BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3407

Length=678
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001242304.1|  uncharacterized protein LOC100811369               201   6e-59   
ref|XP_004512162.1|  PREDICTED: cell number regulator 13-like iso...    202   6e-59   
ref|XP_004512157.1|  PREDICTED: cell number regulator 13-like iso...    202   1e-58   
gb|AFK40961.1|  unknown                                                 200   2e-58   Lotus japonicus
ref|XP_006572883.1|  PREDICTED: uncharacterized protein LOC100811...    201   3e-58   
ref|XP_009611045.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    200   5e-58   Nicotiana tomentosiformis
ref|XP_002531154.1|  conserved hypothetical protein                     196   5e-58   
ref|XP_007157885.1|  hypothetical protein PHAVU_002G106200g             200   6e-58   Phaseolus vulgaris [French bean]
ref|XP_009803786.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    200   8e-58   Nicotiana sylvestris
ref|XP_004287784.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    199   1e-57   Fragaria vesca subsp. vesca
dbj|BAK32933.1|  mid1-complementing activity 2                          198   4e-57   Nicotiana tabacum [American tobacco]
ref|XP_006599316.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    195   6e-57   
ref|XP_006574667.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    196   7e-57   
ref|XP_003519857.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    197   1e-56   
ref|XP_006574663.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    196   1e-56   Glycine max [soybeans]
ref|XP_004232512.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    196   1e-56   Solanum lycopersicum
ref|XP_003612221.1|  hypothetical protein MTR_5g022670                  196   1e-56   Medicago truncatula
ref|XP_012088489.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    196   1e-56   Jatropha curcas
gb|KDO71309.1|  hypothetical protein CISIN_1g014734mg                   196   1e-56   Citrus sinensis [apfelsine]
ref|XP_006340771.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    196   2e-56   Solanum tuberosum [potatoes]
ref|XP_003629262.1|  Cornifelin                                         196   2e-56   Medicago truncatula
ref|XP_007156188.1|  hypothetical protein PHAVU_003G265800g             196   2e-56   Phaseolus vulgaris [French bean]
ref|XP_004146155.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    196   3e-56   Cucumis sativus [cucumbers]
gb|KDO71305.1|  hypothetical protein CISIN_1g014734mg                   196   3e-56   Citrus sinensis [apfelsine]
ref|XP_008448524.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    196   3e-56   Cucumis melo [Oriental melon]
gb|KHN35538.1|  Protein MID1-COMPLEMENTING ACTIVITY 1                   196   3e-56   Glycine soja [wild soybean]
ref|XP_009363461.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    196   3e-56   
ref|XP_003548830.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    196   3e-56   Glycine max [soybeans]
ref|XP_009801746.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    196   3e-56   Nicotiana sylvestris
emb|CAN71842.1|  hypothetical protein VITISV_036262                     196   3e-56   Vitis vinifera
ref|XP_006466999.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    195   4e-56   Citrus sinensis [apfelsine]
ref|XP_006425392.1|  hypothetical protein CICLE_v10025703mg             195   4e-56   
ref|XP_004509394.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    195   4e-56   Cicer arietinum [garbanzo]
ref|XP_008352422.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    195   4e-56   Malus domestica [apple tree]
ref|XP_006599313.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    195   7e-56   
gb|KDP23985.1|  hypothetical protein JCGZ_25373                         194   8e-56   Jatropha curcas
tpg|DAA43437.1|  TPA: putative cell number regulator 13                 187   9e-56   
ref|XP_009624357.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    194   1e-55   Nicotiana tomentosiformis
ref|XP_006343349.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    194   1e-55   Solanum tuberosum [potatoes]
ref|XP_008807147.1|  PREDICTED: cell number regulator 13-like           194   1e-55   Phoenix dactylifera
emb|CDP01861.1|  unnamed protein product                                194   2e-55   Coffea canephora [robusta coffee]
ref|XP_010933353.1|  PREDICTED: cell number regulator 13-like iso...    193   2e-55   
ref|XP_010933352.1|  PREDICTED: cell number regulator 13-like iso...    193   3e-55   Elaeis guineensis
ref|XP_006383064.1|  hypothetical protein POPTR_0005s11200g             192   4e-55   Populus trichocarpa [western balsam poplar]
ref|XP_009408218.1|  PREDICTED: cell number regulator 13-like iso...    192   4e-55   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB17609.1|  hypothetical protein B456_003G007400                    191   5e-55   Gossypium raimondii
ref|XP_009408217.1|  PREDICTED: cell number regulator 13-like iso...    192   5e-55   
ref|XP_011043148.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    192   5e-55   Populus euphratica
ref|XP_010029652.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    192   5e-55   Eucalyptus grandis [rose gum]
ref|XP_009408216.1|  PREDICTED: cell number regulator 13-like iso...    192   5e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010029651.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    192   5e-55   Eucalyptus grandis [rose gum]
ref|XP_008242042.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    191   6e-55   Prunus mume [ume]
ref|XP_010531102.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    192   8e-55   
gb|KHG25004.1|  mid1-complementing activity 1 -like protein             192   9e-55   Gossypium arboreum [tree cotton]
ref|XP_009386557.1|  PREDICTED: cell number regulator 13-like iso...    191   9e-55   
ref|XP_002272810.2|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    192   1e-54   Vitis vinifera
ref|XP_009386556.1|  PREDICTED: cell number regulator 13-like iso...    191   1e-54   
ref|XP_009386559.1|  PREDICTED: cell number regulator 13-like iso...    190   1e-54   
ref|XP_011658059.1|  PREDICTED: cell number regulator 13 isoform X2     189   1e-54   Cucumis sativus [cucumbers]
gb|KCW56602.1|  hypothetical protein EUGRSUZ_I02323                     192   1e-54   Eucalyptus grandis [rose gum]
gb|KHN36012.1|  Protein MID1-COMPLEMENTING ACTIVITY 1                   191   1e-54   Glycine soja [wild soybean]
gb|KGN48940.1|  hypothetical protein Csa_6G507150                       189   1e-54   Cucumis sativus [cucumbers]
ref|XP_007202160.1|  hypothetical protein PRUPE_ppa006351mg             191   2e-54   Prunus persica
ref|XP_008242040.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    191   2e-54   Prunus mume [ume]
ref|XP_011099884.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    191   2e-54   
gb|KJB17606.1|  hypothetical protein B456_003G007400                    191   2e-54   Gossypium raimondii
ref|XP_009386555.1|  PREDICTED: cell number regulator 13-like iso...    191   2e-54   
ref|XP_008440857.1|  PREDICTED: cell number regulator 13 isoform X2     188   3e-54   Cucumis melo [Oriental melon]
ref|XP_010920111.1|  PREDICTED: cell number regulator 13-like           190   3e-54   Elaeis guineensis
ref|XP_009418750.1|  PREDICTED: cell number regulator 13-like           189   1e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004135021.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    189   1e-53   Cucumis sativus [cucumbers]
ref|XP_008809428.1|  PREDICTED: cell number regulator 13-like iso...    188   1e-53   
ref|XP_010113309.1|  hypothetical protein L484_026640                   188   2e-53   
ref|XP_010266008.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    188   2e-53   Nelumbo nucifera [Indian lotus]
ref|XP_009379353.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    188   2e-53   Pyrus x bretschneideri [bai li]
ref|XP_008809427.1|  PREDICTED: cell number regulator 13-like iso...    188   2e-53   
ref|XP_008809426.1|  PREDICTED: cell number regulator 13-like iso...    188   2e-53   
ref|XP_008440854.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    188   2e-53   
ref|XP_006412042.1|  hypothetical protein EUTSA_v10025310mg             188   3e-53   Eutrema salsugineum [saltwater cress]
gb|EYU36803.1|  hypothetical protein MIMGU_mgv1a011010mg                184   3e-53   Erythranthe guttata [common monkey flower]
ref|NP_001049013.1|  Os03g0157300                                       187   4e-53   
dbj|BAH20129.1|  AT4G35920                                              187   4e-53   Arabidopsis thaliana [mouse-ear cress]
emb|CDX75539.1|  BnaA01g01630D                                          187   5e-53   
ref|XP_010526810.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    187   5e-53   Tarenaya hassleriana [spider flower]
gb|KJB43289.1|  hypothetical protein B456_007G192000                    187   5e-53   Gossypium raimondii
emb|CDX69186.1|  BnaC01g02670D                                          187   6e-53   
ref|NP_195317.2|  protein MID1-complementing activity 1                 187   7e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009138395.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    187   7e-53   Brassica rapa
gb|EEE65313.1|  hypothetical protein OsJ_20556                          187   8e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010446852.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    186   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_002468480.1|  hypothetical protein SORBIDRAFT_01g046630          186   1e-52   Sorghum bicolor [broomcorn]
gb|AAK32909.1|AF367322_1  AT4g35920/F4B14_190                           186   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006282626.1|  hypothetical protein CARUB_v10004901mg             186   1e-52   Capsella rubella
ref|XP_002867046.1|  hypothetical protein ARALYDRAFT_491044             186   1e-52   
ref|XP_010432209.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    186   1e-52   Camelina sativa [gold-of-pleasure]
emb|CDX72565.1|  BnaC07g45870D                                          186   2e-52   
ref|XP_004985646.1|  PREDICTED: cell number regulator 13-like           186   2e-52   Setaria italica
gb|KHG10652.1|  mid1-complementing activity 1 -like protein             184   2e-52   Gossypium arboreum [tree cotton]
gb|ACN26521.1|  unknown                                                 186   2e-52   Zea mays [maize]
ref|NP_001182136.1|  cell number regulator 13                           186   2e-52   Zea mays [maize]
ref|XP_008393931.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    185   2e-52   
ref|XP_008665504.1|  PREDICTED: cell number regulator 13-like           180   2e-52   
emb|CAA18486.1|  putative protein                                       186   2e-52   Arabidopsis thaliana [mouse-ear cress]
emb|CDY47043.1|  BnaAnng08310D                                          185   2e-52   Brassica napus [oilseed rape]
ref|XP_009148721.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    185   4e-52   Brassica rapa
ref|XP_010935125.1|  PREDICTED: cell number regulator 13-like           185   4e-52   Elaeis guineensis
ref|XP_011074700.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    184   6e-52   Sesamum indicum [beniseed]
gb|ABR16594.1|  unknown                                                 184   7e-52   Picea sitchensis
ref|XP_011083456.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    184   7e-52   Sesamum indicum [beniseed]
ref|XP_006846924.1|  PREDICTED: cell number regulator 13                184   9e-52   Amborella trichopoda
ref|XP_010266845.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    183   1e-51   Nelumbo nucifera [Indian lotus]
ref|XP_007046628.1|  PLAC8 family protein                               182   4e-51   
ref|XP_008806599.1|  PREDICTED: cell number regulator 13-like iso...    181   1e-50   
ref|XP_006297774.1|  hypothetical protein CARUB_v10013809mg             181   1e-50   Capsella rubella
ref|XP_008806598.1|  PREDICTED: cell number regulator 13-like iso...    181   2e-50   
gb|EMT07324.1|  hypothetical protein F775_31025                         180   2e-50   
gb|EYU17580.1|  hypothetical protein MIMGU_mgv1a007522mg                180   2e-50   Erythranthe guttata [common monkey flower]
ref|XP_010467574.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    180   3e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010467573.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    180   3e-50   Camelina sativa [gold-of-pleasure]
ref|XP_009112457.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    179   4e-50   
gb|AAM51833.1|AC105730_7  Unknown protein                               186   5e-50   Oryza sativa Japonica Group [Japonica rice]
emb|CDY30346.1|  BnaA09g09310D                                          178   5e-50   Brassica napus [oilseed rape]
ref|XP_010680412.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    178   6e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006409246.1|  hypothetical protein EUTSA_v10023167mg             178   7e-50   
ref|XP_009112456.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    178   7e-50   Brassica rapa
ref|XP_010680410.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    179   7e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009112455.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    178   7e-50   Brassica rapa
ref|XP_006649427.1|  PREDICTED: cell number regulator 13-like           179   7e-50   Oryza brachyantha
gb|EPS70744.1|  mid1-complementing activity 2                           178   7e-50   Genlisea aurea
emb|CDY26830.1|  BnaC09g09570D                                          178   8e-50   Brassica napus [oilseed rape]
ref|XP_010413502.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    179   9e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010489416.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    176   1e-49   Camelina sativa [gold-of-pleasure]
gb|EYU30814.1|  hypothetical protein MIMGU_mgv1a007258mg                177   4e-49   Erythranthe guttata [common monkey flower]
ref|XP_010489410.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    176   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010489415.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    175   2e-48   Camelina sativa [gold-of-pleasure]
ref|XP_003558777.1|  PREDICTED: cell number regulator 13                172   2e-47   Brachypodium distachyon [annual false brome]
ref|XP_010692506.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    167   2e-45   
ref|XP_009389172.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    166   3e-45   
pir||T08859  hypothetical protein A_TM017A05.4 - Arabidopsis thal...    160   3e-44
ref|XP_009389171.1|  PREDICTED: protein kinase 2A, chloroplastic-...    166   6e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001031368.1|  protein MID1-complementing activity 2              160   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001767697.1|  predicted protein                                  152   8e-43   
pir||D84556  hypothetical protein At2g17780 [imported] - Arabidop...    160   1e-42
ref|NP_001031367.1|  protein MID1-complementing activity 2              159   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031366.1|  protein MID1-complementing activity 2              160   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179369.2|  protein MID1-complementing activity 2                 160   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002886128.1|  hypothetical protein ARALYDRAFT_480672             159   1e-42   
ref|XP_001768983.1|  predicted protein                                  151   2e-39   
ref|XP_001769010.1|  predicted protein                                  147   3e-39   
ref|XP_002978386.1|  hypothetical protein SELMODRAFT_418221             142   3e-36   
ref|XP_002970226.1|  hypothetical protein SELMODRAFT_93428              140   1e-35   
gb|ADE76255.1|  unknown                                                 129   1e-32   Picea sitchensis
ref|XP_001785848.1|  predicted protein                                  124   8e-30   
ref|XP_010658234.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    124   2e-29   
ref|XP_010658233.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    124   2e-29   Vitis vinifera
ref|XP_010658232.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    124   2e-29   Vitis vinifera
ref|XP_010658231.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    124   2e-29   Vitis vinifera
ref|NP_001068428.2|  Os11g0670100                                       119   2e-29   
gb|EEC72317.1|  hypothetical protein OsI_05510                          120   4e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_002520777.1|  conserved hypothetical protein                     119   7e-28   
gb|EEC80653.1|  hypothetical protein OsI_23047                          117   9e-28   Oryza sativa Indica Group [Indian rice]
gb|EEE57693.1|  hypothetical protein OsJ_08164                          122   1e-27   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95227.1|  retrotransposon protein, putative, unclassified         121   3e-27   Oryza sativa Japonica Group [Japonica rice]
gb|KDP44714.1|  hypothetical protein JCGZ_01214                         117   3e-27   Jatropha curcas
ref|XP_012090597.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    117   7e-27   
ref|XP_011035883.1|  PREDICTED: cell number regulator 13-like           115   2e-26   Populus euphratica
gb|EAZ08702.1|  hypothetical protein OsI_30969                          111   3e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_002316192.2|  hypothetical protein POPTR_0010s19210g             112   2e-25   
gb|KDO68875.1|  hypothetical protein CISIN_1g020555mg                   111   2e-25   Citrus sinensis [apfelsine]
ref|XP_006486524.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    109   1e-24   
ref|XP_006435802.1|  hypothetical protein CICLE_v10031760mg             109   2e-24   
ref|XP_006356472.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    108   4e-24   Solanum tuberosum [potatoes]
ref|XP_002437501.1|  hypothetical protein SORBIDRAFT_10g028240          107   2e-23   
ref|XP_008676748.1|  PREDICTED: uncharacterized protein LOC100272...    107   3e-23   Zea mays [maize]
ref|XP_008676749.1|  PREDICTED: uncharacterized protein LOC100272...    107   3e-23   
ref|XP_010318233.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    105   4e-23   
ref|XP_006575552.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    105   4e-23   Glycine max [soybeans]
ref|XP_003518431.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    105   5e-23   Glycine max [soybeans]
ref|XP_004962551.1|  PREDICTED: proline-rich receptor-like protei...    105   6e-23   Setaria italica
ref|XP_009369272.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    100   6e-23   
ref|XP_004235233.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    104   8e-23   Solanum lycopersicum
ref|XP_010237406.1|  PREDICTED: cell number regulator 13-like           101   1e-22   Brachypodium distachyon [annual false brome]
ref|XP_004962550.1|  PREDICTED: proline-rich receptor-like protei...    105   2e-22   Setaria italica
ref|XP_004962548.1|  PREDICTED: proline-rich receptor-like protei...    105   2e-22   Setaria italica
gb|EEC71170.1|  hypothetical protein OsI_03036                        99.8    2e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_002449963.1|  hypothetical protein SORBIDRAFT_05g026280          100   4e-22   Sorghum bicolor [broomcorn]
ref|XP_004979928.1|  PREDICTED: G-type lectin S-receptor-like ser...    103   8e-22   
ref|NP_001068433.1|  Os11g0672300                                     99.4    1e-21   
ref|XP_004979929.1|  PREDICTED: cell number regulator 13-like         98.6    1e-21   Setaria italica
ref|XP_010087526.1|  hypothetical protein L484_006931                   100   2e-21   Morus notabilis
ref|XP_008363765.1|  PREDICTED: LOW QUALITY PROTEIN: protein MID1...    100   2e-21   
emb|CDP13977.1|  unnamed protein product                              99.4    6e-21   Coffea canephora [robusta coffee]
ref|XP_007008883.1|  PLAC8 family protein                             97.8    2e-20   
gb|EMS49964.1|  hypothetical protein TRIUR3_26988                     94.4    2e-20   Triticum urartu
ref|XP_007219349.1|  hypothetical protein PRUPE_ppa019431mg           96.3    7e-20   
ref|NP_001146395.1|  uncharacterized protein LOC100279975             94.0    9e-20   Zea mays [maize]
ref|NP_001142910.1|  uncharacterized protein LOC100275341             94.0    1e-19   
gb|EEC76280.1|  hypothetical protein OsI_13781                        95.5    3e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_002438909.1|  hypothetical protein SORBIDRAFT_10g028036        90.5    7e-19   
gb|KHN38534.1|  Protein MID1-COMPLEMENTING ACTIVITY 1                 93.2    8e-19   Glycine soja [wild soybean]
ref|XP_002446043.1|  hypothetical protein SORBIDRAFT_06g000900        90.1    8e-19   
gb|EMT23150.1|  hypothetical protein F775_17508                       90.5    1e-18   
ref|XP_004979962.1|  PREDICTED: cysteine-rich receptor-like prote...  93.2    2e-18   
ref|XP_008234071.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  92.4    2e-18   
ref|XP_004979961.1|  PREDICTED: cysteine-rich receptor-like prote...  93.2    2e-18   
dbj|BAD45624.1|  receptor protein kinase-like                         93.6    3e-18   Oryza sativa Japonica Group [Japonica rice]
gb|EEE52537.1|  hypothetical protein OsJ_34760                        89.7    3e-18   Oryza sativa Japonica Group [Japonica rice]
gb|EEE52535.1|  hypothetical protein OsJ_34758                        90.5    4e-18   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95138.1|  Protein kinase domain containing protein              92.8    4e-18   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95204.1|  hypothetical protein LOC_Os11g44520                   90.1    6e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004979334.1|  PREDICTED: putative serine/threonine-protein...  92.0    7e-18   Setaria italica
ref|XP_004966167.1|  PREDICTED: cysteine-rich receptor-like prote...  91.7    1e-17   Setaria italica
ref|XP_010227386.1|  PREDICTED: putative cysteine-rich receptor-l...  91.3    1e-17   
ref|XP_008648919.1|  PREDICTED: putative cysteine-rich receptor-l...  91.3    1e-17   Zea mays [maize]
ref|XP_010227385.1|  PREDICTED: putative cysteine-rich receptor-l...  91.3    1e-17   Brachypodium distachyon [annual false brome]
ref|XP_008648920.1|  PREDICTED: putative cysteine-rich receptor-l...  91.3    1e-17   Zea mays [maize]
gb|EAY92100.1|  hypothetical protein OsI_13806                        91.3    1e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_008648918.1|  PREDICTED: putative cysteine-rich receptor-l...  91.3    1e-17   Zea mays [maize]
ref|NP_001058414.2|  Os06g0689600                                     86.7    1e-17   
ref|XP_008648917.1|  PREDICTED: putative cysteine-rich receptor-l...  91.3    2e-17   Zea mays [maize]
ref|NP_001068421.1|  Os11g0666200                                     90.9    2e-17   
gb|EEC81213.1|  hypothetical protein OsI_24251                        90.9    2e-17   Oryza sativa Indica Group [Indian rice]
gb|EAY99718.1|  hypothetical protein OsI_21701                        90.5    2e-17   Oryza sativa Indica Group [Indian rice]
ref|NP_001056829.1|  Os06g0151700                                     90.5    2e-17   
ref|XP_004966168.1|  PREDICTED: putative cysteine-rich receptor-l...  90.5    3e-17   Setaria italica
gb|ABA98611.1|  Protein kinase domain containing protein              89.7    4e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010239007.1|  PREDICTED: uncharacterized protein LOC100829732  88.2    4e-17   
gb|EEE52533.1|  hypothetical protein OsJ_34756                        89.0    1e-16   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95202.1|  Protein kinase domain containing protein, expressed   88.6    1e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EEC72318.1|  hypothetical protein OsI_05511                        87.8    2e-16   Oryza sativa Indica Group [Indian rice]
gb|EMS60707.1|  Receptor-like serine/threonine-protein kinase SD1-8   88.2    2e-16   Triticum urartu
gb|ADB85257.1|  putative retrotransposon protein                      89.0    2e-16   Phyllostachys edulis [kikko-chiku]
gb|EAY92077.1|  hypothetical protein OsI_13782                        87.0    4e-16   Oryza sativa Indica Group [Indian rice]
dbj|BAJ88144.1|  predicted protein                                    85.9    8e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAD45621.1|  receptor protein kinase-like                         85.1    2e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82898.1|  hypothetical protein OsI_27806                        79.7    3e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_004977713.1|  PREDICTED: probable receptor-like protein ki...  84.7    3e-15   
dbj|BAD05279.1|  receptor kinase-like                                 80.1    4e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ06794.1|  hypothetical protein OsI_29039                        82.0    2e-14   Oryza sativa Indica Group [Indian rice]
dbj|BAD54275.1|  hypothetical protein                                 77.0    4e-14   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95208.1|  Protein kinase domain containing protein, expressed   81.3    6e-14   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ42543.1|  hypothetical protein OsJ_27109                        80.1    6e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663655.1|  PREDICTED: uncharacterized protein LOC102716637  80.5    1e-13   
dbj|BAJ90976.1|  predicted protein                                    79.0    2e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ97098.1|  predicted protein                                    79.0    2e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004986952.1|  PREDICTED: G-type lectin S-receptor-like ser...  78.2    3e-13   Setaria italica
ref|XP_010236930.1|  PREDICTED: cell number regulator 13-like         74.7    3e-13   
ref|XP_002449970.1|  hypothetical protein SORBIDRAFT_05g026335        76.3    5e-13   
gb|EEC68569.1|  hypothetical protein OsI_36900                        76.6    6e-13   Oryza sativa Indica Group [Indian rice]
gb|EMS46805.1|  Putative serine/threonine-protein kinase-like pro...  77.8    7e-13   Triticum urartu
gb|EMT22570.1|  Putative serine/threonine-protein kinase-like pro...  77.4    7e-13   
gb|EEE52504.1|  hypothetical protein OsJ_34707                        77.0    7e-13   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95276.1|  Protein kinase domain containing protein, expressed   77.0    7e-13   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ94356.1|  predicted protein                                    77.0    9e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC68589.1|  hypothetical protein OsI_36937                        76.6    1e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_006664922.1|  PREDICTED: putative serine/threonine-protein...  75.5    3e-12   Oryza brachyantha
dbj|BAJ94547.1|  predicted protein                                    75.5    3e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010067558.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  74.7    3e-12   
gb|EMT18704.1|  Putative serine/threonine-protein kinase-like pro...  75.1    4e-12   
gb|EMT00201.1|  hypothetical protein F775_03636                       70.9    4e-12   
ref|XP_006663098.1|  PREDICTED: putative serine/threonine-protein...  74.7    5e-12   
ref|XP_003577260.1|  PREDICTED: putative serine/threonine-protein...  74.3    6e-12   Brachypodium distachyon [annual false brome]
gb|EEE52534.1|  hypothetical protein OsJ_34757                        68.6    1e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EMT06234.1|  hypothetical protein F775_14004                       70.5    1e-11   
ref|NP_001066816.1|  Os12g0499200                                     72.0    2e-11   
gb|EEC68590.1|  hypothetical protein OsI_36938                        70.9    6e-11   Oryza sativa Indica Group [Indian rice]
gb|EMT22573.1|  Putative serine/threonine-protein kinase-like pro...  71.2    7e-11   
ref|NP_001068420.2|  Os11g0666100                                     67.8    9e-11   
gb|EMT11112.1|  Putative serine/threonine-protein kinase-like pro...  69.7    1e-10   
gb|EEC82899.1|  hypothetical protein OsI_27807                        68.6    7e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_004984958.1|  PREDICTED: putative serine/threonine-protein...  67.0    1e-09   Setaria italica
dbj|BAK02708.1|  predicted protein                                    63.9    2e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC81215.1|  hypothetical protein OsI_24255                        65.9    4e-09   Oryza sativa Indica Group [Indian rice]
gb|EMT27204.1|  hypothetical protein F775_44002                       62.8    5e-09   
ref|XP_004980847.1|  PREDICTED: cysteine-rich receptor-like prote...  65.1    6e-09   
ref|XP_002439055.1|  hypothetical protein SORBIDRAFT_10g030680        65.1    7e-09   
gb|EEE66257.1|  hypothetical protein OsJ_22442                        64.3    1e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EAY75160.1|  hypothetical protein OsI_03052                        63.9    1e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_002442644.1|  hypothetical protein SORBIDRAFT_08g000420        63.9    2e-08   Sorghum bicolor [broomcorn]
gb|ABA95159.1|  hypothetical protein LOC_Os11g44460                   59.7    2e-08   
tpg|DAA59141.1|  TPA: putative CRINKLY4-like receptor protein kin...  61.2    7e-08   
ref|NP_001131825.1|  uncharacterized LOC100193199                     61.2    1e-07   
gb|KCW53204.1|  hypothetical protein EUGRSUZ_J02474                   60.8    1e-07   
ref|NP_001058430.1|  Os06g0693000                                     61.2    1e-07   
gb|ACG27970.1|  receptor protein kinase CRINKLY4 precursor            60.8    2e-07   
gb|KCW53202.1|  hypothetical protein EUGRSUZ_J02474                   60.5    2e-07   
gb|KCW53201.1|  hypothetical protein EUGRSUZ_J02474                   60.5    2e-07   
gb|EEC81230.1|  hypothetical protein OsI_24279                        60.5    2e-07   
ref|XP_010033519.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  60.5    2e-07   
gb|EAY72265.1|  hypothetical protein OsI_00119                        59.3    3e-07   
gb|EMT06786.1|  Putative serine/threonine-protein kinase-like pro...  59.7    4e-07   
ref|XP_009389783.1|  PREDICTED: cell number regulator 13-like         58.2    5e-07   
gb|ABA95221.1|  Protein kinase domain containing protein, expressed   59.3    5e-07   
gb|ABA95218.1|  Protein kinase domain containing protein, expressed   59.3    6e-07   
gb|EEE52493.1|  hypothetical protein OsJ_34689                        58.9    6e-07   
ref|XP_006663099.1|  PREDICTED: G-type lectin S-receptor-like ser...  56.6    5e-06   
gb|EMT09971.1|  Receptor-like protein kinase ANXUR2                   55.1    1e-05   
gb|ABA95152.1|  retrotransposon protein, putative, Ty1-copia subc...  55.1    2e-05   
gb|ABF96098.1|  hypothetical protein LOC_Os03g24810                   51.2    6e-05   
gb|EEE66253.1|  hypothetical protein OsJ_22437                        51.6    2e-04   
ref|NP_001176699.1|  Os11g0664133                                     49.3    2e-04   
gb|EAY84441.1|  hypothetical protein OsI_05814                        49.7    3e-04   
dbj|BAJ96697.1|  predicted protein                                    50.1    3e-04   
gb|EAY92075.1|  hypothetical protein OsI_13780                        50.1    6e-04   
ref|XP_006657274.1|  PREDICTED: putative cysteine-rich receptor-l...  50.1    7e-04   
gb|EAZ36550.1|  hypothetical protein OsJ_20890                        46.6    0.001   



>ref|NP_001242304.1| uncharacterized protein LOC100811369 [Glycine max]
 gb|ACU17641.1| unknown [Glycine max]
Length=372

 Score =   201 bits (512),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASW+ +G+LANVAQLTG+DA++LIGMIV+AASTA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWDQMGELANVAQLTGVDAVRLIGMIVRAASTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELKKYPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  61   ISELKKYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  104



>ref|XP_004512162.1| PREDICTED: cell number regulator 13-like isoform X6 [Cicer arietinum]
Length=387

 Score =   202 bits (513),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASWEN+GD ANVAQLTG+DA+KLI MI KAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWENMGDFANVAQLTGVDAVKLIAMIAKAATTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELK+YPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  61   ISELKRYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  104



>ref|XP_004512157.1| PREDICTED: cell number regulator 13-like isoform X1 [Cicer arietinum]
 ref|XP_004512158.1| PREDICTED: cell number regulator 13-like isoform X2 [Cicer arietinum]
 ref|XP_004512159.1| PREDICTED: cell number regulator 13-like isoform X3 [Cicer arietinum]
 ref|XP_004512160.1| PREDICTED: cell number regulator 13-like isoform X4 [Cicer arietinum]
 ref|XP_004512161.1| PREDICTED: cell number regulator 13-like isoform X5 [Cicer arietinum]
Length=417

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASWEN+GD ANVAQLTG+DA+KLI MI KAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWENMGDFANVAQLTGVDAVKLIAMIAKAATTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELK+YPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  61   ISELKRYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  104



>gb|AFK40961.1| unknown [Lotus japonicus]
Length=386

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASW+++GD AN+AQLTG+DA+KLIGMIVKAASTA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWDHMGDFANIAQLTGVDAVKLIGMIVKAASTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELK+YPETREPLE LEDALRRSY+L+NSCQDRSYLYL+AMGW
Sbjct  61   ISELKRYPETREPLEQLEDALRRSYMLVNSCQDRSYLYLMAMGW  104



>ref|XP_006572883.1| PREDICTED: uncharacterized protein LOC100811369 isoform X1 [Glycine 
max]
Length=415

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASW+ +G+LANVAQLTG+DA++LIGMIV+AASTA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWDQMGELANVAQLTGVDAVRLIGMIVRAASTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELKKYPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  61   ISELKKYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  104



>ref|XP_009611045.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009611046.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
tomentosiformis]
Length=419

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASWE+ G++ANVAQLTGIDA++LIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWEHFGEIANVAQLTGIDAVRLIGMIVKAATTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            ITELK+YPETREPLE LEDALRRSYIL+ SCQDRSYLYLLAMGW
Sbjct  61   ITELKRYPETREPLEQLEDALRRSYILVKSCQDRSYLYLLAMGW  104



>ref|XP_002531154.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31239.1| conserved hypothetical protein [Ricinus communis]
Length=283

 Score =   196 bits (499),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            M+SW++ G++ANVAQLTG+DA++LIGMI KAASTA+MHKKNC+QFAQHLKLIGNLLEQLK
Sbjct  1    MSSWDHFGEIANVAQLTGLDAVRLIGMIGKAASTARMHKKNCKQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELKKYPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  61   ISELKKYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  104



>ref|XP_007157885.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 ref|XP_007157886.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 ref|XP_007157887.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 ref|XP_007157888.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 gb|ESW29879.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 gb|ESW29880.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 gb|ESW29881.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 gb|ESW29882.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
Length=416

 Score =   200 bits (508),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASW+ +G+LANVAQLTG+DA++LIGMIV+AASTA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWDQMGELANVAQLTGVDAVRLIGMIVRAASTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELK+YPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  61   ISELKRYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  104



>ref|XP_009803786.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
sylvestris]
 ref|XP_009803787.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
sylvestris]
Length=419

 Score =   200 bits (508),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASWE+ G++ANVAQLTGIDA++LIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWEHFGEIANVAQLTGIDAVRLIGMIVKAATTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            ITELK+YPETREPLE LEDALRRSYIL+ SCQDRSYLYLLAMGW
Sbjct  61   ITELKRYPETREPLEQLEDALRRSYILVKSCQDRSYLYLLAMGW  104



>ref|XP_004287784.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Fragaria vesca 
subsp. vesca]
Length=415

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASW++ GD+ANVAQLTG+DA+KLIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWDHFGDIANVAQLTGLDAVKLIGMIVKAAATARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELK+YPETREPLE LE+ALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  61   ISELKRYPETREPLEQLEEALRRSYILVNSCQDRSYLYLLAMGW  104



>dbj|BAK32933.1| mid1-complementing activity 2 [Nicotiana tabacum]
Length=419

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASWE+ G++ANVAQLTGIDA++LIGMIVKAA+TA+MHKKNCRQFAQHLKLIG+LLEQLK
Sbjct  1    MASWEHFGEIANVAQLTGIDAVRLIGMIVKAATTARMHKKNCRQFAQHLKLIGSLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            ITELK+YPETREPLE LEDALRRSYIL+ SCQDRSYLYLLAMGW
Sbjct  61   ITELKRYPETREPLEQLEDALRRSYILVKSCQDRSYLYLLAMGW  104



>ref|XP_006599316.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X5 [Glycine max]
Length=335

 Score =   195 bits (496),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +SWE  G++ANVAQLTGIDA++LIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLL+QLKI
Sbjct  3    SSWEYFGEIANVAQLTGIDAVRLIGMIVKAANTARMHKKNCRQFAQHLKLIGNLLDQLKI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELKKYPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  63   SELKKYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  105



>ref|XP_006574667.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X6 [Glycine max]
 ref|XP_006574668.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X7 [Glycine max]
Length=378

 Score =   196 bits (498),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +SWE  G++ANVAQLTGIDA+KLIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLL+QLKI
Sbjct  4    SSWEYFGEIANVAQLTGIDAVKLIGMIVKAANTARMHKKNCRQFAQHLKLIGNLLDQLKI  63

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELKKYPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  64   SELKKYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  106



>ref|XP_003519857.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Glycine max]
 gb|KHN00454.1| Protein MID1-COMPLEMENTING ACTIVITY 1 [Glycine soja]
Length=416

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +SWE  G++ANVAQLTGIDA+KLIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLL+QLKI
Sbjct  4    SSWEYFGEIANVAQLTGIDAVKLIGMIVKAANTARMHKKNCRQFAQHLKLIGNLLDQLKI  63

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELKKYPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  64   SELKKYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  106



>ref|XP_006574663.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Glycine max]
 ref|XP_006574664.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X3 [Glycine max]
 ref|XP_006574665.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X4 [Glycine max]
 ref|XP_006574666.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X5 [Glycine max]
Length=418

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +SWE  G++ANVAQLTGIDA+KLIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLL+QLKI
Sbjct  4    SSWEYFGEIANVAQLTGIDAVKLIGMIVKAANTARMHKKNCRQFAQHLKLIGNLLDQLKI  63

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELKKYPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  64   SELKKYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  106



>ref|XP_004232512.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Solanum lycopersicum]
 ref|XP_010316435.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Solanum lycopersicum]
Length=418

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MAS ++ GD+AN+AQLTGIDA++LIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASLDHFGDIANIAQLTGIDAVRLIGMIVKAAATARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            ITELK+YPETREPLE LEDALRRSY+L+NSCQDRSYLYLLAMGW
Sbjct  61   ITELKRYPETREPLEHLEDALRRSYLLVNSCQDRSYLYLLAMGW  104



>ref|XP_003612221.1| hypothetical protein MTR_5g022670 [Medicago truncatula]
 gb|AES95179.1| MID1-complementing activity-like protein [Medicago truncatula]
Length=416

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASW+++GD AN+AQLTG+DA+KLIGMIVKAASTA+MHKKNCRQFA HLKLIGNLLEQLK
Sbjct  1    MASWDHMGDFANIAQLTGVDAVKLIGMIVKAASTARMHKKNCRQFAMHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELK+YPETREPLE LEDALRRSY+L++SCQDRSYLYLLAMGW
Sbjct  61   ISELKRYPETREPLEQLEDALRRSYMLVHSCQDRSYLYLLAMGW  104



>ref|XP_012088489.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Jatropha curcas]
 ref|XP_012088490.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Jatropha curcas]
Length=418

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 102/106 (96%), Gaps = 0/106 (0%)
 Frame = +3

Query  360  VKMASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQ  539
            +KMASW+NLG+LA VAQLTG+DA++LI MI KAA+TA+MHKKNC+QFAQHLKLIGNLLEQ
Sbjct  2    LKMASWDNLGELATVAQLTGVDAVRLIAMIAKAATTARMHKKNCKQFAQHLKLIGNLLEQ  61

Query  540  LKITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            LKI+ELKKYPETREPLE LE+ALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  62   LKISELKKYPETREPLEQLEEALRRSYILVNSCQDRSYLYLLAMGW  107



>gb|KDO71309.1| hypothetical protein CISIN_1g014734mg [Citrus sinensis]
Length=409

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA+WE+ G++ANVAQL G DA++LIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MANWEHFGEIANVAQLAGFDAVRLIGMIVKAATTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELKKYPETREPLE LEDALRRSY+L+NSCQDRSYLYLLAMGW
Sbjct  61   ISELKKYPETREPLEQLEDALRRSYLLVNSCQDRSYLYLLAMGW  104



>ref|XP_006340771.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006340772.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Solanum tuberosum]
Length=418

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MAS ++ GD+AN+AQLTGIDA++LIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASLDHFGDVANIAQLTGIDAVRLIGMIVKAAATARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            ITELK+YPETREPLE LEDALRRSY+L+NSCQDRSYLYLLAMGW
Sbjct  61   ITELKRYPETREPLEHLEDALRRSYLLVNSCQDRSYLYLLAMGW  104



>ref|XP_003629262.1| Cornifelin [Medicago truncatula]
 gb|AET03738.1| MID1-complementing activity-like protein [Medicago truncatula]
Length=424

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +SWE  G++ANVAQLTG+DA+KLIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLL+QLKI
Sbjct  3    SSWEQFGEIANVAQLTGLDAVKLIGMIVKAANTARMHKKNCRQFAQHLKLIGNLLDQLKI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELKKYPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  63   SELKKYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  105



>ref|XP_007156188.1| hypothetical protein PHAVU_003G265800g [Phaseolus vulgaris]
 ref|XP_007156189.1| hypothetical protein PHAVU_003G265800g [Phaseolus vulgaris]
 gb|ESW28182.1| hypothetical protein PHAVU_003G265800g [Phaseolus vulgaris]
 gb|ESW28183.1| hypothetical protein PHAVU_003G265800g [Phaseolus vulgaris]
Length=415

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +SWE  G++ANVAQLTGIDA++LIGMIVKAASTA+MHKKNCRQFAQHLKLIGNLL+QLKI
Sbjct  3    SSWEYFGEIANVAQLTGIDAVRLIGMIVKAASTARMHKKNCRQFAQHLKLIGNLLDQLKI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELKKYPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  63   SELKKYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  105



>ref|XP_004146155.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Cucumis sativus]
 gb|KGN55644.1| hypothetical protein Csa_3G002640 [Cucumis sativus]
Length=418

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            M+SWE LG++ANVAQLTGIDA++LI MIVK+ASTA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MSSWETLGEIANVAQLTGIDAVRLISMIVKSASTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELK+YPETREPLE LE+ALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  61   ISELKRYPETREPLEQLEEALRRSYILVNSCQDRSYLYLLAMGW  104



>gb|KDO71305.1| hypothetical protein CISIN_1g014734mg [Citrus sinensis]
 gb|KDO71306.1| hypothetical protein CISIN_1g014734mg [Citrus sinensis]
 gb|KDO71307.1| hypothetical protein CISIN_1g014734mg [Citrus sinensis]
 gb|KDO71308.1| hypothetical protein CISIN_1g014734mg [Citrus sinensis]
Length=419

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA+WE+ G++ANVAQL G DA++LIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MANWEHFGEIANVAQLAGFDAVRLIGMIVKAATTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELKKYPETREPLE LEDALRRSY+L+NSCQDRSYLYLLAMGW
Sbjct  61   ISELKKYPETREPLEQLEDALRRSYLLVNSCQDRSYLYLLAMGW  104



>ref|XP_008448524.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Cucumis melo]
Length=418

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            M+SWE LG++ANVAQLTGIDA++LI MIVK+ASTA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MSSWETLGEIANVAQLTGIDAVRLISMIVKSASTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELK+YPETREPLE LE+ALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  61   ISELKRYPETREPLEQLEEALRRSYILVNSCQDRSYLYLLAMGW  104



>gb|KHN35538.1| Protein MID1-COMPLEMENTING ACTIVITY 1 [Glycine soja]
Length=415

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +SWE  G++ANVAQLTGIDA++LIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLL+QLKI
Sbjct  3    SSWEYFGEIANVAQLTGIDAVRLIGMIVKAANTARMHKKNCRQFAQHLKLIGNLLDQLKI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELKKYPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  63   SELKKYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  105



>ref|XP_009363461.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Pyrus x bretschneideri]
Length=415

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASW++LG++ANVAQLTG+DA++LIG+IVKAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWDHLGEIANVAQLTGLDAVRLIGLIVKAANTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELK+YPETREPLE LE+ALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  61   ISELKRYPETREPLEQLEEALRRSYILVNSCQDRSYLYLLAMGW  104



>ref|XP_003548830.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Glycine max]
Length=415

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +SWE  G++ANVAQLTGIDA++LIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLL+QLKI
Sbjct  3    SSWEYFGEIANVAQLTGIDAVRLIGMIVKAANTARMHKKNCRQFAQHLKLIGNLLDQLKI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELKKYPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  63   SELKKYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  105



>ref|XP_009801746.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
sylvestris]
 ref|XP_009801747.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
sylvestris]
Length=419

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA+WE+ G++AN AQL G+DA++LIGMIVKAASTA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MATWEHFGEVANFAQLAGLDAVRLIGMIVKAASTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            ITELKKYPETREPLE LEDALRRSY+L+ SCQDRSYLYLLAMGW
Sbjct  61   ITELKKYPETREPLEYLEDALRRSYMLVQSCQDRSYLYLLAMGW  104



>emb|CAN71842.1| hypothetical protein VITISV_036262 [Vitis vinifera]
Length=425

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +3

Query  357  GVKMASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLE  536
            G+KMA+WE+ G++ANVAQLTG+DA++LIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLE
Sbjct  95   GLKMATWEHFGEIANVAQLTGVDAVRLIGMIVSAANTARMHKKNCRQFAQHLKLIGNLLE  154

Query  537  QLKITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            QLKI+ELK+YPE REPLE LED+LRR YIL+NSCQDRSYLYLLAMGW
Sbjct  155  QLKISELKRYPEMREPLEQLEDSLRRGYILVNSCQDRSYLYLLAMGW  201



>ref|XP_006466999.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006467000.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Citrus sinensis]
Length=419

 Score =   195 bits (496),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA+WE+ G++ANVAQL G DA++LIG+IVKAASTA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MANWEHFGEIANVAQLAGFDAVRLIGLIVKAASTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELKKYPETREPLE LEDALRRSY+L+NSCQDRSYLYLLAMGW
Sbjct  61   ISELKKYPETREPLEQLEDALRRSYLLVNSCQDRSYLYLLAMGW  104



>ref|XP_006425392.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 ref|XP_006425393.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 ref|XP_006425394.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 ref|XP_006425395.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 ref|XP_006425396.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 gb|ESR38632.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 gb|ESR38633.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 gb|ESR38634.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 gb|ESR38635.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 gb|ESR38636.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
Length=419

 Score =   195 bits (496),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA+WE+ G++ANVAQL G DA++LIG+IVKAASTA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MANWEHFGEIANVAQLAGFDAVRLIGLIVKAASTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELKKYPETREPLE LEDALRRSY+L+NSCQDRSYLYLLAMGW
Sbjct  61   ISELKKYPETREPLEQLEDALRRSYLLVNSCQDRSYLYLLAMGW  104



>ref|XP_004509394.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004509395.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Cicer arietinum]
 ref|XP_004509396.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X3 [Cicer arietinum]
Length=424

 Score =   195 bits (496),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 101/103 (98%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +SWE+ G++ANVAQLTG+DA++LIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLL+QLKI
Sbjct  3    SSWEHFGEIANVAQLTGLDAVRLIGMIVKAANTARMHKKNCRQFAQHLKLIGNLLDQLKI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELKKYPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  63   SELKKYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  105



>ref|XP_008352422.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Malus 
domestica]
 ref|XP_008352423.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Malus 
domestica]
Length=415

 Score =   195 bits (496),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASW+ LG++ANVAQLTG+DA++LIG+IVKAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWDQLGEIANVAQLTGLDAVRLIGLIVKAANTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELK+YPETREPLE LE+ALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  61   ISELKRYPETREPLEQLEEALRRSYILVNSCQDRSYLYLLAMGW  104



>ref|XP_006599313.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Glycine max]
 ref|XP_006599314.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X3 [Glycine max]
 ref|XP_006599315.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X4 [Glycine max]
Length=432

 Score =   195 bits (495),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +SWE  G++ANVAQLTGIDA++LIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLL+QLKI
Sbjct  3    SSWEYFGEIANVAQLTGIDAVRLIGMIVKAANTARMHKKNCRQFAQHLKLIGNLLDQLKI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELKKYPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  63   SELKKYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  105



>gb|KDP23985.1| hypothetical protein JCGZ_25373 [Jatropha curcas]
Length=415

 Score =   194 bits (494),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASW+NLG+LA VAQLTG+DA++LI MI KAA+TA+MHKKNC+QFAQHLKLIGNLLEQLK
Sbjct  1    MASWDNLGELATVAQLTGVDAVRLIAMIAKAATTARMHKKNCKQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELKKYPETREPLE LE+ALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  61   ISELKKYPETREPLEQLEEALRRSYILVNSCQDRSYLYLLAMGW  104



>tpg|DAA43437.1| TPA: putative cell number regulator 13 [Zea mays]
Length=163

 Score =   187 bits (474),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASW+NLG+L+N+AQLTG+DA+KLI +IV+AASTA++HK+NCR+FAQHLKLIG LLEQL+
Sbjct  1    MASWDNLGELSNIAQLTGLDAVKLISLIVRAASTARLHKRNCRRFAQHLKLIGGLLEQLR  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            ++EL+KYPETREPLE LEDALRR Y+L+NSCQDRSYLYLLAMGW
Sbjct  61   VSELRKYPETREPLEQLEDALRRGYLLVNSCQDRSYLYLLAMGW  104



>ref|XP_009624357.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009624358.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
tomentosiformis]
 dbj|BAK32932.1| mid1-complementing activity 1 [Nicotiana tabacum]
Length=419

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA+WE+ G++AN AQL G+DA++LIGMIVKAASTA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MATWEHFGEVANFAQLAGLDAVRLIGMIVKAASTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            ITELKKYPETREPLE LEDALRRSY+L++SC DRSYLYLLAMGW
Sbjct  61   ITELKKYPETREPLEYLEDALRRSYMLVHSCHDRSYLYLLAMGW  104



>ref|XP_006343349.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006343350.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006343351.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X3 [Solanum tuberosum]
Length=419

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA+WE+ G++AN AQL G+DA+KLIG+IVKAASTA+MHKKNCRQFAQHLKLIGNLLEQL+
Sbjct  1    MATWEHFGEIANGAQLAGLDAVKLIGLIVKAASTARMHKKNCRQFAQHLKLIGNLLEQLR  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            ITELKKYPET EPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  61   ITELKKYPETSEPLEYLEDALRRSYILVNSCQDRSYLYLLAMGW  104



>ref|XP_008807147.1| PREDICTED: cell number regulator 13-like [Phoenix dactylifera]
 ref|XP_008807148.1| PREDICTED: cell number regulator 13-like [Phoenix dactylifera]
Length=421

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +SW+ LG+++NVAQLTG+DA++LIGMIVKAASTA+MHKKNCR FAQHLKLIGNLLEQLKI
Sbjct  3    SSWDQLGEISNVAQLTGLDAVRLIGMIVKAASTARMHKKNCRHFAQHLKLIGNLLEQLKI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELKKYPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  63   SELKKYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  105



>emb|CDP01861.1| unnamed protein product [Coffea canephora]
Length=419

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            M++WE+ G++ANVAQLTG+DA++LIGMIV+AA+TA++HKKNCRQFA HLKLIGNLLEQLK
Sbjct  1    MSTWEHFGEIANVAQLTGVDAVRLIGMIVQAANTARLHKKNCRQFAMHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELKKYPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  61   ISELKKYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  104



>ref|XP_010933353.1| PREDICTED: cell number regulator 13-like isoform X2 [Elaeis guineensis]
Length=402

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +SW+ LG++ANVAQLTG+DA++LIGMIVKAASTA+MHKKNCR FAQHLKLIGNLLEQL+I
Sbjct  3    SSWDQLGEIANVAQLTGLDAVRLIGMIVKAASTARMHKKNCRLFAQHLKLIGNLLEQLRI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELKKYPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  63   SELKKYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  105



>ref|XP_010933352.1| PREDICTED: cell number regulator 13-like isoform X1 [Elaeis guineensis]
Length=421

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +SW+ LG++ANVAQLTG+DA++LIGMIVKAASTA+MHKKNCR FAQHLKLIGNLLEQL+I
Sbjct  3    SSWDQLGEIANVAQLTGLDAVRLIGMIVKAASTARMHKKNCRLFAQHLKLIGNLLEQLRI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELKKYPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  63   SELKKYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  105



>ref|XP_006383064.1| hypothetical protein POPTR_0005s11200g [Populus trichocarpa]
 gb|ERP60861.1| hypothetical protein POPTR_0005s11200g [Populus trichocarpa]
Length=419

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA+WE+LG++ANV QLTGIDA++LI MI KAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MATWEHLGEVANVVQLTGIDAVRLIAMIGKAATTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELK+YPETREPLE LEDALRRSY+L+NSCQDRSYLYLLAMGW
Sbjct  61   ISELKRYPETREPLEQLEDALRRSYLLVNSCQDRSYLYLLAMGW  104



>ref|XP_009408218.1| PREDICTED: cell number regulator 13-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=405

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASWE LG+LA VAQLTG+DA++LIG+IV+AA+TA+MH+KNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWEQLGELATVAQLTGVDAVRLIGLIVQAATTARMHRKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELKKYPETREPLE LEDALRRSYIL++SCQ+RSYLYLLAMGW
Sbjct  61   ISELKKYPETREPLEQLEDALRRSYILVDSCQNRSYLYLLAMGW  104



>gb|KJB17609.1| hypothetical protein B456_003G007400 [Gossypium raimondii]
Length=378

 Score =   191 bits (486),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASWE+ G++ANVAQL G DA++LI MIVKAASTA+MHKK+CRQFAQHLKLIGNLLEQL+
Sbjct  1    MASWEHFGEIANVAQLAGFDAVRLIAMIVKAASTARMHKKSCRQFAQHLKLIGNLLEQLR  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELKKYPETREPLE LEDALRRSYIL+NSCQ+RSYLY+LAMGW
Sbjct  61   ISELKKYPETREPLEQLEDALRRSYILVNSCQERSYLYVLAMGW  104



>ref|XP_009408217.1| PREDICTED: cell number regulator 13-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=410

 Score =   192 bits (488),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASWE LG+LA VAQLTG+DA++LIG+IV+AA+TA+MH+KNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWEQLGELATVAQLTGVDAVRLIGLIVQAATTARMHRKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELKKYPETREPLE LEDALRRSYIL++SCQ+RSYLYLLAMGW
Sbjct  61   ISELKKYPETREPLEQLEDALRRSYILVDSCQNRSYLYLLAMGW  104



>ref|XP_011043148.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Populus euphratica]
 ref|XP_011043149.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Populus euphratica]
Length=419

 Score =   192 bits (489),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA+WE+LG++ANV QLTGIDA++LI MI KAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MATWEHLGEVANVVQLTGIDAVRLIAMIGKAATTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELK+YPETREPLE LEDALRRSY+L+NSCQDRSYLYLLAMGW
Sbjct  61   ISELKRYPETREPLEQLEDALRRSYLLVNSCQDRSYLYLLAMGW  104



>ref|XP_010029652.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Eucalyptus grandis]
Length=417

 Score =   192 bits (488),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA+WE  G++ANVAQLTG+DA +LIGMIV+AA+TA+MHK+NCRQFAQHLKLIGNLLEQLK
Sbjct  1    MATWEAFGEVANVAQLTGLDATRLIGMIVQAANTARMHKRNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELK+YPETREP+E LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  61   ISELKRYPETREPIEQLEDALRRSYILVNSCQDRSYLYLLAMGW  104



>ref|XP_009408216.1| PREDICTED: cell number regulator 13-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=415

 Score =   192 bits (488),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASWE LG+LA VAQLTG+DA++LIG+IV+AA+TA+MH+KNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWEQLGELATVAQLTGVDAVRLIGLIVQAATTARMHRKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELKKYPETREPLE LEDALRRSYIL++SCQ+RSYLYLLAMGW
Sbjct  61   ISELKKYPETREPLEQLEDALRRSYILVDSCQNRSYLYLLAMGW  104



>ref|XP_010029651.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Eucalyptus grandis]
Length=418

 Score =   192 bits (488),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA+WE  G++ANVAQLTG+DA +LIGMIV+AA+TA+MHK+NCRQFAQHLKLIGNLLEQLK
Sbjct  1    MATWEAFGEVANVAQLTGLDATRLIGMIVQAANTARMHKRNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELK+YPETREP+E LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  61   ISELKRYPETREPIEQLEDALRRSYILVNSCQDRSYLYLLAMGW  104



>ref|XP_008242042.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X2 [Prunus 
mume]
Length=385

 Score =   191 bits (486),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +SW++ G++ANVAQLTG+DA++LIGMIVKAASTA+MHKKNCRQFA HLKLIGNLLEQLKI
Sbjct  3    SSWDHFGEIANVAQLTGLDAVRLIGMIVKAASTARMHKKNCRQFALHLKLIGNLLEQLKI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELK+YPETREPLE LE+ALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  63   SELKRYPETREPLEQLEEALRRSYILVNSCQDRSYLYLLAMGW  105



>ref|XP_010531102.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
 ref|XP_010531103.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
 ref|XP_010531104.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
 ref|XP_010531105.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
 ref|XP_010531106.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
Length=416

 Score =   192 bits (487),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW++LGD+A+VAQLTG+DA++LIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDHLGDIASVAQLTGLDAVRLIGMIVSAANTARMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            ELKKYPETREPLE LE+ALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  64   ELKKYPETREPLEQLEEALRRSYILVNSCQDRSYLYLLAMGW  105



>gb|KHG25004.1| mid1-complementing activity 1 -like protein [Gossypium arboreum]
Length=418

 Score =   192 bits (487),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASWE+ G++ANVAQL G DA++LI MIVKAASTA+MHKK+CRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWEHFGEIANVAQLAGFDAVRLIAMIVKAASTARMHKKSCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELKKYPETREPLE LEDALRRSYIL+NSCQ+RSYLY+LAMGW
Sbjct  61   ISELKKYPETREPLEQLEDALRRSYILVNSCQERSYLYVLAMGW  104



>ref|XP_009386557.1| PREDICTED: cell number regulator 13-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=384

 Score =   191 bits (485),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +SWE +GD+ANV QLTG+DA++LIGMIVKAAS A+MHKKNCR+FAQHLKLIG+LLEQLKI
Sbjct  3    SSWEYMGDMANVVQLTGLDAVRLIGMIVKAASVARMHKKNCRRFAQHLKLIGSLLEQLKI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELK+YPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  63   SELKRYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  105



>ref|XP_002272810.2| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Vitis vinifera]
Length=420

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA+WE+ G++ANVAQLTG+DA++LIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MATWEHFGEIANVAQLTGVDAVRLIGMIVSAANTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELK+YPE REPLE LED+LRR YIL+NSCQDRSYLYLLAMGW
Sbjct  61   ISELKRYPEMREPLEQLEDSLRRGYILVNSCQDRSYLYLLAMGW  104



>ref|XP_009386556.1| PREDICTED: cell number regulator 13-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=385

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +SWE +GD+ANV QLTG+DA++LIGMIVKAAS A+MHKKNCR+FAQHLKLIG+LLEQLKI
Sbjct  3    SSWEYMGDMANVVQLTGLDAVRLIGMIVKAASVARMHKKNCRRFAQHLKLIGSLLEQLKI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELK+YPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  63   SELKRYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  105



>ref|XP_009386559.1| PREDICTED: cell number regulator 13-like isoform X4 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009386560.1| PREDICTED: cell number regulator 13-like isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +SWE +GD+ANV QLTG+DA++LIGMIVKAAS A+MHKKNCR+FAQHLKLIG+LLEQLKI
Sbjct  3    SSWEYMGDMANVVQLTGLDAVRLIGMIVKAASVARMHKKNCRRFAQHLKLIGSLLEQLKI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELK+YPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  63   SELKRYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  105



>ref|XP_011658059.1| PREDICTED: cell number regulator 13 isoform X2 [Cucumis sativus]
Length=337

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            M+SW++LGD+A VAQLTGI+A++LI MIVKAA+TA+MHKKNC+QFAQHLKLIGNLL+QLK
Sbjct  1    MSSWDSLGDVAGVAQLTGINAVQLISMIVKAANTARMHKKNCKQFAQHLKLIGNLLDQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+E+KKYPETREPLE LEDALR+SYILINSCQDRSYLYLLAMGW
Sbjct  61   ISEMKKYPETREPLEQLEDALRKSYILINSCQDRSYLYLLAMGW  104



>gb|KCW56602.1| hypothetical protein EUGRSUZ_I02323 [Eucalyptus grandis]
Length=472

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA+WE  G++ANVAQLTG+DA +LIGMIV+AA+TA+MHK+NCRQFAQHLKLIGNLLEQLK
Sbjct  1    MATWEAFGEVANVAQLTGLDATRLIGMIVQAANTARMHKRNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELK+YPETREP+E LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  61   ISELKRYPETREPIEQLEDALRRSYILVNSCQDRSYLYLLAMGW  104



>gb|KHN36012.1| Protein MID1-COMPLEMENTING ACTIVITY 1 [Glycine soja]
Length=409

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = +3

Query  384  LGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKK  563
            +G+LANVAQLTG+DA++LIGMIV+AASTA+MHKKNCRQFAQHLKLIGNLLEQLKI+ELKK
Sbjct  1    MGELANVAQLTGVDAVRLIGMIVRAASTARMHKKNCRQFAQHLKLIGNLLEQLKISELKK  60

Query  564  YPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            YPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  61   YPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  98



>gb|KGN48940.1| hypothetical protein Csa_6G507150 [Cucumis sativus]
Length=336

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            M+SW++LGD+A VAQLTGI+A++LI MIVKAA+TA+MHKKNC+QFAQHLKLIGNLL+QLK
Sbjct  1    MSSWDSLGDVAGVAQLTGINAVQLISMIVKAANTARMHKKNCKQFAQHLKLIGNLLDQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+E+KKYPETREPLE LEDALR+SYILINSCQDRSYLYLLAMGW
Sbjct  61   ISEMKKYPETREPLEQLEDALRKSYILINSCQDRSYLYLLAMGW  104



>ref|XP_007202160.1| hypothetical protein PRUPE_ppa006351mg [Prunus persica]
 gb|EMJ03359.1| hypothetical protein PRUPE_ppa006351mg [Prunus persica]
Length=416

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +SW++ G++ANVAQLTG+DA++LIGMIVKAASTA+MHKKNCRQFA HLKLIGNLLEQLKI
Sbjct  3    SSWDHFGEIANVAQLTGLDAVRLIGMIVKAASTARMHKKNCRQFALHLKLIGNLLEQLKI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELK+YPETREPLE LE+ALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  63   SELKRYPETREPLEQLEEALRRSYILVNSCQDRSYLYLLAMGW  105



>ref|XP_008242040.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Prunus 
mume]
 ref|XP_008242041.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Prunus 
mume]
Length=416

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +SW++ G++ANVAQLTG+DA++LIGMIVKAASTA+MHKKNCRQFA HLKLIGNLLEQLKI
Sbjct  3    SSWDHFGEIANVAQLTGLDAVRLIGMIVKAASTARMHKKNCRQFALHLKLIGNLLEQLKI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELK+YPETREPLE LE+ALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  63   SELKRYPETREPLEQLEEALRRSYILVNSCQDRSYLYLLAMGW  105



>ref|XP_011099884.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Sesamum indicum]
 ref|XP_011099885.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Sesamum indicum]
 ref|XP_011099886.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Sesamum indicum]
 ref|XP_011099887.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Sesamum indicum]
Length=416

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            M++WE+ G++ANVAQL G+DA  LIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLLE L+
Sbjct  1    MSTWEHFGEIANVAQLAGVDAASLIGMIVKAANTARMHKKNCRQFAQHLKLIGNLLESLR  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELKKYPETREPLE LEDALRRSYIL+NSCQDRSY YLLAMGW
Sbjct  61   ISELKKYPETREPLEQLEDALRRSYILVNSCQDRSYFYLLAMGW  104



>gb|KJB17606.1| hypothetical protein B456_003G007400 [Gossypium raimondii]
 gb|KJB17607.1| hypothetical protein B456_003G007400 [Gossypium raimondii]
 gb|KJB17608.1| hypothetical protein B456_003G007400 [Gossypium raimondii]
Length=418

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASWE+ G++ANVAQL G DA++LI MIVKAASTA+MHKK+CRQFAQHLKLIGNLLEQL+
Sbjct  1    MASWEHFGEIANVAQLAGFDAVRLIAMIVKAASTARMHKKSCRQFAQHLKLIGNLLEQLR  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELKKYPETREPLE LEDALRRSYIL+NSCQ+RSYLY+LAMGW
Sbjct  61   ISELKKYPETREPLEQLEDALRRSYILVNSCQERSYLYVLAMGW  104



>ref|XP_009386555.1| PREDICTED: cell number regulator 13-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=423

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +SWE +GD+ANV QLTG+DA++LIGMIVKAAS A+MHKKNCR+FAQHLKLIG+LLEQLKI
Sbjct  3    SSWEYMGDMANVVQLTGLDAVRLIGMIVKAASVARMHKKNCRRFAQHLKLIGSLLEQLKI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELK+YPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  63   SELKRYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  105



>ref|XP_008440857.1| PREDICTED: cell number regulator 13 isoform X2 [Cucumis melo]
Length=336

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            M+SW++LGD+A+VAQLTGI+A++LI MIVKAA+TA+MHKKNC+QFAQHLKLIGNLL+QLK
Sbjct  1    MSSWDSLGDVASVAQLTGINAVQLISMIVKAANTARMHKKNCKQFAQHLKLIGNLLDQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+EL KYPETREPLE LEDALR+SYILINSCQDRSYLYLLAMGW
Sbjct  61   ISELTKYPETREPLEQLEDALRKSYILINSCQDRSYLYLLAMGW  104



>ref|XP_010920111.1| PREDICTED: cell number regulator 13-like [Elaeis guineensis]
 ref|XP_010920112.1| PREDICTED: cell number regulator 13-like [Elaeis guineensis]
Length=414

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +SW+ +G+++NVAQLTG+DA++LIGMIVKAASTA+MHK+NCR FA+HLKLIGNLLEQLKI
Sbjct  3    SSWDQMGEISNVAQLTGLDAVRLIGMIVKAASTARMHKRNCRHFAKHLKLIGNLLEQLKI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELKKYPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  63   SELKKYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  105



>ref|XP_009418750.1| PREDICTED: cell number regulator 13-like [Musa acuminata subsp. 
malaccensis]
Length=418

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASWE LG+L+ VAQLTG+DA +LIG+IV+AA+TA+MH+KNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWEQLGELSTVAQLTGLDAGRLIGLIVQAATTARMHRKNCRQFAQHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELKKYPETREPLE LEDALRRSYIL++SCQ+RSYLYLLAMGW
Sbjct  61   ISELKKYPETREPLEQLEDALRRSYILVDSCQNRSYLYLLAMGW  104



>ref|XP_004135021.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Cucumis 
sativus]
Length=416

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            M+SW++LGD+A VAQLTGI+A++LI MIVKAA+TA+MHKKNC+QFAQHLKLIGNLL+QLK
Sbjct  1    MSSWDSLGDVAGVAQLTGINAVQLISMIVKAANTARMHKKNCKQFAQHLKLIGNLLDQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+E+KKYPETREPLE LEDALR+SYILINSCQDRSYLYLLAMGW
Sbjct  61   ISEMKKYPETREPLEQLEDALRKSYILINSCQDRSYLYLLAMGW  104



>ref|XP_008809428.1| PREDICTED: cell number regulator 13-like isoform X3 [Phoenix 
dactylifera]
Length=397

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 101/103 (98%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +S++ LG++ANVAQLTG+DA++LIGMIVKAA+TA+MHKKNCR+FAQHLKLIGNLLEQL+I
Sbjct  3    SSFDQLGEIANVAQLTGLDAVRLIGMIVKAAATARMHKKNCRKFAQHLKLIGNLLEQLRI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELKKYPET+EPLE LEDALRRSY+L+NSCQDRSYLYLLAMGW
Sbjct  63   SELKKYPETQEPLEQLEDALRRSYVLVNSCQDRSYLYLLAMGW  105



>ref|XP_010113309.1| hypothetical protein L484_026640 [Morus notabilis]
 gb|EXC35316.1| hypothetical protein L484_026640 [Morus notabilis]
Length=397

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 100/105 (95%), Gaps = 1/105 (1%)
 Frame = +3

Query  366  MAS-WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQL  542
            MAS WE+ G++AN+AQL G+DA++LI +IVKAASTA+MHKKNCRQF+QHLKLIGNLLEQL
Sbjct  1    MASQWEHFGEIANIAQLAGLDAIRLIALIVKAASTARMHKKNCRQFSQHLKLIGNLLEQL  60

Query  543  KITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            KI+ELK+YPETREPLE LEDALRRSY+L+NSCQDRSYLYLLAMGW
Sbjct  61   KISELKRYPETREPLEQLEDALRRSYVLVNSCQDRSYLYLLAMGW  105



>ref|XP_010266008.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nelumbo 
nucifera]
 ref|XP_010266009.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nelumbo 
nucifera]
 ref|XP_010266010.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nelumbo 
nucifera]
Length=420

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            ++W++LG++ NVAQLTG+DA++LIGMIV+AASTA+MHKKNCRQFA HLKLIGNLL+QLKI
Sbjct  3    SAWDHLGEIGNVAQLTGLDAVRLIGMIVQAASTARMHKKNCRQFALHLKLIGNLLQQLKI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELKKYPETREPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  63   SELKKYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGW  105



>ref|XP_009379353.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379354.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379355.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379356.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379357.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379358.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379359.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
Length=412

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 100/104 (96%), Gaps = 3/104 (3%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MAS+   G+LANVAQLTG+DA++LIGMIVKAASTA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASF---GELANVAQLTGVDAVRLIGMIVKAASTARMHKKNCRQFAQHLKLIGNLLEQLK  57

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELK+YPETREPLE LE+ALRRSYIL++SCQDRSYLYLLAMGW
Sbjct  58   ISELKRYPETREPLEQLEEALRRSYILVSSCQDRSYLYLLAMGW  101



>ref|XP_008809427.1| PREDICTED: cell number regulator 13-like isoform X2 [Phoenix 
dactylifera]
Length=420

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 101/103 (98%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +S++ LG++ANVAQLTG+DA++LIGMIVKAA+TA+MHKKNCR+FAQHLKLIGNLLEQL+I
Sbjct  3    SSFDQLGEIANVAQLTGLDAVRLIGMIVKAAATARMHKKNCRKFAQHLKLIGNLLEQLRI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELKKYPET+EPLE LEDALRRSY+L+NSCQDRSYLYLLAMGW
Sbjct  63   SELKKYPETQEPLEQLEDALRRSYVLVNSCQDRSYLYLLAMGW  105



>ref|XP_008809426.1| PREDICTED: cell number regulator 13-like isoform X1 [Phoenix 
dactylifera]
Length=421

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 101/103 (98%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +S++ LG++ANVAQLTG+DA++LIGMIVKAA+TA+MHKKNCR+FAQHLKLIGNLLEQL+I
Sbjct  3    SSFDQLGEIANVAQLTGLDAVRLIGMIVKAAATARMHKKNCRKFAQHLKLIGNLLEQLRI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELKKYPET+EPLE LEDALRRSY+L+NSCQDRSYLYLLAMGW
Sbjct  63   SELKKYPETQEPLEQLEDALRRSYVLVNSCQDRSYLYLLAMGW  105



>ref|XP_008440854.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440855.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440856.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Cucumis 
melo]
Length=415

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            M+SW++LGD+A+VAQLTGI+A++LI MIVKAA+TA+MHKKNC+QFAQHLKLIGNLL+QLK
Sbjct  1    MSSWDSLGDVASVAQLTGINAVQLISMIVKAANTARMHKKNCKQFAQHLKLIGNLLDQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+EL KYPETREPLE LEDALR+SYILINSCQDRSYLYLLAMGW
Sbjct  61   ISELTKYPETREPLEQLEDALRKSYILINSCQDRSYLYLLAMGW  104



>ref|XP_006412042.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 ref|XP_006412043.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 ref|XP_006412044.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 ref|XP_006412045.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 gb|ESQ53495.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 gb|ESQ53496.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 gb|ESQ53497.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 gb|ESQ53498.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
Length=418

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+KKYPETREPLE LEDALRRSYIL+NSC+DRSYLYLLAMGW
Sbjct  64   EMKKYPETREPLEGLEDALRRSYILVNSCRDRSYLYLLAMGW  105



>gb|EYU36803.1| hypothetical protein MIMGU_mgv1a011010mg [Erythranthe guttata]
Length=295

 Score =   184 bits (468),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            M SWE  G++ANV QL+G++A+ LIG+IVKAASTA+MHK+NCRQFAQH+K+IGNLLEQLK
Sbjct  1    MGSWEQFGEIANVVQLSGLNAISLIGLIVKAASTARMHKQNCRQFAQHVKMIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            ITELK+YPETREPLE LEDALRR+Y+L+NSCQ+RSYLYL+AMGW
Sbjct  61   ITELKRYPETREPLEHLEDALRRAYLLVNSCQERSYLYLMAMGW  104



>ref|NP_001049013.1| Os03g0157300 [Oryza sativa Japonica Group]
 gb|ABF94063.1| Protein of unknown function, DUF614 containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF10927.1| Os03g0157300 [Oryza sativa Japonica Group]
 gb|EEC74547.1| hypothetical protein OsI_10083 [Oryza sativa Indica Group]
 dbj|BAJ40168.1| mid1-complementing activity 1 [Oryza sativa Japonica Group]
Length=418

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASWENLGD+A V QLTG+DA++LI MIVKAASTA++HK+NCR+FAQHLKLIG LLEQL+
Sbjct  1    MASWENLGDVATVVQLTGLDAVRLISMIVKAASTARLHKRNCRRFAQHLKLIGGLLEQLR  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            ++ELKKYPETREPLE LEDALRR+Y+L++SCQDRSYLYLLAMGW
Sbjct  61   VSELKKYPETREPLEQLEDALRRAYLLVHSCQDRSYLYLLAMGW  104



>dbj|BAH20129.1| AT4G35920 [Arabidopsis thaliana]
Length=421

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+KKYPETREPLE LEDALRRSY+L+NSC+DRSYLYLLAMGW
Sbjct  64   EMKKYPETREPLERLEDALRRSYLLVNSCRDRSYLYLLAMGW  105



>emb|CDX75539.1| BnaA01g01630D [Brassica napus]
Length=419

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+KKYPETREPLE LEDALRRSYIL+NSC+DRSYLYLLAMGW
Sbjct  64   EMKKYPETREPLEGLEDALRRSYILVNSCRDRSYLYLLAMGW  105



>ref|XP_010526810.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
 ref|XP_010526811.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
Length=409

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW++LG++++VAQLTG+DA++LIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLL QLKI+
Sbjct  4    SWDHLGEISSVAQLTGLDAVRLIGMIVSAANTARMHKKNCRQFAQHLKLIGNLLGQLKIS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            ELKKYPETREPLE LED+LRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  64   ELKKYPETREPLEQLEDSLRRSYILVNSCQDRSYLYLLAMGW  105



>gb|KJB43289.1| hypothetical protein B456_007G192000 [Gossypium raimondii]
 gb|KJB43290.1| hypothetical protein B456_007G192000 [Gossypium raimondii]
 gb|KJB43291.1| hypothetical protein B456_007G192000 [Gossypium raimondii]
Length=416

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 98/105 (93%), Gaps = 1/105 (1%)
 Frame = +3

Query  366  MAS-WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQL  542
            MAS WE+ G++ANVAQL G DA++LI MI KAASTA+MHKKNCRQFAQHLKLIGNLLEQL
Sbjct  1    MASVWEHFGEVANVAQLAGFDAVRLIAMIGKAASTARMHKKNCRQFAQHLKLIGNLLEQL  60

Query  543  KITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            KI+ELK+YPETREPLE LEDALRR+YIL+NSCQDRSYLYLLAMGW
Sbjct  61   KISELKRYPETREPLEQLEDALRRAYILVNSCQDRSYLYLLAMGW  105



>emb|CDX69186.1| BnaC01g02670D [Brassica napus]
Length=420

 Score =   187 bits (474),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+KKYPETREPLE LEDALRRSYIL+NSC+DRSYLYLLAMGW
Sbjct  64   EMKKYPETREPLEGLEDALRRSYILVNSCRDRSYLYLLAMGW  105



>ref|NP_195317.2| protein MID1-complementing activity 1 [Arabidopsis thaliana]
 ref|NP_849503.1| protein MID1-complementing activity 1 [Arabidopsis thaliana]
 ref|NP_849504.2| protein MID1-complementing activity 1 [Arabidopsis thaliana]
 sp|Q8L7E9.1|MCAC1_ARATH RecName: Full=Protein MID1-COMPLEMENTING ACTIVITY 1 [Arabidopsis 
thaliana]
 gb|AAM96959.1| putative protein [Arabidopsis thaliana]
 gb|AAO30093.1| putative protein [Arabidopsis thaliana]
 dbj|BAF46389.1| Mca1 [Arabidopsis thaliana]
 dbj|BAH19557.1| AT4G35920 [Arabidopsis thaliana]
 gb|AEE86589.1| protein MID1-complementing activity 1 [Arabidopsis thaliana]
 gb|AEE86590.1| protein MID1-complementing activity 1 [Arabidopsis thaliana]
 gb|AEE86591.1| protein MID1-complementing activity 1 [Arabidopsis thaliana]
Length=421

 Score =   187 bits (474),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+KKYPETREPLE LEDALRRSY+L+NSC+DRSYLYLLAMGW
Sbjct  64   EMKKYPETREPLEGLEDALRRSYLLVNSCRDRSYLYLLAMGW  105



>ref|XP_009138395.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Brassica 
rapa]
 ref|XP_009138396.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Brassica 
rapa]
Length=416

 Score =   187 bits (474),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA+MHKKNCRQFAQHL+LIGNLLEQLK++
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTARMHKKNCRQFAQHLELIGNLLEQLKLS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+KKYPETREPLE LEDALRRSY+L+NSC+DRSYLYLLAMGW
Sbjct  64   EMKKYPETREPLEGLEDALRRSYVLVNSCRDRSYLYLLAMGW  105



>gb|EEE65313.1| hypothetical protein OsJ_20556 [Oryza sativa Japonica Group]
Length=458

 Score =   187 bits (476),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASWENLGD+A V QLTG+DA++LI MIVKAASTA++HK+NCR+FAQHLKLIG LLEQL+
Sbjct  1    MASWENLGDVATVVQLTGLDAVRLISMIVKAASTARLHKRNCRRFAQHLKLIGGLLEQLR  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            ++ELKKYPETREPLE LEDALRR+Y+L++SCQDRSYLYLLAMGW
Sbjct  61   VSELKKYPETREPLEQLEDALRRAYLLVHSCQDRSYLYLLAMGW  104



>ref|XP_010446852.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010446853.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010446854.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010446856.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
Length=421

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+KKYPETREPLE LEDALRRSY+L+NSC+DRSYLYLLAMGW
Sbjct  64   EMKKYPETREPLEGLEDALRRSYLLVNSCRDRSYLYLLAMGW  105



>ref|XP_002468480.1| hypothetical protein SORBIDRAFT_01g046630 [Sorghum bicolor]
 gb|EER95478.1| hypothetical protein SORBIDRAFT_01g046630 [Sorghum bicolor]
Length=420

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASW+NLG+L+N+AQLTG+DA+KLI +IV+AASTA++HK+NCR+FAQHLKLIG LLEQL+
Sbjct  1    MASWDNLGELSNIAQLTGLDAVKLISLIVRAASTARLHKRNCRRFAQHLKLIGGLLEQLR  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            ++EL+KYPETREPLE LEDALRR Y+L+NSCQDRSYLYLLAMGW
Sbjct  61   VSELRKYPETREPLEQLEDALRRGYLLVNSCQDRSYLYLLAMGW  104



>gb|AAK32909.1|AF367322_1 AT4g35920/F4B14_190 [Arabidopsis thaliana]
 gb|AAM91434.1| AT4g35920/F4B14_190 [Arabidopsis thaliana]
Length=440

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+KKYPETREPLE LEDALRRSY+L+NSC+DRSYLYLLAMGW
Sbjct  64   EMKKYPETREPLEGLEDALRRSYLLVNSCRDRSYLYLLAMGW  105



>ref|XP_006282626.1| hypothetical protein CARUB_v10004901mg [Capsella rubella]
 ref|XP_006282627.1| hypothetical protein CARUB_v10004901mg [Capsella rubella]
 gb|EOA15524.1| hypothetical protein CARUB_v10004901mg [Capsella rubella]
 gb|EOA15525.1| hypothetical protein CARUB_v10004901mg [Capsella rubella]
Length=421

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+KKYPETREPLE LEDALRRSY+L+NSC+DRSYLYLLAMGW
Sbjct  64   EMKKYPETREPLEGLEDALRRSYLLVNSCRDRSYLYLLAMGW  105



>ref|XP_002867046.1| hypothetical protein ARALYDRAFT_491044 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43305.1| hypothetical protein ARALYDRAFT_491044 [Arabidopsis lyrata subsp. 
lyrata]
Length=421

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+KKYPETREPLE LEDALRRSY+L+NSC+DRSYLYLLAMGW
Sbjct  64   EMKKYPETREPLEGLEDALRRSYLLVNSCRDRSYLYLLAMGW  105



>ref|XP_010432209.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010432210.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010437400.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010437401.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
Length=421

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+KKYPETREPLE LEDALRRSY+L+NSC+DRSYLYLLAMGW
Sbjct  64   EMKKYPETREPLEGLEDALRRSYLLVNSCRDRSYLYLLAMGW  105



>emb|CDX72565.1| BnaC07g45870D [Brassica napus]
Length=414

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLK++
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKLS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+KKYPETREPLE LEDALRRSYIL+NSC+DRSYLYLLAMGW
Sbjct  64   EMKKYPETREPLEGLEDALRRSYILVNSCRDRSYLYLLAMGW  105



>ref|XP_004985646.1| PREDICTED: cell number regulator 13-like [Setaria italica]
Length=418

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASW+NLG+L+N+AQLTG+DA+KLI +IVKAASTA+MHK NCR+FA+HLKLIG LLEQL+
Sbjct  1    MASWDNLGELSNIAQLTGLDAVKLISLIVKAASTARMHKSNCRRFARHLKLIGGLLEQLR  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            ++EL+KYPETREPLE LEDALRR Y+L+NSCQDRSYLYLLAMGW
Sbjct  61   VSELRKYPETREPLEQLEDALRRGYLLVNSCQDRSYLYLLAMGW  104



>gb|KHG10652.1| mid1-complementing activity 1 -like protein [Gossypium arboreum]
Length=332

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            ++WE+ G++ANVAQL G DA++LI MI KAASTA+MHKKNCRQFA HLKLIGNLLEQLKI
Sbjct  3    SAWEHFGEVANVAQLAGFDAVRLIAMIGKAASTARMHKKNCRQFALHLKLIGNLLEQLKI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELK+YPETREPLE LEDALRR+YIL+NSCQDRSYLYLLAMGW
Sbjct  63   SELKRYPETREPLEQLEDALRRAYILVNSCQDRSYLYLLAMGW  105



>gb|ACN26521.1| unknown [Zea mays]
 tpg|DAA43436.1| TPA: putative cell number regulator 13 [Zea mays]
Length=428

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASW+NLG+L+N+AQLTG+DA+KLI +IV+AASTA++HK+NCR+FAQHLKLIG LLEQL+
Sbjct  1    MASWDNLGELSNIAQLTGLDAVKLISLIVRAASTARLHKRNCRRFAQHLKLIGGLLEQLR  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            ++EL+KYPETREPLE LEDALRR Y+L+NSCQDRSYLYLLAMGW
Sbjct  61   VSELRKYPETREPLEQLEDALRRGYLLVNSCQDRSYLYLLAMGW  104



>ref|NP_001182136.1| cell number regulator 13 [Zea mays]
 sp|B6SJQ0.1|CNR13_MAIZE RecName: Full=Cell number regulator 13; AltName: Full=ZmCNR13 
[Zea mays]
 gb|ACG25083.1| domain of unknown function DUF614 containing protein [Zea mays]
 gb|ADI48426.1| cell number regulator 13 [Zea mays]
Length=428

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASW+NLG+L+N+AQLTG+DA+KLI +IV+AASTA++HK+NCR+FAQHLKLIG LLEQL+
Sbjct  1    MASWDNLGELSNIAQLTGLDAVKLISLIVRAASTARLHKRNCRRFAQHLKLIGGLLEQLR  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            ++EL+KYPETREPLE LEDALRR Y+L+NSCQDRSYLYLLAMGW
Sbjct  61   VSELRKYPETREPLEQLEDALRRGYLLVNSCQDRSYLYLLAMGW  104



>ref|XP_008393931.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Malus domestica]
 ref|XP_008393938.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Malus domestica]
 ref|XP_008393943.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Malus domestica]
 ref|XP_008393951.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Malus domestica]
 ref|XP_008393959.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Malus domestica]
Length=408

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 100/104 (96%), Gaps = 3/104 (3%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MAS+   G++ANVAQLTG+DA++LIGMIVKAASTA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASF---GEMANVAQLTGVDAVRLIGMIVKAASTARMHKKNCRQFAQHLKLIGNLLEQLK  57

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELK+YPETREPLE LE+AL+RSYIL++SCQDRSYLYLLAMGW
Sbjct  58   ISELKRYPETREPLEQLEEALKRSYILVSSCQDRSYLYLLAMGW  101



>ref|XP_008665504.1| PREDICTED: cell number regulator 13-like [Zea mays]
 ref|XP_008665505.1| PREDICTED: cell number regulator 13-like [Zea mays]
Length=224

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASW+NLG+L+N+AQLTG+DA+KLI +IV+AASTA++HK+NCR+FAQHLKLIG LLEQL+
Sbjct  1    MASWDNLGELSNIAQLTGLDAVKLISLIVRAASTARLHKRNCRRFAQHLKLIGGLLEQLR  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            ++EL+KYPET EPLE LEDALRR Y+L+NSCQD SYLYLLAMGW
Sbjct  61   VSELRKYPETPEPLEQLEDALRRGYLLVNSCQDHSYLYLLAMGW  104



>emb|CAA18486.1| putative protein [Arabidopsis thaliana]
 emb|CAA21478.1| putative protein [Arabidopsis thaliana]
 emb|CAB81501.1| putative protein [Arabidopsis thaliana]
Length=447

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+KKYPETREPLE LEDALRRSY+L+NSC+DRSYLYLLAMGW
Sbjct  64   EMKKYPETREPLEGLEDALRRSYLLVNSCRDRSYLYLLAMGW  105



>emb|CDY47043.1| BnaAnng08310D [Brassica napus]
Length=416

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLK++
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKLS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+KKYPETREPLE LEDALRRSY+L+NSC+DRSYLYLLAMGW
Sbjct  64   EMKKYPETREPLEGLEDALRRSYVLVNSCRDRSYLYLLAMGW  105



>ref|XP_009148721.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Brassica rapa]
 ref|XP_009148775.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Brassica rapa]
Length=419

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKK CRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKTCRQFAQHLKLIGNLLEQLKIS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+KKYPETREPLE LEDALRRSYIL+NSC+DRSYLYLLAMGW
Sbjct  64   EMKKYPETREPLEGLEDALRRSYILVNSCRDRSYLYLLAMGW  105



>ref|XP_010935125.1| PREDICTED: cell number regulator 13-like [Elaeis guineensis]
 ref|XP_010935126.1| PREDICTED: cell number regulator 13-like [Elaeis guineensis]
Length=420

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASW+ LG+L+ VAQLTG+DA++LIG+IV+AA+TA+MHKKNCR FA HLKLIGNLLEQLK
Sbjct  1    MASWDQLGELSTVAQLTGLDAVRLIGLIVRAATTARMHKKNCRHFAHHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            ++ELKKYPETREPLE LEDALRR+YIL++SCQ+RSYLYLLAMGW
Sbjct  61   VSELKKYPETREPLEQLEDALRRAYILVDSCQNRSYLYLLAMGW  104



>ref|XP_011074700.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Sesamum 
indicum]
Length=403

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA+WE  G++ANV QLTG++A+ LIG+IVKAASTA+MHK+NCRQFAQH+K+IGNLLEQLK
Sbjct  1    MAAWEQFGEIANVVQLTGLNAVSLIGLIVKAASTARMHKQNCRQFAQHVKMIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+E++KYPETREPLE LEDALRR+Y+L+NSCQ+RSYLYL+AMGW
Sbjct  61   ISEMRKYPETREPLEQLEDALRRAYLLVNSCQERSYLYLMAMGW  104



>gb|ABR16594.1| unknown [Picea sitchensis]
Length=418

 Score =   184 bits (467),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            WEN+GDLANV QLTG++A+ LI +IVKAAS A+MHKKNCRQFAQHLKLIGNLLEQLK TE
Sbjct  7    WENVGDLANVTQLTGLNAVSLIALIVKAASNARMHKKNCRQFAQHLKLIGNLLEQLKATE  66

Query  555  LKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            LKKYPETREPLE LEDALRRSY+L++SCQ+RSYLYLLAMGW
Sbjct  67   LKKYPETREPLEQLEDALRRSYVLVDSCQNRSYLYLLAMGW  107



>ref|XP_011083456.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Sesamum 
indicum]
Length=405

 Score =   184 bits (466),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASWE+ G++ANV QLTG++A+ LIG+IVKAA+TA+MH+KNCRQFAQH+K+IGNLLEQLK
Sbjct  1    MASWEHFGEVANVIQLTGLNAVALIGLIVKAANTARMHRKNCRQFAQHVKMIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+E+KKYPETREPLE LEDALRR+Y+L+NSCQ+RSYLYL+AMGW
Sbjct  61   ISEMKKYPETREPLEQLEDALRRAYLLVNSCQERSYLYLMAMGW  104



>ref|XP_006846924.1| PREDICTED: cell number regulator 13 [Amborella trichopoda]
 gb|ERN08505.1| hypothetical protein AMTR_s00152p00084120 [Amborella trichopoda]
Length=421

 Score =   184 bits (467),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            A+W+ LG++A VAQLTG+DA+KLI MI +AA+TA+MHKKNCRQFAQHLKLIGNLL+QL+I
Sbjct  3    ATWDQLGEIATVAQLTGLDAVKLIAMIARAATTARMHKKNCRQFAQHLKLIGNLLDQLRI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELKKYP TREPLE LEDALRRSY+L+NSCQDRSYLYLLAMGW
Sbjct  63   SELKKYPGTREPLEGLEDALRRSYVLVNSCQDRSYLYLLAMGW  105



>ref|XP_010266845.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nelumbo 
nucifera]
Length=409

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            ++W+++G++ NVAQL G+DA++LIGMIV AASTA+MHKKNC+QFA HLKLIGNLLEQLKI
Sbjct  3    SAWDHIGEIGNVAQLAGMDAVRLIGMIVHAASTARMHKKNCKQFALHLKLIGNLLEQLKI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELKKYPETREPLE LEDALRRSYIL+NSCQD+SYLYLLAMGW
Sbjct  63   SELKKYPETREPLEQLEDALRRSYILVNSCQDKSYLYLLAMGW  105



>ref|XP_007046628.1| PLAC8 family protein [Theobroma cacao]
 gb|EOX90785.1| PLAC8 family protein [Theobroma cacao]
Length=421

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +SWE++G++A+V QL G DA +LI MI KAA+TA+MHKKNCRQFAQHLKLIGNLLEQLKI
Sbjct  3    SSWEHIGEVASVVQLAGFDAGRLIAMIAKAANTARMHKKNCRQFAQHLKLIGNLLEQLKI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +ELK+YPETREPLE LEDALRRSYIL+NSCQ+RSYLYLLAMGW
Sbjct  63   SELKRYPETREPLEQLEDALRRSYILVNSCQERSYLYLLAMGW  105



>ref|XP_008806599.1| PREDICTED: cell number regulator 13-like isoform X2 [Phoenix 
dactylifera]
Length=418

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASW+ LG+L+ V QLTG+DA++LIG+IV+  +TA+MHKKNCRQFAQHLKLIGNLL+QLK
Sbjct  1    MASWDQLGELSTVVQLTGLDAVRLIGLIVQTTATARMHKKNCRQFAQHLKLIGNLLQQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            ++ELKKYPETREPLE LEDALRR+YIL++SC++RSYLYLLAMGW
Sbjct  61   VSELKKYPETREPLEQLEDALRRAYILVDSCRNRSYLYLLAMGW  104



>ref|XP_006297774.1| hypothetical protein CARUB_v10013809mg [Capsella rubella]
 gb|EOA30672.1| hypothetical protein CARUB_v10013809mg [Capsella rubella]
Length=417

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SWE LGD A+VAQLTG+DA+KLIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLEQL+I+
Sbjct  4    SWEQLGDFASVAQLTGVDAVKLIGMIVSAANTARMHKKNCRQFAQHLKLIGNLLEQLRIS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+K+Y E  EPLE LEDALRRSYIL+NSCQ++SYLYLLAMGW
Sbjct  64   EMKQYSEILEPLEGLEDALRRSYILVNSCQEKSYLYLLAMGW  105



>ref|XP_008806598.1| PREDICTED: cell number regulator 13-like isoform X1 [Phoenix 
dactylifera]
Length=420

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASW+ LG+L+ V QLTG+DA++LIG+IV+  +TA+MHKKNCRQFAQHLKLIGNLL+QLK
Sbjct  1    MASWDQLGELSTVVQLTGLDAVRLIGLIVQTTATARMHKKNCRQFAQHLKLIGNLLQQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            ++ELKKYPETREPLE LEDALRR+YIL++SC++RSYLYLLAMGW
Sbjct  61   VSELKKYPETREPLEQLEDALRRAYILVDSCRNRSYLYLLAMGW  104



>gb|EMT07324.1| hypothetical protein F775_31025 [Aegilops tauschii]
Length=395

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +3

Query  381  NLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELK  560
            N+GDLAN+AQLTG+DA++LIG+IVKAA+TA+MHK NCR+FAQHLKLIG LLEQL+++ELK
Sbjct  3    NVGDLANIAQLTGLDAVRLIGLIVKAAATARMHKSNCRRFAQHLKLIGGLLEQLRVSELK  62

Query  561  KYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            KYPETREPLE LEDALRR Y+L+NSCQDRSYLYLLAMGW
Sbjct  63   KYPETREPLEQLEDALRRGYLLVNSCQDRSYLYLLAMGW  101



>gb|EYU17580.1| hypothetical protein MIMGU_mgv1a007522mg [Erythranthe guttata]
Length=404

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASWE  G++AN+ QL+G++A  LIG+IVKAA+TA+MHKKNCRQFAQH+KLIGNLL+QLK
Sbjct  1    MASWEQFGEIANIVQLSGLNAAALIGLIVKAANTARMHKKNCRQFAQHVKLIGNLLDQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            ITELK+ PETREPLE LEDALRR+Y+L+NSCQ+RSYLYL+AMGW
Sbjct  61   ITELKRRPETREPLEQLEDALRRAYLLVNSCQERSYLYLMAMGW  104



>ref|XP_010467574.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X2 [Camelina sativa]
Length=419

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SWE LG++A+VAQLTG+DA+KLIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLEQL+I+
Sbjct  2    SWEQLGEIASVAQLTGVDAVKLIGMIVSAANTARMHKKNCRQFAQHLKLIGNLLEQLRIS  61

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+K+Y E  EPLE LEDALRRSYIL+NSCQ++SYLYLLAMGW
Sbjct  62   EMKQYSEILEPLEGLEDALRRSYILVNSCQEKSYLYLLAMGW  103



>ref|XP_010467573.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Camelina sativa]
Length=420

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SWE LG++A+VAQLTG+DA+KLIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLEQL+I+
Sbjct  2    SWEQLGEIASVAQLTGVDAVKLIGMIVSAANTARMHKKNCRQFAQHLKLIGNLLEQLRIS  61

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+K+Y E  EPLE LEDALRRSYIL+NSCQ++SYLYLLAMGW
Sbjct  62   EMKQYSEILEPLEGLEDALRRSYILVNSCQEKSYLYLLAMGW  103



>ref|XP_009112457.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X3 [Brassica rapa]
Length=376

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 97/103 (94%), Gaps = 1/103 (1%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTG+DA+KLIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDQLGEIASVAQLTGVDAVKLIGMIVAAANTARMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  552  ELKKY-PETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+KK  PE +EPLE LEDALRRSY+L+NSCQD+SYLYLLAMGW
Sbjct  64   EMKKTRPEVQEPLEGLEDALRRSYLLVNSCQDKSYLYLLAMGW  106



>gb|AAM51833.1|AC105730_7 Unknown protein [Oryza sativa Japonica Group]
Length=1202

 Score =   186 bits (473),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASWENLGD+A V QLTG+DA++LI MIVKAASTA++HK+NCR+FAQHLKLIG LLEQL+
Sbjct  1    MASWENLGDVATVVQLTGLDAVRLISMIVKAASTARLHKRNCRRFAQHLKLIGGLLEQLR  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            ++ELKKYPETREPLE LEDALRR+Y+L++SCQDRSYLYLLAMGW
Sbjct  61   VSELKKYPETREPLEQLEDALRRAYLLVHSCQDRSYLYLLAMGW  104



>emb|CDY30346.1| BnaA09g09310D [Brassica napus]
Length=389

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 97/103 (94%), Gaps = 1/103 (1%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTG+DA+KLIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDQLGEIASVAQLTGVDALKLIGMIVTAANTARMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  552  ELKKY-PETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+KK  PE +EPLE LEDALRRSY+L+NSCQD+SYLYLLAMGW
Sbjct  64   EMKKTRPEVQEPLEGLEDALRRSYLLVNSCQDKSYLYLLAMGW  106



>ref|XP_010680412.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=396

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +3

Query  378  ENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  557
            +++ D+A +AQLTG+DA+KLIG+IVKAA+TA+MH+KNCRQFA HLKLIGNLLEQLKI+EL
Sbjct  2    DHMEDVATIAQLTGLDAVKLIGLIVKAANTARMHRKNCRQFANHLKLIGNLLEQLKISEL  61

Query  558  KKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            K+YPETREPLE LEDALRRSYIL++SCQDRSYLYLLAMGW
Sbjct  62   KRYPETREPLEQLEDALRRSYILVHSCQDRSYLYLLAMGW  101



>ref|XP_006409246.1| hypothetical protein EUTSA_v10023167mg, partial [Eutrema salsugineum]
 gb|ESQ50699.1| hypothetical protein EUTSA_v10023167mg, partial [Eutrema salsugineum]
Length=373

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTG+DA++LIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLEQLK++
Sbjct  4    SWDQLGEIASVAQLTGVDAVRLIGMIVTAANTARMHKKNCRQFAQHLKLIGNLLEQLKVS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+K  P  +EPLE LEDALRRSYIL+NSCQDRSYLYLLAMGW
Sbjct  64   EMKMCPGIQEPLEGLEDALRRSYILVNSCQDRSYLYLLAMGW  105



>ref|XP_009112456.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X2 [Brassica rapa]
Length=388

 Score =   178 bits (452),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 97/103 (94%), Gaps = 1/103 (1%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTG+DA+KLIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDQLGEIASVAQLTGVDAVKLIGMIVAAANTARMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  552  ELKKY-PETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+KK  PE +EPLE LEDALRRSY+L+NSCQD+SYLYLLAMGW
Sbjct  64   EMKKTRPEVQEPLEGLEDALRRSYLLVNSCQDKSYLYLLAMGW  106



>ref|XP_010680410.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010680411.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=410

 Score =   179 bits (453),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +3

Query  378  ENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  557
            +++ D+A +AQLTG+DA+KLIG+IVKAA+TA+MH+KNCRQFA HLKLIGNLLEQLKI+EL
Sbjct  2    DHMEDVATIAQLTGLDAVKLIGLIVKAANTARMHRKNCRQFANHLKLIGNLLEQLKISEL  61

Query  558  KKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            K+YPETREPLE LEDALRRSYIL++SCQDRSYLYLLAMGW
Sbjct  62   KRYPETREPLEQLEDALRRSYILVHSCQDRSYLYLLAMGW  101



>ref|XP_009112455.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Brassica rapa]
Length=389

 Score =   178 bits (452),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 97/103 (94%), Gaps = 1/103 (1%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTG+DA+KLIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDQLGEIASVAQLTGVDAVKLIGMIVAAANTARMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  552  ELKKY-PETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+KK  PE +EPLE LEDALRRSY+L+NSCQD+SYLYLLAMGW
Sbjct  64   EMKKTRPEVQEPLEGLEDALRRSYLLVNSCQDKSYLYLLAMGW  106



>ref|XP_006649427.1| PREDICTED: cell number regulator 13-like [Oryza brachyantha]
Length=419

 Score =   179 bits (453),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 98/106 (92%), Gaps = 2/106 (2%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAA--STAKMHKKNCRQFAQHLKLIGNLLEQ  539
            MASWENLG++A V QLTG+DA +LI MIVKAA  STA++HK+NCR+FAQHLKLIG LLEQ
Sbjct  1    MASWENLGEVATVVQLTGLDAGRLISMIVKAAAASTARLHKRNCRRFAQHLKLIGGLLEQ  60

Query  540  LKITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            L+++ELKKYPETREPLE LEDALRR+Y+L++SCQDRSYLYLLAMGW
Sbjct  61   LRVSELKKYPETREPLEQLEDALRRAYLLVHSCQDRSYLYLLAMGW  106



>gb|EPS70744.1| mid1-complementing activity 2 [Genlisea aurea]
Length=376

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MASW+  G+ ANV QL G++A+ LIG+IVKAA+TA+MHK+NCRQFAQHLKLIGNLLEQL+
Sbjct  1    MASWDQFGEAANVIQLAGLNAVALIGLIVKAANTARMHKRNCRQFAQHLKLIGNLLEQLR  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELKKYPE+REPLE+LEDALRR+Y+L+NSCQ++S+LYL+AMGW
Sbjct  61   ISELKKYPESREPLEMLEDALRRAYLLVNSCQEKSFLYLMAMGW  104



>emb|CDY26830.1| BnaC09g09570D [Brassica napus]
Length=391

 Score =   178 bits (451),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 97/103 (94%), Gaps = 1/103 (1%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTG+DA+KLIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDQLGEIASVAQLTGVDAVKLIGMIVTAANTARMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  552  ELKKY-PETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+KK  PE +EPLE LEDALRRSY+L+NSCQD+SYLYLLAMGW
Sbjct  64   EMKKTRPEVQEPLEGLEDALRRSYLLVNSCQDKSYLYLLAMGW  106



>ref|XP_010413502.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like [Camelina 
sativa]
 ref|XP_010413510.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like [Camelina 
sativa]
 ref|XP_010413517.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like [Camelina 
sativa]
Length=419

 Score =   179 bits (453),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTG+DA+KLIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  2    SWDQLGEIASVAQLTGVDAVKLIGMIVSAANTARMHKKNCRQFAQHLKLIGNLLEQLKIS  61

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+K+Y E  EPLE LEDALRRSYIL+NSCQ+RS++YLLAMGW
Sbjct  62   EMKQYSEILEPLEGLEDALRRSYILVNSCQERSFIYLLAMGW  103



>ref|XP_010489416.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X3 [Camelina sativa]
Length=315

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTG+DA+KLIGMIV AA+TA+ HKKNCRQFAQHLKLIGNLLEQL+I+
Sbjct  2    SWDQLGEIASVAQLTGVDAVKLIGMIVSAANTARTHKKNCRQFAQHLKLIGNLLEQLRIS  61

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+K+Y E  EPLE LEDALRRSYIL+NSCQ+RS++YLLAMGW
Sbjct  62   EMKQYSEILEPLEGLEDALRRSYILVNSCQERSFIYLLAMGW  103



>gb|EYU30814.1| hypothetical protein MIMGU_mgv1a007258mg [Erythranthe guttata]
Length=413

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +3

Query  381  NLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELK  560
            + G++ANVAQL G+DA  LIGMIVKAA+TA+MHKKNCRQFA HLKLIGNLLE L+I+ELK
Sbjct  3    HFGEMANVAQLAGMDAASLIGMIVKAATTARMHKKNCRQFALHLKLIGNLLESLRISELK  62

Query  561  KYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            KYPETREPLE LEDALRRSY+LI+SCQDRSYLYLLAMGW
Sbjct  63   KYPETREPLEQLEDALRRSYVLIHSCQDRSYLYLLAMGW  101



>ref|XP_010489410.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Camelina sativa]
 ref|XP_010489411.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Camelina sativa]
 ref|XP_010489413.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Camelina sativa]
 ref|XP_010489414.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Camelina sativa]
Length=421

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTG+DA+KLIGMIV AA+TA+ HKKNCRQFAQHLKLIGNLLEQL+I+
Sbjct  2    SWDQLGEIASVAQLTGVDAVKLIGMIVSAANTARTHKKNCRQFAQHLKLIGNLLEQLRIS  61

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+K+Y E  EPLE LEDALRRSYIL+NSCQ+RS++YLLAMGW
Sbjct  62   EMKQYSEILEPLEGLEDALRRSYILVNSCQERSFIYLLAMGW  103



>ref|XP_010489415.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X2 [Camelina sativa]
Length=420

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTG+DA+KLIGMIV AA+TA+ HKKNCRQFAQHLKLIGNLLEQL+I+
Sbjct  2    SWDQLGEIASVAQLTGVDAVKLIGMIVSAANTARTHKKNCRQFAQHLKLIGNLLEQLRIS  61

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+K+Y E  EPLE LEDALRRSYIL+NSCQ+RS++YLLAMGW
Sbjct  62   EMKQYSEILEPLEGLEDALRRSYILVNSCQERSFIYLLAMGW  103



>ref|XP_003558777.1| PREDICTED: cell number regulator 13 [Brachypodium distachyon]
Length=412

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +3

Query  381  NLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELK  560
            +LGD+ANVAQ+TG+DA+++I +IVKAASTA+MHK+NCR+FAQHLKLIG LLEQL+++ELK
Sbjct  3    SLGDVANVAQVTGLDAVRIIALIVKAASTARMHKRNCRRFAQHLKLIGGLLEQLRVSELK  62

Query  561  KYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            KYPETREPLE LE+ALRR ++L++SCQDRSYLYLLAMGW
Sbjct  63   KYPETREPLEQLEEALRRGFLLVHSCQDRSYLYLLAMGW  101



>ref|XP_010692506.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692507.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692508.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Beta vulgaris 
subsp. vulgaris]
Length=406

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            M++W+ L ++ N+AQLTG++A+ LIG+IV  A+ A++HKKNCR+FA HLKLIGNLLEQLK
Sbjct  1    MSNWDTLNEVGNLAQLTGVNAVGLIGLIVDTANRARLHKKNCRKFAHHLKLIGNLLEQLK  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            I+ELKKYPETREPLE LEDAL+R+Y+L++SC+D+SYLYL+AMGW
Sbjct  61   ISELKKYPETREPLEQLEDALKRAYVLVHSCEDKSYLYLVAMGW  104



>ref|XP_009389172.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=366

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            ++W  +GD+A+V QL G+DA+ LI MI+K AS A+MH+KNCRQFA  LKL+GNLLEQL+I
Sbjct  3    STWGPVGDVASVMQLVGVDAVSLIRMIIKVASDARMHRKNCRQFAHQLKLVGNLLEQLRI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +EL+K+  TREPLELLEDALRRSYIL+NSCQDRSYLYLL MGW
Sbjct  63   SELRKHRSTREPLELLEDALRRSYILVNSCQDRSYLYLLVMGW  105



>pir||T08859 hypothetical protein A_TM017A05.4 - Arabidopsis thaliana
Length=276

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTGIDA+KLIGMIV AA+TA+MHKKNCRQFA HLKLI NLLEQ+K +
Sbjct  4    SWDQLGEIASVAQLTGIDALKLIGMIVNAANTARMHKKNCRQFAHHLKLIRNLLEQIKNS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+ +  E  EPL+ L+DALRRSYIL+ SCQ++SYLYLLAMGW
Sbjct  64   EMNQRSEILEPLQGLDDALRRSYILVKSCQEKSYLYLLAMGW  105



>ref|XP_009389171.1| PREDICTED: protein kinase 2A, chloroplastic-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=597

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            ++W  +GD+A+V QL G+DA+ LI MI+K AS A+MH+KNCRQFA  LKL+GNLLEQL+I
Sbjct  3    STWGPVGDVASVMQLVGVDAVSLIRMIIKVASDARMHRKNCRQFAHQLKLVGNLLEQLRI  62

Query  549  TELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +EL+K+  TREPLELLEDALRRSYIL+NSCQDRSYLYLL MGW
Sbjct  63   SELRKHRSTREPLELLEDALRRSYILVNSCQDRSYLYLLVMGW  105



>ref|NP_001031368.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
 gb|AEC06685.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
Length=314

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTGIDA+KLIGMIV AA+TA+MHKKNCRQFA HLKLI NLLEQ+K +
Sbjct  4    SWDQLGEIASVAQLTGIDALKLIGMIVNAANTARMHKKNCRQFAHHLKLIRNLLEQIKNS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+ +  E  EPL+ L+DALRRSYIL+ SCQ++SYLYLLAMGW
Sbjct  64   EMNQRSEILEPLQGLDDALRRSYILVKSCQEKSYLYLLAMGW  105



>ref|XP_001767697.1| predicted protein [Physcomitrella patens]
 gb|EDQ67448.1| predicted protein, partial [Physcomitrella patens]
Length=110

 Score =   152 bits (383),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +3

Query  384  LGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKK  563
            LGD+ANV QLTGI+A++LI MIV+AA+ A+MHKKNCRQFA HLKLI  LLEQL IT+LK+
Sbjct  1    LGDVANVGQLTGINAVQLISMIVQAANNARMHKKNCRQFAHHLKLISKLLEQLNITDLKE  60

Query  564  YPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
             PET EPLEL E++LR++ +LI SC+D+SYLYLLAMGW
Sbjct  61   RPETGEPLELFEESLRKALVLIESCRDKSYLYLLAMGW  98



>pir||D84556 hypothetical protein At2g17780 [imported] - Arabidopsis thaliana
Length=417

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTGIDA+KLIGMIV AA+TA+MHKKNCRQFA HLKLI NLLEQ+K +
Sbjct  4    SWDQLGEIASVAQLTGIDALKLIGMIVNAANTARMHKKNCRQFAHHLKLIRNLLEQIKNS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+ +  E  EPL+ L+DALRRSYIL+ SCQ++SYLYLLAMGW
Sbjct  64   EMNQRSEILEPLQGLDDALRRSYILVKSCQEKSYLYLLAMGW  105



>ref|NP_001031367.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
 gb|AEC06684.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
Length=410

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTGIDA+KLIGMIV AA+TA+MHKKNCRQFA HLKLI NLLEQ+K +
Sbjct  4    SWDQLGEIASVAQLTGIDALKLIGMIVNAANTARMHKKNCRQFAHHLKLIRNLLEQIKNS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+ +  E  EPL+ L+DALRRSYIL+ SCQ++SYLYLLAMGW
Sbjct  64   EMNQRSEILEPLQGLDDALRRSYILVKSCQEKSYLYLLAMGW  105



>ref|NP_001031366.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
 gb|AEC06683.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
Length=414

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTGIDA+KLIGMIV AA+TA+MHKKNCRQFA HLKLI NLLEQ+K +
Sbjct  4    SWDQLGEIASVAQLTGIDALKLIGMIVNAANTARMHKKNCRQFAHHLKLIRNLLEQIKNS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+ +  E  EPL+ L+DALRRSYIL+ SCQ++SYLYLLAMGW
Sbjct  64   EMNQRSEILEPLQGLDDALRRSYILVKSCQEKSYLYLLAMGW  105



>ref|NP_179369.2| protein MID1-complementing activity 2 [Arabidopsis thaliana]
 sp|Q3EBY6.1|MCAC2_ARATH RecName: Full=Protein MID1-COMPLEMENTING ACTIVITY 2 [Arabidopsis 
thaliana]
 dbj|BAF46390.1| Mca2 [Arabidopsis thaliana]
 gb|AEC06682.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
Length=416

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTGIDA+KLIGMIV AA+TA+MHKKNCRQFA HLKLI NLLEQ+K +
Sbjct  4    SWDQLGEIASVAQLTGIDALKLIGMIVNAANTARMHKKNCRQFAHHLKLIRNLLEQIKNS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+ +  E  EPL+ L+DALRRSYIL+ SCQ++SYLYLLAMGW
Sbjct  64   EMNQRSEILEPLQGLDDALRRSYILVKSCQEKSYLYLLAMGW  105



>ref|XP_002886128.1| hypothetical protein ARALYDRAFT_480672 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62387.1| hypothetical protein ARALYDRAFT_480672 [Arabidopsis lyrata subsp. 
lyrata]
Length=417

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +3

Query  372  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  551
            SW+ LG++A+VAQLTGIDA+KLIGMIV AA+TA+MHKKNCRQFA HLKLI NLLEQ+K +
Sbjct  4    SWDQLGEIASVAQLTGIDALKLIGMIVNAANTARMHKKNCRQFAHHLKLIRNLLEQIKNS  63

Query  552  ELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            E+ +  E  EPL+ L+DALRRSYIL+ SCQ++SYLYLLAMGW
Sbjct  64   EMNQRSEILEPLQGLDDALRRSYILVKSCQEKSYLYLLAMGW  105



>ref|XP_001768983.1| predicted protein [Physcomitrella patens]
 gb|EDQ66181.1| predicted protein [Physcomitrella patens]
Length=415

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            W  LGD+A+  QL GI+A++LI MIVKAA+ A+MHKKNCRQFAQHLKLI NLLEQL +T+
Sbjct  3    WLALGDVASFGQLAGINAVQLIAMIVKAANNARMHKKNCRQFAQHLKLIANLLEQLNLTD  62

Query  555  LKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            LK+ PE REPLE LE ALR++ +L+ SC+D+SYLYL+AMGW
Sbjct  63   LKERPECREPLEHLEQALRKAVVLVESCRDKSYLYLVAMGW  103



>ref|XP_001769010.1| predicted protein [Physcomitrella patens]
 gb|EDQ66208.1| predicted protein [Physcomitrella patens]
Length=247

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +3

Query  384  LGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKK  563
            +GD+ANV QL GI+A++LI +IV+AA+ A+MHKKNCRQFA HLKLI NLLEQL +++LK 
Sbjct  15   IGDVANVGQLAGINAVQLIAIIVQAANNARMHKKNCRQFAHHLKLISNLLEQLNMSDLKD  74

Query  564  YPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
             PETREPLEL E++LR++ +L+ +C+++SYLYL+AMGW
Sbjct  75   RPETREPLELFEESLRKAVVLVENCRNKSYLYLVAMGW  112



>ref|XP_002978386.1| hypothetical protein SELMODRAFT_418221 [Selaginella moellendorffii]
 gb|EFJ20372.1| hypothetical protein SELMODRAFT_418221 [Selaginella moellendorffii]
Length=380

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +3

Query  384  LGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKK  563
            +GD+A VAQ+ G+D++KLI  +  AA  A+MHKKNCR FAQHLKLIGNLLE+L+++ELK+
Sbjct  5    VGDVATVAQIAGLDSLKLIAAVAAAAKNARMHKKNCRNFAQHLKLIGNLLEKLRLSELKE  64

Query  564  YPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +PET EPLE LE+ALR++YIL+NSC+++SYLYLLAMGW
Sbjct  65   HPETSEPLERLEEALRKAYILVNSCKNKSYLYLLAMGW  102



>ref|XP_002970226.1| hypothetical protein SELMODRAFT_93428 [Selaginella moellendorffii]
 gb|EFJ28356.1| hypothetical protein SELMODRAFT_93428 [Selaginella moellendorffii]
Length=395

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +3

Query  384  LGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKK  563
            +GD+A VAQ+ G+D++KLI  +  AA  A+MHKKNCR FAQHLKLIGNLLE+L+++EL++
Sbjct  5    VGDVATVAQIAGLDSLKLIAAVAAAAKNARMHKKNCRNFAQHLKLIGNLLEKLRLSELRE  64

Query  564  YPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +PET EPLE LE+ALR++YIL+NSC+++SYLYLLAMGW
Sbjct  65   HPETSEPLERLEEALRKAYILVNSCKNKSYLYLLAMGW  102



>gb|ADE76255.1| unknown [Picea sitchensis]
Length=247

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +3

Query  474  MHKKNCRQFAQHLKLIGNLLEQLKITELKKYPETREPLELLEDALRRSYILINSCQDRSY  653
            MHKKNCRQFA HLK+IGNLLEQLK++ELK++PETREPLE  EDALRR+Y L+NSCQDRSY
Sbjct  1    MHKKNCRQFAHHLKMIGNLLEQLKVSELKEWPETREPLEQFEDALRRAYGLVNSCQDRSY  60

Query  654  LYLLAMGW  677
            LYLLA+GW
Sbjct  61   LYLLALGW  68



>ref|XP_001785848.1| predicted protein [Physcomitrella patens]
 gb|EDQ49335.1| predicted protein, partial [Physcomitrella patens]
Length=399

 Score =   124 bits (312),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  384  LGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKK  563
            +GD+ANV QL GI+A++LI MIVKAA  A+MHKKNC+ FAQHLKLI NLLE L +T+LK+
Sbjct  1    MGDVANVGQLVGINAVQLIAMIVKAAKNARMHKKNCQNFAQHLKLISNLLELLNLTDLKR  60

Query  564  YPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
             PE REPLE LE ALR++ IL+ SC+D+SYLYL+AMGW
Sbjct  61   RPEYREPLEHLEQALRKAVILVESCRDKSYLYLVAMGW  98



>ref|XP_010658234.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X4 [Vitis vinifera]
Length=429

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +3

Query  390  DLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYP  569
            ++ +VAQ  G+DA+ +IGM+  AA  A  H++NC + + H ++IGNLLE+L  TEL+ +P
Sbjct  68   EMEDVAQAAGVDALSVIGMVAAAARKANTHRRNCEKISNHARMIGNLLEKLNATELRSFP  127

Query  570  ETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
             T EPL LLE+ALR++ +L+ SC+DRSYLYLLAMGW
Sbjct  128  ATGEPLHLLEEALRKALVLVESCRDRSYLYLLAMGW  163



>ref|XP_010658233.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X3 [Vitis vinifera]
Length=446

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +3

Query  390  DLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYP  569
            ++ +VAQ  G+DA+ +IGM+  AA  A  H++NC + + H ++IGNLLE+L  TEL+ +P
Sbjct  68   EMEDVAQAAGVDALSVIGMVAAAARKANTHRRNCEKISNHARMIGNLLEKLNATELRSFP  127

Query  570  ETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
             T EPL LLE+ALR++ +L+ SC+DRSYLYLLAMGW
Sbjct  128  ATGEPLHLLEEALRKALVLVESCRDRSYLYLLAMGW  163



>ref|XP_010658232.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Vitis vinifera]
Length=450

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +3

Query  390  DLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYP  569
            ++ +VAQ  G+DA+ +IGM+  AA  A  H++NC + + H ++IGNLLE+L  TEL+ +P
Sbjct  68   EMEDVAQAAGVDALSVIGMVAAAARKANTHRRNCEKISNHARMIGNLLEKLNATELRSFP  127

Query  570  ETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
             T EPL LLE+ALR++ +L+ SC+DRSYLYLLAMGW
Sbjct  128  ATGEPLHLLEEALRKALVLVESCRDRSYLYLLAMGW  163



>ref|XP_010658231.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Vitis vinifera]
Length=453

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +3

Query  390  DLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYP  569
            ++ +VAQ  G+DA+ +IGM+  AA  A  H++NC + + H ++IGNLLE+L  TEL+ +P
Sbjct  68   EMEDVAQAAGVDALSVIGMVAAAARKANTHRRNCEKISNHARMIGNLLEKLNATELRSFP  127

Query  570  ETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
             T EPL LLE+ALR++ +L+ SC+DRSYLYLLAMGW
Sbjct  128  ATGEPLHLLEEALRKALVLVESCRDRSYLYLLAMGW  163



>ref|NP_001068428.2| Os11g0670100 [Oryza sativa Japonica Group]
 dbj|BAF28791.2| Os11g0670100 [Oryza sativa Japonica Group]
Length=205

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA W  LG +AN+AQL G+DA  LI MIV+AA TAK +++ C++ A+H+K+IG+LL++L+
Sbjct  1    MALWNGLGQVANIAQLAGVDAYGLIKMIVEAAQTAKRNRETCQKLARHVKMIGDLLQRLQ  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
             TEL ++ ETR P+E LE+ LR +Y+LI SCQD SYL+   MG
Sbjct  61   STELMQHQETRNPVEQLEETLRHTYMLILSCQDSSYLHSCFMG  103



>gb|EEC72317.1| hypothetical protein OsI_05510 [Oryza sativa Indica Group]
Length=435

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA W  LG +AN+AQL G+DA  LI MIV+AA TAK +++ C++ A+H+K+IG+LL++L+
Sbjct  1    MALWNGLGQVANIAQLAGVDAYGLIKMIVEAAQTAKRNRETCQKLARHVKMIGDLLQRLQ  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
             TEL ++ ETR P+E LE+ LR +Y+LI SCQD SYL+   MG
Sbjct  61   STELMQHQETRNPVEQLEETLRHTYMLILSCQDSSYLHSCFMG  103



>ref|XP_002520777.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41486.1| conserved hypothetical protein [Ricinus communis]
Length=393

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +3

Query  393  LANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPE  572
            +A++AQ+ G+DA  L  MI+ AA  A  H+KNC Q A+H+KLIGNLLE+LK T+L   P 
Sbjct  1    MASIAQVAGVDATGLANMIISAARNATTHRKNCEQLAEHVKLIGNLLEKLKSTDLMNLPA  60

Query  573  TREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            T+EPL+ +E+ALR++  L+ SC+D+SYLY+LA+GW
Sbjct  61   TKEPLDGMEEALRKALDLVESCKDKSYLYMLALGW  95



>gb|EEC80653.1| hypothetical protein OsI_23047 [Oryza sativa Indica Group]
Length=279

 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA W  LG +AN+AQL G+DA  LI MIV+AA TAK +++ C++ A+H+K+IG+LL++L+
Sbjct  1    MALWNGLGQVANIAQLAGVDAYGLIKMIVEAAQTAKRNQETCQKLARHVKMIGDLLQRLQ  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
             TEL ++ ETR P+E LE+ LR +Y++I SCQD SYL+   MG
Sbjct  61   STELMQHQETRNPVEQLEETLRHTYMVILSCQDSSYLHSCFMG  103



>gb|EEE57693.1| hypothetical protein OsJ_08164 [Oryza sativa Japonica Group]
Length=1467

 Score =   122 bits (306),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 56/103 (54%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA W  LG +AN+AQL G+DA  LI MIV+AA TAK +++ C++ A+H+K+IG+LL++L+
Sbjct  1    MALWNGLGQVANIAQLAGVDAYGLIKMIVEAAQTAKRNRETCQKLARHVKMIGDLLQRLQ  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
             TEL ++ ETR P+E LE+ LR +Y+LI SCQD SYL+   MG
Sbjct  61   STELMQHQETRNPVEQLEETLRHTYMLILSCQDSSYLHSCFMG  103



>gb|ABA95227.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=2776

 Score =   121 bits (304),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 56/103 (54%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA W  LG +AN+AQL G+DA  LI MIV+AA TAK +++ C++ A+H+K+IG+LL++L+
Sbjct  1    MALWNGLGQVANIAQLAGVDAYGLIKMIVEAAQTAKRNRETCQKLARHVKMIGDLLQRLQ  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
             TEL ++ ETR P+E LE+ LR +Y+LI SCQD SYL+   MG
Sbjct  61   STELMQHQETRNPVEQLEETLRHTYMLILSCQDSSYLHSCFMG  103



>gb|KDP44714.1| hypothetical protein JCGZ_01214 [Jatropha curcas]
Length=381

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  396  ANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPET  575
             ++AQ+TG+DA+ L  MI+ AA  A  H++NC Q A+H+KLI NLLE+LK ++L   P T
Sbjct  3    TSIAQVTGVDALGLANMIISAARNATTHRRNCEQLAEHVKLISNLLEKLKSSDLMNLPAT  62

Query  576  REPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +EPLE +EDALR++  L+ +C+D SYLY+LAMGW
Sbjct  63   KEPLEGMEDALRKALDLVENCKDNSYLYMLAMGW  96



>ref|XP_012090597.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like [Jatropha 
curcas]
Length=531

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  396  ANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPET  575
             ++AQ+TG+DA+ L  MI+ AA  A  H++NC Q A+H+KLI NLLE+LK ++L   P T
Sbjct  144  TSIAQVTGVDALGLANMIISAARNATTHRRNCEQLAEHVKLISNLLEKLKSSDLMNLPAT  203

Query  576  REPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +EPLE +EDALR++  L+ +C+D SYLY+LAMGW
Sbjct  204  KEPLEGMEDALRKALDLVENCKDNSYLYMLAMGW  237



>ref|XP_011035883.1| PREDICTED: cell number regulator 13-like [Populus euphratica]
Length=388

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +3

Query  393  LANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPE  572
            +AN+AQ+ G+D   L  MI+ +A  A  HKKNC Q A+H+K+I NLLE++K T+L   P 
Sbjct  1    MANLAQVAGVDTSGLANMIISSARNATAHKKNCEQLAEHVKIISNLLEKIKSTDLVNLPA  60

Query  573  TREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            T+EPL+ LE+ALR++  L+ SC+++SYLY+LAMGW
Sbjct  61   TKEPLDCLEEALRKALDLVESCKEKSYLYMLAMGW  95



>gb|EAZ08702.1| hypothetical protein OsI_30969 [Oryza sativa Indica Group]
Length=200

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +3

Query  369  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  548
            +SW+ LG  A+V Q+TG+DA  L+ MIV+AA TA+ ++  CRQ AQH++++G LL +L+I
Sbjct  5    SSWDRLGQAASVMQVTGVDAFGLVAMIVQAAHTARRNRDLCRQLAQHVQIVGGLLRKLQI  64

Query  549  TELKKYPETREPLELLEDALRRSYILINSC  638
             EL+++PETR PLE L+DAL R+Y L+ SC
Sbjct  65   PELRRHPETRRPLEQLDDALLRAYKLVRSC  94



>ref|XP_002316192.2| hypothetical protein POPTR_0010s19210g, partial [Populus trichocarpa]
 gb|EEF02363.2| hypothetical protein POPTR_0010s19210g, partial [Populus trichocarpa]
Length=396

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +3

Query  390  DLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYP  569
            ++AN+AQ+ G+    L  MI+ +A  A  HKKNC Q A+H+K+I NLLE++K T+L   P
Sbjct  5    NMANLAQVAGVHTSGLANMIISSARNATAHKKNCEQLAEHVKIISNLLEKIKSTDLVNLP  64

Query  570  ETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
             T+EPL+ LE+ALR++  L+ SC+++SYLY+LAMGW
Sbjct  65   ATKEPLDCLEEALRKALDLVESCKEKSYLYMLAMGW  100



>gb|KDO68875.1| hypothetical protein CISIN_1g020555mg [Citrus sinensis]
Length=324

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 74/97 (76%), Gaps = 2/97 (2%)
 Frame = +3

Query  393  LANVA--QLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKY  566
            +AN+A   +TG+DA+ L+  I+ +A  A  H++NC Q A+H+K+IGNLLE+LK T+L   
Sbjct  1    MANLAVQAVTGVDAVSLVNTIISSARKAAAHRRNCEQLAEHVKMIGNLLEKLKSTDLVSL  60

Query  567  PETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            P  +EPL+ LE+AL+++  L+ SC+D+SYLY+LAMGW
Sbjct  61   PAIKEPLDCLEEALKKALDLVESCRDKSYLYMLAMGW  97



>ref|XP_006486524.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Citrus 
sinensis]
Length=342

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 73/97 (75%), Gaps = 2/97 (2%)
 Frame = +3

Query  393  LANVA--QLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKY  566
            +AN+A   + G+DA+ L+  I+ +A  A  H++NC Q A+H+K+IGNLLE+LK T+L   
Sbjct  1    MANLAVQAVAGVDAVSLVNTIISSARKAAAHRRNCEQLAEHVKMIGNLLEKLKSTDLVSL  60

Query  567  PETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            P  +EPL+ LE+AL+++  L+ SC+D+SYLY+LAMGW
Sbjct  61   PAIKEPLDCLEEALKKALDLVESCRDKSYLYMLAMGW  97



>ref|XP_006435802.1| hypothetical protein CICLE_v10031760mg [Citrus clementina]
 gb|ESR49042.1| hypothetical protein CICLE_v10031760mg [Citrus clementina]
Length=393

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 73/97 (75%), Gaps = 2/97 (2%)
 Frame = +3

Query  393  LANVA--QLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKY  566
            +AN+A   + G+DA+ L+  I+ +A  A  H++NC Q A+H+K+IGNLLE+LK T+L   
Sbjct  1    MANLAVQAVAGVDAVSLVNTIISSARKAAAHRRNCEQLAEHVKMIGNLLEKLKSTDLVSL  60

Query  567  PETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            P  +EPL+ LE+AL+++  L+ SC+D+SYLY+LAMGW
Sbjct  61   PAIKEPLDCLEEALKKALDLVESCRDKSYLYMLAMGW  97



>ref|XP_006356472.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Solanum tuberosum]
Length=389

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +3

Query  393  LANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPE  572
            + ++AQ+ G++A+ +I +I+ A+  A  HK+NC Q A+H++LIGNLLE+LK T+L K   
Sbjct  1    MEDIAQVAGVNALGVINLIIAASKNATTHKRNCEQLAEHVRLIGNLLEKLKSTDLMKMSA  60

Query  573  TREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            T EPLE LE+AL ++  L++SC+++SY Y+LAMGW
Sbjct  61   TAEPLEGLEEALGKALELVDSCREKSYFYMLAMGW  95



>ref|XP_002437501.1| hypothetical protein SORBIDRAFT_10g028240 [Sorghum bicolor]
 gb|EER88868.1| hypothetical protein SORBIDRAFT_10g028240 [Sorghum bicolor]
Length=535

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            W  LG  +NVAQL G+DA+ L+ M+V+AA  A+ H+  CR+ AQH++++G LL +L++ E
Sbjct  30   WTVLGQASNVAQLVGVDALGLVSMVVQAALAARRHRDACRRLAQHVEVVGGLLRELEVAE  89

Query  555  LKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
            L +   TR PL+ L DALRR Y L+ +CQD  YL  L +G
Sbjct  90   LMRRETTRRPLQQLHDALRRCYALVTACQDCGYLRSLFVG  129



>ref|XP_008676748.1| PREDICTED: uncharacterized protein LOC100272597 isoform X1 [Zea 
mays]
Length=510

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA W  +G +A++AQL G+DA  LI MIV+AA T K +++ C+  A+  ++IG+LL QL+
Sbjct  1    MALWNGIGQVASIAQLAGVDAYGLISMIVEAAKTVKRNRETCQLLARRARMIGDLLHQLE  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
             T+L ++ ETR P+E LE+ LR +Y+LI SC++ SYLY   MG
Sbjct  61   RTQLMQHMETRNPVEHLEETLRHAYVLITSCRNSSYLYNCCMG  103



>ref|XP_008676749.1| PREDICTED: uncharacterized protein LOC100272597 isoform X2 [Zea 
mays]
Length=508

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA W  +G +A++AQL G+DA  LI MIV+AA T K +++ C+  A+  ++IG+LL QL+
Sbjct  1    MALWNGIGQVASIAQLAGVDAYGLISMIVEAAKTVKRNRETCQLLARRARMIGDLLHQLE  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
             T+L ++ ETR P+E LE+ LR +Y+LI SC++ SYLY   MG
Sbjct  61   RTQLMQHMETRNPVEHLEETLRHAYVLITSCRNSSYLYNCCMG  103



>ref|XP_010318233.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Solanum lycopersicum]
Length=377

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +3

Query  393  LANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPE  572
            + + AQ+ G++A+ +I +I+ A+  A  HK+NC Q A+H+++IGNLLE+LK T+L K   
Sbjct  1    MEDFAQVAGVNALGVINLIIAASKNATTHKRNCEQLAEHVRMIGNLLEKLKSTDLMKLSA  60

Query  573  TREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            T EPLE L+ AL  +  L+NSC+++SY Y+LAMGW
Sbjct  61   TAEPLEGLDAALGNALELVNSCREKSYFYMLAMGW  95



>ref|XP_006575552.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Glycine max]
Length=384

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +3

Query  393  LANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPE  572
            + N+AQ+ G++AM +   ++ AA  A+ H++NC + A  +++I NLLE LK TE+ + P 
Sbjct  1    MENLAQVAGLNAMSVTNTVITAAHNARAHRRNCERMAAQVRMIWNLLEALKSTEVARLPA  60

Query  573  TREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            T+EPL+ LE+AL+ +  L+ SC+DRSYLY+LAMGW
Sbjct  61   TKEPLDGLEEALQEALDLVESCKDRSYLYMLAMGW  95



>ref|XP_003518431.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Glycine max]
Length=403

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +3

Query  393  LANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPE  572
            + N+AQ+ G++AM +   ++ AA  A+ H++NC + A  +++I NLLE LK TE+ + P 
Sbjct  1    MENLAQVAGLNAMSVTNTVITAAHNARAHRRNCERMAAQVRMIWNLLEALKSTEVARLPA  60

Query  573  TREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            T+EPL+ LE+AL+ +  L+ SC+DRSYLY+LAMGW
Sbjct  61   TKEPLDGLEEALQEALDLVESCKDRSYLYMLAMGW  95



>ref|XP_004962551.1| PREDICTED: proline-rich receptor-like protein kinase PERK14-like 
isoform X4 [Setaria italica]
Length=424

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 71/104 (68%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA W  LG +A VAQLTG+DA  LI MI++A  T   +K++CR  A+   +IG+LL++L+
Sbjct  1    MALWNGLGQVATVAQLTGVDASGLIAMILEAVRTVSRNKEDCRHLARRAMMIGDLLQKLQ  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
              ++ + PE R PL+ L+DALR +Y+LI SCQ+ S  Y   MGW
Sbjct  61   GWDMMQEPEIRRPLDGLDDALREAYVLIASCQNCSTTYRFLMGW  104



>ref|XP_009369272.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
Length=141

 Score =   100 bits (250),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  396  ANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPET  575
            ++ A+  G+DA+ L   I   A +A+ H+ NC+QFA+H++++GNLLE++K T+  K P T
Sbjct  4    SDFAEAPGLDAVSLTTTIASTAQSARTHRHNCQQFAEHVRMVGNLLEKMKSTDFMKLPCT  63

Query  576  REPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +EPL+ LE AL ++ +L+  C+D S LY+ A+GW
Sbjct  64   KEPLDGLEKALVKALLLVQGCRDNSCLYMFALGW  97



>ref|XP_004235233.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Solanum lycopersicum]
Length=390

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +3

Query  393  LANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPE  572
            + + AQ+ G++A+ +I +I+ A+  A  HK+NC Q A+H+++IGNLLE+LK T+L K   
Sbjct  1    MEDFAQVAGVNALGVINLIIAASKNATTHKRNCEQLAEHVRMIGNLLEKLKSTDLMKLSA  60

Query  573  TREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            T EPLE L+ AL  +  L+NSC+++SY Y+LAMGW
Sbjct  61   TAEPLEGLDAALGNALELVNSCREKSYFYMLAMGW  95



>ref|XP_010237406.1| PREDICTED: cell number regulator 13-like [Brachypodium distachyon]
 ref|XP_010237407.1| PREDICTED: cell number regulator 13-like [Brachypodium distachyon]
Length=206

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA+W  +   A+VAQL G+DA  LI MIV+A  T + +K+ C++ A+ +K+IG+LL+QL 
Sbjct  1    MATWNGVSQAASVAQLAGVDAYGLIKMIVEAVQTVRRNKETCQKLARRVKMIGDLLQQLH  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
              +L ++ +TR P+E LE+ LR++++LI +CQD S++Y    G
Sbjct  61   EAQLMQHGDTRSPVEQLEETLRQAFMLITTCQDSSFMYHCFTG  103



>ref|XP_004962550.1| PREDICTED: proline-rich receptor-like protein kinase PERK14-like 
isoform X3 [Setaria italica]
Length=556

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 71/104 (68%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA W  LG +A VAQLTG+DA  LI MI++A  T   +K++CR  A+   +IG+LL++L+
Sbjct  1    MALWNGLGQVATVAQLTGVDASGLIAMILEAVRTVSRNKEDCRHLARRAMMIGDLLQKLQ  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
              ++ + PE R PL+ L+DALR +Y+LI SCQ+ S  Y   MGW
Sbjct  61   GWDMMQEPEIRRPLDGLDDALREAYVLIASCQNCSTTYRFLMGW  104



>ref|XP_004962548.1| PREDICTED: proline-rich receptor-like protein kinase PERK14-like 
isoform X1 [Setaria italica]
 ref|XP_004962549.1| PREDICTED: proline-rich receptor-like protein kinase PERK14-like 
isoform X2 [Setaria italica]
Length=558

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 71/104 (68%), Gaps = 0/104 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA W  LG +A VAQLTG+DA  LI MI++A  T   +K++CR  A+   +IG+LL++L+
Sbjct  1    MALWNGLGQVATVAQLTGVDASGLIAMILEAVRTVSRNKEDCRHLARRAMMIGDLLQKLQ  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
              ++ + PE R PL+ L+DALR +Y+LI SCQ+ S  Y   MGW
Sbjct  61   GWDMMQEPEIRRPLDGLDDALREAYVLIASCQNCSTTYRFLMGW  104



>gb|EEC71170.1| hypothetical protein OsI_03036 [Oryza sativa Indica Group]
 gb|EEE52505.1| hypothetical protein OsJ_34708 [Oryza sativa Japonica Group]
Length=152

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = +3

Query  396  ANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPET  575
            + +AQ  G+DA  LI MI +AA T + ++  C Q A+ LK+IG+LL+QL   +L + PET
Sbjct  8    STIAQFAGVDAYGLIKMIAEAAQTVRRNRATCLQLARRLKMIGDLLKQLHGAQLMQQPET  67

Query  576  REPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
            R P+E LE+ LRR+Y+L+ SCQ RSY+Y   MG
Sbjct  68   RNPVEQLEETLRRAYLLVRSCQGRSYVYRCFMG  100



>ref|XP_002449963.1| hypothetical protein SORBIDRAFT_05g026280 [Sorghum bicolor]
 gb|EES08951.1| hypothetical protein SORBIDRAFT_05g026280 [Sorghum bicolor]
Length=186

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = +3

Query  384  LGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQL--KITEL  557
            +G +A VAQL G+DA  LI MI +AA T + ++  CRQ A+ +++IG LL +L  + T+L
Sbjct  4    VGQVATVAQLVGVDAFSLITMIAEAAQTVRRNRAVCRQLARRVEMIGGLLRRLQDQDTQL  63

Query  558  KKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
             + PETR P+E LE+ LRR+Y+L+ SCQ R Y Y   MG
Sbjct  64   MQLPETRTPVEALEETLRRAYLLVRSCQRRGYAYRCFMG  102



>ref|XP_004979928.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-13-like [Setaria italica]
Length=507

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 72/103 (70%), Gaps = 0/103 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA W  +  LA+VAQL G+DA  LI MI +AA T K +++ C+  A+  ++IG+LL+QL+
Sbjct  1    MALWNGVSQLASVAQLAGVDAYGLISMIAEAARTVKRNRETCQLLARRARMIGDLLQQLE  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
             T L ++ ETR P+E LE+ LR++YILI SC+D  YL+   MG
Sbjct  61   RTRLMQHMETRNPVEQLEETLRQAYILIASCRDSGYLHSCCMG  103



>ref|NP_001068433.1| Os11g0672300 [Oryza sativa Japonica Group]
 gb|ABA95277.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABA95278.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF28796.1| Os11g0672300 [Oryza sativa Japonica Group]
 dbj|BAG89898.1| unnamed protein product [Oryza sativa Japonica Group]
Length=214

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = +3

Query  396  ANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPET  575
            + +AQ  G+DA  LI MI +AA T + ++  C Q A+ LK+IG+LL+QL   +L + PET
Sbjct  8    STIAQFAGVDAYGLIKMIAEAAQTVRRNRATCLQLARRLKMIGDLLKQLHGAQLMQQPET  67

Query  576  REPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
            R P+E LE+ LRR+Y+L+ SCQ RSY+Y   MG
Sbjct  68   RNPVEQLEETLRRAYLLVRSCQGRSYVYRCFMG  100



>ref|XP_004979929.1| PREDICTED: cell number regulator 13-like [Setaria italica]
Length=194

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 64/97 (66%), Gaps = 0/97 (0%)
 Frame = +3

Query  384  LGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKK  563
            +G +A VAQL G+DA  LI MI  AA T + ++  CRQ A+ +++IG LL +L+     +
Sbjct  4    VGQVATVAQLVGLDAYSLITMIADAARTVRRNRATCRQLARRVEMIGGLLRRLQDAHPMR  63

Query  564  YPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
             PETR P+E LE+ LRR+Y+L+ SCQ R Y Y   MG
Sbjct  64   APETRAPVEELEETLRRAYLLVRSCQRRGYAYRCFMG  100



>ref|XP_010087526.1| hypothetical protein L484_006931 [Morus notabilis]
 gb|EXB29257.1| hypothetical protein L484_006931 [Morus notabilis]
Length=388

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 66/98 (67%), Gaps = 0/98 (0%)
 Frame = +3

Query  384  LGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKK  563
            +G  +      G DA+ L  MI  +A TA  H++NC Q A+H ++IGNLLE+LK T+L  
Sbjct  1    MGTFSQPYYAAGTDAVTLTSMIAASARTAATHRRNCEQLAEHARVIGNLLEKLKATDLVT  60

Query  564  YPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
             P  +EPL+ LE++L+++  LI  C+D+S LYLLAMGW
Sbjct  61   LPAVKEPLDGLEESLKKALELIECCRDKSCLYLLAMGW  98



>ref|XP_008363765.1| PREDICTED: LOW QUALITY PROTEIN: protein MID1-COMPLEMENTING ACTIVITY 
1-like [Malus domestica]
Length=392

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  396  ANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPET  575
            ++ A+  G+DA+ L   IV  A +A+ H+ NC+Q A+H++++GNLLE++K T+L K P T
Sbjct  4    SDFAEAPGLDAVGLTSTIVSTAQSARTHRHNCQQLAEHVRMVGNLLEKMKSTDLMKLPCT  63

Query  576  REPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +EPL+ LE AL ++ +L+  C+D S LY+ A+GW
Sbjct  64   KEPLDGLEKALVKALLLVQGCRDNSCLYMFALGW  97



>emb|CDP13977.1| unnamed protein product [Coffea canephora]
Length=378

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 66/95 (69%), Gaps = 0/95 (0%)
 Frame = +3

Query  393  LANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPE  572
            +    + T  DAM LI +I  AA  A  HK NC+Q A H+++IGNLLE+LK T+L K   
Sbjct  1    MEGTGRATRADAMGLINLITTAARNAITHKNNCQQLADHVRMIGNLLEKLKSTDLMKLAA  60

Query  573  TREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            T EPL  LE+AL+++  L+ SC+D+SYLY++++GW
Sbjct  61   TAEPLAQLEEALKKALDLVESCRDKSYLYMISLGW  95



>ref|XP_007008883.1| PLAC8 family protein [Theobroma cacao]
 gb|EOY17693.1| PLAC8 family protein [Theobroma cacao]
Length=385

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = +3

Query  417  GIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPETREPLELL  596
            G++++ L  +I+ +A  A MH+ NC Q A+H+KLIGNLLE+LK T L   P  +EPL+ L
Sbjct  4    GLNSLGLTTLILSSARNASMHRNNCEQLAEHVKLIGNLLEKLKSTNLVTLPAVKEPLDGL  63

Query  597  EDALRRSYILINSCQDRSYLYLLAMGW  677
            ++AL+++  L+ SC+D+S+LY+LA+GW
Sbjct  64   DEALKKALDLVESCRDKSWLYMLALGW  90



>gb|EMS49964.1| hypothetical protein TRIUR3_26988 [Triticum urartu]
Length=157

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 62/97 (64%), Gaps = 0/97 (0%)
 Frame = +3

Query  384  LGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKK  563
            +G  A VAQ  G+DA  +I MI  AA T + ++  C Q A+  K+IG+LL QL   +L +
Sbjct  4    VGQAAMVAQFAGVDAYGIIKMIADAAQTVRRNRATCLQLARRAKMIGDLLHQLHAAQLMQ  63

Query  564  YPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
             PETR P+E LE+ LRR+ +L+ SCQ R YLY   +G
Sbjct  64   QPETRNPMEQLEETLRRALLLVRSCQGRRYLYRCFLG  100



>ref|XP_007219349.1| hypothetical protein PRUPE_ppa019431mg [Prunus persica]
 gb|EMJ20548.1| hypothetical protein PRUPE_ppa019431mg [Prunus persica]
Length=398

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +3

Query  420  IDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPETREPLELLE  599
            +DA+ L   IV  A  A+ H+ NC Q A+H+ +IGNLLE++K T+L K P T+EPL  LE
Sbjct  13   LDALSLTNTIVSLARNARTHRHNCGQLAEHVGMIGNLLEKIKSTDLMKLPATKEPLVGLE  72

Query  600  DALRRSYILINSCQDRSYLYLLAMGW  677
            +AL ++  L+ SC+D+S LY+LAMGW
Sbjct  73   EALEKALQLVESCRDKSCLYMLAMGW  98



>ref|NP_001146395.1| uncharacterized protein LOC100279975 [Zea mays]
 gb|ACL53879.1| unknown [Zea mays]
Length=194

 Score = 94.0 bits (232),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 69/103 (67%), Gaps = 6/103 (6%)
 Frame = +3

Query  384  LGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE---  554
            +G +A VAQL G+DA  LI MI +AA TA+ ++  CRQ A+ +++IG+LL +L+  +   
Sbjct  4    VGQVATVAQLVGVDAFSLITMIAEAAQTARRNRAVCRQLARRVEMIGSLLRRLREQDDND  63

Query  555  ---LKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
               L ++ ETR P+E LE+ LRR+Y+L+ SCQ R Y +   MG
Sbjct  64   DMRLLRHAETRGPVEALEETLRRAYLLVRSCQRRGYAFRCLMG  106



>ref|NP_001142910.1| uncharacterized protein LOC100275341 [Zea mays]
 gb|ACG27492.1| hypothetical protein [Zea mays]
Length=227

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = +3

Query  399  NVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPETR  578
            ++A+L G+DA+KL+ MIV+AA T + +KK CRQ   H+++I +LLE+L+   + ++PETR
Sbjct  2    DIAKLAGVDAVKLVVMIVRAAQTVRRNKKTCRQLVHHVQIIDDLLEKLQTPAMMQHPETR  61

Query  579  EPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
              L  LE+ LR  Y+ + SCQ+  YLY L  G
Sbjct  62   NGLNDLEEILREVYMFVTSCQNNKYLYHLFTG  93



>gb|EEC76280.1| hypothetical protein OsI_13781 [Oryza sativa Indica Group]
Length=476

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 62/101 (61%), Gaps = 0/101 (0%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            W  LG  A VAQL G D   LI +I++AA TA+ +KK C Q A+ + +I  LL  L+  E
Sbjct  2    WSGLGQAATVAQLVGADVGSLISVIMQAAMTARQNKKECEQLARRVFMIAELLPHLQDPE  61

Query  555  LKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            + + PE R PL  L+DALR ++ L+ SCQ R+  Y L M W
Sbjct  62   VMRRPEVRRPLAGLDDALREAHELVTSCQRRAAAYRLVMAW  102



>ref|XP_002438909.1| hypothetical protein SORBIDRAFT_10g028036 [Sorghum bicolor]
 gb|EER90276.1| hypothetical protein SORBIDRAFT_10g028036, partial [Sorghum bicolor]
Length=151

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            W  LG  +NV QL GIDA+ L+ M+V+AA  A+ H+  CR+ AQH++L+G LL +L++ E
Sbjct  19   WTVLGQASNVVQLVGIDALGLVSMVVQAALAARRHRDACRRLAQHVELVGGLLRELELAE  78

Query  555  LKKYPETREPLELLEDALRRSYILINSCQDRS  650
            L +   TR PLE L  ALRR Y L+ +CQDR 
Sbjct  79   LMRREATRRPLEQLSAALRRCYALVTACQDRG  110



>gb|KHN38534.1| Protein MID1-COMPLEMENTING ACTIVITY 1 [Glycine soja]
Length=372

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +3

Query  429  MKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPETREPLELLEDAL  608
            M +   ++ AA  A+ H++NC + A  +++I NLLE LK TE+ + P T+EPL+ LE+AL
Sbjct  1    MSVTNTVITAAHNARAHRRNCERMAAQVRMIWNLLEALKSTEVARLPATKEPLDGLEEAL  60

Query  609  RRSYILINSCQDRSYLYLLAMGW  677
            + +  L+ SC+DRSYLY+LAMGW
Sbjct  61   QEALDLVESCKDRSYLYMLAMGW  83



>ref|XP_002446043.1| hypothetical protein SORBIDRAFT_06g000900 [Sorghum bicolor]
 gb|EES10371.1| hypothetical protein SORBIDRAFT_06g000900 [Sorghum bicolor]
Length=146

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 66/92 (72%), Gaps = 1/92 (1%)
 Frame = +3

Query  366  MAS-WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQL  542
            MAS W+ LG  A+V QLTG+DA  ++ MI++AA TA+ ++  C+Q A+ ++++  LLE+L
Sbjct  1    MASFWDMLGKAASVMQLTGVDAFGMVSMIIQAARTARRNRDLCQQLAKKVEIVSGLLEEL  60

Query  543  KITELKKYPETREPLELLEDALRRSYILINSC  638
             I EL+++ +TR PL+ L  AL R Y+L+ SC
Sbjct  61   NIPELRRHRKTRRPLDELRSALFRGYVLVWSC  92



>gb|EMT23150.1| hypothetical protein F775_17508 [Aegilops tauschii]
Length=173

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 67/91 (74%), Gaps = 1/91 (1%)
 Frame = +3

Query  402  VAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPETRE  581
            +AQL G+DA  LI MIV+AA T + +++ C+  A+ +K+IG+LL+QL+ T+L ++ +TR 
Sbjct  1    MAQLAGVDAYGLITMIVEAARTVRRNRETCQLLARRVKMIGDLLQQLESTQLMQHLDTRN  60

Query  582  PLELLEDALRRSYILINSCQDRSYLYLLAMG  674
            P+E LE  +R +Y+LI SCQD SYLY   MG
Sbjct  61   PVEQLE-TVRHTYMLIRSCQDGSYLYSCFMG  90



>ref|XP_004979962.1| PREDICTED: cysteine-rich receptor-like protein kinase 15-like 
isoform X2 [Setaria italica]
Length=441

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +3

Query  399  NVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPETR  578
            ++A+L G+DA+KL+ MIV+A+ T + +KK C+Q  QH+++IG+LL++L+ +E+ + PE R
Sbjct  2    DIAKLAGVDAIKLVVMIVQASQTVRHNKKTCQQLVQHVQIIGDLLKKLQASEMMQQPEIR  61

Query  579  EPLELLEDALRRSYILINSCQDRSYLYLLAM  671
              L  LE  LR +Y+L+ SCQ+ +Y+Y L M
Sbjct  62   NGLSELEQILREAYMLVTSCQNNNYVYHLFM  92



>ref|XP_008234071.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Prunus 
mume]
Length=398

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +3

Query  420  IDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPETREPLELLE  599
            +DA+ L   IV  A  A+ H+ NC Q A+H+ +IGNLLE++K T+L K P T+E L  LE
Sbjct  13   LDALSLTNTIVSLARNARTHRHNCGQLAEHVGMIGNLLEKIKSTDLMKLPATKETLVGLE  72

Query  600  DALRRSYILINSCQDRSYLYLLAMGW  677
            +AL ++  L+ SC+D+S LY+LAMGW
Sbjct  73   EALEKALQLVESCRDKSCLYMLAMGW  98



>ref|XP_004979961.1| PREDICTED: cysteine-rich receptor-like protein kinase 15-like 
isoform X1 [Setaria italica]
Length=496

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +3

Query  399  NVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPETR  578
            ++A+L G+DA+KL+ MIV+A+ T + +KK C+Q  QH+++IG+LL++L+ +E+ + PE R
Sbjct  2    DIAKLAGVDAIKLVVMIVQASQTVRHNKKTCQQLVQHVQIIGDLLKKLQASEMMQQPEIR  61

Query  579  EPLELLEDALRRSYILINSCQDRSYLYLLAM  671
              L  LE  LR +Y+L+ SCQ+ +Y+Y L M
Sbjct  62   NGLSELEQILREAYMLVTSCQNNNYVYHLFM  92



>dbj|BAD45624.1| receptor protein kinase-like [Oryza sativa Japonica Group]
Length=541

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 70/101 (69%), Gaps = 1/101 (1%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            W  LG  +NVAQL G+DA+ L+ M+V+AA  A+ H+  CR+  QH++L+G LL +L++ E
Sbjct  92   WGVLGQASNVAQLVGVDALGLVSMVVQAALAARRHRDACRRLGQHVELVGGLLWELELAE  151

Query  555  LKKYPETREPLELLEDALRRSYILINSCQ-DRSYLYLLAMG  674
            L +   TR PLE L+ ALRR Y L+ +CQ DR YL+ L +G
Sbjct  152  LMRREATRRPLEQLQGALRRCYALVTACQEDRGYLHRLLLG  192



>gb|EEE52537.1| hypothetical protein OsJ_34760 [Oryza sativa Japonica Group]
Length=202

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 64/103 (62%), Gaps = 0/103 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            +A W+  G  A VAQL G D   LI MI++AA TA+ +KK C Q A+ +  I  LL+ L+
Sbjct  32   IALWDVTGHAATVAQLVGADVGGLISMIMQAAMTAQQNKKECEQLARRVFTIAELLQHLQ  91

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
              E+ + PE R PL  L+D LR ++ L+ SCQD+S +Y L M 
Sbjct  92   DPEVLRRPEIRRPLTGLDDTLREAHELVLSCQDKSAVYRLVMA  134



>gb|EEE52535.1| hypothetical protein OsJ_34758 [Oryza sativa Japonica Group]
Length=279

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 65/104 (63%), Gaps = 1/104 (1%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA W  LG  A VAQL G+D   L+ MI+ AA TA+ +K+ C Q A+ + +IG LL  L+
Sbjct  1    MALWGGLGQTATVAQLVGVDVGGLVSMIMHAALTARQNKRECEQLARRVFMIGELLPHLQ  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLY-LLAMG  674
             + + + PE R PL LL   LR ++ L+ SCQ RS +Y L+A G
Sbjct  61   DSSVMRRPEVRRPLMLLGGMLREAHELVASCQGRSTVYQLVAAG  104



>gb|ABA95138.1| Protein kinase domain containing protein [Oryza sativa Japonica 
Group]
 gb|EAZ19206.1| hypothetical protein OsJ_34746 [Oryza sativa Japonica Group]
Length=543

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 64/103 (62%), Gaps = 0/103 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA W  LG  A VAQL G D   LI MI++AA TA+ +KK C Q A+ +  I  LL+ L+
Sbjct  1    MALWSGLGQAATVAQLVGADVGGLISMIMQAAMTAQQNKKECEQLARRVFTIAELLQHLQ  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
              +L + PE R PL  L+D LR ++ L+ SCQD+S +Y L M 
Sbjct  61   DPDLLRRPEIRRPLTGLDDTLREAHELVLSCQDKSAVYQLVMA  103



>gb|ABA95204.1| hypothetical protein LOC_Os11g44520 [Oryza sativa Japonica Group]
Length=308

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 65/104 (63%), Gaps = 1/104 (1%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA W  LG  A VAQL G+D   L+ MI+ AA TA+ +K+ C Q A+ + +IG LL  L+
Sbjct  1    MALWGGLGQTATVAQLVGVDVGGLVSMIMHAALTARQNKRECEQLARRVFMIGELLPHLQ  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLY-LLAMG  674
             + + + PE R PL LL   LR ++ L+ SCQ RS +Y L+A G
Sbjct  61   DSSVMRRPEVRRPLMLLGGMLREAHELVASCQGRSTVYQLVAAG  104



>ref|XP_004979334.1| PREDICTED: putative serine/threonine-protein kinase-like protein 
CCR3-like [Setaria italica]
Length=519

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 64/99 (65%), Gaps = 0/99 (0%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            W  LG  A VAQL G D   LI MI++AA TA+ +KK C Q A+ +  +G LL+ L+  E
Sbjct  2    WTVLGQAATVAQLVGADVGGLISMIIQAAVTAQQNKKECEQLARRVFTVGELLQHLQDPE  61

Query  555  LKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAM  671
            + + PE R PL  L+DALR ++ L+ +CQD+S +Y L +
Sbjct  62   VLRRPEIRRPLAGLDDALREAHKLVMACQDKSAVYRLVL  100



>ref|XP_004966167.1| PREDICTED: cysteine-rich receptor-like protein kinase 19-like 
[Setaria italica]
Length=569

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 67/100 (67%), Gaps = 0/100 (0%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            W  LG  +NVAQL G+DA+ L  M+V+AA  A+ H+  CR+ AQH++++G LL +L++ E
Sbjct  13   WTVLGQASNVAQLVGVDALGLASMVVQAALAARRHRDACRRLAQHVEIVGGLLRELELAE  72

Query  555  LKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
            L ++  TR PLE L  ALRR Y L+ +CQD  YL  L  G
Sbjct  73   LMRWEATRRPLEQLSGALRRCYALVTACQDCGYLRSLLAG  112



>ref|XP_010227386.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
20 isoform X2 [Brachypodium distachyon]
Length=567

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 68/100 (68%), Gaps = 0/100 (0%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            W  LG  +NVAQL G+DA+ L+ M+V+AA  A+ H+  C + AQH++L+G LL +L++ E
Sbjct  13   WGTLGQASNVAQLVGVDALGLVSMVVQAALAARRHRDACVRLAQHVELVGGLLRELELAE  72

Query  555  LKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
            L +   TR PLE L  ALRR Y L+++CQD  YL  L +G
Sbjct  73   LMRREATRRPLEQLRGALRRCYALVSACQDCGYLRRLLLG  112



>ref|XP_008648919.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
23 isoform X3 [Zea mays]
Length=568

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 68/100 (68%), Gaps = 0/100 (0%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            W  LG  +NVAQL G+DA+ L+ M+V+AA  A+ H+  CR+ AQH++++G LL +L++ E
Sbjct  8    WAVLGQASNVAQLVGVDALGLVSMVVQAALAARRHRDACRRLAQHVEVVGGLLRELELAE  67

Query  555  LKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
            L +   TR PL+ L  ALRR Y L+ +CQD  YL  L +G
Sbjct  68   LMRREATRRPLDQLRAALRRCYALVTACQDCGYLRSLLLG  107



>ref|XP_010227385.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
20 isoform X1 [Brachypodium distachyon]
Length=569

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 68/100 (68%), Gaps = 0/100 (0%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            W  LG  +NVAQL G+DA+ L+ M+V+AA  A+ H+  C + AQH++L+G LL +L++ E
Sbjct  13   WGTLGQASNVAQLVGVDALGLVSMVVQAALAARRHRDACVRLAQHVELVGGLLRELELAE  72

Query  555  LKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
            L +   TR PLE L  ALRR Y L+++CQD  YL  L +G
Sbjct  73   LMRREATRRPLEQLRGALRRCYALVSACQDCGYLRRLLLG  112



>ref|XP_008648920.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
23 isoform X4 [Zea mays]
 gb|AFW75924.1| putative protein kinase superfamily protein [Zea mays]
Length=567

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 68/100 (68%), Gaps = 0/100 (0%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            W  LG  +NVAQL G+DA+ L+ M+V+AA  A+ H+  CR+ AQH++++G LL +L++ E
Sbjct  8    WAVLGQASNVAQLVGVDALGLVSMVVQAALAARRHRDACRRLAQHVEVVGGLLRELELAE  67

Query  555  LKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
            L +   TR PL+ L  ALRR Y L+ +CQD  YL  L +G
Sbjct  68   LMRREATRRPLDQLRAALRRCYALVTACQDCGYLRSLLLG  107



>gb|EAY92100.1| hypothetical protein OsI_13806 [Oryza sativa Indica Group]
Length=539

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 64/103 (62%), Gaps = 0/103 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA W  LG  A VAQL G D   LI MI++AA TA+ +KK C Q A+ +  I  LL+ L+
Sbjct  1    MALWGGLGQAATVAQLVGADIGGLITMIMQAAMTAQQNKKECEQLARRIFTIAELLQHLQ  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
              E+ + PE R PL  L+D LR ++ L+ SCQD+S +Y L M 
Sbjct  61   DPEVLRRPEIRRPLTGLDDTLREAHELVLSCQDKSAVYRLVMA  103



>ref|XP_008648918.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
23 isoform X2 [Zea mays]
Length=576

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 68/100 (68%), Gaps = 0/100 (0%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            W  LG  +NVAQL G+DA+ L+ M+V+AA  A+ H+  CR+ AQH++++G LL +L++ E
Sbjct  8    WAVLGQASNVAQLVGVDALGLVSMVVQAALAARRHRDACRRLAQHVEVVGGLLRELELAE  67

Query  555  LKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
            L +   TR PL+ L  ALRR Y L+ +CQD  YL  L +G
Sbjct  68   LMRREATRRPLDQLRAALRRCYALVTACQDCGYLRSLLLG  107



>ref|NP_001058414.2| Os06g0689600 [Oryza sativa Japonica Group]
 dbj|BAF20328.2| Os06g0689600 [Oryza sativa Japonica Group]
Length=149

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 66/101 (65%), Gaps = 1/101 (1%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            W  LG  +NVAQL G+DA+ L+ M+ +AA  A+ H+  CR+  QH +L+G LL +L++ E
Sbjct  7    WGVLGQASNVAQLVGVDALGLVSMVAQAALAARRHRDACRRLGQHAELVGGLLRELELAE  66

Query  555  LKKYPETREPLELLEDALRRSYILINSCQ-DRSYLYLLAMG  674
            L +   TR PLE L+ ALRR Y L  +CQ D  YL+ L +G
Sbjct  67   LMRREATRRPLEQLQGALRRCYALATACQEDGGYLHRLLLG  107



>ref|XP_008648917.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
23 isoform X1 [Zea mays]
Length=577

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 68/100 (68%), Gaps = 0/100 (0%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            W  LG  +NVAQL G+DA+ L+ M+V+AA  A+ H+  CR+ AQH++++G LL +L++ E
Sbjct  8    WAVLGQASNVAQLVGVDALGLVSMVVQAALAARRHRDACRRLAQHVEVVGGLLRELELAE  67

Query  555  LKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
            L +   TR PL+ L  ALRR Y L+ +CQD  YL  L +G
Sbjct  68   LMRREATRRPLDQLRAALRRCYALVTACQDCGYLRSLLLG  107



>ref|NP_001068421.1| Os11g0666200 [Oryza sativa Japonica Group]
 gb|ABA95156.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28784.1| Os11g0666200 [Oryza sativa Japonica Group]
 gb|EAZ19221.1| hypothetical protein OsJ_34761 [Oryza sativa Japonica Group]
Length=537

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 64/103 (62%), Gaps = 0/103 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA W  LG  A VAQL G D   LI MI++AA TA+ +KK C Q A+ +  I  LL+ L+
Sbjct  1    MALWGGLGQAATVAQLVGADIGGLITMIMQAAMTAQQNKKECEQLARRVFTIAELLQHLQ  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
              E+ + PE R PL  L+D LR ++ L+ SCQD+S +Y L M 
Sbjct  61   DPEVLRRPEIRRPLTGLDDTLREAHELVLSCQDKSAVYRLVMA  103



>gb|EEC81213.1| hypothetical protein OsI_24251 [Oryza sativa Indica Group]
Length=536

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 69/101 (68%), Gaps = 1/101 (1%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            W  LG  +NVAQL G+DA+ L+ M+ +AA  A+ H+  CR+  QH++L+G LL +L++ E
Sbjct  7    WGVLGQASNVAQLVGVDALGLVSMVAQAALAARRHQDACRRLGQHVELVGGLLRELELAE  66

Query  555  LKKYPETREPLELLEDALRRSYILINSCQ-DRSYLYLLAMG  674
            L +   TR PLE L+ ALRR Y L+ +CQ DR YL+ L +G
Sbjct  67   LMRREATRRPLEQLQGALRRCYALVTACQEDRGYLHRLLLG  107



>gb|EAY99718.1| hypothetical protein OsI_21701 [Oryza sativa Indica Group]
Length=532

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA W  LG  A VAQL G D   LI  I++AA+TA+ +K+ C Q A+ + +I +LL  L+
Sbjct  1    MAVWGGLGQAATVAQLVGADVGGLISSIIQAAATARQNKRECDQLARRVVMIADLLPHLQ  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAM  671
              E+ + PE R PL  L D LR ++ L+ SCQ RS  Y   M
Sbjct  61   DPEVMRRPEVRRPLAELGDTLREAHELVASCQGRSAAYRFVM  102



>ref|NP_001056829.1| Os06g0151700 [Oryza sativa Japonica Group]
 dbj|BAD69328.1| cytokinin-regulated kinase-like [Oryza sativa Japonica Group]
 dbj|BAD69064.1| cytokinin-regulated kinase-like [Oryza sativa Japonica Group]
 dbj|BAF18743.1| Os06g0151700 [Oryza sativa Japonica Group]
 gb|EAZ35850.1| hypothetical protein OsJ_20148 [Oryza sativa Japonica Group]
Length=532

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA W  LG  A VAQL G D   LI  I++AA+TA+ +K+ C Q A+ + +I +LL  L+
Sbjct  1    MAVWGGLGQAATVAQLVGADVGGLISSIIQAAATARQNKRECDQLARRVVMIADLLPHLQ  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAM  671
              E+ + PE R PL  L D LR ++ L+ SCQ RS  Y   M
Sbjct  61   DPEVMRRPEVRRPLAELGDTLREAHELVASCQGRSAAYRFVM  102



>ref|XP_004966168.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
23-like [Setaria italica]
Length=566

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 67/100 (67%), Gaps = 0/100 (0%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            W  LG  +NV QL G+DA+ L+ M+V+A+  A+ H+  CR+ AQH++++G LL +L++ E
Sbjct  11   WTVLGQASNVVQLVGVDALGLVSMVVQASLAARRHRDACRRLAQHVEIVGGLLRELELAE  70

Query  555  LKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
            L ++  TR PLE L  ALRR Y L+ +CQD  YL  L  G
Sbjct  71   LMRWEATRRPLEQLSGALRRCYALVTACQDCGYLRSLLAG  110



>gb|ABA98611.1| Protein kinase domain containing protein [Oryza sativa Japonica 
Group]
 gb|EAZ20573.1| hypothetical protein OsJ_36182 [Oryza sativa Japonica Group]
Length=522

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 62/103 (60%), Gaps = 0/103 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA W  LG  A VAQL G D   LI MIV+AA TA+ +KK C Q A+   +I  LL  L+
Sbjct  1    MALWSGLGQAATVAQLVGADVGSLISMIVQAAVTAQHNKKECEQLARRAFMIAELLPHLR  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
              E+   PE R PL  L+D LR ++ L+ SCQ++S ++ L M 
Sbjct  61   DPEVVCLPEIRRPLVGLDDTLREAHELVMSCQEKSVMHRLVMA  103



>ref|XP_010239007.1| PREDICTED: uncharacterized protein LOC100829732 [Brachypodium 
distachyon]
Length=365

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +3

Query  399  NVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPETR  578
            +V Q  G+DA+KL+ MIV+AA T + +KK C+Q A   ++IG+LL++L+ +   + PE R
Sbjct  2    DVVQPAGVDAVKLVLMIVQAAQTVRHNKKTCQQLAHRTQMIGDLLKRLQSSGKMRQPEAR  61

Query  579  EPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
              LE+LED L  +Y+LI SCQ+ +Y+Y + MG
Sbjct  62   SLLEVLEDILCEAYMLIKSCQNSNYMYQILMG  93



>gb|EEE52533.1| hypothetical protein OsJ_34756 [Oryza sativa Japonica Group]
Length=567

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 62/101 (61%), Gaps = 1/101 (1%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            W  LG  A VAQL G D   LI +I++AA TA+ +K+ C Q A+ + +I  LL  L+  E
Sbjct  2    WSGLGQAATVAQLVGADVGSLISVIMQAAMTARQNKE-CEQLARRVFMIAELLPHLQDPE  60

Query  555  LKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            + + PE R PL  L+DALR ++ L+ SCQ R+  Y L M W
Sbjct  61   VMRRPEVRRPLAGLDDALREAHELVASCQGRAAAYRLVMAW  101



>gb|ABA95202.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
Length=580

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 62/101 (61%), Gaps = 1/101 (1%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            W  LG  A VAQL G D   LI +I++AA TA+ +K+ C Q A+ + +I  LL  L+  E
Sbjct  2    WSGLGQAATVAQLVGADVGSLISVIMQAAMTARQNKE-CEQLARRVFMIAELLPHLQDPE  60

Query  555  LKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            + + PE R PL  L+DALR ++ L+ SCQ R+  Y L M W
Sbjct  61   VMRRPEVRRPLAGLDDALREAHELVASCQGRAAAYRLVMAW  101



>gb|EEC72318.1| hypothetical protein OsI_05511 [Oryza sativa Indica Group]
Length=455

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  399  NVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPETR  578
            ++A L G+DA+KL+ MIV+AA   + +KK C+Q   H++++G+LL++L+ +E+ + PE R
Sbjct  2    DLAHLAGLDAVKLVRMIVQAAQKVRHNKKICQQLVHHVQIVGDLLKKLQTSEMMQQPEIR  61

Query  579  EPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
            + L  L++ LR +Y+L+ SC+  SY+Y   MG
Sbjct  62   DGLNELKEILREAYMLVTSCESSSYMYHFFMG  93



>gb|EMS60707.1| Receptor-like serine/threonine-protein kinase SD1-8 [Triticum 
urartu]
Length=610

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 63/107 (59%), Gaps = 0/107 (0%)
 Frame = +3

Query  357  GVKMASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLE  536
            G  MA W  +   A +AQL G+DA+ LI  IV+AA T + +K+ C++  Q ++LI  LL 
Sbjct  69   GADMAQWNGMEQAATIAQLVGVDALGLISTIVQAAQTVQRNKETCQELVQDVQLINGLLR  128

Query  537  QLKITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
             L+  E+ +  E    L  LE  LR +Y L++SCQD S  Y + MGW
Sbjct  129  MLQNPEMMQREEIVNALNGLEGTLREAYSLVSSCQDCSTTYRIFMGW  175



>gb|ADB85257.1| putative retrotransposon protein [Phyllostachys edulis]
Length=2039

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 45/100 (45%), Positives = 66/100 (66%), Gaps = 0/100 (0%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            W  LG  ++V QL G+DA+ L+ M+V+AA  A+ H+  C + AQH++++G LL +L++ E
Sbjct  282  WNTLGQASSVVQLVGVDALGLVSMVVQAALAARRHRDACMRLAQHVEIVGGLLRELELAE  341

Query  555  LKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
            L +   TR PLE L  ALRR Y L+ +CQD  YL+ L  G
Sbjct  342  LMRREATRRPLEQLRGALRRCYALVRACQDCGYLHRLLFG  381



>gb|EAY92077.1| hypothetical protein OsI_13782 [Oryza sativa Indica Group]
Length=509

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 61/103 (59%), Gaps = 0/103 (0%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA W  LG  A VAQL G D   +I  I++AA+ A+ +KK C Q A+ + +I +LL  L+
Sbjct  1    MALWGGLGQAATVAQLVGADVGGVISKIIQAAAMAQQNKKECDQLARRVLMIADLLPHLQ  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
              E+ + PE R PL  L+D LR ++ L+ SCQ RS  Y   M 
Sbjct  61   DPEVMRRPEVRRPLTGLDDTLREAHELVISCQGRSAAYRFVMA  103



>dbj|BAJ88144.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=506

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 66/100 (66%), Gaps = 0/100 (0%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            W  LG  ++VAQL G+DA+ L+ M+V+AA  A+ H+  C + AQH++L+G LL +L++ E
Sbjct  13   WAALGQASSVAQLVGVDALGLVSMVVQAALAARRHRDACVRLAQHVELVGVLLRELELAE  72

Query  555  LKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
            L +   TR PLE L  ALRR Y L  +CQD  YL  L +G
Sbjct  73   LMRREATRRPLEQLGTALRRCYALATACQDCGYLRRLLLG  112



>dbj|BAD45621.1| receptor protein kinase-like [Oryza sativa Japonica Group]
Length=567

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 66/101 (65%), Gaps = 1/101 (1%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            W  LG  +NVAQL G+DA+ L+ M+ +AA  A+ H+  CR+  QH +L+G LL +L++ E
Sbjct  7    WGVLGQASNVAQLVGVDALGLVSMVAQAALAARRHRDACRRLGQHAELVGGLLRELELAE  66

Query  555  LKKYPETREPLELLEDALRRSYILINSCQ-DRSYLYLLAMG  674
            L +   TR PLE L+ ALRR Y L  +CQ D  YL+ L +G
Sbjct  67   LMRREATRRPLEQLQGALRRCYALATACQEDGGYLHRLLLG  107



>gb|EEC82898.1| hypothetical protein OsI_27806 [Oryza sativa Indica Group]
Length=120

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = +3

Query  435  LIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPETREPLELLEDALRR  614
            +I MIV+AA TAK +++ C+  A+ +K+IG+LL +L+ TEL ++ ETR P+E LE+ LR 
Sbjct  7    VIKMIVEAAQTAKRNRETCQLLARRVKMIGDLLNRLQRTELMQHQETRNPVEQLEETLRH  66

Query  615  S--YILINSCQDRSYLYLLAMG  674
            +  Y+LI SCQD SYL+   MG
Sbjct  67   TFVYMLILSCQDSSYLHSCFMG  88



>ref|XP_004977713.1| PREDICTED: probable receptor-like protein kinase At5g59700-like 
[Setaria italica]
Length=621

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = +3

Query  366  MAS-WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQL  542
            MAS W+ LG +  V QLTG+DA  ++ MIV+AA TA+ ++  C+Q A+ ++++  LLE+L
Sbjct  1    MASFWDVLGKVTGVMQLTGVDAFGMVSMIVQAARTARRNRDLCQQLAKKVEIVSGLLEEL  60

Query  543  KITELKKYPETREPLELLEDALRRSYILI  629
            +I EL+++ +TR PL+ L  AL R Y+L+
Sbjct  61   QIPELRRHRKTRRPLDELRTALFRGYVLV  89



>dbj|BAD05279.1| receptor kinase-like [Oryza sativa Japonica Group]
Length=171

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 56/100 (56%), Gaps = 0/100 (0%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            W  LG+ A VAQL G D   LI  I++AA+TA+ +K  C Q A    +I +LL  L+  E
Sbjct  2    WGELGNAATVAQLVGADLGGLISKIIQAAATARRNKAECEQLAVRASMIYDLLPHLQHPE  61

Query  555  LKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
            + + PE   PL LLED LR ++ L+  CQ +   Y   M 
Sbjct  62   VVRRPEVLRPLALLEDTLREAHQLVTCCQHKGPTYRFVMA  101



>gb|EAZ06794.1| hypothetical protein OsI_29039 [Oryza sativa Indica Group]
Length=489

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 58/101 (57%), Gaps = 0/101 (0%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            W  LG+ A VAQL G +   LI  I++AA+TA+ +K+ C   A    +I +LL  L+  E
Sbjct  2    WGELGNAATVAQLVGANLGGLISKIIQAAATARQNKRECEHLAVRASMIYDLLPHLQHPE  61

Query  555  LKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            + + PE   PL LLED L+ ++ L+  CQ +S  Y   M W
Sbjct  62   VMRRPEVLRPLALLEDTLQEAHELVTCCQQKSPTYRFVMAW  102



>dbj|BAD54275.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ37269.1| hypothetical protein OsJ_21607 [Oryza sativa Japonica Group]
Length=138

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            M  W ++  +A VAQ+ G+DA  LI M+ + A   + +K  CRQ A+H++ +G LL  ++
Sbjct  1    MPIWSSVDPVATVAQIAGVDAYGLISMVTERAEKVRRNKYECRQLAEHVETVGGLLHHVE  60

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
                +  P    PLE LE  LR + +L++SC+  SY      G
Sbjct  61   ----RDDPRIAAPLEKLEGTLREAVVLVSSCEASSYFRRFFRG  99



>gb|ABA95208.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 gb|EAZ19224.1| hypothetical protein OsJ_34764 [Oryza sativa Japonica Group]
Length=993

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 40/101 (40%), Positives = 60/101 (59%), Gaps = 0/101 (0%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            WE +  +A +AQLTG+DA+ LI  IV+AA     +K+ C++  Q ++LI +LL  L+  E
Sbjct  435  WEGMDRMATIAQLTGVDALGLISTIVQAAQAVCRNKETCQELVQEIQLIRDLLRMLQDPE  494

Query  555  LKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
            +    E    L  LE  L+ +Y L+ SC+D S +Y   MGW
Sbjct  495  MMCREEIVNVLSGLEGTLKEAYALVTSCRDCSTMYRFFMGW  535


 Score = 71.6 bits (174),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 40/103 (39%), Positives = 62/103 (60%), Gaps = 1/103 (1%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA W  LG    VAQL G D   LI +I+KAA TA+ +K+ C Q A+ + +I  LL  L+
Sbjct  1    MALWGGLGQATTVAQLVGADVGGLISVIMKAALTAQQNKE-CEQLARRVFMIAELLPHLQ  59

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
              E+ + PE + PL  L+D LR ++ L+ S Q+++ ++ L + 
Sbjct  60   DPEVMRRPEIQRPLVGLDDTLREAHELVISFQEKNAMHRLELA  102



>gb|EAZ42543.1| hypothetical protein OsJ_27109 [Oryza sativa Japonica Group]
Length=487

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 56/100 (56%), Gaps = 0/100 (0%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            W  LG+ A VAQL G D   LI  I++AA+TA+ +K  C Q A    +I +LL  L+  E
Sbjct  2    WGELGNAATVAQLVGADLGGLISKIIQAAATARRNKAECEQLAVRASMIYDLLPHLQHPE  61

Query  555  LKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
            + + PE   PL LLED LR ++ L+  CQ +   Y   M 
Sbjct  62   VVRRPEVLRPLALLEDTLREAHQLVTCCQHKGPTYRFVMA  101



>ref|XP_006663655.1| PREDICTED: uncharacterized protein LOC102716637 [Oryza brachyantha]
Length=1660

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  447  IVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPETREPLELLEDALRRSYIL  626
            I++A    + ++K C+Q AQ +++I NLL+ ++ +E+ + PETR+P+  LE+ LRR+YIL
Sbjct  785  IIQAVHKVRRNRKACKQLAQRVQMIANLLQSMQSSEMMQRPETRKPISGLEETLRRAYIL  844

Query  627  INSCQDRSYLYLLAMG  674
            I SCQ+ S +YL  MG
Sbjct  845  ITSCQNSSSMYLFFMG  860



>dbj|BAJ90976.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=600

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 58/108 (54%), Gaps = 6/108 (6%)
 Frame = +3

Query  351  LIGVKMASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNL  530
            L  V MA W  LG  A VAQL G D   LI MIV+AA TA+ +K  C Q A+ + +I  L
Sbjct  39   LHSVAMALWTGLGQAATVAQLVGADVGGLISMIVQAAITARQNKSECEQLARRVLMIAQL  98

Query  531  LEQLKITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
            L  +      + PE  +PL  L D LR ++ L+ SCQ RS  Y   M 
Sbjct  99   LPHV------QEPEAAQPLAGLGDTLRDAHELVVSCQGRSAAYQFVMA  140



>dbj|BAJ97098.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=570

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 58/107 (54%), Gaps = 6/107 (6%)
 Frame = +3

Query  354  IGVKMASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLL  533
            + V MA W  LG  A VAQL G D   LI MIV+AA TA+ ++  C Q A+ + +I  LL
Sbjct  47   LAVAMALWTGLGQAATVAQLVGADVGGLISMIVQAAMTARQNRSECEQLARRVLMIAQLL  106

Query  534  EQLKITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
              +      + PE  +PL  L D LR ++ L+ SCQ RS  Y   M 
Sbjct  107  PHV------QEPEAAQPLAGLGDTLRDAHELVVSCQGRSAAYQFVMA  147



>ref|XP_004986952.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g61500-like [Setaria italica]
Length=473

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 63/103 (61%), Gaps = 3/103 (3%)
 Frame = +3

Query  375  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  554
            W+ L  +++VAQLTG+DA  LI  IV+ A+TA+ ++K CR+ A+ ++ IG+LL  L+   
Sbjct  2    WDGLEKVSSVAQLTGVDAFVLITTIVRVAATARRNRKTCRELAEQVERIGDLLRSLEEQP  61

Query  555  ---LKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
               + + PET  PL  L   LRR+  ++ SC+   Y+  L  G
Sbjct  62   GMGIMRRPETSAPLMELHGTLRRACAVVESCRRGGYVRGLFTG  104



>ref|XP_010236930.1| PREDICTED: cell number regulator 13-like [Brachypodium distachyon]
Length=172

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = +3

Query  396  ANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGN-LLEQLKITELKKYPE  572
            + +AQL G+D + LI MIV+AA T + +K+ C++  Q ++LI N LL  L+  E+ +  E
Sbjct  6    STIAQLVGVDTLGLISMIVQAAQTVRRNKETCQELVQDVQLINNDLLRMLQDPEMMQRAE  65

Query  573  TREPLELLEDALRRSYILINSCQDRSYLYLLAMGW  677
                L  LE  L+ +Y LI+SC+D S  Y + MGW
Sbjct  66   IVNALNGLEGTLQEAYNLISSCRDCSAAYRIFMGW  100



>ref|XP_002449970.1| hypothetical protein SORBIDRAFT_05g026335 [Sorghum bicolor]
 gb|EES08958.1| hypothetical protein SORBIDRAFT_05g026335, partial [Sorghum bicolor]
Length=324

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = +3

Query  420  IDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELKKYPETREPLELLE  599
            + A ++   + +AA T + +KK C+Q   H+++IG+LL++L+  E+ ++PETR  L  LE
Sbjct  19   VHAARIKDKVSQAAQTVRHNKKTCQQLVHHVQIIGDLLKKLQTPEMMEHPETRNGLNNLE  78

Query  600  DALRRSYILINSCQDRSYLYLLAMG  674
            + LR +Y+L+ SCQ+ +Y+Y L  G
Sbjct  79   EILREAYMLVTSCQNNNYVYHLFTG  103



>gb|EEC68569.1| hypothetical protein OsI_36900 [Oryza sativa Indica Group]
Length=373

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 71/108 (66%), Gaps = 7/108 (6%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLL----  533
            MAS E +   AN+AQLTG+DA+ LI MIV+AA  A+ +K+ C + A+ ++ +G+LL    
Sbjct  1    MAS-EAVSMAANIAQLTGVDALGLITMIVEAAKAARRNKRTCLELARLVEQVGDLLRALQ  59

Query  534  EQLKITELKKYPETREPLELLEDALRRSYILINSCQDR-SYLYLLAMG  674
            EQ  +T +++ PET  PL  L++ LRR++ L+ SC+ R SY   L  G
Sbjct  60   EQPGVTVMER-PETSAPLRELQETLRRAHELVESCRRRGSYPRRLFAG  106



>gb|EMS46805.1| Putative serine/threonine-protein kinase-like protein CCR3 [Triticum 
urartu]
Length=727

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 44/103 (43%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = +3

Query  366  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  545
            MA W  LG  A VAQL G D   LI MIV+AA TA+ +K  C Q A+ + +I  LL  + 
Sbjct  1    MALWTGLGQAATVAQLVGADVGGLISMIVQAAMTARQNKSECEQLARRVLMIAQLLPHV-  59

Query  546  ITELKKYPETREPLELLEDALRRSYILINSCQDRSYLYLLAMG  674
                 + PE  +PL  L D LR ++ L+ SCQ RS  Y   M 
Sbjct  60   -----QEPEAAQPLAGLGDTLRDTHELVVSCQGRSAAYQFVMA  97



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1147404787994