y + +EL     SK+S +TIGPFQ    E A
Sbjct  418   --VFPKGQPIPCVKVLTLQRSSLFHLELFYTNPNELPPGISSKVSCFTIGPFQGSNSENA  475

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             K+KV V+LNLHGIVSVESA L+E    +         +  KME++ +   DSS T  ++Q
Sbjct  476   KVKVTVKLNLHGIVSVESAWLIEGHGDDPVTKHNARSKMDKMESEGVSI-DSSTTVEDVQ  534

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             D       S +    S  +              K  ++ ++ +SE +YG ++  ++  A 
Sbjct  535   DSASVQSKSSHSSAVSVVR-------------DKAGRRLDISISETIYGGMTKPELALAQ  581

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             E E  +A QD  ME+TKDKKNA+E+YVY+MRNKL+  Y+ F  D E+E +   LQE
Sbjct  582   ETENLLAQQDITMEQTKDKKNALESYVYEMRNKLFSTYRSFASDQEREGISRSLQE  637



>gb|AIL24130.1| heat shock protein 2, partial [Tamarix hispida]
Length=212

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 179/213 (84%), Gaps = 5/213 (2%)
 Frame = +2

Query  299  LSWKGPSPDAQNGAAENQQSTIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPS  478
            LSWKG +P+AQNGA ENQQST+VFPKGNPIPSVKALTFYRSGTF+I+VQYAD+SELQAP+
Sbjct  1    LSWKGSAPEAQNGAEENQQSTVVFPKGNPIPSVKALTFYRSGTFTINVQYADMSELQAPA  60

Query  479  KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  658
            KISTYTIGPFQS KGERAKLKVKVRL+LHGIVS+ESATLLEEEEVEVPV KE  K+S KM
Sbjct  61   KISTYTIGPFQSSKGERAKLKVKVRLSLHGIVSIESATLLEEEEVEVPVTKELAKDS-KM  119

Query  659  ETDDI---PPQDSSETDVNMQDDKVTSDAS-ENHVLESGDKPVQMETDakaeapkkkvkk  826
            +TD      P    E DVNMQD K  ++ S EN   E G+KP QMETD KAEAPKKKVKK
Sbjct  120  DTDQASGDAPSAPPEGDVNMQDAKGAAEVSAENGTSELGEKPAQMETDTKAEAPKKKVKK  179

Query  827  TNVPVSELVYGALSPADVQKAVEKEFEMALQDR  925
            TNVPV ELVYG + P D+QK VEKEFEMALQDR
Sbjct  180  TNVPVVELVYGGVLPTDLQKLVEKEFEMALQDR  212



>ref|XP_008365284.1| PREDICTED: heat shock 70 kDa protein 16, partial [Malus domestica]
Length=683

 Score =   260 bits (665),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 153/356 (43%), Positives = 220/356 (62%), Gaps = 24/356 (7%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE ++  +LER+  P  KA+ +AGL  + IHS+E++GSGSR+PA+ +IL   F KEP R
Sbjct  302   DFEMLASGLLERIGXPCSKALXDAGLTADKIHSVELVGSGSRIPAVARILASVFRKEPGR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIA-LSWKGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VR+ +V +S PF +A L  + P     +G       
Sbjct  362   TLNASECVARGCALQCAMLSPVFRVREXEVQDSIPFSVAFLIDEAPICTGTSG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSK--ISTYTIGPFQSGKGERA  532
              I+FPKG PIPSVK L F RS  F +   YA+ SE+ A +   I  + IGPFQ   GE+ 
Sbjct  415   -ILFPKGQPIPSVKXLXFRRSSLFHLKAFYANPSEVPAGTSPDICCFXIGPFQCSHGEKT  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KVKV L+LHG+VSVESA ++E+   +         +   M+TD +    S+E      
Sbjct  474   RVKVKVMLDLHGVVSVESAMVMEDHGDDSSTGGLAGSKMEPMDTDYVTASGSTE------  527

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
                  +D  E    ES  +     T  +A+  KK  ++  +PVSE +YG ++ A++ +A 
Sbjct  528   ---AVADGFE----ESSMQHNSSHTGGEAKRNKKATRRLEIPVSESIYGGMTKAELSEAQ  580

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             EKE ++A QDRIME+TKDKKNA+E+YVY+M NKL + Y+ F    E E +   LQ+
Sbjct  581   EKELQLAQQDRIMEQTKDKKNALESYVYEMXNKLLNTYRSFASYQEMEGISRSLQQ  636



>ref|XP_006452327.1| hypothetical protein CICLE_v10007538mg [Citrus clementina]
 ref|XP_006475181.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Citrus 
sinensis]
 gb|ESR65567.1| hypothetical protein CICLE_v10007538mg [Citrus clementina]
 gb|KDO62654.1| hypothetical protein CISIN_1g004296mg [Citrus sinensis]
 gb|KDO62655.1| hypothetical protein CISIN_1g004296mg [Citrus sinensis]
Length=763

 Score =   262 bits (669),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 154/356 (43%), Positives = 221/356 (62%), Gaps = 23/356 (6%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  + E++  P  KA+A+AGL V+ IHS+E++GSGSR+PAI ++LT  FG+EPRR
Sbjct  302   EFEELASGLTEKIAIPCRKALADAGLHVDKIHSVEIVGSGSRIPAITRLLTSLFGREPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             ++NASECV++GCALQCA+LSP F+VR+++V +  P+ I +S  +GP     N   E    
Sbjct  362   SLNASECVARGCALQCAMLSPAFRVREYEVQDCNPYSIGISSDEGPICIGSNTNGE----  417

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERA  532
               VFPKG PIP VK LT  RS  F +++ Y + +EL     SK+S +TIGPFQ    E A
Sbjct  418   --VFPKGQPIPCVKVLTLQRSSLFHLELFYTNPNELPPGISSKVSCFTIGPFQGSNSENA  475

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             K+KV V+LNLHGIVSVESA L+E    +         +  KME++ +   DSS T  ++Q
Sbjct  476   KVKVTVKLNLHGIVSVESAWLIEGHGDDPVTKHNARSKMDKMESEGVSI-DSSTTVEDVQ  534

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             D       S +    S  +              K  ++ ++ +SE +YG ++  ++  A 
Sbjct  535   DSASVQSKSSHSSAVSVVR-------------DKAGRRLDISISETIYGGMTKPELALAQ  581

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             E E  +A QD  ME+TKDKKNA+E+YVY+MRNKL+  Y+ F  D E+E +   LQE
Sbjct  582   ETENLLAQQDITMEQTKDKKNALESYVYEMRNKLFSTYRSFASDQEREGISRSLQE  637



>gb|KCW67010.1| hypothetical protein EUGRSUZ_F00767 [Eucalyptus grandis]
Length=711

 Score =   261 bits (666),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 148/359 (41%), Positives = 218/359 (61%), Gaps = 34/359 (9%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE ++  +LER+  P ++A+A+A L VE +HS+E++GSGSR+PAI K+LT  F +EPRR
Sbjct  302   EFEILASALLERISIPCKRALADAALPVERLHSVELVGSGSRIPAITKVLTSIFRREPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NASECV++GCALQCA+LSP F+VR+++V +S PF I  S  G       GA  N    
Sbjct  362   TLNASECVARGCALQCAMLSPVFRVREYEVQDSIPFSIGFSSDG----GPIGAGSN---V  414

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQA--PSKISTYTIGPFQSGKGERAK  535
             ++FPKG PIPSVK LT  RS +F ++  YA+  EL +   SKIS + +GP +   GE++K
Sbjct  415   VLFPKGRPIPSVKVLTLQRSSSFQLEAFYANPDELPSGMSSKISCFMVGPVKGLHGEKSK  474

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKME--TDDIPPQDSSETDVNM  709
             +KV+V+LNLHGI                      +  +T +E   +     D ++   + 
Sbjct  475   VKVRVQLNLHGI--------------------ITIDSATMIEEGVEGTVSNDDTQAHGDK  514

Query  710   QDDKVTSDASENHVLESGDKPVQMETDakae--apkkkvkkTNVPVSELVYGALSPADVQ  883
              D +  S A +N V E G       + A        K  KK ++PV   +YG ++  +V 
Sbjct  515   MDTESASFAGDNGV-EDGTHSHSQSSHASDHHIRKHKVTKKHDIPVHLKIYGGMTEVEVL  573

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             +A EKE+++A QD+I E+TK+KKNA+E+YVY+ RNKL + Y+ F  D E+E +   LQ+
Sbjct  574   EAQEKEYQLAQQDKIAEQTKEKKNALESYVYETRNKLLNTYRSFASDREREGISRSLQQ  632



>gb|KCW67009.1| hypothetical protein EUGRSUZ_F00767 [Eucalyptus grandis]
Length=718

 Score =   260 bits (665),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 146/355 (41%), Positives = 220/355 (62%), Gaps = 26/355 (7%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE ++  +LER+  P ++A+A+A L VE +HS+E++GSGSR+PAI K+LT  F +EPRR
Sbjct  246   EFEILASALLERISIPCKRALADAALPVERLHSVELVGSGSRIPAITKVLTSIFRREPRR  305

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NASECV++GCALQCA+LSP F+VR+++V +S PF I  S  G       GA  N    
Sbjct  306   TLNASECVARGCALQCAMLSPVFRVREYEVQDSIPFSIGFSSDG----GPIGAGSN---V  358

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQA--PSKISTYTIGPFQSGKGERAK  535
             ++FPKG PIPSVK LT  RS +F ++  YA+  EL +   SKIS + +GP +   GE++K
Sbjct  359   VLFPKGRPIPSVKVLTLQRSSSFQLEAFYANPDELPSGMSSKISCFMVGPVKGLHGEKSK  418

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             +KV+V+LNLHGI++++SAT++EE         +      KM+T+            +   
Sbjct  419   VKVRVQLNLHGIITIDSATMIEEGVEGTVSNDDTQAHGDKMDTE----------SASFAG  468

Query  716   DKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVE  895
             D    D + +H   S      +      +         ++PV   +YG ++  +V +A E
Sbjct  469   DNGVEDGTHSHSQSSHASDHHIRKHKVTKKH-------DIPVHLKIYGGMTEVEVLEAQE  521

Query  896   KEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KE+++A QD+I E+TK+KKNA+E+YVY+ RNKL + Y+ F  D E+E +   LQ+
Sbjct  522   KEYQLAQQDKIAEQTKEKKNALESYVYETRNKLLNTYRSFASDREREGISRSLQQ  576



>ref|XP_010060358.1| PREDICTED: heat shock 70 kDa protein 16 [Eucalyptus grandis]
Length=774

 Score =   261 bits (666),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 148/359 (41%), Positives = 218/359 (61%), Gaps = 34/359 (9%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE ++  +LER+  P ++A+A+A L VE +HS+E++GSGSR+PAI K+LT  F +EPRR
Sbjct  302   EFEILASALLERISIPCKRALADAALPVERLHSVELVGSGSRIPAITKVLTSIFRREPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NASECV++GCALQCA+LSP F+VR+++V +S PF I  S  G       GA  N    
Sbjct  362   TLNASECVARGCALQCAMLSPVFRVREYEVQDSIPFSIGFSSDG----GPIGAGSN---V  414

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQA--PSKISTYTIGPFQSGKGERAK  535
             ++FPKG PIPSVK LT  RS +F ++  YA+  EL +   SKIS + +GP +   GE++K
Sbjct  415   VLFPKGRPIPSVKVLTLQRSSSFQLEAFYANPDELPSGMSSKISCFMVGPVKGLHGEKSK  474

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKME--TDDIPPQDSSETDVNM  709
             +KV+V+LNLHGI                      +  +T +E   +     D ++   + 
Sbjct  475   VKVRVQLNLHGI--------------------ITIDSATMIEEGVEGTVSNDDTQAHGDK  514

Query  710   QDDKVTSDASENHVLESGDKPVQMETDakae--apkkkvkkTNVPVSELVYGALSPADVQ  883
              D +  S A +N V E G       + A        K  KK ++PV   +YG ++  +V 
Sbjct  515   MDTESASFAGDNGV-EDGTHSHSQSSHASDHHIRKHKVTKKHDIPVHLKIYGGMTEVEVL  573

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             +A EKE+++A QD+I E+TK+KKNA+E+YVY+ RNKL + Y+ F  D E+E +   LQ+
Sbjct  574   EAQEKEYQLAQQDKIAEQTKEKKNALESYVYETRNKLLNTYRSFASDREREGISRSLQQ  632



>ref|XP_008366399.1| PREDICTED: heat shock 70 kDa protein 16-like [Malus domestica]
Length=777

 Score =   259 bits (662),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 156/356 (44%), Positives = 222/356 (62%), Gaps = 24/356 (7%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE ++  +LER+  P  +A+A+AGL  + IHS+E++GSGSR+PA+ +IL   F  EPRR
Sbjct  302   DFEMLASGLLERICVPCSEALADAGLTADKIHSVELVGSGSRIPAVARILASVFKNEPRR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIA-LSWKGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VR+++V +S PF IA L  + P     NG       
Sbjct  362   TLNASECVARGCALQCAMLSPVFRVREYEVQDSIPFSIAFLIDEAPICPGTNG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQA--PSKISTYTIGPFQSGKGERA  532
              I+FPKG PIPSVK LTF RS  F +   YA+ +E+ A   S I  +TIGPFQ    ++ 
Sbjct  415   -ILFPKGQPIPSVKVLTFRRSSLFHLKAFYANPTEVPAGVSSDICCFTIGPFQCSHSKKT  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KVKV LNLHG+VSVESA ++EE   +         +   M+ D +    S+E    + 
Sbjct  474   RVKVKVVLNLHGVVSVESAMVMEEHGDDSSTRGLADSKMDPMDIDYVTASGSTEA---VA  530

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             D    S    N    SGD           E   K  ++  +PVSE +YG ++ A++ +A 
Sbjct  531   DGFEKSSIQHNSSHTSGDP----------ERNNKASRRLEIPVSESMYGGMTKAELSEAQ  580

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             +KE ++A  DRIME+TKDKKNA+E+YVY+MRNKL++ Y+ F  D E+E +   LQ+
Sbjct  581   DKELQLAQHDRIMEQTKDKKNALESYVYEMRNKLFNTYRSFASDQEREGISRSLQQ  636



>gb|KHG25442.1| Heat shock 70 kDa 16 -like protein [Gossypium arboreum]
Length=757

 Score =   258 bits (659),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 140/356 (39%), Positives = 216/356 (61%), Gaps = 40/356 (11%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  +LER+  P  KAI +AGL V  +H++E++GSGSR+PAI + L  FF +EP R
Sbjct  302   EFEKLAPGLLERINIPCTKAITDAGLTVGKVHAVELVGSGSRIPAITRQLASFFRREPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VRD++V +  PF I  S  K P     N        
Sbjct  362   TINASECVARGCALQCAMLSPIFRVRDYEVQDCIPFSIGFSLDKTPILQGSN--------  413

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQA--PSKISTYTIGPFQSGKGERA  532
              ++FP+G PIPS   L   RS  F ++  YA+ +EL +  PS+IS +TIGPFQ+   ERA
Sbjct  414   YVLFPRGQPIPSAIVLQLQRSSLFHLEPFYANPNELPSGVPSEISCFTIGPFQASNSERA  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KVKV+LNLHGI                            +E+  +  +   +++++ +
Sbjct  474   RVKVKVQLNLHGI--------------------------VTVESAMLIEEHVDDSELSTK  507

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             + +  ++ SE+       KP     D   +   K +++  +PVSE + G ++  ++ +A 
Sbjct  508   EARHVTNGSEDGTYMQS-KPSNASAD--GKTNDKTMRRLEIPVSENINGTMTGVELMEAQ  564

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             +KE ++A QDR ME+TK+KKNA+E+YVY+MRNKL++ Y+ F  D E++ +   LQE
Sbjct  565   DKELKLAQQDRTMEQTKEKKNALESYVYEMRNKLFNTYRGFASDEERDGISKSLQE  620



>ref|XP_009352450.1| PREDICTED: heat shock 70 kDa protein 16-like, partial [Pyrus 
x bretschneideri]
Length=736

 Score =   256 bits (654),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 150/355 (42%), Positives = 213/355 (60%), Gaps = 22/355 (6%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE ++  +LER+  P  KA+A+AGL  + IHS+E++GSGSR+PA+ +IL   FGKEP R
Sbjct  302   DFEMLASGLLERIGVPCSKALADAGLTADMIHSVELVGSGSRIPAVARILASVFGKEPGR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NASECV++GCALQCA+LSP F+V +++V +S PF IAL                  S 
Sbjct  362   TLNASECVARGCALQCAMLSPVFRVGEYEVQDSIPFSIALL-------VDEAPICTGTSD  414

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSK--ISTYTIGPFQSGKGERAK  535
             I+FPK  PIPSVK LTF RS  F +   Y + SE+ A +   I  +TIGPFQ   GER  
Sbjct  415   ILFPKCQPIPSVKVLTFQRSSLFHLKAFYDNPSEVSAGASPDICCFTIGPFQCSHGERTM  474

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             +KVK  L+LHG+VSVESA ++E+   +             M+ D +     +        
Sbjct  475   VKVKFMLDLHGVVSVESAMVMEDHGDDSSTRGLAGSTMEPMDIDCVTASGYT--------  526

Query  716   DKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVE  895
                 +D  E    ES  +     T  +A+  KK  ++  +PVSE +YG ++ A++ +A E
Sbjct  527   -GAVADGFE----ESSTQHNSSHTGGEAKRNKKATRRLEIPVSESIYGGMTKAELSEAQE  581

Query  896   KEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KE ++A  DRIME+ KDKKNA+E+YVY+M+ KL + YQ F  D E+E +   LQ+
Sbjct  582   KELQLAQWDRIMEQIKDKKNALESYVYEMQTKLLNTYQSFASDQEREGISRSLQQ  636



>ref|XP_004151979.1| PREDICTED: heat shock 70 kDa protein 16 [Cucumis sativus]
 gb|KGN57923.1| hypothetical protein Csa_3G391900 [Cucumis sativus]
Length=762

 Score =   256 bits (654),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 147/357 (41%), Positives = 225/357 (63%), Gaps = 45/357 (13%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  +LE++  P  + +A+AGLAVENIHS+E++GSGSR+PAI ++LT  F KEP R
Sbjct  302   EFEKLASGLLEKISIPCTRGLADAGLAVENIHSVELVGSGSRIPAISRLLTSVFKKEPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIAL-SWKGPSPDAQNGAAENQQS  358
              +NASECV++GCALQCA+LSP F+VR+++V +SFPF I   S  GP     N        
Sbjct  362   KLNASECVARGCALQCAMLSPVFRVREYEVQDSFPFSIGFQSDAGPISLGLN--------  413

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERA  532
              ++FPKG  IPS K L+F R+  F ++  Y++  EL     SKI  +TIGPFQ      +
Sbjct  414   NVLFPKGQHIPSTKILSFQRNSLFHLEAVYSNPDELPPHMSSKIGCFTIGPFQGSNNSNS  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeST-KMETDDIPPQDSSETDVNM  709
             ++KV+V+LN++GI++VESATL+E+   +    ++    +T KMET+ +   DSS ++   
Sbjct  474   RVKVRVQLNMNGIITVESATLVEDTIDQQMPRRDATYSNTEKMETEFV---DSSHSE---  527

Query  710   QDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKA  889
                   SD S       G + +                  ++PVSE +YG ++ A++ +A
Sbjct  528   ------SDVSRK---ARGTRRI------------------DIPVSEHIYGGMTKAELLEA  560

Query  890   VEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
               +E ++A QD+ ME+ K+KKNA+E+YVY+MRNKL++ Y+ F  D E+E + + LQ+
Sbjct  561   QGRELQLAQQDKNMEQAKNKKNALESYVYEMRNKLFNTYRSFASDQEREGISSSLQQ  617



>ref|XP_008465078.1| PREDICTED: heat shock 70 kDa protein 16 [Cucumis melo]
 ref|XP_008465079.1| PREDICTED: heat shock 70 kDa protein 16 [Cucumis melo]
Length=762

 Score =   254 bits (649),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 146/358 (41%), Positives = 227/358 (63%), Gaps = 47/358 (13%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  +LE++  P  + +A+AGLAVE IHS+E++GSGSR+PAI ++LT  F KEP R
Sbjct  302   EFEKLASGLLEKISIPCTRGLADAGLAVEKIHSVELVGSGSRIPAITRLLTSVFKKEPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
              +NASECV++GCALQCA+LSP F+VR+++V +SFPF I     G S DA  G      + 
Sbjct  362   KLNASECVARGCALQCAMLSPVFRVREYEVQDSFPFSI-----GFSSDA--GPISLGLNN  414

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERAK  535
             ++FPKG  IPS K L+F R+  F ++  Y++  EL     SKI  +TIGPFQ      ++
Sbjct  415   VLFPKGQHIPSTKILSFQRNSLFHLEAVYSNPDELPPGMSSKIGCFTIGPFQGSNNSNSR  474

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeST-KMETDDIPPQDS--SETDVN  706
             +KV+V+LN++GI++VESAT++E+   +    ++    +T KMET+ +   DS  SE+DV+
Sbjct  475   VKVRVQLNMNGIITVESATIVEDTIDQQISRRDATHSNTEKMETEFV---DSFHSESDVS  531

Query  707   MQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
              +                G + +                  ++PVSE +YG ++ A++ +
Sbjct  532   RK--------------ARGTRRI------------------DIPVSEHIYGGMTKAELLE  559

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             A  +E ++A QD+ ME+ K+KKNA+E+YVY+MRNKL++ Y+ F  D E+E + + LQ+
Sbjct  560   AQGRELQLAQQDKNMEQAKNKKNALESYVYEMRNKLFNTYRSFASDQEREGISSSLQQ  617



>gb|KJB22068.1| hypothetical protein B456_004G027900 [Gossypium raimondii]
 gb|KJB22070.1| hypothetical protein B456_004G027900 [Gossypium raimondii]
Length=757

 Score =   254 bits (649),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 141/356 (40%), Positives = 215/356 (60%), Gaps = 40/356 (11%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  +LER+  P  KAI +AGL V  I ++E++GSGSR+PAI + L  FF +EP R
Sbjct  302   EFEKLASGLLERINIPCTKAITDAGLTVGKILAVELVGSGSRIPAITRQLASFFRREPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VRD++V +  PF I  S  K P     N        
Sbjct  362   TINASECVARGCALQCAMLSPIFRVRDYEVQDCIPFSIGFSLDKTPILQGSN--------  413

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQA--PSKISTYTIGPFQSGKGERA  532
              ++FP+G PIPS   L   RS  F ++  YA+ +EL +  PS+IS +TIGPFQ+   ERA
Sbjct  414   YVLFPRGQPIPSAIVLQLQRSSLFHLEPFYANPNELPSGVPSEISCFTIGPFQASNSERA  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KVKV+LNLHGI                            +E+  +  +   +++++ +
Sbjct  474   RVKVKVQLNLHGI--------------------------VNVESAMLIEEHVDDSELSTK  507

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             + +  ++ SE+       KP     D   +   K +++  +PVSE + G ++  ++ +A 
Sbjct  508   EVRHVTNGSEDGTYMQ-PKPSNASAD--GKTNDKTMRRLEIPVSENINGTMTGVELMEAQ  564

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             +KE ++A QDR ME+TK+KKNA+E+YVY+MRNKL++ Y+ F  D E+E +   LQE
Sbjct  565   DKELKLAQQDRTMEQTKEKKNALESYVYEMRNKLFNIYRGFASDEEREGISKSLQE  620



>ref|XP_003563414.2| PREDICTED: heat shock 70 kDa protein 16 [Brachypodium distachyon]
Length=736

 Score =   253 bits (645),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 132/355 (37%), Positives = 214/355 (60%), Gaps = 53/355 (15%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE++   +LERV +P ++A+A++G+ +E + S+E++GSGSRVPAI ++L EFF +EP R
Sbjct  301   EFEKLCSQLLERVVEPCKRAMADSGVGLEKLQSVELVGSGSRVPAIARVLAEFFRREPSR  360

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+N SECV++GCALQCA+LSPT +VR+++V ++ P  I             G      S 
Sbjct  361   TINVSECVARGCALQCAMLSPTLRVREYEVQDAIPASIGFC-------TNEGPISTLSSN  413

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERAK  535
              +F +G P+PSVK +T +R+  F++DV Y D +EL     +KI ++ IGPF +   E++K
Sbjct  414   ALFRRGQPLPSVKIITLHRNSGFNLDVYYLDENELPPGTSTKIGSFQIGPFHA-HTEKSK  472

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             +KVK+RLNLHG+                      ++ +  +E D      S   +V+  +
Sbjct  473   VKVKIRLNLHGL--------------------ISVESAVLIEDDQRDTNSSDSMEVDHNN  512

Query  716   DKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVE  895
             D    D S N      ++P+Q +               ++ +   +YGA+S  ++ +A E
Sbjct  513   D--VGDKSRN------ERPIQRQ---------------DLQIIGSIYGAMSKQELLEAQE  549

Query  896   KEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             +E+++A QD++ME TK++KNA+E+YVYD+RNKL ++Y+ F  DSE+EQ+   LQ+
Sbjct  550   QEYQLAYQDKLMERTKERKNALESYVYDIRNKLSERYRSFATDSEREQISVNLQQ  604



>ref|XP_009614255.1| PREDICTED: heat shock 70 kDa protein 16 [Nicotiana tomentosiformis]
Length=753

 Score =   251 bits (642),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 209/356 (59%), Gaps = 54/356 (15%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE++S  +LE++  P  KA+ ++GL  + IH++E++GSGSR+PA+ +IL   F KEP R
Sbjct  302   DFEKLSSDLLEKISIPCRKALLDSGLTADRIHTLELVGSGSRIPAVGRILNSLFRKEPGR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIAL-SWKGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VR+++V +SFPF I   S +GP     NG       
Sbjct  362   TINASECVARGCALQCAMLSPIFRVREYEVQDSFPFSIGFASDEGPVCTLSNG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERA  532
              I+FPKG+  PS+K LT +RS  F+++  Y + +EL      KIS  TIGPFQ    E+A
Sbjct  415   -ILFPKGHSFPSMKVLTLHRSSCFNLEAFYTNQNELPPGVSDKISKSTIGPFQVPHSEKA  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             K+KVK++LNLHGIV+VESA L++++             +  ME DD     +    V  Q
Sbjct  474   KIKVKIQLNLHGIVTVESAWLIKDQTSHSTSENNTDTHAEDMEGDDTRKSKA----VKRQ  529

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             D                                       +PVSE V G ++ A++ +A 
Sbjct  530   D---------------------------------------IPVSESVNGGMTLAELSQAQ  550

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             EKE ++A QD  +E TKDKKN +EAYVY+ RNKL + Y+ F  DSE+E +   LQ+
Sbjct  551   EKECQLAEQDIKVERTKDKKNTLEAYVYETRNKLLNTYRSFATDSEREGISCNLQQ  606



>gb|KHM99573.1| Heat shock 70 kDa protein 16 [Glycine soja]
Length=769

 Score =   251 bits (642),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 220/356 (62%), Gaps = 30/356 (8%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  +LERV  P  +A+ +A L  E I S+E++GSGSR+PAI   LT  F +EP R
Sbjct  302   EFEKLASGLLERVSIPCHRALTDANLTAEKISSVELVGSGSRIPAISTSLTSLFKREPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
              +NASECV++GCALQCA+LSP ++VR+++V +  PF I LS  +GP     NG       
Sbjct  362   QLNASECVARGCALQCAMLSPVYRVREYEVKDVIPFSIGLSSDEGPVAVRSNG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERA  532
              ++FP+G P PSVK +TF RS  F ++  YA+  EL  +   KIS  TIGPF    G + 
Sbjct  415   -VLFPRGQPFPSVKVITFQRSNLFHLEAFYANPDELPPRTSPKISCVTIGPFHGSHGSKI  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KV+V L+LHGIVS+ESATL                   K + DD+       ++ +  
Sbjct  474   RVKVRVPLDLHGIVSIESATL------------------IKDDMDDLVMAGDYHSNSDAM  515

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             D    S+   N   +  +K ++    + A+  +K  ++ NVPV+E VYG ++ A++ +A+
Sbjct  516   DIDPISETVTNGFEDDTNKKLEFPC-SSADGTRKDNRRLNVPVNENVYGGMTKAEISEAL  574

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             EKE ++A QDRI+E+TK+KKN++E++VYDMR+KL+  Y+ F  + EK+ +   LQE
Sbjct  575   EKELQLAQQDRIVEQTKEKKNSLESFVYDMRSKLFHTYRSFASEQEKDGISRSLQE  630



>gb|AII99889.1| heat shock protein [Cicer arietinum]
Length=771

 Score =   251 bits (642),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 143/356 (40%), Positives = 222/356 (62%), Gaps = 28/356 (8%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE ++  +LER+  P  KA+A+AGL V+ ++S+E+IGSGSR+PAI ++LT  F +E  R
Sbjct  302   EFENLAAGLLERICIPCNKALADAGLTVDKMYSVELIGSGSRIPAIARLLTSVFKRELSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+ SP F++++++V +S PF I LS  +GP     NG       
Sbjct  362   TLNASECVARGCALQCAMQSPVFRIKEYEVQDSIPFSIGLSSDEGPICLKSNG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPS--KISTYTIGPFQSGKGERA  532
              ++FPKG PIPS K LTF+ S     +  YA+  E+   +  KIS +TIGP     G + 
Sbjct  415   -VLFPKGQPIPSYKTLTFHGSNFLRFEAFYANPDEVPKGTSPKISCFTIGPLNGSHGSKM  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
              ++V+++LNLHGIV++ES+TL+E+   +    ++    S  ++ + I     SETD N  
Sbjct  474   GVEVRIQLNLHGIVNIESSTLIEDHAEDSVTTRDCHSNSEAIDVEPI-----SETDQNTN  528

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             + +       +H    G +              K  K+ +VPVSE +YG ++ A++ +A 
Sbjct  529   EYRKDKKCESSHHSSDGTR------------KDKANKRLHVPVSENIYGGMTQAEIIEAQ  576

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             E+E ++  QDR ME TKDK+N++E+YVYDMRNKL+++Y+ F  + E++ +   LQE
Sbjct  577   EQECQLTQQDRTMELTKDKRNSLESYVYDMRNKLFNEYRNFASEQERDGISRSLQE  632



>ref|XP_003532123.1| PREDICTED: heat shock 70 kDa protein 16-like [Glycine max]
Length=769

 Score =   251 bits (641),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 220/356 (62%), Gaps = 30/356 (8%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  +LERV  P  +A+ +A L  E I S+E++GSGSR+PAI   LT  F +EP R
Sbjct  302   EFEKLASGLLERVSIPCRRALTDANLTAEKISSVELVGSGSRIPAISTSLTSLFKREPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
              +NASECV++GCALQCA+LSP ++VR+++V +  PF I LS  +GP     NG       
Sbjct  362   QLNASECVARGCALQCAMLSPVYRVREYEVKDVIPFSIGLSSDEGPVAVRSNG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERA  532
              ++FP+G P PSVK +TF RS  F ++  YA+  EL  +   KIS  TIGPF    G + 
Sbjct  415   -VLFPRGQPFPSVKVITFQRSNLFHLEAFYANPDELPPRTSPKISCVTIGPFHGSHGSKI  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KV+V L+LHGIVS+ESATL                   K + DD+       ++ +  
Sbjct  474   RVKVRVPLDLHGIVSIESATL------------------IKDDMDDLVMAGDYHSNSDAM  515

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             D    S+   N   +  +K ++    + A+  +K  ++ NVPV+E VYG ++ A++ +A+
Sbjct  516   DIDPISETVTNGFEDDTNKKLEFPC-SSADGTRKDNRRLNVPVNENVYGGMTKAEISEAL  574

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             EKE ++A QDRI+E+TK+KKN++E++VYDMR+KL+  Y+ F  + EK+ +   LQE
Sbjct  575   EKELQLAQQDRIVEQTKEKKNSLESFVYDMRSKLFHTYRSFASEQEKDGISRSLQE  630



>gb|KDO75458.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis]
 gb|KDO75459.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis]
Length=692

 Score =   249 bits (637),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 148/358 (41%), Positives = 222/358 (62%), Gaps = 45/358 (13%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE++S  +LER++ P +KA+A +GL VE IHS+E++GSGSR+PAI ++L   F +EP R
Sbjct  303   EFEKLSSSLLERMRIPCQKALAGSGLNVEKIHSVELVGSGSRIPAISRMLNSLFNREPGR  362

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP + VR+F+V +SFPF I  S  KGP     NG       
Sbjct  363   TINASECVARGCALQCAMLSPQYCVREFEVQDSFPFSIGFSSEKGPICTFSNG-------  415

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPS----KISTYTIGPFQSGKGE  526
              ++ PKG P PSVK LT +RS  F +   YAD +EL  PS    +IS++ IGPFQ+   E
Sbjct  416   -VLLPKGQPFPSVKILTLHRSNGFQLQAFYADQNEL--PSVVSPQISSFMIGPFQTSHAE  472

Query  527   RAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVN  706
              A++KV+V L+L G+V V+SA+L+EE                    DD   ++S +  + 
Sbjct  473   TARVKVRVHLDLDGVVRVQSASLIEEF------------------VDDSVRRESRDAHLT  514

Query  707   MQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             +++     DA  +H   +   P       +     K +K+  +PV+E V G ++  ++ +
Sbjct  515   LEE-----DAKSDHTPATAIDP-------EINRKGKVLKRLEIPVNENVNGGMTKTELSE  562

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             AVEKE ++  QD  ME TKD+KNA+E+YVY+MR+K+ + Y+ F  +SE+E +   L++
Sbjct  563   AVEKEHQLVQQDLKMERTKDRKNALESYVYEMRDKISNIYRSFATESEREGISRNLRD  620



>ref|XP_004491392.1| PREDICTED: heat shock 70 kDa protein 16-like [Cicer arietinum]
Length=773

 Score =   251 bits (640),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 143/356 (40%), Positives = 222/356 (62%), Gaps = 28/356 (8%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE ++  +LER+  P  KA+A+AGL V+ ++S+E+IGSGSR+PAI ++LT  F +E  R
Sbjct  302   EFENLAAGLLERICIPCNKALADAGLTVDKMYSVELIGSGSRIPAIARLLTSVFKRELSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+ SP F++++++V +S PF I LS  +GP     NG       
Sbjct  362   TLNASECVARGCALQCAMQSPVFRIKEYEVQDSIPFSIGLSSDEGPICLKSNG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPS--KISTYTIGPFQSGKGERA  532
              ++FPKG PIPS K LTF+ S     +  YA+  E+   +  KIS +TIGP     G + 
Sbjct  415   -VLFPKGQPIPSYKTLTFHGSNFLRFEAFYANPDEVPKGTSPKISCFTIGPLNGSHGSKM  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
              ++V+++LNLHGIV++ES+TL+E+   +    ++    S  ++ + I     SETD N  
Sbjct  474   GVEVRIQLNLHGIVNIESSTLIEDHAEDSVTTRDCHSNSEAIDVEPI-----SETDQNTN  528

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             + +       +H    G +              K  K+ +VPVSE +YG ++ A++ +A 
Sbjct  529   EYRKDKKCESSHHSSDGTR------------KDKANKRLHVPVSENIYGGMTQAEIIEAQ  576

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             E+E ++  QDR ME TKDK+N++E+YVYDMRNKL+++Y+ F  + E++ +   LQE
Sbjct  577   EQECQLTQQDRTMELTKDKRNSLESYVYDMRNKLFNEYRNFASEQERDGISRSLQE  632



>ref|XP_006468028.1| PREDICTED: heat shock 70 kDa protein 16-like [Citrus sinensis]
 gb|KDO75456.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis]
 gb|KDO75457.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis]
Length=768

 Score =   250 bits (638),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 148/358 (41%), Positives = 222/358 (62%), Gaps = 45/358 (13%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE++S  +LER++ P +KA+A +GL VE IHS+E++GSGSR+PAI ++L   F +EP R
Sbjct  303   EFEKLSSSLLERMRIPCQKALAGSGLNVEKIHSVELVGSGSRIPAISRMLNSLFNREPGR  362

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP + VR+F+V +SFPF I  S  KGP     NG       
Sbjct  363   TINASECVARGCALQCAMLSPQYCVREFEVQDSFPFSIGFSSEKGPICTFSNG-------  415

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPS----KISTYTIGPFQSGKGE  526
              ++ PKG P PSVK LT +RS  F +   YAD +EL  PS    +IS++ IGPFQ+   E
Sbjct  416   -VLLPKGQPFPSVKILTLHRSNGFQLQAFYADQNEL--PSVVSPQISSFMIGPFQTSHAE  472

Query  527   RAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVN  706
              A++KV+V L+L G+V V+SA+L+EE                    DD   ++S +  + 
Sbjct  473   TARVKVRVHLDLDGVVRVQSASLIEEF------------------VDDSVRRESRDAHLT  514

Query  707   MQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             +++     DA  +H   +         D +     K +K+  +PV+E V G ++  ++ +
Sbjct  515   LEE-----DAKSDHTPATA-------IDPEINRKGKVLKRLEIPVNENVNGGMTKTELSE  562

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             AVEKE ++  QD  ME TKD+KNA+E+YVY+MR+K+ + Y+ F  +SE+E +   L++
Sbjct  563   AVEKEHQLVQQDLKMERTKDRKNALESYVYEMRDKISNIYRSFATESEREGISRNLRD  620



>ref|XP_006449032.1| hypothetical protein CICLE_v10014383mg [Citrus clementina]
 gb|ESR62272.1| hypothetical protein CICLE_v10014383mg [Citrus clementina]
Length=646

 Score =   247 bits (631),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 147/358 (41%), Positives = 221/358 (62%), Gaps = 45/358 (13%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE++S  +LER++ P +KA+A +GL VE IHS+E++GSGSR+PAI ++L   F +EP R
Sbjct  287   EFEKLSSGLLERMRIPCQKALAGSGLNVEKIHSVELVGSGSRIPAISRMLNSLFNREPGR  346

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP + +R+F+V +SFPF I  S  KGP     NG       
Sbjct  347   TINASECVARGCALQCAMLSPQYCIREFEVQDSFPFSIGFSSEKGPICTFSNG-------  399

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPS----KISTYTIGPFQSGKGE  526
              ++ PKG P PSVK LT +RS  F +   YAD +EL  PS    +IS++ IGPFQ+   E
Sbjct  400   -VLLPKGQPFPSVKILTLHRSNGFQLQAFYADQNEL--PSVVSPQISSFMIGPFQTSHAE  456

Query  527   RAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVN  706
              A++KV+V L+L G+V V+SA+L+EE                    DD   ++S +  + 
Sbjct  457   TARVKVRVHLDLDGVVRVQSASLIEEF------------------VDDSVRRESRDAHLT  498

Query  707   MQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             +++     DA  +H   +   P       +     K +K+  +PV+E V G  +  ++ +
Sbjct  499   LEE-----DAKSDHTPATAIDP-------EINRKGKVLKRLEIPVNENVNGGTTKTELSE  546

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             AVEKE ++  QD  ME TKD+KNA+E+YVY+MR+K+ + Y+ F  +SE+E +   L++
Sbjct  547   AVEKEHQLVQQDLKMERTKDRKNALESYVYEMRDKISNIYRSFATESEREGISRNLRD  604



>ref|XP_006417329.1| hypothetical protein EUTSA_v10006883mg [Eutrema salsugineum]
 gb|ESQ35682.1| hypothetical protein EUTSA_v10006883mg [Eutrema salsugineum]
Length=763

 Score =   249 bits (636),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 141/358 (39%), Positives = 213/358 (59%), Gaps = 47/358 (13%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE++S  +LER+  P +KA+A++GL++++IHS+E++GSGSR+PAI K+L+  F +E  R
Sbjct  303   EFEKLSSGLLERLIVPCQKALADSGLSLDHIHSVELVGSGSRIPAISKMLSSLFKRELGR  362

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VRD++V +SFPF I  S  KGP     N        
Sbjct  363   TVNASECVARGCALQCAMLSPVFRVRDYEVQDSFPFSIGFSSDKGPINTPSN--------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERA  532
              ++FPK    PSVK +T  R  TF ++  YA+  E+   +PS+IS++TIGPFQ   GE A
Sbjct  415   EVLFPKSQVFPSVKVITLRRENTFHLEAFYANQDEIAPDSPSQISSFTIGPFQISHGEAA  474

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSET--DVN  706
             ++KV+V+LNLHGI                        +S  +  D      S ET  + N
Sbjct  475   RVKVRVQLNLHGI---------------------VTIDSASLIEDHKENMTSEETISENN  513

Query  707   MQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
              Q       AS+  +  +G+ P  ++             +  +PV + V GAL+  ++ +
Sbjct  514   HQSSATKDGASDPSLGSTGNDPKAIK-------------RMEIPVVQSVSGALTKNELSE  560

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             A ++E  +  QD  ME TKDKKNA+E++VY+MR+K+ + Y+    +SE+E +   LQE
Sbjct  561   AKQRENSLVEQDLKMESTKDKKNALESFVYEMRDKMLNTYRSTATESERECIARNLQE  618



>emb|CDY49794.1| BnaCnng18070D [Brassica napus]
Length=761

 Score =   249 bits (635),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 140/356 (39%), Positives = 218/356 (61%), Gaps = 43/356 (12%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQ+S  +LER+  P +KA+A++GL+++ IHS+E++GSGSR+PAI K+L+  F +E  R
Sbjct  304   EFEQLSSGLLERLIVPCQKALADSGLSLDQIHSVELVGSGSRIPAISKMLSSLFKRELGR  363

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VRD++V +SFPF I  S  KGP     N        
Sbjct  364   TVNASECVARGCALQCAMLSPIFRVRDYEVQDSFPFSIGFSSDKGPINTPSN--------  415

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQ--APSKISTYTIGPFQSGKGERA  532
              ++FPKG   PSVK LT  R  TF ++  YAD +E+   +P +I ++TIGPFQS  G+ A
Sbjct  416   EMLFPKGQVFPSVKVLTLRRENTFHLEAFYADHNEISPDSPIQIGSFTIGPFQSSHGQAA  475

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KV+V+LNLHGI                        +S  +  D   P++++ ++  + 
Sbjct  476   RVKVRVQLNLHGI---------------------VTIDSASLIED---PKENTTSEETVS  511

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             ++   S A+++   +    P   +         K +K+  + V E V GAL+  ++ +A 
Sbjct  512   ENNHQSPATKDGTSDPSSGPTGND--------HKAIKRMKISVVENVSGALTKDELLEAK  563

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             ++E+ +  QD  ME TKDKKNA+E++VY+MR+K+ + Y+    +SE+E +   LQE
Sbjct  564   QREYSLVQQDLKMESTKDKKNALESFVYEMRDKMLNTYRSTATESERECIARNLQE  619



>ref|XP_004966217.1| PREDICTED: heat shock 70 kDa protein 16-like [Setaria italica]
Length=750

 Score =   248 bits (634),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 137/355 (39%), Positives = 218/355 (61%), Gaps = 55/355 (15%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE++   +LER+ +P ++A+A +G+ +E +HS+E++GSGSRVP+I K+L  FF +E  R
Sbjct  306   EFEKLCAGLLERIVEPCKRAVAVSGIGLERLHSVELVGSGSRVPSIAKVLAGFFRRETSR  365

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NASECV++GCALQCA+LSPTF+VR+++V ++ P  I             G      S 
Sbjct  366   TLNASECVARGCALQCAMLSPTFRVREYEVQDAIPASIGCC-------TSEGPISTLSSN  418

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERAK  535
              +F +G P PSVK +T  ++ +F++D  Y D +EL     ++I ++ IGPFQ+   E +K
Sbjct  419   ALFRRGLPFPSVKTITLQKNSSFNLDAYYVDENELPPGTTTRIGSFQIGPFQADT-EASK  477

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             +KVK+RLNLHG++SVESA L                       DD   ++++  D +M+ 
Sbjct  478   VKVKIRLNLHGLISVESAAL----------------------IDDY-ERNATSAD-HMEV  513

Query  716   DKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVE  895
             D    D S N      ++ +Q +               ++P++E +YGA+S  ++ +A E
Sbjct  514   DSSGDDTSRN------ERSIQRQ---------------DLPIAEYIYGAMSKQELLEAQE  552

Query  896   KEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             +E ++A QD++ME TKD+KNA+E+YVYD RNKL ++Y+ F  DSE+E++   LQ+
Sbjct  553   QEQQLAYQDKLMERTKDRKNALESYVYDTRNKLSERYRSFATDSEREEISVNLQQ  607



>ref|XP_006595737.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X2 [Glycine 
max]
Length=773

 Score =   248 bits (634),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 144/355 (41%), Positives = 217/355 (61%), Gaps = 28/355 (8%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE ++  +LE+   P  KA+A+AG+ VE I+S+E++GSGSR+PAI  +LT  F +E  R
Sbjct  302   EFENLASGLLEKFNIPCNKALADAGMTVEKINSVELVGSGSRIPAITNLLTSLFKRELSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKG-PSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+V++++V +S PF I LS  G P  +  +G       
Sbjct  362   TLNASECVARGCALQCAMLSPIFRVKEYEVQDSIPFSIGLSCDGSPICEGSDG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERA  532
              ++FPKG PIPSVK LTF  S    ++  YA+  EL      KIS +TI PF    G +A
Sbjct  415   -VLFPKGQPIPSVKILTFQCSNLLHLEAFYANPDELPPGTSPKISCFTIDPFHGSHGSKA  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KV+V+LNLHGI+S+ESATL+E+   +     +    S  M  + +     SET  N+ 
Sbjct  474   RIKVRVQLNLHGIISIESATLMEDHVDDSVTTGDYHSNSEAMNVEPV-----SETVENVT  528

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             +D +         L  G K              K  ++ +VPVSE +YG ++ A++ +A 
Sbjct  529   EDSINKKCEAPRHLADGTK------------KDKANRRLHVPVSENIYGGMTKAEILEAQ  576

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQ  1057
             EKE ++A QDR +E TKD+KN++E+Y+Y+ R+KL+  Y  F  + E++ +   L+
Sbjct  577   EKELQLADQDRTIELTKDRKNSLESYIYETRSKLFSTYLSFSSEHERKDISRSLK  631



>ref|XP_006449031.1| hypothetical protein CICLE_v10014383mg [Citrus clementina]
 gb|ESR62271.1| hypothetical protein CICLE_v10014383mg [Citrus clementina]
Length=752

 Score =   247 bits (631),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 147/358 (41%), Positives = 221/358 (62%), Gaps = 45/358 (13%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE++S  +LER++ P +KA+A +GL VE IHS+E++GSGSR+PAI ++L   F +EP R
Sbjct  287   EFEKLSSGLLERMRIPCQKALAGSGLNVEKIHSVELVGSGSRIPAISRMLNSLFNREPGR  346

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP + +R+F+V +SFPF I  S  KGP     NG       
Sbjct  347   TINASECVARGCALQCAMLSPQYCIREFEVQDSFPFSIGFSSEKGPICTFSNG-------  399

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPS----KISTYTIGPFQSGKGE  526
              ++ PKG P PSVK LT +RS  F +   YAD +EL  PS    +IS++ IGPFQ+   E
Sbjct  400   -VLLPKGQPFPSVKILTLHRSNGFQLQAFYADQNEL--PSVVSPQISSFMIGPFQTSHAE  456

Query  527   RAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVN  706
              A++KV+V L+L G+V V+SA+L+EE                    DD   ++S +  + 
Sbjct  457   TARVKVRVHLDLDGVVRVQSASLIEEF------------------VDDSVRRESRDAHLT  498

Query  707   MQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             +++     DA  +H   +         D +     K +K+  +PV+E V G  +  ++ +
Sbjct  499   LEE-----DAKSDHTPATA-------IDPEINRKGKVLKRLEIPVNENVNGGTTKTELSE  546

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             AVEKE ++  QD  ME TKD+KNA+E+YVY+MR+K+ + Y+ F  +SE+E +   L++
Sbjct  547   AVEKEHQLVQQDLKMERTKDRKNALESYVYEMRDKISNIYRSFATESEREGISRNLRD  604



>ref|XP_009760615.1| PREDICTED: heat shock 70 kDa protein 16 [Nicotiana sylvestris]
 ref|XP_009760616.1| PREDICTED: heat shock 70 kDa protein 16 [Nicotiana sylvestris]
Length=753

 Score =   247 bits (630),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 206/356 (58%), Gaps = 54/356 (15%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE++S  +LE++  P  KA+ ++GL  + IH++E++GSGSR+PA+ +IL   F KEP R
Sbjct  302   DFEKLSSDLLEKISIPCCKALLDSGLTADRIHTLELVGSGSRIPAVGRILNSLFRKEPGR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIAL-SWKGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VR+++V +SFPF I   S +GP     NG       
Sbjct  362   TINASECVARGCALQCAMLSPIFRVREYEVQDSFPFSIGFASDEGPVCTLSNG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERA  532
              I+FPKG+  PS+K LT  RS +F ++  Y + +EL      KIS  TIGPFQ    E+A
Sbjct  415   -ILFPKGHSFPSMKVLTLQRSSSFYLEAFYTNQNELPPGVSDKISKSTIGPFQVPNSEKA  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             K+KVK++LNLHGIV+VESA L++++             +  ME DD          V  Q
Sbjct  474   KIKVKIQLNLHGIVTVESAWLIKDQTSHSTSENNTDTHAEDMEGDDT----RKSMAVKRQ  529

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             D                                       +PVSE V G ++ A++ +A 
Sbjct  530   D---------------------------------------IPVSESVNGGMTLAELSQAQ  550

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             EKE  +A QD  +E TKDKKN +EAYVY+ RNKL + Y+ F  DSE+E +   LQ+
Sbjct  551   EKECHLAEQDIKVERTKDKKNTLEAYVYETRNKLLNTYRSFATDSEREGISCNLQQ  606



>ref|XP_003553093.1| PREDICTED: heat shock 70 kDa protein 16-like [Glycine max]
Length=766

 Score =   247 bits (631),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 147/356 (41%), Positives = 214/356 (60%), Gaps = 33/356 (9%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  +LERV  P  +A+ +A L  E I S+E++GSGSR+PAI  +LT  F +EP R
Sbjct  302   EFEKLASGLLERVSIPCRRALIDANLTEEKISSVELVGSGSRIPAISTLLTSLFKREPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
              +NASECV++GCALQCA+LSP ++VR+++V +  PF I LS  +GP     NG       
Sbjct  362   QLNASECVARGCALQCAMLSPIYRVREYEVKDVIPFSIGLSSDEGPVAVRSNG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSK--ISTYTIGPFQSGKGERA  532
              ++FP+G P PSVK +TF RS  F ++  YA+  EL   +   IS  TIGPF    G + 
Sbjct  415   -VLFPRGQPFPSVKVITFRRSDLFHLEAFYANPDELPPGTSPIISCVTIGPFHGSHGSKI  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KV+V L+LHGI    S       + +  +  +    S  M+ D I     SET  N  
Sbjct  474   RVKVRVPLDLHGI---VSIESATLIKDDSVMAGDYHSNSDAMDIDPI-----SETVTNGF  525

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             +D        N  LES   P        A+  +K  ++ NVPV+E VYG ++ A++ +A 
Sbjct  526   EDNT------NKNLES---PCS-----SADGTRKDNRRLNVPVNENVYGGMTKAEISEAR  571

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             EKE ++A QDRI+E+TK+KKN++E+YVYDMR+KL+  Y+ F  + EK+ +   LQE
Sbjct  572   EKELQLAHQDRIVEQTKEKKNSLESYVYDMRSKLFHTYRSFASEQEKDDISRTLQE  627



>emb|CAN63915.1| hypothetical protein VITISV_004852 [Vitis vinifera]
Length=810

 Score =   248 bits (632),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 152/400 (38%), Positives = 223/400 (56%), Gaps = 67/400 (17%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE ++  + ER++ P  +A+++A L V+ IH++E++GSGSR+PAI ++L   F +EPRR
Sbjct  270   EFENLASGLFERIRVPCNQALSDARLTVDKIHAVELVGSGSRIPAISRLLASLFRREPRR  329

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQ-------------------------------  268
             T+N SECV++GCALQCA+LSP F+VRD++                               
Sbjct  330   TLNVSECVARGCALQCAMLSPIFRVRDYEASTHNKWWGVEGMLFVIPKKVRLRLERIQRE  389

Query  269   --------------VNESFPFPIALSWKGPSPDAQNGAAENQQSTIVFPKGNPIPSVKAL  406
                           V +S PF I  S       +         ++I+FPKG PIPS K L
Sbjct  390   FLWEDLEERRKIHLVQDSLPFSIGFS-------SDEVPICTMTNSILFPKGQPIPSAKIL  442

Query  407   TFYRSGTFSIDVQYADVSELQA--PSKISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsv  580
             TF RS  F ++  YA+ +EL A  PSKI  +TIGPFQ+  G  AK+KVKV LN HGIV+V
Sbjct  443   TFQRSSLFHLEAFYANPNELPAGMPSKIGCFTIGPFQASHG--AKVKVKVHLNXHGIVTV  500

Query  581   esatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQDDKVTSDASENHVLES  760
             ESA+L+E+ E +          S KME + +    SS    N  +D  ++ +  +    +
Sbjct  501   ESASLIEDHEDDSVTRDHAQLNSDKMEAESVSGSGSSVAVENGVEDGTSTQSKSSQTTSA  560

Query  761   GDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEET  940
             G       T           ++  +PVSE +YG ++ A++ +A EKE ++  QDR +E+T
Sbjct  561   GGVRKHKST-----------RRHEIPVSENIYGGMTEAELSEAQEKEIQLTQQDRTVEQT  609

Query  941   KDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             K+KKNA+E+YVYDMRNKL+  Y+ F  D E+E +   LQ+
Sbjct  610   KEKKNALESYVYDMRNKLFHTYRSFASDQEREGISRSLQQ  649



>ref|XP_010476099.1| PREDICTED: heat shock 70 kDa protein 16 [Camelina sativa]
Length=764

 Score =   247 bits (630),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 141/356 (40%), Positives = 224/356 (63%), Gaps = 43/356 (12%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQ+S  +LER+  P +KA+A++GL++++IHS+E++GSGSR+PAI K+L+  F +E  R
Sbjct  303   EFEQLSAGLLERLIVPCQKALADSGLSLDHIHSVELVGSGSRIPAISKMLSSLFKRELGR  362

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VRD++V +SFPF +  S  KGP     N        
Sbjct  363   TVNASECVARGCALQCAMLSPVFRVRDYEVQDSFPFAVGFSSEKGPINTTSN--------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERA  532
              ++FPKG   PSVK LT +R  TF ++  YA+ +E+    P+ IS++ IGPF    GE A
Sbjct  415   ELLFPKGQVFPSVKVLTLHRENTFHLEAFYANHNEITPDLPTPISSFKIGPFHISHGEAA  474

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KV+V+LNLHGIV+++SA+L+E  +               + ++D+  +++ ++     
Sbjct  475   RVKVRVQLNLHGIVTIDSASLIEHHKE-------------NITSEDVISENNHQSAATKD  521

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             D   T DAS      +G++P  ++             +  +PV   + GAL+  ++ +A 
Sbjct  522   D---TLDASSG---PTGNEPKAIK-------------RMEIPVVANLSGALTKDELSEAK  562

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             ++E  +  QD  ME TKDKKNA+E++VY+MR+K+ + Y+    +SE+E +   LQE
Sbjct  563   QRENSLVEQDLKMESTKDKKNALESFVYEMRDKMLNTYRNTATESERECIARNLQE  618



>ref|XP_009420545.1| PREDICTED: heat shock 70 kDa protein 16 [Musa acuminata subsp. 
malaccensis]
Length=781

 Score =   247 bits (630),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 146/363 (40%), Positives = 222/363 (61%), Gaps = 39/363 (11%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE++ + +L+R+ +P ++A+  A L  + I+++E++GSGSR+PAI +ILTEFF +EP R
Sbjct  303   EFERLCLGLLDRLLEPCKQALENAELNQDRINAVELVGSGSRIPAITRILTEFFRREPSR  362

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NASECV++GCAL CA+LSP F+VRD++V +SFPF +  +          G        
Sbjct  363   TLNASECVARGCALHCAMLSPIFRVRDYEVQDSFPFSVTFA-------TDEGPITTVSRN  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERAK  535
             ++FPK   IPSVK L+FYR+  F ++  YA+ SEL   A  KIS + +GPF   +GER K
Sbjct  416   VLFPKSQLIPSVKMLSFYRTDAFKMEAFYANQSELPPGASQKISCFQVGPFPVHEGERYK  475

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDD--IPPQDSSETDVNM  709
             +KVKVRLNLHG+VSVES                     + +E DD     +D+S  D NM
Sbjct  476   VKVKVRLNLHGMVSVESV--------------------SLIEDDDNSTVSRDASRVD-NM  514

Query  710   QDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVP------VSELVYGALSP  871
             + +   SDA+ +  + + +  +    +  +       K   +P      ++E +YG  + 
Sbjct  515   ETEPA-SDANSDSTVHTAENGIYEHVEHGSIPSSDTSKAERLPRRHELLITETIYGGTTK  573

Query  872   ADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAK  1051
               + +A E+E  +A QD+ ME+TKDKKNA+EAYVY++RNKL+++Y+ F  DSE+E +   
Sbjct  574   EWLLEAQEQEKWLAYQDKQMEQTKDKKNALEAYVYEIRNKLFERYRSFANDSEREGISVS  633

Query  1052  LQE  1060
             LQ+
Sbjct  634   LQQ  636



>ref|XP_007146461.1| hypothetical protein PHAVU_006G042400g [Phaseolus vulgaris]
 gb|ESW18455.1| hypothetical protein PHAVU_006G042400g [Phaseolus vulgaris]
Length=771

 Score =   246 bits (629),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 220/356 (62%), Gaps = 28/356 (8%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  +LERV  P  +A+ +A L  E I S+E++GSGSR+PAI  IL   F +EP R
Sbjct  302   EFEKLASGLLERVSIPCLRALTDANLTAEKISSVELVGSGSRIPAISTILISLFKREPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
              +NASECV++GCALQCA+LSP ++VR+++V +  PF I LS  +GP     NG       
Sbjct  362   QLNASECVARGCALQCAMLSPVYRVREYEVQDVIPFSIGLSSDEGPIAVISNG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPS--KISTYTIGPFQSGKGERA  532
              ++FPKG P PSVK + F RS  F ++  Y +  EL   +  KIS  TIGPF    G ++
Sbjct  415   -VLFPKGQPFPSVKVIAFQRSNLFHLEAFYVNPDELPPGTSPKISCVTIGPFHGSHGSKS  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KV+V L+LHGI+++ESATL++ +  ++ +  +    S +M+ D IP     ET  N  
Sbjct  474   RVKVRVSLDLHGILNIESATLIKNDMDDLVMAGDHNSNSDEMDIDPIP-----ETVTNGF  528

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             +D        N  LES    V            K  ++ +VPV+E +YG ++ A++ +A 
Sbjct  529   EDIT------NKKLESPYSSVD------GIRKDKGTRRVDVPVNENIYGGMTKAEISEAR  576

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             EKE ++A QD I+E+TK+KKN++E+YVYDMR+KL+  Y+ F  + E++ +   LQE
Sbjct  577   EKELQLAQQDIIIEQTKEKKNSLESYVYDMRSKLFHTYRSFASEHERDDISRSLQE  632



>ref|XP_010533816.1| PREDICTED: heat shock 70 kDa protein 16 [Tarenaya hassleriana]
Length=763

 Score =   246 bits (628),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 139/358 (39%), Positives = 217/358 (61%), Gaps = 44/358 (12%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE +S  +LER+  P +KA+A++G++++ IHS+E++GSGSR+PAI ++L+  F +EP R
Sbjct  302   EFESLSSGLLERLIVPCQKALADSGVSLDQIHSVELVGSGSRIPAISRMLSTLFRREPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VR+++V +SFPF +  S  KGP   + NG       
Sbjct  362   TVNASECVARGCALQCAMLSPVFRVREYEVQDSFPFSVGFSSDKGPINMSSNG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPS----KISTYTIGPFQSGKGE  526
              I+FPKG   PSVK L   +  TF ++  Y + +EL  PS    +IS++TIGPFQ    E
Sbjct  415   -ILFPKGQVFPSVKVLALRKDSTFHLEAFYVNHNEL--PSGVQPQISSFTIGPFQIAHRE  471

Query  527   RAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVN  706
              A++KV+++LNLHGI                        +S  +  D    Q+S+ +D  
Sbjct  472   AARVKVRIQLNLHGI---------------------VTIDSASLVEDH---QNSTSSDEI  507

Query  707   MQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQK  886
             M ++  TS A+++   +    P   ++        K  K+  +PV E   GAL+  ++ +
Sbjct  508   MSENNRTSSATKDDNSDPSAGPTGNDS-----TKHKTSKRMEIPVVERASGALTKDELLE  562

Query  887   AVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             A ++E  +  QD  ME TKD+KNA+E+YVY+MR+K+ + Y+ F  ++E+E +   LQE
Sbjct  563   AKQRENSLVQQDLKMELTKDRKNALESYVYEMRDKMLNTYRSFATEAEREGIARNLQE  620



>ref|XP_010458573.1| PREDICTED: heat shock 70 kDa protein 16-like [Camelina sativa]
Length=765

 Score =   246 bits (628),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 140/356 (39%), Positives = 224/356 (63%), Gaps = 42/356 (12%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQ+S  +LER+  P +KA+A++GL++++IHS+E++GSGSR+PAI K+L+  F +E  R
Sbjct  303   EFEQLSAGLLERLIVPCQKALADSGLSLDHIHSVELVGSGSRIPAISKMLSSLFKRELGR  362

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VRD++V +SFPF +  S  KGP     N        
Sbjct  363   TVNASECVARGCALQCAMLSPVFRVRDYEVQDSFPFAVGFSSEKGPINTTSN--------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERA  532
              ++FPKG   PSVK LT +R  TF ++  YA+ +E+    P+ IS++ IGPF    GE A
Sbjct  415   ELLFPKGQVFPSVKVLTLHRENTFRLEAFYANHNEITPDLPTPISSFKIGPFHISHGEAA  474

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KV+V+LNLHG+V+++SA+L+E  +               + ++D+  +++ ++     
Sbjct  475   RVKVRVQLNLHGVVTIDSASLIEHHKE-------------NITSEDVISENNHQSAATKD  521

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             D   T DAS      +G++P  ++             +  +PV   + GAL+  ++ +A 
Sbjct  522   D---TLDASSGPT--TGNEPKAIK-------------RMEIPVVANLSGALTKDELSEAK  563

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             ++E  +  QD  ME TKDKKNA+E++VY+MR+K+ + Y+    +SE+E +   LQE
Sbjct  564   QRENSLVEQDLKMESTKDKKNALESFVYEMRDKMLNTYRNTATESERECIARNLQE  619



>gb|KHN45217.1| Heat shock 70 kDa protein 16 [Glycine soja]
Length=766

 Score =   246 bits (627),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 140/356 (39%), Positives = 212/356 (60%), Gaps = 33/356 (9%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  +LERV  P  +A+ +A L  E I S+E++GSGSR+PAI  +LT  F +EP R
Sbjct  302   EFEKLASGLLERVSIPCRRALIDANLTEEKISSVELVGSGSRIPAISTLLTSLFKREPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
              +NASECV++GCALQCA+LSP + VR+++V +  PF I LS  +GP     NG       
Sbjct  362   QLNASECVARGCALQCAMLSPIYHVREYEVKDVIPFSIGLSSDEGPVAVRSNG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSK--ISTYTIGPFQSGKGERA  532
              ++FP+G P PSVK +TF RS  F ++  YA+  EL   +   IS  TIGPF    G + 
Sbjct  415   -VLFPRGQPFPSVKVITFRRSDLFHLEAFYANPDELPPGTSPIISCVTIGPFHGSHGSKI  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KV+V L+LHGI                        ES  +  DD+       ++ +  
Sbjct  474   RVKVRVPLDLHGI---------------------VSIESATLIKDDLVMAGDYHSNSDAM  512

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             D    S+   N   ++ +K ++    + A+  +K  ++ NVPV+E VYG ++ A++ +A 
Sbjct  513   DIDPISETVTNGFEDNTNKNLESPC-SSADGTRKDNRRLNVPVNENVYGGMTKAEILEAH  571

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             EKE ++A QDRI+E+TK+KKN++E+YVYDMR+KL+  Y+ F  + EK+ +   LQE
Sbjct  572   EKELQLAHQDRIVEQTKEKKNSLESYVYDMRSKLFHTYRSFASEQEKDDISRTLQE  627



>ref|XP_006348107.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Solanum 
tuberosum]
Length=753

 Score =   245 bits (625),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 136/356 (38%), Positives = 205/356 (58%), Gaps = 54/356 (15%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE++S  +LE++  P  KA+ ++GL  E IH++E++GSGSR+PA+ +IL   F KEP R
Sbjct  302   DFEKLSSDLLEKISIPCRKALLDSGLTAERIHTLELVGSGSRIPAMGRILNSVFRKEPGR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIAL-SWKGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VR++++ +SFPF I   S +GP     NG       
Sbjct  362   TVNASECVARGCALQCAMLSPIFRVREYEIQDSFPFSIGFASDEGPVCTLSNG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERA  532
              ++FPKG+  PS+K LT  RS +F ++  Y + +EL      KIS  TIGPFQ    E+A
Sbjct  415   -VLFPKGHSFPSMKVLTLQRSNSFHLEAFYTNQNELPPGVSDKISKSTIGPFQVPHSEKA  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             K+KVK++LNLHG+                      +   +     D     +SE +++  
Sbjct  474   KVKVKIQLNLHGV----------------------VTVESAWLIKDQSSHSTSENNIDTH  511

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
              + +  D +         K V+ +               ++PVSE V G ++  ++ +A 
Sbjct  512   AENMEGDDTRK------SKAVKRQ---------------DIPVSESVDGGMTLMELSQAQ  550

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             EKE ++A QD  +E TKDKKN +EAYVY+ RNKL + Y+ F  DSE+E +   LQ+
Sbjct  551   EKECQLAEQDIKVERTKDKKNTLEAYVYETRNKLLNTYRSFATDSEREGISCNLQQ  606



>gb|EYU27798.1| hypothetical protein MIMGU_mgv1a001740mg [Erythranthe guttata]
Length=722

 Score =   244 bits (623),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 139/359 (39%), Positives = 211/359 (59%), Gaps = 46/359 (13%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  ++ER+  P  +A+ E+GL VE IHS+E++GSGSRVPA+ K+L   F KEP R
Sbjct  302   EFEKLASSLVERISIPCRRALIESGLTVEKIHSVELVGSGSRVPAVTKMLNSVFRKEPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIAL-SWKGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP  +VR+++V + FPF IA  S +GP    ++G       
Sbjct  362   TLNASECVARGCALQCAMLSPIIRVREYEVQDRFPFSIAFASDEGPVCSLKDG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQA--PSKISTYTIGPFQSGKGERA  532
              ++FPK N  P  K +T +RS  F ++  Y +  EL +   ++IS++ IGPF+    ER 
Sbjct  415   -VLFPKNNAFPCTKVITLHRSDIFQMESFYPNHDELPSGVSTRISSFKIGPFRVSHEERT  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             K+KVK++LNLHGI                            +E+  +      ++ VN +
Sbjct  474   KIKVKLQLNLHGIF--------------------------SIESASLVDDQVDDSTVNNR  507

Query  713   DDKVTSDASENHVLESGDK---PVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
              D + S+  E    ES DK   P   E         K +++ ++ + E V+G ++  ++ 
Sbjct  508   ID-IHSENFEPSNHESSDKANGPFGHEM-----RRLKAIRRQDIFIDETVHGGMTQGELS  561

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             +A EKE ++A QD  ME TK+KKN +EAYVY+ RNKL + Y+ F  DSEKE + + LQ+
Sbjct  562   QAQEKELQLAQQDINMERTKEKKNTLEAYVYETRNKLLNSYRSFATDSEKEGICSNLQQ  620



>ref|XP_002889885.1| hypothetical protein ARALYDRAFT_888478 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66144.1| hypothetical protein ARALYDRAFT_888478 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score =   245 bits (626),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 141/359 (39%), Positives = 214/359 (60%), Gaps = 39/359 (11%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE++S  +LER+  P +KA+A++GL++++IHS+E++GSGSR+PAI K+L+  F +E  R
Sbjct  303   EFEKLSAGLLERLIVPCQKALADSGLSLDHIHSVELVGSGSRIPAISKMLSSLFKRELGR  362

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VRD++V +SFPF I  S  KGP     N        
Sbjct  363   TVNASECVARGCALQCAMLSPVFRVRDYEVQDSFPFAIGFSSDKGPINTPSN--------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQ--APSKISTYTIGPFQSGKGERA  532
              ++FPKG   PSVK LT +R  TF ++  YA+ +EL    P++IS++ IGPF    GE A
Sbjct  415   ELLFPKGQIFPSVKVLTLHRENTFHLEAFYANHNELSPDLPTQISSFMIGPFHISHGEAA  474

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KV+V+LNLHGI                 V  +     +K+          SE  +   
Sbjct  475   RVKVRVQLNLHGI-----------------VTIDSATVESKLSL--------SEQLIEYH  509

Query  713   DDKVTSD---ASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
              + +TS+   + ENH   +        +        K +K+  +PV   V GAL+  ++ 
Sbjct  510   KENITSEEMISEENHQSSAMKDGTLDPSSGSTGNEPKAIKRMEIPVVANVSGALTKDELS  569

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             +A ++E  +  QD  ME TKDKKNA+E++VY+MR+K+ + Y+    +SE+E +   LQE
Sbjct  570   EAKQREKSLVEQDLKMESTKDKKNALESFVYEMRDKMLNTYRNTATESERECIARNLQE  628



>gb|EYU27799.1| hypothetical protein MIMGU_mgv1a001740mg [Erythranthe guttata]
Length=766

 Score =   244 bits (624),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 140/359 (39%), Positives = 212/359 (59%), Gaps = 46/359 (13%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  ++ER+  P  +A+ E+GL VE IHS+E++GSGSRVPA+ K+L   F KEP R
Sbjct  302   EFEKLASSLVERISIPCRRALIESGLTVEKIHSVELVGSGSRVPAVTKMLNSVFRKEPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIAL-SWKGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP  +VR+++V + FPF IA  S +GP    ++G       
Sbjct  362   TLNASECVARGCALQCAMLSPIIRVREYEVQDRFPFSIAFASDEGPVCSLKDG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQA--PSKISTYTIGPFQSGKGERA  532
              ++FPK N  P  K +T +RS  F ++  Y +  EL +   ++IS++ IGPF+    ER 
Sbjct  415   -VLFPKNNAFPCTKVITLHRSDIFQMESFYPNHDELPSGVSTRISSFKIGPFRVSHEERT  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             K+KVK++LNLHGI S                          +E+  +      ++ VN +
Sbjct  474   KIKVKLQLNLHGIFS--------------------------IESASLVDDQVDDSTVNNR  507

Query  713   DDKVTSDASENHVLESGDK---PVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
              D + S+  E    ES DK   P   E         K +++ ++ + E V+G ++  ++ 
Sbjct  508   ID-IHSENFEPSNHESSDKANGPFGHEM-----RRLKAIRRQDIFIDETVHGGMTQGELS  561

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             +A EKE ++A QD  ME TK+KKN +EAYVY+ RNKL + Y+ F  DSEKE + + LQ+
Sbjct  562   QAQEKELQLAQQDINMERTKEKKNTLEAYVYETRNKLLNSYRSFATDSEKEGICSNLQQ  620



>ref|XP_008648938.1| PREDICTED: LOW QUALITY PROTEIN: heat shock 70 kDa protein 16-like 
[Zea mays]
Length=838

 Score =   245 bits (626),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 136/355 (38%), Positives = 213/355 (60%), Gaps = 52/355 (15%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE++   +LERV +P ++A+ ++G+ +E +HS+E++GSGSRVPAI K+L  FF +EP R
Sbjct  391   DFEKLCARLLERVVEPCKRAVEDSGIGLERLHSVELVGSGSRVPAITKVLAGFFRREPSR  450

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NASECV++GCALQCA+LSPTF+VR+++V ++ P  I         +  +G      S 
Sbjct  451   TLNASECVARGCALQCAMLSPTFRVREYEVQDAIPASIGF-------NTSDGPVSTLSSD  503

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERAK  535
              +F +G   PSVK +T  ++ +FS D  Y D +EL     + I ++ IGPFQ+   E +K
Sbjct  504   ALFRRGLHFPSVKIITLEKNDSFSFDAYYVDANELPPGTSTDIGSFQIGPFQA-HTEASK  562

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             +KVK+RLNLHG+VSVESA L+ + +           +S+    DD+  +  SE  +  Q+
Sbjct  563   VKVKIRLNLHGLVSVESAVLINDYQRNGSSTDHMEVDSS---GDDMGHKSRSERSIQRQE  619

Query  716   DKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVE  895
                                                    +P++E +YGA+S  ++ +A E
Sbjct  620   ---------------------------------------LPITEYIYGAMSKHELLEAQE  640

Query  896   KEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             +E ++A QD+++E TKD+KNA+E+YVYD RNKL ++Y+ F  DSE+EQ+   LQ+
Sbjct  641   QEQQLAYQDKLVEWTKDRKNALESYVYDTRNKLSERYRSFATDSEREQISVNLQQ  695



>ref|XP_011096072.1| PREDICTED: heat shock 70 kDa protein 16 [Sesamum indicum]
 ref|XP_011096074.1| PREDICTED: heat shock 70 kDa protein 16 [Sesamum indicum]
 ref|XP_011096075.1| PREDICTED: heat shock 70 kDa protein 16 [Sesamum indicum]
Length=756

 Score =   243 bits (621),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 139/357 (39%), Positives = 212/357 (59%), Gaps = 42/357 (12%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  +LER+  P  KA+ ++GL V+ IH++E++GSGSR+PAI KILT  F KEP R
Sbjct  302   EFEKLASALLERISIPCRKALHDSGLTVDKIHTVELVGSGSRIPAITKILTSLFRKEPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIAL-SWKGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VR+++V + FPF I+  S +GP     +G       
Sbjct  362   TLNASECVARGCALQCAMLSPIFRVREYEVQDCFPFSISFASDEGPVCSLTDG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQA--PSKISTYTIGPFQSGKGERA  532
              ++FPKG   PS K LT +R+  F ++  YA+  EL +   ++IS+  IGPF+    E++
Sbjct  415   -VLFPKGTAFPSTKMLTLHRNDIFHMEAFYANQKELPSGVSTRISSSKIGPFRVSHVEKS  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++K+KV+L+LHGI                         S  +  D +      +  V   
Sbjct  474   RIKIKVQLDLHGI---------------------VSIVSASLVDDQV-----DDATVKNN  507

Query  713   DDKVTSDAS-ENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKA  889
              D ++ +    NH  ES  KP    T        K +++ ++ ++E VYG ++  ++ +A
Sbjct  508   GDTLSENVGPGNH--ESFIKP--NGTSGHEIRRLKAIRRQDIFIAEDVYGGMTQGELSQA  563

Query  890   VEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
              EKE ++A QD  +E TK+KKNA+EAYVY+ RNKL   Y+ F  DSEKE + + LQ+
Sbjct  564   QEKELQLAEQDLKVERTKEKKNALEAYVYESRNKLLSTYRSFATDSEKEGISSNLQQ  620



>ref|NP_172631.2| heat shock protein 70 (Hsp 70) family protein [Arabidopsis thaliana]
 sp|Q9SAB1.1|HSP7Q_ARATH RecName: Full=Heat shock 70 kDa protein 16; AltName: Full=Heat 
shock protein 70-16; Short=AtHsp70-16 [Arabidopsis thaliana]
 gb|AAD30257.1|AC007296_18 Strong similarity to gb|Z70314 heat-shock protein from Arabidopsis 
thaliana and is a member of the PF|00012 Hsp70 protein 
family [Arabidopsis thaliana]
 gb|AEE28767.1| heat shock protein 70 (Hsp 70) family protein [Arabidopsis thaliana]
Length=763

 Score =   243 bits (620),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 140/359 (39%), Positives = 211/359 (59%), Gaps = 49/359 (14%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQ+S  +LER+  P +KA+A++GL+++ IHS+E++GSGSR+PAI K+L+  F +E  R
Sbjct  303   EFEQLSAGLLERLIVPCQKALADSGLSLDQIHSVELVGSGSRIPAISKMLSSLFKRELGR  362

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VRD++V +S+PF I  S  KGP     N        
Sbjct  363   TVNASECVARGCALQCAMLSPVFRVRDYEVQDSYPFAIGFSSDKGPINTPSN--------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQ--APSKISTYTIGPFQSGKGERA  532
              ++FPKG   PSVK LT +R  TF ++  YA+ +EL    P++IS++ IGPF    GE A
Sbjct  415   ELLFPKGQIFPSVKVLTLHRENTFQLEAFYANHNELSPDIPTQISSFMIGPFHISHGEAA  474

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KV+V+LNLHGIV++                                    S T +   
Sbjct  475   RVKVRVQLNLHGIVTI-----------------------------------DSATLIEYH  499

Query  713   DDKVTSD---ASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
              + +TS+   + ENH   +        +        K +K+  +PV   V GAL+  ++ 
Sbjct  500   KENITSEEMISEENHQSSAMKDGSLDPSSGSIGNEPKAIKRMEIPVVANVSGALTKDELS  559

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             +A ++E  +  QD  ME TKDKKNA+E++VY+MR+K+ + Y+    +SE+E +   LQE
Sbjct  560   EAKQRENSLVEQDLKMESTKDKKNALESFVYEMRDKMLNTYRNTATESERECIARNLQE  618



>ref|XP_004232717.1| PREDICTED: heat shock 70 kDa protein 16 [Solanum lycopersicum]
Length=753

 Score =   243 bits (620),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 141/356 (40%), Positives = 206/356 (58%), Gaps = 54/356 (15%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE++S  +LE++  P  KA+ ++GL  E IH++E++GSGSR+PA+ +IL   F KEP R
Sbjct  302   DFEKLSSDLLEKISIPCRKALLDSGLTAERIHTLELVGSGSRIPAMGRILNSVFRKEPGR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIAL-SWKGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VR++++ +SFPF I   S +GP     NG       
Sbjct  362   TINASECVARGCALQCAMLSPIFRVREYEIQDSFPFSIGFASDEGPVCTLSNG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERA  532
              ++FPKG+  PS+K LT  RS +F ++  Y + +EL      KIS YT+GPFQ    E+A
Sbjct  415   -VLFPKGHSFPSMKVLTLQRSNSFHLEAFYTNQNELPPGVSDKISKYTLGPFQVPHSEKA  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             K+KVK++LNLHG+V+VESA L++++             +  ME DD     +    V  Q
Sbjct  474   KVKVKIQLNLHGVVTVESAWLIKDQSSHSTSENNIDTYAENMEGDDTRKSKA----VKRQ  529

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             D                                       +PVS  V G ++  ++ +A 
Sbjct  530   D---------------------------------------IPVSGSVDGGMTLMELSQAK  550

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             EKE ++  QD  +E TKDKKN +EAYVY+ RNKL + Y+ F  DSE+E +   LQ+
Sbjct  551   EKERQLTEQDIKVERTKDKKNTLEAYVYETRNKLLNTYRSFATDSEREGISCNLQQ  606



>ref|XP_008644888.1| PREDICTED: heat shock 70 kDa protein 16 isoform X1 [Zea mays]
Length=750

 Score =   242 bits (618),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 135/355 (38%), Positives = 212/355 (60%), Gaps = 52/355 (15%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE++   +LERV +P  +A+ ++ + +E +HS+E++GSGSRVPAI K+L EFF KEP R
Sbjct  303   DFEKLCARLLERVVEPCNRAVTDSRIGLERLHSVELVGSGSRVPAIAKVLKEFFRKEPSR  362

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+N+SECV++GCALQCA+LSPTF+VR+++V+++ P  I            +G      S 
Sbjct  363   TLNSSECVARGCALQCAMLSPTFRVREYEVHDAIPASIGFY-------TSDGPVSTLSSD  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERAK  535
              +F +G P PSVK +T  ++ +FS D  Y D +EL     + I ++ IGPFQ+   E +K
Sbjct  416   ALFRRGLPFPSVKIITLQKNDSFSFDAYYVDANELPPGTSTDIGSFQIGPFQA-HMEASK  474

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             +KVK+RLNLHG+VSVESA L+++ +           +++    DD+  +  SE  +  Q+
Sbjct  475   VKVKIRLNLHGLVSVESAALIDDYQRNATSADHMEVDTS---GDDMGHKSRSERSIQRQE  531

Query  716   DKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVE  895
                                                    +P++E +  A+S  ++ +A E
Sbjct  532   ---------------------------------------LPITEYICCAMSKQELLEAQE  552

Query  896   KEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             +E ++A QD++ME TKD+KNA+E+YVYD RNKL ++Y+ F  DSE+EQ+   LQ+
Sbjct  553   QEHQLAYQDKLMERTKDRKNALESYVYDTRNKLSERYRSFATDSEREQISFNLQQ  607



>ref|XP_006657253.1| PREDICTED: heat shock 70 kDa protein 16-like [Oryza brachyantha]
Length=729

 Score =   242 bits (617),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 128/356 (36%), Positives = 218/356 (61%), Gaps = 52/356 (15%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE++   +LERV +P +KA+ ++ +  + +HS+E++GSGSRVPAI ++L  FF +EP R
Sbjct  285   EFEKLCAGLLERVVEPCKKAMVDSRIEFDRLHSVELVGSGSRVPAIARVLAGFFRREPSR  344

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIAL-SWKGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSPTF+VR+++V ++ P  I   + +GP             S
Sbjct  345   TLNASECVARGCALQCAMLSPTFRVREYEVQDANPASIGFCTIEGP--------ISTLSS  396

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERA  532
               +F +G+P+PSVK  T +++ TF +D  Y D +EL     +++ ++ IGPFQ+   E++
Sbjct  397   KPLFQRGHPLPSVKVATLHKNSTFKLDAFYVDENELPPGTSTEVGSFQIGPFQA-HTEKS  455

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             K+K+++RLNLHG++                                     S E+   + 
Sbjct  456   KVKLRIRLNLHGLI-------------------------------------SVESAALVD  478

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             DD+  ++++++  ++S     +M          K +++ ++P+ E +YGA+S  ++ +A 
Sbjct  479   DDQSNANSADSMEVDSNG---EMGQQGDTSRSGKLIQRQDLPIIESIYGAMSKQELLEAQ  535

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             E+E ++A QD++ME TKD+KNA+E+YVYD RNKL ++Y+ F  DSE+E++   LQ+
Sbjct  536   EQETQLAYQDKLMERTKDRKNALESYVYDTRNKLSERYRSFATDSEREEISFNLQQ  591



>ref|XP_006306833.1| hypothetical protein CARUB_v10008380mg [Capsella rubella]
 gb|EOA39731.1| hypothetical protein CARUB_v10008380mg [Capsella rubella]
Length=737

 Score =   242 bits (617),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 141/356 (40%), Positives = 221/356 (62%), Gaps = 43/356 (12%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQ+S  +LER+  P +KA+A++GL+++ IHS+E++GSGSR+PAI K+L+  F +E  R
Sbjct  303   EFEQLSAGLLERLIVPCQKALADSGLSLDQIHSVELVGSGSRIPAISKMLSSLFKRELGR  362

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VRD++V +SFPF +  S  KGP     N        
Sbjct  363   TVNASECVARGCALQCAMLSPVFRVRDYEVQDSFPFSVGFSSDKGPISTPSN--------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERA  532
              ++FPKG   PSVK LT +R  TF ++  YA+ +E     P+ IS++ IGPF    GE A
Sbjct  415   ELLFPKGQVFPSVKVLTLHRENTFHLEAFYANHNETTPDLPTPISSFMIGPFHISHGEAA  474

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KV+V+LNLHGIV+++SA+L+E  +               + ++++  +++ ++     
Sbjct  475   RVKVRVQLNLHGIVTIDSASLIEYHKE-------------NLTSEEMISENNHQSSATKD  521

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             D   T D S      +G++P  ++             +  VPV   V GAL+  ++ +A 
Sbjct  522   D---TLDPSSG---PTGNEPKAIK-------------RMEVPVVANVSGALTKDELLEAK  562

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             ++E  +  QD  ME TKDKKNA+E++VY+MR+K+ + Y+    +SE+E +   LQE
Sbjct  563   QRENSLVEQDLKMESTKDKKNALESFVYEMRDKMLNTYRNTATESERECIAKNLQE  618



>gb|AET00484.2| heat shock 70 kDa protein [Medicago truncatula]
Length=774

 Score =   242 bits (617),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 147/356 (41%), Positives = 219/356 (62%), Gaps = 28/356 (8%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE ++  +L+R+  P  KA+A+AGL V+ I+S+E++GSGSR+P+I  +LT  F +E  R
Sbjct  302   EFENLASGLLDRICIPCHKALADAGLTVDKIYSVELVGSGSRIPSITGLLTSLFKRELSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F V++++V +S PF I LS  +GP  +  NG       
Sbjct  362   TLNASECVARGCALQCAMLSPVFHVKEYEVQDSIPFSIGLSSDEGPICEETNG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPS--KISTYTIGPFQSGKGERA  532
              ++FPKG PIPS KALT   S    ++  YA+  E+   +  KIS +TIGPFQ     +A
Sbjct  415   -VLFPKGQPIPSSKALTLQGSDLLHLEAFYANPDEVPKGTSPKISCFTIGPFQRSGESKA  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
              ++V++ LNLHGIVS+ES+TL+E+   +    +E    S   E  D+ P   SET+ N  
Sbjct  474   VVEVRIDLNLHGIVSIESSTLIEDRVEDSVTPREYQSNS---EAGDVEP--ISETEQNDN  528

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             +  +       H    G +              K   + ++PVSE VYG ++ A+V +A 
Sbjct  529   EHSINEKCGSPHRSSDGTR------------KDKANIRVHIPVSENVYGGMTKAEVTEAQ  576

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             EKE ++  QD  ME TKDK+N++E+YVYD+RNKL ++Y++F  + EK+ +   L E
Sbjct  577   EKERQLMQQDITMELTKDKRNSLESYVYDVRNKLLNEYRKFASEQEKDGISRSLLE  632



>ref|XP_006306834.1| hypothetical protein CARUB_v10008380mg [Capsella rubella]
 gb|EOA39732.1| hypothetical protein CARUB_v10008380mg [Capsella rubella]
Length=763

 Score =   241 bits (615),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 141/356 (40%), Positives = 221/356 (62%), Gaps = 43/356 (12%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQ+S  +LER+  P +KA+A++GL+++ IHS+E++GSGSR+PAI K+L+  F +E  R
Sbjct  303   EFEQLSAGLLERLIVPCQKALADSGLSLDQIHSVELVGSGSRIPAISKMLSSLFKRELGR  362

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VRD++V +SFPF +  S  KGP     N        
Sbjct  363   TVNASECVARGCALQCAMLSPVFRVRDYEVQDSFPFSVGFSSDKGPISTPSN--------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERA  532
              ++FPKG   PSVK LT +R  TF ++  YA+ +E     P+ IS++ IGPF    GE A
Sbjct  415   ELLFPKGQVFPSVKVLTLHRENTFHLEAFYANHNETTPDLPTPISSFMIGPFHISHGEAA  474

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KV+V+LNLHGIV+++SA+L+E  +               + ++++  +++ ++     
Sbjct  475   RVKVRVQLNLHGIVTIDSASLIEYHKE-------------NLTSEEMISENNHQSSATKD  521

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             D   T D S      +G++P  ++             +  VPV   V GAL+  ++ +A 
Sbjct  522   D---TLDPSSG---PTGNEPKAIK-------------RMEVPVVANVSGALTKDELLEAK  562

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             ++E  +  QD  ME TKDKKNA+E++VY+MR+K+ + Y+    +SE+E +   LQE
Sbjct  563   QRENSLVEQDLKMESTKDKKNALESFVYEMRDKMLNTYRNTATESERECIAKNLQE  618



>ref|XP_007142281.1| hypothetical protein PHAVU_008G267400g [Phaseolus vulgaris]
 gb|ESW14275.1| hypothetical protein PHAVU_008G267400g [Phaseolus vulgaris]
Length=548

 Score =   236 bits (603),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 139/356 (39%), Positives = 209/356 (59%), Gaps = 34/356 (10%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE ++  +LER+  P  KA+A+A L VENI+S+EV+GSGSR+PAI  ILT  F +E  R
Sbjct  85    EFENLASGLLERICVPCNKALADAALTVENINSVEVVGSGSRIPAITGILTSLFKRELSR  144

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKG-PSPDAQNGAAENQQS  358
              +NASECV++GCALQCA+LSP F+V+ ++V +S PF I LS  G P     +G       
Sbjct  145   RLNASECVARGCALQCAMLSPVFRVKKYEVQDSNPFSIGLSSDGKPIRAGLDG-------  197

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERA  532
              ++FPKG  IPS+K LTF  S    ++  YA+  EL      KI  +TIGPF      +A
Sbjct  198   -VLFPKGQSIPSIKFLTFQYSDLLRLEAFYANPDELPPGTSPKICCFTIGPFHGSHASKA  256

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             +++V+V+LN HGI+ +ES  L+E+   +           +  ET +I P   SET  N  
Sbjct  257   RIEVQVQLNFHGIIGIESVVLVEDHVDDSR---------SNSETINIEP--VSETIENAS  305

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
              D +      +H    G +                 ++ +VPVSE +YGA++ A++ +A 
Sbjct  306   KDSINEKCEASHHSADGTR------------KDNANRRLHVPVSENIYGAMTKAEISEAQ  353

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             EKE ++A QD+ +E+ KD+KN +E+Y+Y+ R+KL+  Y  F  + E++ +   L+E
Sbjct  354   EKELKLADQDKTIEQIKDRKNLLESYIYETRSKLFSTYLSFSSEHERKDISRSLKE  409



>dbj|BAD45483.1| putative heat-shock protein [Oryza sativa Japonica Group]
 gb|EAZ38028.1| hypothetical protein OsJ_22372 [Oryza sativa Japonica Group]
Length=753

 Score =   241 bits (614),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 132/355 (37%), Positives = 210/355 (59%), Gaps = 53/355 (15%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE++   +LERV +P +KA+  + +  + +HS+E++GSGSRVPAI +IL  FF +EP R
Sbjct  307   EFEKLCAGLLERVVEPCKKAMEGSRIGFDRLHSVELVGSGSRVPAIARILAGFFRREPSR  366

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NASECV++GCALQCA+LSPTF+VR+++V ++ P  I             G      S 
Sbjct  367   TLNASECVARGCALQCAMLSPTFRVREYEVQDAIPSSIGFC-------TSEGPISTLPSN  419

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERAK  535
              +F +G+P+PSVK +T +++  F +D  Y D +EL     +KI  + IGPFQ+   E++K
Sbjct  420   ALFQRGHPLPSVKVVTLHKNSKFKLDAFYVDENELPPGTSTKIGAFQIGPFQA-HTEKSK  478

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             +KV++RLNLHG+                        ES  +  DD             Q 
Sbjct  479   VKVRIRLNLHGL---------------------VSVESAALIDDD-------------QS  504

Query  716   DKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVE  895
             D  ++D+ E  V  +G+   Q++         +  +   +P+ + +YGA+S  ++ +A E
Sbjct  505   DAHSADSME--VDSNGEMGQQVD-------KSRSERLIQLPIVQSIYGAMSNQELLEAQE  555

Query  896   KEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             +E ++A QD++ME TK++KNA+E+YVYD RNKL ++Y+ F  DSE+E++   LQ+
Sbjct  556   QESQLAYQDKLMERTKERKNALESYVYDTRNKLSERYRSFATDSEREEISLSLQQ  610



>ref|XP_010493114.1| PREDICTED: heat shock 70 kDa protein 16-like [Camelina sativa]
 ref|XP_010493121.1| PREDICTED: heat shock 70 kDa protein 16-like [Camelina sativa]
Length=764

 Score =   239 bits (611),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 139/356 (39%), Positives = 220/356 (62%), Gaps = 43/356 (12%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFEQ+S  +LER+  P +KA+A++GL +++IHS+E++GSGSR+PAI K+L+  F +E  R
Sbjct  303   EFEQLSAGLLERLIVPCQKALADSGLILDHIHSVELVGSGSRIPAISKMLSSLFKRELGR  362

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F+VRD++V + FPF +  S  KGP     N        
Sbjct  363   TVNASECVARGCALQCAMLSPVFRVRDYEVQDFFPFAVGFSSEKGPINTISN--------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERA  532
              ++FPKG   PSVK LT +R  TF ++  YA+  E+    P+ I ++ IGPF    GE A
Sbjct  415   ELLFPKGQVFPSVKVLTLHRENTFHLEAFYANHDEITPDLPTPICSFKIGPFHISYGEAA  474

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KV+V+LNLHGIV+++SA+L+E  +               + ++D+  +++ ++     
Sbjct  475   RVKVRVQLNLHGIVTIDSASLIEHHKE-------------NITSEDVISENNHQSAATKD  521

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
             D   T DAS      +G++P  ++             +  +PV   + GAL+  ++ +A 
Sbjct  522   D---TLDASSG---PTGNEPKAIK-------------RMEIPVIANLSGALTKDELSEAK  562

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             ++E  +  QD  ME TKDKKNA+E++VY+MR+K+ + Y+    +SE+E +   LQE
Sbjct  563   QRENSLVEQDLKMESTKDKKNALESFVYEMRDKMLNTYRNTATESERECIARNLQE  618



>gb|KJB69295.1| hypothetical protein B456_011G014900 [Gossypium raimondii]
 gb|KJB69296.1| hypothetical protein B456_011G014900 [Gossypium raimondii]
 gb|KJB69297.1| hypothetical protein B456_011G014900 [Gossypium raimondii]
 gb|KJB69298.1| hypothetical protein B456_011G014900 [Gossypium raimondii]
Length=774

 Score =   239 bits (611),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 146/366 (40%), Positives = 222/366 (61%), Gaps = 47/366 (13%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE++S  +LER+  P  K +A++GL ++ I+S+E++GSGSR+PAI +IL   F +EP R
Sbjct  302   EFEKLSSDLLERITVPCRKVLADSGLTLDKINSVELVGSGSRIPAITRILASIFNREPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             T+NASECV+ GCALQCA+LSP F+VR+++V +S P  I  S  KGP     NG       
Sbjct  362   TINASECVAHGCALQCAMLSPIFRVREYEVQDSLPLSIGFSSDKGPVCTLSNG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKIS----TYTIGPFQSGKGE  526
              ++FPKG+P PSVK LT +R+  F+++  Y + +EL  PSK+S    T+TIGP Q     
Sbjct  415   -VLFPKGHPFPSVKILTLHRTNMFNMEACYVNSNEL--PSKLSPQINTFTIGPIQCHIN-  470

Query  527   RAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVN  706
              AK+KV+V+LNLHGIV ++SA L+E++      + +    S ++E       D S+   +
Sbjct  471   MAKVKVRVQLNLHGIVKLDSAVLIEDQLDNSVTINDPHLTSEEVE-------DKSDRISS  523

Query  707   MQDDKVTSDASENH--------VLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGA  862
             +++    SD S++         V   G    ++E                +P+SE V   
Sbjct  524   VENIAQVSDNSQSEPPSCPGAGVARRGKAVKRLE----------------IPISESVCDG  567

Query  863   LSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQL  1042
             +   ++ KA EKE  +  QD  ME+TKDKKNA+E+YVY+MR+K+ + Y+ F  +S++E++
Sbjct  568   MKRDEIAKAEEKERWLMQQDLKMEQTKDKKNALESYVYEMRDKILNAYRSFANESDREEI  627

Query  1043  IAKLQE  1060
               KLQE
Sbjct  628   SRKLQE  633



>ref|XP_002305580.2| hypothetical protein POPTR_0004s01640g [Populus trichocarpa]
 gb|EEE86091.2| hypothetical protein POPTR_0004s01640g [Populus trichocarpa]
Length=757

 Score =   239 bits (609),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 142/360 (39%), Positives = 211/360 (59%), Gaps = 52/360 (14%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE++S  ++E +  P  K +A +GL VE IHS+E++GSGSR+PAI ++L   F +EP R
Sbjct  302   EFERLSSGLVESISVPCRKVLANSGLTVEKIHSVELVGSGSRIPAITRMLASLFKREPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
              +NASECV++GCALQCA+LSP F+VR++QV +SFPF I LS  K P     N        
Sbjct  362   RINASECVARGCALQCAMLSPIFRVREYQVQDSFPFSIGLSSDKVPICTLPN--------  413

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERA  532
             + +FPKG   PS+K L  +R+  F ++  YAD +EL     S+IS++ IGPF   + E  
Sbjct  414   STLFPKGQAFPSLKILALHRNNMFQMEAFYADPNELPFGIASQISSFMIGPFPVYQLEMV  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             K+KV+V+LNLHGIV                                     + E  + ++
Sbjct  474   KVKVRVQLNLHGIV-------------------------------------NIEAFMQIE  496

Query  713   DD-KVTSDASENHVLESGDKPVQMETDakaeapkkkv---kkTNVPVSELVYGALSPADV  880
             D  +VT+  SEN V +S   P   +  A+     +K    K+  +PVSE VYG ++ A++
Sbjct  497   DGAEVTNVTSENMVAKSDHSPSVEQNGAEVTNVAQKGKIFKRLEIPVSEEVYGGMTKAEL  556

Query  881   QKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
              +A + E ++A QD  ME  KDKKNA+E+YVY+MR+K++ KYQ F  +SE+ ++   L++
Sbjct  557   SEAEKIELQLAQQDLKMERIKDKKNALESYVYEMRDKIFSKYQSFATESERNEISINLEK  616



>dbj|BAK01312.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=730

 Score =   238 bits (607),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 131/355 (37%), Positives = 216/355 (61%), Gaps = 53/355 (15%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE++   +LERV +P ++A+A+AG+ ++ + S+E++GSGSRVPAI ++L  FF +EP R
Sbjct  295   DFEKLCAELLERVVEPCKRAMADAGIGLDKLQSVELVGSGSRVPAIARVLAGFFRREPSR  354

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+N SECV++GCALQCA+LSPTF+VR+++V +  P  I             G      S 
Sbjct  355   TINVSECVARGCALQCAMLSPTFRVREYEVQDVIPASIGFC-------TNEGPISTLSSN  407

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERAK  535
              +F +G P+PSVK +T +++  F++D  Y D +EL     ++I ++ IGPFQ+   E++K
Sbjct  408   ALFRRGQPLPSVKIITLHKNSGFTLDAFYVDENELPPGTSTQIGSFEIGPFQA-HSEKSK  466

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             +KVK+RLNLHG++SVESA L+++                  +  D+   DS E D N   
Sbjct  467   VKVKIRLNLHGLISVESAVLIDD------------------DQRDVNSADSMELDSNDDM  508

Query  716   DKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVE  895
             D  + +          ++P+  +               ++ + E +YG +S  ++ +A E
Sbjct  509   DHKSKN----------ERPMHRQ---------------DLQIVESIYGVMSKQELLEAQE  543

Query  896   KEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             +E ++A QD+++E TK++KNA+E+YVYD RNKL ++Y+ F  DSE+E++   LQ+
Sbjct  544   QEQQLAYQDKLVERTKERKNALESYVYDTRNKLSERYRSFATDSEREEISVNLQQ  598



>ref|XP_002969191.1| hypothetical protein SELMODRAFT_440676 [Selaginella moellendorffii]
 gb|EFJ30307.1| hypothetical protein SELMODRAFT_440676 [Selaginella moellendorffii]
Length=743

 Score =   238 bits (606),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 137/366 (37%), Positives = 209/366 (57%), Gaps = 68/366 (19%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE++  P+L+R++   E+A+ ++ LAV++I ++EVIGSGSRVPAI ++L   F +EP R
Sbjct  304   EFEKLCAPLLQRIRHACERALTDSELAVDDISAVEVIGSGSRVPAIARVLAAAFRREPSR  363

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPS--------PDAQNG  337
             T+NASE +++GCALQ A+ SPTF+V+  +V++ F FP+A SW GP+        P   + 
Sbjct  364   TLNASESIARGCALQGAMFSPTFRVKKLEVHDYFLFPVAFSWAGPAAFEYGLDDPTTPSA  423

Query  338   AAENQ--QSTIVFPKGNPIPSVKALTFYRSG-TFSIDVQYADVSELQAPSK--ISTYTIG  502
             +   Q   ++IVF +G   P+ K LTF+ +   F I V Y D++EL A +    +T+T+G
Sbjct  424   SIVPQILPNSIVFRRGVSFPTSKQLTFWVTNPIFEIRVLYGDLTELSASASNPFATFTVG  483

Query  503   PFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQ  682
             P    K E ++L++ + LN HGI                      L  +T ME ++    
Sbjct  484   PLSCRKPESSRLRLSIHLNQHGI--------------------LMLSSATLMEDEE----  519

Query  683   DSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGA  862
                                    LESG +  Q        +  ++++ T+VP+ E+    
Sbjct  520   -----------------------LESGMQQGQ--------SRMRRLRHTDVPIVEMTTKE  548

Query  863   LSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQL  1042
             LS  ++Q A+EKEFEM  QDR+ EETK+ KNA+EA VYDMRNK Y K QE+  ++EK+ L
Sbjct  549   LSSLELQNAIEKEFEMEFQDRVSEETKEAKNALEALVYDMRNKFYGKLQEYASETEKKDL  608

Query  1043  IAKLQE  1060
             + KLQ+
Sbjct  609   LKKLQD  614



>ref|XP_007142282.1| hypothetical protein PHAVU_008G267400g [Phaseolus vulgaris]
 gb|ESW14276.1| hypothetical protein PHAVU_008G267400g [Phaseolus vulgaris]
Length=765

 Score =   237 bits (604),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 138/356 (39%), Positives = 203/356 (57%), Gaps = 34/356 (10%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE ++  +LER+  P  KA+A+A L VENI+S+EV+GSGSR+PAI  ILT  F +E  R
Sbjct  302   EFENLASGLLERICVPCNKALADAALTVENINSVEVVGSGSRIPAITGILTSLFKRELSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKG-PSPDAQNGAAENQQS  358
              +NASECV++GCALQCA+LSP F+V+ ++V +S PF I LS  G P     +G       
Sbjct  362   RLNASECVARGCALQCAMLSPVFRVKKYEVQDSNPFSIGLSSDGKPIRAGLDG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERA  532
              ++FPKG  IPS+K LTF  S    ++  YA+  EL      KI  +TIGPF      +A
Sbjct  415   -VLFPKGQSIPSIKFLTFQYSDLLRLEAFYANPDELPPGTSPKICCFTIGPFHGSHASKA  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             +++V+V+LN HGI            E  V V        +  ET +I P   SET  N  
Sbjct  474   RIEVQVQLNFHGI---------IGIESVVLVEDHVDDSRSNSETINIEP--VSETIENAS  522

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
              D +      +H    G +                 ++ +VPVSE +YGA++ A++ +A 
Sbjct  523   KDSINEKCEASHHSADGTR------------KDNANRRLHVPVSENIYGAMTKAEISEAQ  570

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             EKE ++A QD+ +E+ KD+KN +E+Y+Y+ R+KL+  Y  F  + E++ +   L+E
Sbjct  571   EKELKLADQDKTIEQIKDRKNLLESYIYETRSKLFSTYLSFSSEHERKDISRSLKE  626



>ref|XP_003617525.1| 97 kDa heat shock protein [Medicago truncatula]
Length=789

 Score =   237 bits (604),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 145/368 (39%), Positives = 215/368 (58%), Gaps = 37/368 (10%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE ++  +L+R+  P  KA+A+AGL V+ I+S+E++GSGSR+P+I  +LT  F +E  R
Sbjct  302   EFENLASGLLDRICIPCHKALADAGLTVDKIYSVELVGSGSRIPSITGLLTSLFKRELSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
             T+NASECV++GCALQCA+LSP F V++++V +S PF I LS  +GP  +  NG       
Sbjct  362   TLNASECVARGCALQCAMLSPVFHVKEYEVQDSIPFSIGLSSDEGPICEETNG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPS--KISTYTIGPFQSGKGERA  532
              ++FPKG PIPS KALT   S    ++  YA+  E+   +  KIS +TIGPFQ     +A
Sbjct  415   -VLFPKGQPIPSSKALTLQGSDLLHLEAFYANPDEVPKGTSPKISCFTIGPFQRSGESKA  473

Query  533   KLKVKVRLNLHGIvsvesat------------lleeeevevpvvkeqlkeSTKMETDDIP  676
              ++V++ LNLHGIVS+ES+T                 E  V       +  +  E  D+ 
Sbjct  474   VVEVRIDLNLHGIVSIESSTVSKKPNFNLFNVTSSLIEDRVEDSVTPREYQSNSEAGDVE  533

Query  677   PQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVY  856
             P   SET+ N  +  +       H    G +              K   + ++PVSE VY
Sbjct  534   P--ISETEQNDNEHSINEKCGSPHRSSDGTR------------KDKANIRVHIPVSENVY  579

Query  857   GALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKE  1036
             G ++ A+V +A EKE ++  QD  ME TKDK+N++E+YVYD+RNKL ++Y++F  + EK+
Sbjct  580   GGMTKAEVTEAQEKERQLMQQDITMELTKDKRNSLESYVYDVRNKLLNEYRKFASEQEKD  639

Query  1037  QLIAKLQE  1060
              +   L E
Sbjct  640   GISRSLLE  647



>ref|XP_011037663.1| PREDICTED: heat shock 70 kDa protein 16 [Populus euphratica]
Length=769

 Score =   236 bits (602),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 140/373 (38%), Positives = 210/373 (56%), Gaps = 66/373 (18%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE++S  ++E +  P +K +A +GL VENIHS+E++GSGSR+PAI ++L   F +EP R
Sbjct  302   EFERLSSGLVESISVPCQKVLANSGLTVENIHSVELVGSGSRIPAITRMLASLFKREPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
              +NASECV++GCAL CA+LSP  +VR++QV +SFPF I LS  K P     N        
Sbjct  362   RINASECVARGCALHCAMLSPILRVREYQVQDSFPFSIGLSSDKVPICTLPN--------  413

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERA  532
             + +FPKG   PS+K L  +R+  F ++  YAD +EL     S+IS++ IGPF   + E  
Sbjct  414   STLFPKGQAFPSLKILALHRNNMFQMEAFYADPNELPFGMASQISSFMIGPFPVYQLEMV  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             K+KV+V+LNLHGIV                                     + E  + ++
Sbjct  474   KVKVRVQLNLHGIV-------------------------------------NIEAFMQIE  496

Query  713   DD-KVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNV----------------PV  841
             D  +VT+  SEN V +S   P  +E +            +++                PV
Sbjct  497   DGAEVTNVTSENMVAKSDHSP-SVEQNGAEVTNVALSAPSSIPADEIRKGKFFKRLEIPV  555

Query  842   SELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVV  1021
             SE VYG ++ A++ +A + E ++A QD  ME  KDKKNA+E+YVY+MR+K++ KYQ F  
Sbjct  556   SEEVYGGMTKAELSEAEKIELQLAHQDLKMERIKDKKNALESYVYEMRDKIFSKYQSFAT  615

Query  1022  DSEKEQLIAKLQE  1060
             +SE++++   LQ+
Sbjct  616   ESERDEISINLQK  628



>ref|XP_002973871.1| hypothetical protein SELMODRAFT_267697 [Selaginella moellendorffii]
 gb|EFJ24826.1| hypothetical protein SELMODRAFT_267697 [Selaginella moellendorffii]
Length=751

 Score =   234 bits (596),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 137/369 (37%), Positives = 210/369 (57%), Gaps = 66/369 (18%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE++  P+L+R++   E+A+ ++ LAV++I ++EVIGSGSRVPAI ++L   F +EP R
Sbjct  304   EFEKLCAPLLQRIRHACERALTDSELAVDDISAVEVIGSGSRVPAIARVLAAAFRREPSR  363

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPS--------PDAQNG  337
             T+NASE +++GCALQ A+ SPTF+V+  +V++ F FP+A SW GP+        P   + 
Sbjct  364   TLNASESIARGCALQGAMFSPTFRVKKLEVHDYFLFPVAFSWAGPAAFEYGLDDPTTPSA  423

Query  338   AAENQ--QSTIVFPKGNPIPSVKALTFYRSG-TFSIDVQYADVSELQAPSK--ISTYTIG  502
             +   Q   ++IVF +G    + K LTF+ +   F I   Y D++EL A +    +T+T+G
Sbjct  424   SIVPQILPNSIVFRRGVSFSTSKQLTFWVTNPIFEIRALYGDLTELSASASNPFATFTVG  483

Query  503   PFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQ  682
             P    K E ++L++ + LN HGI                      L  +T ME ++    
Sbjct  484   PLSCRKPESSRLRLSIHLNQHGI--------------------LMLSSATLMEDEE----  519

Query  683   DSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDaka---eapkkkvkkTNVPVSELV  853
                                    LESG   +Q ET       ++  ++++ T+VP+ E+ 
Sbjct  520   -----------------------LESG---MQQETSLCRFQGQSRMRRLRHTDVPIVEMT  553

Query  854   YGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEK  1033
                LS  ++Q A+EKEFEM  QDR+ EETK+ KNA+EA VYDMRNK Y K QE+  ++EK
Sbjct  554   TKELSSLELQNAIEKEFEMEFQDRVSEETKEAKNALEALVYDMRNKFYGKLQEYASETEK  613

Query  1034  EQLIAKLQE  1060
             + L+ KLQ+
Sbjct  614   KDLLKKLQD  622



>ref|XP_004500055.1| PREDICTED: heat shock 70 kDa protein 16-like [Cicer arietinum]
Length=770

 Score =   231 bits (590),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 130/356 (37%), Positives = 205/356 (58%), Gaps = 31/356 (9%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  +LER+  P  KA+ +AGL  + I S+E++GSGSR+PAI  +L+  F +EP R
Sbjct  302   EFEKLASGLLERISIPCTKALYDAGLTADKISSVELVGSGSRIPAISTLLSSLFAREPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIA-LSWKGPSPDAQNGAAENQQS  358
              +NASECV++GCALQCA+LSPT++VRD++V +  PF    LS +GP     +G       
Sbjct  362   KLNASECVARGCALQCAMLSPTYRVRDYEVQDIIPFSYGLLSDEGPICAGSDG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPS--KISTYTIGPFQSGKGERA  532
              ++FPKG  IPS   L   R+  F ++  YA+  EL   +  KIS +TIGP     G + 
Sbjct  415   -VIFPKGQFIPSTTVLQLRRTNLFHLEAVYANSDELPPGTFPKISCFTIGPLLGSHGSKT  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KV++ LNLHGI             +E   + +   + ++ +  DI P   +  + N  
Sbjct  474   RVKVRLHLNLHGI-----------FSIESATLIKDHADDSEFDAMDIDPVSETSDNTNFV  522

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
              +    D++  H     D P    + A      K  ++  + V+E +YG +  A++ +A 
Sbjct  523   ANGA-EDSTNKH-----DSP---RSSADNSRKDKANRRIPIQVNENIYGGMKTAEISEAH  573

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             +KE ++A QDR +E TK+KKN +E+YVYD R+KL++ Y+ F  D E++ +   LQE
Sbjct  574   KKELQLAQQDRTVELTKEKKNTLESYVYDTRSKLFNTYRSFASDQERDGISRSLQE  629



>gb|AII99893.1| heat shock protein [Cicer arietinum]
Length=771

 Score =   231 bits (588),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 130/356 (37%), Positives = 205/356 (58%), Gaps = 31/356 (9%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE+++  +LER+  P  KA+ +AGL  + I S+E++GSGSR+PAI  +L+  F +EP R
Sbjct  302   EFEKLASGLLERISIPCTKALYDAGLTADKISSVELVGSGSRIPAISTLLSSLFAREPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIA-LSWKGPSPDAQNGAAENQQS  358
              +NASECV++GCALQCA+LSPT++VRD++V +  PF    LS +GP     +G       
Sbjct  362   KLNASECVARGCALQCAMLSPTYRVRDYEVQDIIPFSYGLLSDEGPICAGSDG-------  414

Query  359   TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPS--KISTYTIGPFQSGKGERA  532
              ++FPKG  IPS   L   R+  F ++  YA+  EL   +  KIS +TIGP     G + 
Sbjct  415   -VIFPKGQFIPSTTVLQLRRTNLFHLEAVYANSDELPPGTFPKISCFTIGPLLGSHGSKT  473

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             ++KV++ LNLHGI             +E   + +   + ++ +  DI P   +  + N  
Sbjct  474   RVKVRLHLNLHGI-----------FSIESATLIKDHADDSEFDAMDIDPVSETSDNTNFV  522

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
              +    D++  H     D P    + A      K  ++  + V+E +YG +  A++ +A 
Sbjct  523   ANGA-EDSTNKH-----DSP---RSSADNSRKDKANRRIPIQVNENIYGGMKTAEISEAH  573

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             +KE ++A QDR +E TK+KKN +E+YVYD R+KL++ Y+ F  D E++ +   LQE
Sbjct  574   KKELQLAQQDRTVELTKEKKNTLESYVYDTRSKLFNTYRSFASDQERDGISRSLQE  629



>ref|XP_009610837.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X2 [Nicotiana 
tomentosiformis]
Length=780

 Score =   229 bits (585),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 173/200 (87%), Gaps = 6/200 (3%)
 Frame = +2

Query  479   KISTYTIGPFQSGKGERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKM  658
             K+  + IGPFQS KGERAKLKVKVRLNLHGIVSV+SATLLEEEEVEVPVVKE +KE  +M
Sbjct  385   KVREFQIGPFQSAKGERAKLKVKVRLNLHGIVSVDSATLLEEEEVEVPVVKEAVKEPAEM  444

Query  659   ETD----DIPPQDSSETDVNMQDDKVTSDAS--ENHVLESGDKPVQMETDakaeapkkkv  820
             ETD    D  P  +SE+DVNMQD K   DAS  EN V ESGDKPV+METDAK EAPKKKV
Sbjct  445   ETDEASGDAAPSTTSESDVNMQDAKGAGDASVAENDVPESGDKPVKMETDAKVEAPKKKV  504

Query  821   kkTNVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYD  1000
             KKT+VPV+E+VYGA++ ADVQKAVEKEFEMALQDR+MEETKDKKNAVEAYVYDMRNKL D
Sbjct  505   KKTSVPVTEIVYGAMAAADVQKAVEKEFEMALQDRVMEETKDKKNAVEAYVYDMRNKLSD  564

Query  1001  KYQEFVVDSEKEQLIAKLQE  1060
             KYQEFV+DSE+EQ +AKLQE
Sbjct  565   KYQEFVIDSEREQFMAKLQE  584


 Score =   170 bits (430),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 87/96 (91%), Gaps = 3/96 (3%)
 Frame = +2

Query  2    EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
            EFEQISIPILERVKKPLE A+AEAG   ENIH++EV+GS SRVPAI++ILTEFFGKEPRR
Sbjct  302  EFEQISIPILERVKKPLENALAEAGFTTENIHAVEVVGSSSRVPAIMRILTEFFGKEPRR  361

Query  182  TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPF  289
            TMNASECV+KGCALQCAILSPTFKVR+FQ+    PF
Sbjct  362  TMNASECVAKGCALQCAILSPTFKVREFQIG---PF  394



>ref|XP_010665569.1| PREDICTED: heat shock 70 kDa protein 16 [Beta vulgaris subsp. 
vulgaris]
Length=767

 Score =   227 bits (578),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 134/357 (38%), Positives = 199/357 (56%), Gaps = 32/357 (9%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE++S  +L+ + +P  KA+  AG++ E I S+E++GSGSR+PAI ++L   F KEP R
Sbjct  302   EFEKLSERLLDGIAEPCRKALINAGVSPEKIQSVELVGSGSRIPAISRVLASVFRKEPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIA--LSWKGPSPDAQNGAAENQQ  355
              +NASECV++GCALQCA+ SP F+V+D++V +S PF I   LS  GP     NG      
Sbjct  362   KLNASECVARGCALQCAMFSPNFRVKDYEVEDSLPFSIGFHLSEDGPIHALPNG------  415

Query  356   STIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGER  529
               ++FP+G+PIPS K +   +S  F I+  Y D SEL      KIS ++IGPF +   E 
Sbjct  416   --VLFPRGHPIPSDKVIKLRKSSNFKIEAFYVDESELPPGVSPKISNFSIGPFPATHTEN  473

Query  530   AKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNM  709
             A +K K  L +HG                       L  ++ +   D  P   S  D++ 
Sbjct  474   AYVKAKALLTVHG--------------------TVTLVSASLVGGYDDDPVIRSNRDMSA  513

Query  710   QDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKA  889
             +  +  SD +EN   +    P             K + +++V + E VYG LS  ++ KA
Sbjct  514   EKMEDESDYAENGAEDRYSAPKPGPASYSHNRKGKAMTRSSVMIDETVYGRLSGTELSKA  573

Query  890   VEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
              EKE E++ QD  +E+ K+KKN +E+YVY+ RNK+   Y++F  DSEKE +   LQ+
Sbjct  574   REKEAELSEQDYKVEQAKEKKNTLESYVYETRNKILSTYKDFTADSEKEGICENLQQ  630



>ref|XP_002949519.1| heat shock protein Hsp70E [Volvox carteri f. nagariensis]
 gb|EFJ49538.1| heat shock protein Hsp70E [Volvox carteri f. nagariensis]
Length=809

 Score =   223 bits (568),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 140/357 (39%), Positives = 202/357 (57%), Gaps = 42/357 (12%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
              FEQ++ PIL R++ P+E A+ E+ L+VE+I S+EV+GS +R+PA+ +I+ E F K P R
Sbjct  305   HFEQLAEPILARLRAPMEDALRESKLSVEDISSVEVVGSCTRMPAVCRIVEEVFKKAPSR  364

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             TMN+ ECVS+G ALQCA+LSP FKVR+F+V ++ P P+ +SW+G     ++GAA  Q   
Sbjct  365   TMNSKECVSRGAALQCAMLSPVFKVREFEVVDAAPLPVCMSWEG-----KDGAAVTQ---  416

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVS--ELQAPS---KISTYTIGPFQSGKG-  523
             ++F +G   PS K ++F RS  F++   YA  +  EL  P+    +  YTIGPFQ   G 
Sbjct  417   VLFARGEAFPSSKMISFNRSQPFTVRAHYALDTPPELLPPAFDKNLGVYTIGPFQVPAGA  476

Query  524   ERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDV  703
             E AKLKVKV LNLHG++ V+    +EE E E P          KM+        SS    
Sbjct  477   ETAKLKVKVELNLHGLIQVQQVQSIEETEEEAPAPASTPTADVKMDEAAAAAAASS----  532

Query  704   NMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
                 +   S  +    ++  D P Q  +                     V G  S + + 
Sbjct  533   --NGNPAASAPARKKKVKKTDVPFQASS---------------------VCG-YSKSQLD  568

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKL  1054
                EKE +M   DR+ EET ++KNA+E YVYD+RNKLYD Y  ++ +++KE L  +L
Sbjct  569   DYFEKEHQMQAADRLQEETNERKNALEGYVYDLRNKLYDAYAPYIKEADKEVLQGQL  625



>ref|XP_008644889.1| PREDICTED: heat shock 70 kDa protein 16 isoform X2 [Zea mays]
Length=727

 Score =   222 bits (565),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 133/356 (37%), Positives = 206/356 (58%), Gaps = 59/356 (17%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE++   +LERV +P  +A+ ++ + +E +HS+E++GSGSRVPAI K+L EFF KEP R
Sbjct  303   DFEKLCARLLERVVEPCNRAVTDSRIGLERLHSVELVGSGSRVPAIAKVLKEFFRKEPSR  362

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+N+SECV++GCALQCA+LSPTF+VR+++V+++ P  I            +G      S 
Sbjct  363   TLNSSECVARGCALQCAMLSPTFRVREYEVHDAIPASIGFY-------TSDGPVSTLSSD  415

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERAK  535
              +F +G P PSVK +T  ++ +FS D  Y D +EL     + I ++ IGPFQ+   E +K
Sbjct  416   ALFRRGLPFPSVKIITLQKNDSFSFDAYYVDANELPPGTSTDIGSFQIGPFQA-HMEASK  474

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             +KVK+RLNLHG+VSVESA L+++ +           +++    DD+  +  SE  +  Q+
Sbjct  475   VKVKIRLNLHGLVSVESAALIDDYQRNATSADHMEVDTS---GDDMGHKSRSERSIQRQE  531

Query  716   DKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVE  895
                                                    +P++E +  A+S  ++ +A E
Sbjct  532   ---------------------------------------LPITEYICCAMSKQELLEAQE  552

Query  896   KEFEMALQDRIMEETKDKKNAVEAYVYDMRNK----LY---DKYQEFVVDSEKEQL  1042
             +E ++A QD++ME TKD+KNA+E+YVYD RNK    LY   D   E V  S+ E+L
Sbjct  553   QEHQLAYQDKLMERTKDRKNALESYVYDTRNKTEDWLYEEGDDETEVVYSSKLEEL  608



>emb|CEF99759.1| Heat shock protein 70 family [Ostreococcus tauri]
Length=801

 Score =   221 bits (564),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 137/356 (38%), Positives = 216/356 (61%), Gaps = 36/356 (10%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             + E+++   + R+  P+E A+ EAGL V +I ++E++G+ SR+P I+  + E FGK P R
Sbjct  302   KMEELAADTISRLVTPVETAVKEAGLTVGDIAAVELVGNASRMPCILGRMQELFGKMPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NASECV++GCALQ A+LSP F+VR+F+V +SFPFPI ++W      + +G+ +N +  
Sbjct  362   TLNASECVARGCALQGAMLSPLFRVREFEVQDSFPFPINVTWA-----SDDGSDKNME--  414

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQA---PSKISTYTIGPF-QSGKGER  529
              +F + N +PS K +TF+++  F+I   Y D   L +    +K+  + IGP  +  KGE+
Sbjct  415   -LFERNNLVPSTKLMTFFKNDKFTIQANYTDEQGLLSQGTDTKVGAFQIGPLPKIAKGEK  473

Query  530   AKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNM  709
              KLKVKVRLN++ +                        ES ++  +     ++S T+  M
Sbjct  474   HKLKVKVRLNMNSL---------------------VSVESAQVVEEIEEEVEASATEEEM  512

Query  710   QDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKA  889
             +D    +D ++   +E+  K      + +  APKKKVKKT+VPV+  V G L    ++K 
Sbjct  513   KDAPAPADGADG--METDAKEESKSEEKEKPAPKKKVKKTDVPVTSEV-GGLPQKVLEKF  569

Query  890   VEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQ  1057
              ++EF+MALQD+I+EETK++KNAVE YVY MRNKL ++  E+V D+ +E   A L 
Sbjct  570   TQEEFDMALQDKIIEETKERKNAVEEYVYSMRNKLSEQLAEYVDDATRESFSALLN  625



>gb|ERN19664.1| hypothetical protein AMTR_s00062p00170870 [Amborella trichopoda]
Length=568

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 142/192 (74%), Gaps = 10/192 (5%)
 Frame = +2

Query  2    EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
            EFE++S  ++ERV+ P EKA+ +AGL +E +HS+E++GSGSR+PAI ++L  FF +EP R
Sbjct  302  EFEKLSAGLIERVQVPCEKALNDAGLGLERVHSVELVGSGSRIPAIARMLASFFKREPSR  361

Query  182  TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
            T+NASECV++GCALQCA+LSP ++VRD++V + FPF IA S       +  G      S 
Sbjct  362  TLNASECVARGCALQCAMLSPIYRVRDYEVQDIFPFSIAFS-------SDEGPVSTPSSN  414

Query  362  IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERAK  535
            I+FPKG PIPSVK LTF+RSGTF ++  YA+ S L      KIS++ IGPFQ+   +++K
Sbjct  415  ILFPKGQPIPSVKMLTFHRSGTFCLEAFYANQSGLPPGTCQKISSFMIGPFQA-SSDKSK  473

Query  536  LKVKVRLNLHGI  571
            +KV++RLNLHGI
Sbjct  474  VKVRLRLNLHGI  485



>gb|EPS74057.1| hypothetical protein M569_00693, partial [Genlisea aurea]
Length=738

 Score =   219 bits (558),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 130/355 (37%), Positives = 208/355 (59%), Gaps = 33/355 (9%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE ++  ++E++     +A+ E+GL  E IH +E++GSGSRVPAI  +L   FGKEP R
Sbjct  302   EFENLASGLVEKIDFACRRALDESGLTFERIHGVELVGSGSRVPAITNMLHSLFGKEPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NASECV++GCA+QCA+LSPT++++++++ + FPF  ++S    S D  +  +   ++ 
Sbjct  362   TLNASECVARGCAVQCAMLSPTYRLKEYEIEDRFPFSFSVSL--SSDDEVSVCSVGDRA-  418

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSE--LQAPSKISTYTIGPFQSGKGERAK  535
               FPKG   P  K L   R+  FS+++ Y++ +E  L   ++IS++ IGPF+    E+A 
Sbjct  419   -FFPKGTTFPRSKVLKLQRNDVFSMEIFYSNQNELPLGVSTRISSFKIGPFRVSSDEKAN  477

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQD  715
             +K+KV+LNL+GI               V +V + L +S K  T +  P++ S++      
Sbjct  478   IKIKVQLNLNGI----------VAVNAVSLVDDHLDDSLKSSTTETLPENLSQS------  521

Query  716   DKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAVE  895
                      NH  +S  K              K V++ +V ++E  Y  ++  ++ +A  
Sbjct  522   ---------NH--DSFGKACVPSLMGHGMRRLKAVRRQDVFINETTYCGMTKEELSQARS  570

Query  896   KEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             KE ++A QD+ ME TK+KKNA+EAYVY+ RNKL D Y+ F   SEKE +  KLQ+
Sbjct  571   KEHDLAQQDKNMERTKEKKNALEAYVYETRNKLMDTYRGFASASEKEGISDKLQQ  625



>ref|XP_003600064.1| Heat shock 70 kDa protein 4L [Medicago truncatula]
 gb|AES70315.1| heat shock 70 kDa protein [Medicago truncatula]
Length=774

 Score =   219 bits (557),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 133/356 (37%), Positives = 209/356 (59%), Gaps = 35/356 (10%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             EFE ++  +LER+  P ++A+ EAGL  E I S+E++GSGSR+PA+  +L+  F +EP R
Sbjct  302   EFENLASGLLERISTPCKEALIEAGLDAEKISSVELVGSGSRIPAVSTLLSSLFKREPSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
              +NASECV++GCALQCA+LSPT++VR+++V +  PF   L       D   G        
Sbjct  362   KLNASECVARGCALQCAMLSPTYRVREYEVQDISPFSYGL-----ESDKVRG--------  408

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERAK  535
             ++FPKG+ +PS   + F ++ +  ++  YA+  EL      KIS++TIGP    +G +AK
Sbjct  409   VLFPKGHLLPSTVVIKFQQTDSIHLEAFYANEHELPPGTSPKISSFTIGPLPGSQGSKAK  468

Query  536   LKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQ-DSSETDVNMQ  712
             +KV+ +LNLHGI S++SATL                   K  TDD     D+ + D   +
Sbjct  469   VKVRAQLNLHGIFSIDSATL------------------IKDHTDDHHSNFDAMDVDPKSE  510

Query  713   DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKAV  892
                 TS  + N   ES +K    ++ A      K  ++  + V+E +YG ++  ++ +A 
Sbjct  511   TSDSTSSVA-NGAEESTNKRDSPQSYADCLRKDKANRRIPIAVNENIYGGMTMKEISEAH  569

Query  893   EKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
             EKE ++A QDR +E TK+KKN +E+YVY+ R+KL++ Y+ F  D E++ +   LQE
Sbjct  570   EKELQLAQQDRAVELTKEKKNTLESYVYETRSKLFNTYRSFASDQERDVISRSLQE  625



>ref|XP_002505210.1| heat shock protein 70 [Micromonas sp. RCC299]
 gb|ACO66468.1| heat shock protein 70 [Micromonas sp. RCC299]
Length=811

 Score =   211 bits (536),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 218/356 (61%), Gaps = 28/356 (8%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             + E++S  +L+R+ +P++KA++EAG+   ++ ++E++G+ SR+P I   L  FFG    R
Sbjct  302   KMEELSSALLDRMMEPVKKAMSEAGMIPADVKAVELVGNASRMPFISSQLEAFFGMPCSR  361

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NASECV++GCALQ A+LSP F+VRDF+V +SFPFP++ SW+     A  G  ++ +  
Sbjct  362   TLNASECVARGCALQGAMLSPQFRVRDFEVVDSFPFPVSFSWQ-----ADGGEVKDME--  414

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGE--R  529
              +F + N +PS K +TF+R+ TF++  +Y   + L   A ++I ++ +GP  S   +  +
Sbjct  415   -LFERNNAVPSSKMMTFFRNETFTLQAKYTTPTLLPPNAMTQIGSFDVGPIPSTNSDDGK  473

Query  530   AKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNM  709
              KLKVKVRLNL+G+VSVESA  +EE E EV    E    +      D P ++   T    
Sbjct  474   TKLKVKVRLNLNGLVSVESAQAVEEIEEEVAPAPEVAPAAEAPMDTDAPAENGENT----  529

Query  710   QDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQKA  889
                     A E+    +G+KP++ E  A     KKKVKK +VPVS  V G L    +++ 
Sbjct  530   --------APED---PNGEKPMETEAAAPVPEKKKKVKKIDVPVSSTV-GGLPAQVLEQF  577

Query  890   VEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQ  1057
             V +EFEMALQDR+MEETK++KNAVE YVY MR K+     +FV     E  +A L 
Sbjct  578   VNEEFEMALQDRVMEETKERKNAVEEYVYGMRTKVTGALSDFVAPEAAESFVALLN  633



>emb|CDX97975.1| BnaA06g07260D [Brassica napus]
Length=761

 Score =   210 bits (534),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 139/193 (72%), Gaps = 11/193 (6%)
 Frame = +2

Query  2    EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
            EFE++S  +LER+  P +KA+A++GL+++ IHS+E++GSGSR+PAI K+L+  F +E  R
Sbjct  304  EFEKLSSGLLERLIVPCQKALADSGLSLDQIHSVELVGSGSRIPAISKMLSSLFKRELGR  363

Query  182  TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
            T+NASECV++GCALQCA+LSP F+VRD++V +SFPF I  S  KGP     N        
Sbjct  364  TVNASECVARGCALQCAMLSPIFRVRDYEVQDSFPFSIGFSSDKGPINTPSN--------  415

Query  359  TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQ--APSKISTYTIGPFQSGKGERA  532
             ++FPKG   PSVK LT  R  TF +   Y D +E+   +PS+I T+TIGPFQS  GE A
Sbjct  416  EMLFPKGQVFPSVKVLTLRRENTFHLKAFYEDHNEISPDSPSQIGTFTIGPFQSSHGEAA  475

Query  533  KLKVKVRLNLHGI  571
            ++KV+V+LNLHGI
Sbjct  476  RVKVRVQLNLHGI  488


 Score = 67.0 bits (162),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +2

Query  833   VPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQE  1012
             + V E V GAL+  ++ +A ++E+ +  QD  ME TKDKKNA+E++VY+MR+K+ + Y+ 
Sbjct  544   ISVVENVSGALTKDELLEAKQREYSLVQQDLKMESTKDKKNALESFVYEMRDKMLNTYRS  603

Query  1013  FVVDSEKEQLIAKLQE  1060
                +SE+E +   LQE
Sbjct  604   TATESERECIARNLQE  619



>ref|XP_009148495.1| PREDICTED: heat shock 70 kDa protein 16 [Brassica rapa]
 ref|XP_009148496.1| PREDICTED: heat shock 70 kDa protein 16 [Brassica rapa]
Length=761

 Score =   210 bits (534),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 139/193 (72%), Gaps = 11/193 (6%)
 Frame = +2

Query  2    EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
            EFE++S  +LER+  P +KA+A++GL+++ IHS+E++GSGSR+PAI K+L+  F +E  R
Sbjct  304  EFEKLSSGLLERLIVPCQKALADSGLSLDQIHSVELVGSGSRIPAISKMLSSLFKRELGR  363

Query  182  TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSW-KGPSPDAQNGAAENQQS  358
            T+NASECV++GCALQCA+LSP F+VRD++V +SFPF I  S  KGP     N        
Sbjct  364  TVNASECVARGCALQCAMLSPIFRVRDYEVQDSFPFSIGFSSDKGPINTPSN--------  415

Query  359  TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQ--APSKISTYTIGPFQSGKGERA  532
             ++FPKG   PSVK LT  R  TF +   Y D +E+   +PS+I T+TIGPFQS  GE A
Sbjct  416  EMLFPKGQVFPSVKVLTLRRENTFHLKAFYEDHNEISPDSPSQIGTFTIGPFQSSHGEAA  475

Query  533  KLKVKVRLNLHGI  571
            ++KV+V+LNLHGI
Sbjct  476  RVKVRVQLNLHGI  488


 Score = 67.0 bits (162),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +2

Query  833   VPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQE  1012
             + V E V GAL+  ++ +A ++E+ +  QD  ME TKDKKNA+E++VY+MR+K+ + Y+ 
Sbjct  544   ISVVENVSGALTKDELLEAKQREYSLVQQDLKMESTKDKKNALESFVYEMRDKMLNTYRS  603

Query  1013  FVVDSEKEQLIAKLQE  1060
                +SE+E +   LQE
Sbjct  604   TATESERECIARNLQE  619



>gb|AAH65970.1| Heat shock protein 4 [Danio rerio]
Length=840

 Score =   202 bits (513),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 141/365 (39%), Positives = 214/365 (59%), Gaps = 25/365 (7%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE++   IL RV+ PL   + +A L  ++IH++E++G  SR+PAI + +++FFGKEP  
Sbjct  305   QFEEMCADILARVEPPLRSLLEQAHLKKDDIHAVEIVGGASRMPAIKERISKFFGKEPST  364

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NA E V++GCALQCAILSP FKVR+F + E  PFPI+L W        N AAE+  S 
Sbjct  365   TLNADEAVARGCALQCAILSPAFKVREFSITEVVPFPISLKW--------NSAAEDGVSD  416

Query  362   I-VFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGK------  520
               VFPK +  P  K LTFYR   F++D  Y    EL  P      TIG +   K      
Sbjct  417   CEVFPKNHAAPFSKVLTFYRREPFTLDAYYNSPKELPYPDP----TIGQYVVQKVVPQAS  472

Query  521   GERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETD-----DIPPQD  685
             GE +K+KVKVR+N+HGI SV SA+L+E ++ E      + ++ST+ E +     D   Q 
Sbjct  473   GESSKVKVKVRVNIHGIFSVSSASLVEVQKSEEEEESMETEQSTEKENENKMQVDQEEQK  532

Query  686   SSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGAL  865
             + ET+    + K  ++  E    E G +  + +   +A+ PK K K  ++P+       L
Sbjct  533   TPETEQENGEKKPGTEEMETSA-EEGKQEKKSDQPPQAKKPKVKTKVLDLPIENNPQWQL  591

Query  866   SPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLI  1045
             +   +   VE E +M +QD++ +E  D KN VE YVY+MR+KL+  +++FV +S+++ L 
Sbjct  592   ANDMLNLFVESEGKMIMQDKLEKERNDAKNYVEEYVYEMRDKLHGIFEKFVTESDRDVLS  651

Query  1046  AKLQE  1060
              KL++
Sbjct  652   LKLED  656



>ref|NP_956151.1| heat shock protein 4b [Danio rerio]
 gb|AAH48063.1| Heat shock protein 4 [Danio rerio]
Length=840

 Score =   202 bits (513),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 141/365 (39%), Positives = 214/365 (59%), Gaps = 25/365 (7%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE++   IL RV+ PL   + +A L  ++IH++E++G  SR+PAI + +++FFGKEP  
Sbjct  305   QFEEMCADILARVEPPLRSLLEQAHLKKDDIHAVEIVGGASRMPAIKERISKFFGKEPST  364

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NA E V++GCALQCAILSP FKVR+F + E  PFPI+L W        N AAE+  S 
Sbjct  365   TLNADEAVARGCALQCAILSPAFKVREFSITEVVPFPISLKW--------NSAAEDGVSD  416

Query  362   I-VFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGK------  520
               VFPK +  P  K LTFYR   F++D  Y    EL  P      TIG +   K      
Sbjct  417   CEVFPKNHAAPFSKVLTFYRREPFTLDAYYNSPKELPYPDP----TIGQYVVQKVVPQAS  472

Query  521   GERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETD-----DIPPQD  685
             GE +K+KVKVR+N+HGI SV SA+L+E ++ E      + ++ST+ E +     D   Q 
Sbjct  473   GESSKVKVKVRVNIHGIFSVSSASLVEVQKSEEEEESMETEQSTEKENENKMQVDQEEQK  532

Query  686   SSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGAL  865
             + ET+    + K  ++  E    E G +  + +   +A+ PK K K  ++P+       L
Sbjct  533   TPETEQENGEKKPGTEEMETSA-EEGKQEKKSDQPPQAKKPKVKTKVLDLPIENNPQWQL  591

Query  866   SPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLI  1045
             +   +   VE E +M +QD++ +E  D KN VE YVY+MR+KL+  +++FV +S+++ L 
Sbjct  592   ANDMLNLFVESEGKMIMQDKLEKERNDAKNYVEEYVYEMRDKLHGIFEKFVTESDRDVLS  651

Query  1046  AKLQE  1060
              KL++
Sbjct  652   LKLED  656



>ref|XP_004073389.1| PREDICTED: heat shock 70 kDa protein 4 isoform X2 [Oryzias latipes]
Length=846

 Score =   200 bits (508),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 136/376 (36%), Positives = 217/376 (58%), Gaps = 44/376 (12%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE++   IL RV+ PL+  + +A L  E+I+++E++G  SR+PA+ + +++FFGKE   
Sbjct  305   QFEEMCADILTRVEPPLQSLLEQAKLKKEDIYAVEIVGGASRIPAVKERISKFFGKELST  364

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NA E V++GCALQCAILSP FKVR+F + E  P+PI+L W      A++G ++ +   
Sbjct  365   TLNADEAVARGCALQCAILSPAFKVREFSITEVVPYPISLKWHSA---AEDGLSDCE---  418

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGK------G  523
              VFPK +  P  K LTFYR   FS++  Y+  SEL  P      TIG F   K      G
Sbjct  419   -VFPKNHAAPFSKVLTFYRREPFSLEAYYSCPSELPYPDP----TIGQFLIQKVVPQASG  473

Query  524   ERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeS-------TKMETDDIPPQ  682
             E +K+KVKVR+N+HGI SV SA+L+E ++ +      + +++       +KM+TD    Q
Sbjct  474   ESSKVKVKVRVNIHGIFSVSSASLVEVQKSDETEEPMETEQAATDKDGESKMQTD----Q  529

Query  683   DSSETDVNMQ----------DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTN  832
             D  +   ++Q          ++++ +   EN   +  D+P Q +        K K K   
Sbjct  530   DGQQAQADVQKETEEKTPQENEEMDTSTEENKGEKKSDQPPQAKK------AKVKTKVLE  583

Query  833   VPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQE  1012
             +P+       L+   +   VE E +M +QD++ +E  D KN VE YVYDMR+KL+  +++
Sbjct  584   LPIENSPQWQLANDMLNLFVENEGKMIMQDKLEKERNDAKNYVEEYVYDMRDKLHGIFEK  643

Query  1013  FVVDSEKEQLIAKLQE  1060
             FV +S+++ L  KL++
Sbjct  644   FVSESDRDALSLKLED  659



>ref|XP_011478585.1| PREDICTED: heat shock 70 kDa protein 4 isoform X1 [Oryzias latipes]
Length=847

 Score =   200 bits (508),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 136/377 (36%), Positives = 217/377 (58%), Gaps = 45/377 (12%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE++   IL RV+ PL+  + +A L  E+I+++E++G  SR+PA+ + +++FFGKE   
Sbjct  305   QFEEMCADILTRVEPPLQSLLEQAKLKKEDIYAVEIVGGASRIPAVKERISKFFGKELST  364

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NA E V++GCALQCAILSP FKVR+F + E  P+PI+L W      A++G ++ +   
Sbjct  365   TLNADEAVARGCALQCAILSPAFKVREFSITEVVPYPISLKWHSA---AEDGLSDCE---  418

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGK------G  523
              VFPK +  P  K LTFYR   FS++  Y+  SEL  P      TIG F   K      G
Sbjct  419   -VFPKNHAAPFSKVLTFYRREPFSLEAYYSCPSELPYPDP----TIGQFLIQKVVPQASG  473

Query  524   ERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeS--------TKMETDDIPP  679
             E +K+KVKVR+N+HGI SV SA+L+E ++ +      + +++        +KM+TD    
Sbjct  474   ESSKVKVKVRVNIHGIFSVSSASLVEVQKSDETEEPMETEQAATDKDGEQSKMQTD----  529

Query  680   QDSSETDVNMQ----------DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkT  829
             QD  +   ++Q          ++++ +   EN   +  D+P Q +        K K K  
Sbjct  530   QDGQQAQADVQKETEEKTPQENEEMDTSTEENKGEKKSDQPPQAKK------AKVKTKVL  583

Query  830   NVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQ  1009
              +P+       L+   +   VE E +M +QD++ +E  D KN VE YVYDMR+KL+  ++
Sbjct  584   ELPIENSPQWQLANDMLNLFVENEGKMIMQDKLEKERNDAKNYVEEYVYDMRDKLHGIFE  643

Query  1010  EFVVDSEKEQLIAKLQE  1060
             +FV +S+++ L  KL++
Sbjct  644   KFVSESDRDALSLKLED  660



>ref|XP_004076160.1| PREDICTED: heat shock 70 kDa protein 4-like [Oryzias latipes]
Length=837

 Score =   199 bits (506),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 131/362 (36%), Positives = 206/362 (57%), Gaps = 25/362 (7%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE++   +L +V+ PL   + +  L  E+I+++E++G  SR+PAI + + +FFGKE   
Sbjct  305   QFEEMCAGLLAKVEGPLRSVMEQTKLKKEDIYAVEIVGGASRIPAIKERIGKFFGKELST  364

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NA E V++GCALQCAILSP FKVR+F + +  PF I+L W        N AA++  S 
Sbjct  365   TLNADEAVARGCALQCAILSPAFKVREFSITDVVPFSISLKW--------NSAADDGLSD  416

Query  362   I-VFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAP-SKISTYTI-GPFQSGKGERA  532
               VFPK +  P  K LTFYRS  F+++  Y +  EL  P + I  + I        GE A
Sbjct  417   CEVFPKNHAAPFSKVLTFYRSEPFTLEAYYNNAKELPCPDTNIGQFLIQNVVPQATGESA  476

Query  533   KLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNMQ  712
             K+KVKVR+N+HG+ SV SA+L+E  +               METD I  +D S+   + +
Sbjct  477   KVKVKVRVNIHGVFSVSSASLVEVVKAVEGEEP--------METDQIVKEDESKIQEDQE  528

Query  713   DDKVTSDASENHV------LESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPA  874
             D K+ +   +  V       E G +  + +   +A+  K K K  ++P+   V   LS  
Sbjct  529   DQKLQTGDKKTEVEEMETSTEDGKQEKKNDQPPQAKKAKVKTKTVDLPIQSKVQWQLSSQ  588

Query  875   DVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKL  1054
             ++   +E E +M +QD++ +E  D KN VE YVY+MR+KL+   ++FV ++E++    KL
Sbjct  589   ELNTFLENEGKMIMQDKLEKERNDAKNNVEEYVYEMRDKLHGVLEKFVNEAERDAFSLKL  648

Query  1055  QE  1060
             ++
Sbjct  649   ED  650



>ref|XP_005642775.1| heat shock protein 70E [Coccomyxa subellipsoidea C-169]
 gb|EIE18231.1| heat shock protein 70E [Coccomyxa subellipsoidea C-169]
Length=792

 Score =   199 bits (505),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 140/359 (39%), Positives = 201/359 (56%), Gaps = 48/359 (13%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE+++ P+L+R + PL  A+ +A +++E+I S+EV+G  SRVPA++  + +FF KEP R
Sbjct  301   QFEELAQPVLQRARAPLATALEQAKISLEDIASVEVVGGSSRVPALLTTMRDFFKKEPSR  360

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NA+E V +GCAL CA+LSP F+VRDF+V E+FPF I   W       ++G    + ++
Sbjct  361   TLNATEVVCRGCALNCAMLSPIFRVRDFEVIEAFPFGIEFQWD------KDG---ERITS  411

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQA--PSKISTYTIGPFQS--GKGER  529
             ++F +  PIPS K LTF+R+  F++  +Y D S +       I T+ IGP  +    G  
Sbjct  412   VLFERNGPIPSAKMLTFFRNTAFTLTARYTDDSPVPEGFDRTIGTFEIGPPVNVPTDGSN  471

Query  530   AKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVNM  709
             AK+KVKV+LNLHG+V VESA  +EEEE E  V                            
Sbjct  472   AKIKVKVKLNLHGVVGVESAQQIEEEEYEETV----------------------------  503

Query  710   QDDKVTSDASENHVLESG--DKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPADVQ  883
                KV   AS       G  D P  MET+      K++ KK  VP    V G LS   VQ
Sbjct  504   ---KVYESASAKASTAPGPADGPAPMETE-AEGPKKRRTKKLQVPFKVHVEG-LSDKIVQ  558

Query  884   KAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQE  1060
               +E E  + LQ +  +ET ++KNAVEAYVY +RN+L D    FV + E+  +  KL +
Sbjct  559   DFIEMEGNIELQKKRQDETNERKNAVEAYVYGLRNQLSDALAPFVTEQEQATVSDKLNQ  617



>ref|NP_989252.1| heat shock 70kDa protein 4 [Xenopus (Silurana) tropicalis]
 gb|AAH63930.1| osmotic stress protein 94 kDa [Xenopus (Silurana) tropicalis]
 gb|AAH76984.1| osmotic stress protein 94 kDa [Xenopus (Silurana) tropicalis]
Length=835

 Score =   199 bits (505),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 133/370 (36%), Positives = 204/370 (55%), Gaps = 42/370 (11%)
 Frame = +2

Query  5     FEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRRT  184
             FE++   +L RV+ PL   + +A L  E+I+++E++G  +R+PA+ + +  FFGKE   T
Sbjct  306   FEEMCDSLLSRVEPPLRSVLEQAKLKKEDIYAVEIVGGATRIPAVKERIMRFFGKEVSTT  365

Query  185   MNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQSTI  364
             +NA E V++GCALQCAILSP FKVR+F + +  P+PI+L W  P   A+ G ++ +    
Sbjct  366   LNADEAVARGCALQCAILSPAFKVREFSITDLVPYPISLKWNSP---AEEGLSDCE----  418

Query  365   VFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGK------GE  526
             VFPK +  P  K LTFYR  +F++D  Y+   EL  P      ++G F   K      G 
Sbjct  419   VFPKNHAAPFSKVLTFYRKESFNLDAYYSAPKELPYPDP----SLGQFHIQKVIPQADGS  474

Query  527   RAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQDSSETDVN  706
              +K+KVKVR+N+HGI SV SA+L+E  + E             METD +     ++ +  
Sbjct  475   SSKVKVKVRVNIHGIFSVSSASLVEIHKTEDG--------EEPMETDQV-----TKEEEK  521

Query  707   MQDDKVTSDASENHVLESGDKPVQMETDa------------kaeapkkkvkkTNVPVSEL  850
             MQ D+  +   EN   ES   P +MET              +A+  K K    ++P+   
Sbjct  522   MQVDQEEAKPEENQQAESKTNPDEMETSQPGTKDKKTDQPPQAKKAKVKTSTVDLPIEHY  581

Query  851   VYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSE  1030
                 +    +   VE E +M +QD++ +E  D KNAVE YVY+MR+KL   Y++FV + +
Sbjct  582   PPWQIGRDMLNLFVENEGKMIMQDKLEKERNDAKNAVEEYVYEMRDKLSGIYEKFVSEDD  641

Query  1031  KEQLIAKLQE  1060
             +   I KL++
Sbjct  642   RNSFILKLED  651



>ref|XP_005795394.1| PREDICTED: heat shock 70 kDa protein 4-like isoform X1 [Xiphophorus 
maculatus]
Length=845

 Score =   197 bits (502),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 137/373 (37%), Positives = 203/373 (54%), Gaps = 39/373 (10%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE++ + IL RV+ PL   + +A L  E+I+++E++G  SR+PA+ + +++FFGKE   
Sbjct  305   QFEEMCVDILARVEPPLHSLLEQAKLKKEDIYAVEIVGGASRIPAVKERISKFFGKELNT  364

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NA E V++GCALQCAILSP FKVR+F + +  P+PI+L W        + A E     
Sbjct  365   TLNADEAVARGCALQCAILSPAFKVREFSITDVVPYPISLKW-------HSAAEEGLSDC  417

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGK------G  523
              VFPK +  P  K LTFYR   FS++  Y   +EL  P      TIG F   K      G
Sbjct  418   EVFPKNHAAPFSKVLTFYRKEPFSLEAYYCSPNELPYPDS----TIGQFVIQKVVPQATG  473

Query  524   ERAKLKVKVRLNLHGIvsvesatlleeeev------evpvvkeqlkeSTKMETDDIPPQD  685
             E +K+KVKVR+N+HGI SV SA+L+E ++                   TKM+TD      
Sbjct  474   ESSKVKVKVRVNIHGIFSVSSASLVEVQKSDETEEPMETEQVSDKDGETKMQTDQ--ETQ  531

Query  686   SSETDVNMQDDKVTSD--------ASENHVLESGDKPVQMETDakaeapkkkvkkTNVPV  841
             S++ D   Q D  T +          EN   +  D+P Q +        K K K   +P+
Sbjct  532   SAQGDAQKQTDDKTPNESEEMETSTEENKGEKKSDQPPQAKK------AKVKTKVLELPI  585

Query  842   SELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVV  1021
                    L+   +   VE E +M +QD++ +E  D KN VE YVYDMR+KL+   ++FV 
Sbjct  586   ENSPQWQLANDMLNLFVENEGKMIMQDKLEKERNDAKNNVEEYVYDMRDKLHGMLEKFVS  645

Query  1022  DSEKEQLIAKLQE  1060
             +S+++ L  KL++
Sbjct  646   ESDRDALSLKLED  658



>ref|XP_007548463.1| PREDICTED: heat shock 70 kDa protein 4 [Poecilia formosa]
Length=845

 Score =   196 bits (497),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 136/373 (36%), Positives = 204/373 (55%), Gaps = 39/373 (10%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE++ + IL RV+ PL   + +A L  E+I+++E++G  SR+P++ + +++FFGKE   
Sbjct  305   QFEEMCVDILARVEPPLHSLLEQAKLKKEDIYAVEIVGGASRIPSVKERISKFFGKELST  364

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NA E V++GCALQCAILSP FKVR+F + +  P+PI+L W        + A E     
Sbjct  365   TLNADEAVARGCALQCAILSPAFKVREFSITDVVPYPISLKW-------HSAAEEGLSDC  417

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGK------G  523
              VFPK +  P  K LTFYR   FS++  Y+  +EL  P      TIG F   K      G
Sbjct  418   EVFPKNHAAPFSKVLTFYRKEPFSLEAYYSSPNELPYPDP----TIGQFVIQKVVPQASG  473

Query  524   ERAKLKVKVRLNLHGIvsvesatlleeeev------evpvvkeqlkeSTKMETDDIPPQD  685
             E +K+KVKVR+N+HGI SV SA+L+E ++                   TKM+TD      
Sbjct  474   ESSKVKVKVRVNIHGIFSVSSASLVEVQKSDETEEPMETEQVSDKDGETKMQTDQ--ETQ  531

Query  686   SSETDVNMQDDKVTSD--------ASENHVLESGDKPVQMETDakaeapkkkvkkTNVPV  841
             S++ D   Q D  T +          EN   +  D+P Q +        K K K   +P+
Sbjct  532   SAQGDAQKQTDDKTPNESEEMETSTEENKGEKKSDQPPQAKK------AKVKTKVLELPI  585

Query  842   SELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVV  1021
                    L+   +   VE E +M +QD++ +E  D KN VE YVYDMR+KL+   ++FV 
Sbjct  586   ENSPQWQLANDMLNLFVENEGKMIMQDKLEKERNDAKNNVEEYVYDMRDKLHGMLEKFVS  645

Query  1022  DSEKEQLIAKLQE  1060
             +S+++ L  KL++
Sbjct  646   ESDRDTLSLKLED  658



>ref|XP_005795395.1| PREDICTED: heat shock 70 kDa protein 4-like isoform X2 [Xiphophorus 
maculatus]
Length=843

 Score =   195 bits (496),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 136/377 (36%), Positives = 205/377 (54%), Gaps = 49/377 (13%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE++ + IL RV+ PL   + +A L  E+I+++E++G  SR+PA+ + +++FFGKE   
Sbjct  305   QFEEMCVDILARVEPPLHSLLEQAKLKKEDIYAVEIVGGASRIPAVKERISKFFGKELNT  364

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NA E V++GCALQCAILSP FKVR+F + +  P+PI+L W        + A E     
Sbjct  365   TLNADEAVARGCALQCAILSPAFKVREFSITDVVPYPISLKW-------HSAAEEGLSDC  417

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGK------G  523
              VFPK +  P  K LTFYR   FS++  Y   +EL  P      TIG F   K      G
Sbjct  418   EVFPKNHAAPFSKVLTFYRKEPFSLEAYYCSPNELPYPDS----TIGQFVIQKVVPQATG  473

Query  524   ERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDDIPPQD------  685
             E +K+KVKVR+N+HGI SV SA+L+E ++ +             MET+ +  +D      
Sbjct  474   ESSKVKVKVRVNIHGIFSVSSASLVEVQKSDETEEP--------METEQVSDKDGEMQTD  525

Query  686   ----SSETDVNMQDDKVTSD--------ASENHVLESGDKPVQMETDakaeapkkkvkkT  829
                 S++ D   Q D  T +          EN   +  D+P Q +        K K K  
Sbjct  526   QETQSAQGDAQKQTDDKTPNESEEMETSTEENKGEKKSDQPPQAKK------AKVKTKVL  579

Query  830   NVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQ  1009
              +P+       L+   +   VE E +M +QD++ +E  D KN VE YVYDMR+KL+   +
Sbjct  580   ELPIENSPQWQLANDMLNLFVENEGKMIMQDKLEKERNDAKNNVEEYVYDMRDKLHGMLE  639

Query  1010  EFVVDSEKEQLIAKLQE  1060
             +FV +S+++ L  KL++
Sbjct  640   KFVSESDRDALSLKLED  656



>ref|XP_006595736.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Glycine 
max]
 gb|KHN11927.1| Heat shock 70 kDa protein 16 [Glycine soja]
Length=802

 Score =   194 bits (494),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 131/193 (68%), Gaps = 11/193 (6%)
 Frame = +2

Query  2    EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
            EFE ++  +LE+   P  KA+A+AG+ VE I+S+E++GSGSR+PAI  +LT  F +E  R
Sbjct  302  EFENLASGLLEKFNIPCNKALADAGMTVEKINSVELVGSGSRIPAITNLLTSLFKRELSR  361

Query  182  TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKG-PSPDAQNGAAENQQS  358
            T+NASECV++GCALQCA+LSP F+V++++V +S PF I LS  G P  +  +G       
Sbjct  362  TLNASECVARGCALQCAMLSPIFRVKEYEVQDSIPFSIGLSCDGSPICEGSDG-------  414

Query  359  TIVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSEL--QAPSKISTYTIGPFQSGKGERA  532
             ++FPKG PIPSVK LTF  S    ++  YA+  EL      KIS +TI PF    G +A
Sbjct  415  -VLFPKGQPIPSVKILTFQCSNLLHLEAFYANPDELPPGTSPKISCFTIDPFHGSHGSKA  473

Query  533  KLKVKVRLNLHGI  571
            ++KV+V+LNLHGI
Sbjct  474  RIKVRVQLNLHGI  486


 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +2

Query  830   NVPVSELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQ  1009
             +VPVSE +YG ++ A++ +A EKE ++A QDR +E TKD+KN++E+Y+Y+ R+KL+  Y 
Sbjct  585   HVPVSENIYGGMTKAEILEAQEKELQLADQDRTIELTKDRKNSLESYIYETRSKLFSTYL  644

Query  1010  EFVVDSEKEQLIAKLQ  1057
              F  + E++ +   L+
Sbjct  645   SFSSEHERKDISRSLK  660



>ref|XP_007258636.1| PREDICTED: heat shock 70 kDa protein 4-like [Astyanax mexicanus]
Length=841

 Score =   194 bits (493),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 134/370 (36%), Positives = 209/370 (56%), Gaps = 31/370 (8%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE++   IL RV+ PL   + +A L  E+I ++E++G  SR+PA+ + +++FFGKE   
Sbjct  305   QFEEMCADILARVEAPLRSIMEQANLKNEDICAVEIVGGASRIPAVKERISKFFGKELSM  364

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NA E V++GCALQCAILSP FKVR+F + +  P+PI+L W        N AAE+  S 
Sbjct  365   TLNADEAVARGCALQCAILSPAFKVREFSITDVVPYPISLKW--------NSAAEDGISD  416

Query  362   I-VFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGK------  520
               VFPK +  P  K LTFYR   FS++  Y   ++L  P      TIG +   K      
Sbjct  417   CEVFPKNHAAPFSKVLTFYRREPFSLEAYYNSPTDLPYPDP----TIGQYMIQKVVPQAT  472

Query  521   GERAKLKVKVRLNLHGIvsvesatlleee----------evevpvvkeqlkeSTKMETDD  670
             GE +K+KVKVR+N+HGI SV SA+L+E +            +      + +E  KM+ D+
Sbjct  473   GESSKVKVKVRINIHGIFSVSSASLVELQKPEEGEEPMDTEQTSSPTAEKEEENKMQVDE  532

Query  671   IPPQDSSETDVNMQDDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSEL  850
                Q  S  D   ++ +  S++ E    E G +  + +   +A+ PK K K   +P+   
Sbjct  533   --DQQKSPDDGQKENGEKKSESDEMETSEEGKQEKKTDQPPQAKKPKVKTKVLELPIENN  590

Query  851   VYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSE  1030
                 L+   +   VE E +M +QD++ +E  D KN VE YVYDMR+KL+  +++F+ +S+
Sbjct  591   PQWQLAIEMLNLFVENEGKMIMQDKLEKERNDAKNNVEEYVYDMRDKLHGMFEKFITESD  650

Query  1031  KEQLIAKLQE  1060
             ++    KL++
Sbjct  651   RDAFSLKLED  660



>ref|XP_008418275.1| PREDICTED: heat shock 70 kDa protein 4 [Poecilia reticulata]
Length=845

 Score =   194 bits (492),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 136/373 (36%), Positives = 208/373 (56%), Gaps = 39/373 (10%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             +FE++ + IL RV+ PL   + +A L  E+I+++E++G  SR+PA+ + +++FFGKE   
Sbjct  305   QFEEMCVDILARVEPPLHSLLEQAKLKKEDIYAVEIVGGASRIPAVKERISKFFGKELST  364

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+NA E V++GCALQCAILSP FKVR+F + +   +PI+L W        + A E     
Sbjct  365   TLNADEAVARGCALQCAILSPAFKVREFSITDVVSYPISLKW-------HSAAEEGLSDC  417

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQSGK------G  523
              VFPK +  P  K LTFYR   FS++  Y+  +EL  P      TIG F   K      G
Sbjct  418   EVFPKNHAAPFSKVLTFYRKEPFSLEAYYSSPNELPYPDP----TIGQFVIQKVVPQASG  473

Query  524   ERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeS------TKMETDDIPPQD  685
             E +K+KVKVR+N+HGI SV SA+L+E ++ +      + +++      TKM+TD      
Sbjct  474   ESSKVKVKVRVNIHGIFSVSSASLVEVQKSDETEEPMETEQASDKDGETKMQTDQ--ETQ  531

Query  686   SSETDVNMQDDKVTSD--------ASENHVLESGDKPVQMETDakaeapkkkvkkTNVPV  841
             S++ D   Q D  T +          EN   +  D+P Q +        K K K   +P+
Sbjct  532   SAQGDAQKQTDDKTPNESEEMETSTEENKGEKKSDQPPQAKK------AKVKTKVLELPI  585

Query  842   SELVYGALSPADVQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVV  1021
                    L+   +   VE E +M +QD++ +E  D KN VE YVYDMR+KL+   ++FV 
Sbjct  586   ENSPQWQLANDMLNLFVENEGKMIMQDKLEKERNDAKNYVEEYVYDMRDKLHGILEKFVS  645

Query  1022  DSEKEQLIAKLQE  1060
             +S+++ L  KL++
Sbjct  646   ESDRDALSLKLED  658



>ref|XP_001597692.1| hypothetical protein SS1G_01888 [Sclerotinia sclerotiorum 1980]
 gb|EDN96960.1| hypothetical protein SS1G_01888 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=711

 Score =   192 bits (488),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 130/360 (36%), Positives = 194/360 (54%), Gaps = 57/360 (16%)
 Frame = +2

Query  2     EFEQISIPILERVKKPLEKAIAEAGLAVENIHSIEVIGSGSRVPAIIKILTEFFGKEPRR  181
             E E +  P+L RV  PLE+A+A+AGL VE+I  IE++G  +RVPA+ + + +FFGK    
Sbjct  303   ELEALVEPLLSRVHVPLEQALADAGLKVEDIDIIELVGGCTRVPALKERIQKFFGKNLSF  362

Query  182   TMNASECVSKGCALQCAILSPTFKVRDFQVNESFPFPIALSWKGPSPDAQNGAAENQQST  361
             T+N  E +++GCA  CAILSP F+VRDF +++   +PI  +W+  SPD      +   S 
Sbjct  363   TLNQDEAIARGCAFSCAILSPVFRVRDFAIHDIVNYPIEFTWE-KSPD----IPDEDTSL  417

Query  362   IVFPKGNPIPSVKALTFYRSGTFSIDVQYADVSELQAPSKISTYTIGPFQ------SGKG  523
              VF KG  +PS K LTFYR   F+++ +YA    L  P  ++ + IG F         K 
Sbjct  418   TVFNKGGIMPSTKILTFYRKEPFTLEAKYAKPELL--PGTMNPW-IGRFTVKNVKADSKD  474

Query  524   ERAKLKVKVRLNLHGIvsvesatlleeeevevpvvkeqlkeSTKMETDD-IPPQDSSETD  700
             +    K+K RLNLHGI++VE    +E+                 ME ++ IP +D  + D
Sbjct  475   DFMICKLKARLNLHGILNVEQGYYVED-----------------MEVEEPIPEKDGEKKD  517

Query  701   VNMQ-DDKVTSDASENHVLESGDKPVQMETDakaeapkkkvkkTNVPVSELVYGALSPAD  877
               M  DDK  +   +  V   GD P+   T                        +L  A 
Sbjct  518   DAMDTDDKPKTRKVKKQV-RKGDLPIVSGT-----------------------ASLDTAA  553

Query  878   VQKAVEKEFEMALQDRIMEETKDKKNAVEAYVYDMRNKLYDKYQEFVVDSEKEQLIAKLQ  1057
             +  A E+E  M ++D+++ +T++KKN +E Y+Y+MRNK+ D+Y EF  D EKE+L AKL+
Sbjct  554   IATASEQENTMNMEDKLVADTEEKKNELETYIYEMRNKIDDQYAEFASDEEKEKLKAKLE  613



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2734198738640