BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3387

Length=1578
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004248008.1|  PREDICTED: phosphoglucan, water dikinase, ch...    623   0.0      Solanum lycopersicum
ref|XP_006358812.1|  PREDICTED: phosphoglucan, water dikinase, ch...    602   0.0      Solanum tuberosum [potatoes]
ref|XP_006358813.1|  PREDICTED: phosphoglucan, water dikinase, ch...    602   0.0      Solanum tuberosum [potatoes]
ref|NP_001274870.1|  glucan/water dikinase                              602   0.0      Solanum tuberosum [potatoes]
ref|XP_009777858.1|  PREDICTED: phosphoglucan, water dikinase, ch...    600   0.0      Nicotiana sylvestris
ref|XP_009599199.1|  PREDICTED: phosphoglucan, water dikinase, ch...    597   0.0      Nicotiana tomentosiformis
emb|CDP10310.1|  unnamed protein product                                565   0.0      Coffea canephora [robusta coffee]
emb|CBI39424.3|  unnamed protein product                                560   0.0      Vitis vinifera
ref|XP_011074900.1|  PREDICTED: phosphoglucan, water dikinase, ch...    560   0.0      Sesamum indicum [beniseed]
ref|XP_002265211.1|  PREDICTED: phosphoglucan, water dikinase, ch...    559   0.0      Vitis vinifera
ref|XP_010069404.1|  PREDICTED: phosphoglucan, water dikinase, ch...    557   0.0      Eucalyptus grandis [rose gum]
ref|XP_012078419.1|  PREDICTED: phosphoglucan, water dikinase, ch...    556   0.0      Jatropha curcas
ref|XP_002518612.1|  chloroplast alpha-glucan water dikinase, put...    551   3e-180   Ricinus communis
ref|XP_002301739.2|  hypothetical protein POPTR_0002s23550g             550   3e-180   
gb|KDO57834.1|  hypothetical protein CISIN_1g015140mg                   523   4e-179   Citrus sinensis [apfelsine]
gb|EYU23932.1|  hypothetical protein MIMGU_mgv1a000391mg                547   1e-178   Erythranthe guttata [common monkey flower]
ref|XP_006421075.1|  hypothetical protein CICLE_v10004968mg             520   9e-178   
ref|XP_011042749.1|  PREDICTED: phosphoglucan, water dikinase, ch...    540   5e-176   Populus euphratica
gb|KJB71923.1|  hypothetical protein B456_011G147600                    536   3e-175   Gossypium raimondii
gb|KJB71922.1|  hypothetical protein B456_011G147600                    536   1e-174   Gossypium raimondii
gb|KJB71921.1|  hypothetical protein B456_011G147600                    536   1e-174   Gossypium raimondii
ref|XP_010673296.1|  PREDICTED: phosphoglucan, water dikinase, ch...    536   1e-174   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP32558.1|  hypothetical protein JCGZ_13108                         533   6e-174   Jatropha curcas
ref|XP_008393850.1|  PREDICTED: phosphoglucan, water dikinase, ch...    527   8e-174   
ref|XP_008393849.1|  PREDICTED: phosphoglucan, water dikinase, ch...    527   2e-173   
ref|XP_011000022.1|  PREDICTED: LOW QUALITY PROTEIN: phosphogluca...    533   2e-173   Populus euphratica
gb|KHF99077.1|  Phosphoglucan, water dikinase, chloroplastic -lik...    533   2e-173   Gossypium arboreum [tree cotton]
ref|XP_004296959.2|  PREDICTED: phosphoglucan, water dikinase, ch...    533   4e-173   Fragaria vesca subsp. vesca
ref|XP_002320442.2|  hypothetical protein POPTR_0014s14510g             530   3e-172   
ref|XP_006493516.1|  PREDICTED: phosphoglucan, water dikinase, ch...    530   7e-172   Citrus sinensis [apfelsine]
ref|XP_008222722.1|  PREDICTED: phosphoglucan, water dikinase, ch...    529   1e-171   Prunus mume [ume]
ref|XP_010107197.1|  Phosphoglucan, water dikinase                      519   3e-171   
gb|KJB37918.1|  hypothetical protein B456_006G226300                    518   8e-171   Gossypium raimondii
ref|XP_007034117.1|  Catalytics,carbohydrate kinases,phosphoglucan      524   6e-170   
ref|XP_009371117.1|  PREDICTED: phosphoglucan, water dikinase, ch...    518   1e-169   Pyrus x bretschneideri [bai li]
ref|XP_007225436.1|  hypothetical protein PRUPE_ppa000429mg             523   2e-169   Prunus persica
gb|AFO83531.1|  glucan water dikinase 3                                 518   1e-168   Manihot esculenta [manioc]
ref|XP_010244064.1|  PREDICTED: phosphoglucan, water dikinase, ch...    521   2e-168   Nelumbo nucifera [Indian lotus]
gb|KJB37917.1|  hypothetical protein B456_006G226300                    519   3e-168   Gossypium raimondii
ref|XP_009371116.1|  PREDICTED: phosphoglucan, water dikinase, ch...    520   3e-168   Pyrus x bretschneideri [bai li]
ref|XP_010546804.1|  PREDICTED: phosphoglucan, water dikinase, ch...    512   2e-165   Tarenaya hassleriana [spider flower]
ref|XP_010546803.1|  PREDICTED: phosphoglucan, water dikinase, ch...    512   2e-165   Tarenaya hassleriana [spider flower]
ref|XP_010454991.1|  PREDICTED: phosphoglucan, water dikinase, ch...    502   1e-164   Camelina sativa [gold-of-pleasure]
ref|XP_006394878.1|  hypothetical protein EUTSA_v10003634mg             498   6e-163   
ref|XP_006845104.1|  PREDICTED: phosphoglucan, water dikinase, ch...    506   6e-163   Amborella trichopoda
ref|XP_010907528.1|  PREDICTED: phosphoglucan, water dikinase, ch...    498   1e-162   
ref|XP_010551754.1|  PREDICTED: phosphoglucan, water dikinase, ch...    504   3e-162   Tarenaya hassleriana [spider flower]
ref|NP_001119280.1|  phosphoglucan, water dikinase                      494   6e-162   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454990.1|  PREDICTED: phosphoglucan, water dikinase, ch...    503   8e-162   Camelina sativa [gold-of-pleasure]
ref|XP_010493900.1|  PREDICTED: phosphoglucan, water dikinase, ch...    503   1e-161   Camelina sativa [gold-of-pleasure]
ref|XP_010493901.1|  PREDICTED: phosphoglucan, water dikinase, ch...    503   1e-161   Camelina sativa [gold-of-pleasure]
gb|KHG00248.1|  Phosphoglucan, water dikinase, chloroplastic -lik...    499   1e-161   Gossypium arboreum [tree cotton]
ref|XP_007142602.1|  hypothetical protein PHAVU_007G001400g             496   2e-161   Phaseolus vulgaris [French bean]
ref|XP_002872212.1|  hypothetical protein ARALYDRAFT_489476             500   1e-160   
ref|XP_004497422.1|  PREDICTED: phosphoglucan, water dikinase, ch...    498   7e-160   Cicer arietinum [garbanzo]
ref|XP_009416602.1|  PREDICTED: phosphoglucan, water dikinase, ch...    500   8e-160   
gb|KFK26410.1|  hypothetical protein AALP_AA8G245000                    497   1e-159   Arabis alpina [alpine rockcress]
ref|XP_008799788.1|  PREDICTED: phosphoglucan, water dikinase, ch...    484   2e-159   
ref|XP_004497421.1|  PREDICTED: phosphoglucan, water dikinase, ch...    497   3e-159   
ref|NP_198009.3|  phosphoglucan, water dikinase                         496   6e-159   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010424348.1|  PREDICTED: phosphoglucan, water dikinase, ch...    491   8e-158   Camelina sativa [gold-of-pleasure]
gb|AAU93516.1|  chloroplast alpha-glucan water dikinase isoform 3       489   3e-156   Arabidopsis thaliana [mouse-ear cress]
emb|CDY65142.1|  BnaC02g48400D                                          491   5e-156   Brassica napus [oilseed rape]
ref|XP_006286926.1|  hypothetical protein CARUB_v10000070mg             488   5e-156   Capsella rubella
ref|XP_009111699.1|  PREDICTED: phosphoglucan, water dikinase, ch...    484   9e-155   Brassica rapa
gb|KHN37254.1|  Phosphoglucan, water dikinase, chloroplastic            484   1e-154   Glycine soja [wild soybean]
ref|XP_009129923.1|  PREDICTED: phosphoglucan, water dikinase, ch...    483   2e-154   Brassica rapa
ref|XP_006589801.1|  PREDICTED: LOW QUALITY PROTEIN: phosphogluca...    482   7e-154   
emb|CDY19771.1|  BnaA09g04240D                                          482   9e-154   Brassica napus [oilseed rape]
emb|CDX87051.1|  BnaC09g03660D                                          481   2e-153   
ref|XP_008454006.1|  PREDICTED: phosphoglucan, water dikinase, ch...    481   7e-153   Cucumis melo [Oriental melon]
gb|KEH27294.1|  phosphoglucan, water dikinase                           479   1e-152   Medicago truncatula
ref|XP_011653043.1|  PREDICTED: phosphoglucan, water dikinase, ch...    478   6e-152   Cucumis sativus [cucumbers]
emb|CDY05529.1|  BnaA02g31620D                                          479   1e-151   
ref|XP_008454007.1|  PREDICTED: phosphoglucan, water dikinase, ch...    476   1e-151   Cucumis melo [Oriental melon]
ref|XP_011653044.1|  PREDICTED: phosphoglucan, water dikinase, ch...    473   2e-150   Cucumis sativus [cucumbers]
ref|XP_004952076.1|  PREDICTED: phosphoglucan, water dikinase, ch...    473   2e-150   Setaria italica
gb|ABG21981.1|  chloroplast alpha-glucan water dikinase isoform 3...    459   4e-150   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002453659.1|  hypothetical protein SORBIDRAFT_04g010020          469   1e-148   Sorghum bicolor [broomcorn]
ref|XP_006663965.1|  PREDICTED: phosphoglucan, water dikinase, ch...    465   3e-147   Oryza brachyantha
ref|NP_001066613.1|  Os12g0297500                                       462   5e-146   
ref|XP_010228078.1|  PREDICTED: phosphoglucan, water dikinase, ch...    455   2e-143   Brachypodium distachyon [annual false brome]
gb|EMT02873.1|  Phosphoglucan, water dikinase, chloroplastic            447   4e-142   
gb|AAC26245.1|  contains similarity glycosyl hydrolases                 429   1e-141   Arabidopsis thaliana [mouse-ear cress]
gb|EEE53074.1|  hypothetical protein OsJ_35828                          447   2e-140   Oryza sativa Japonica Group [Japonica rice]
gb|EEC69133.1|  hypothetical protein OsI_38056                          441   4e-138   Oryza sativa Indica Group [Indian rice]
ref|XP_002973212.1|  hypothetical protein SELMODRAFT_99378              425   9e-133   
ref|XP_002976638.1|  hypothetical protein SELMODRAFT_105597             420   7e-131   
ref|XP_001752167.1|  predicted protein                                  412   3e-128   
gb|EPS59827.1|  glucan/water dikinase                                   385   8e-127   Genlisea aurea
ref|XP_001758857.1|  predicted protein                                  360   2e-108   
ref|XP_006421076.1|  hypothetical protein CICLE_v10004968mg             338   8e-108   
gb|EMS54440.1|  Phosphoglucan, water dikinase, chloroplastic            351   2e-105   Triticum urartu
emb|CAX51387.1|  phosphoglucan water dikinase                           304   5e-96    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_005849428.1|  hypothetical protein CHLNCDRAFT_21770              288   3e-82    Chlorella variabilis
ref|XP_008662597.1|  PREDICTED: phosphoglucan, water dikinase, ch...    269   5e-82    
gb|KIZ07735.1|  hypothetical protein MNEG_0234                          274   2e-78    Monoraphidium neglectum
ref|XP_006421074.1|  hypothetical protein CICLE_v10004968mg             259   1e-77    
gb|KEH27295.1|  phosphoglucan, water dikinase                           270   2e-76    Medicago truncatula
ref|XP_011396449.1|  Phosphoglucan, water dikinase, chloroplastic       251   3e-69    Auxenochlorella protothecoides
ref|XP_003080699.1|  phosphoglucan, water dikinase (ISS)                244   4e-68    
ref|XP_005648862.1|  hypothetical protein COCSUDRAFT_47226              247   1e-67    Coccomyxa subellipsoidea C-169
emb|CEG01409.1|  Carbohydrate binding module family 20                  245   3e-67    Ostreococcus tauri
gb|KDD72859.1|  hypothetical protein H632_c2807p0                       225   3e-64    Helicosporidium sp. ATCC 50920
ref|XP_001697099.1|  phosphoglucan water dikinase                       232   6e-63    Chlamydomonas reinhardtii
ref|XP_002949771.1|  hypothetical protein VOLCADRAFT_90138              232   2e-62    Volvox carteri f. nagariensis
ref|XP_001419310.1|  predicted protein                                  209   4e-55    Ostreococcus lucimarinus CCE9901
ref|XP_003059536.1|  predicted protein                                  206   5e-54    Micromonas pusilla CCMP1545
ref|XP_007511444.1|  predicted protein                                  206   2e-53    Bathycoccus prasinos
ref|XP_002504762.1|  alpha phosphoglucan water dikinase                 200   8e-52    Micromonas commoda
ref|XP_001417570.1|  predicted protein                                  200   1e-51    Ostreococcus lucimarinus CCE9901
ref|XP_003078935.1|  chloroplast alpha-glucan water dikinase isof...    199   2e-51    
emb|CEF97682.1|  Pyruvate phosphate dikinase,PEP/pyruvate-binding       199   3e-51    Ostreococcus tauri
gb|KJB71924.1|  hypothetical protein B456_011G147600                    193   1e-49    Gossypium raimondii
gb|KFG31055.1|  pyruvate phosphate dikinase, pep/pyruvate binding...    187   3e-49    Toxoplasma gondii p89
gb|KFG99968.1|  pyruvate phosphate dikinase, pep/pyruvate binding...    186   2e-48    Toxoplasma gondii VAND
gb|KFH05191.1|  pyruvate phosphate dikinase, pep/pyruvate binding...    188   3e-48    Toxoplasma gondii MAS
ref|XP_002368480.1|  phosphoglucan, water dikinase protein, putative    189   9e-48    
gb|KFG42300.1|  pyruvate phosphate dikinase, pep/pyruvate binding...    187   2e-47    Toxoplasma gondii GAB2-2007-GAL-DOM2
gb|EPT28056.1|  pyruvate phosphate dikinase, pep/pyruvate binding...    188   3e-47    Toxoplasma gondii ME49
gb|ESS33912.1|  pyruvate phosphate dikinase, pep/pyruvate binding...    188   3e-47    Toxoplasma gondii VEG
gb|EPR59823.1|  pyruvate phosphate dikinase, pep/pyruvate binding...    188   3e-47    Toxoplasma gondii GT1
ref|XP_008889223.1|  pyruvate phosphate dikinase, pep/pyruvate bi...    188   3e-47    
gb|KFG41384.1|  pyruvate phosphate dikinase, pep/pyruvate binding...    182   7e-47    Toxoplasma gondii FOU
gb|ABR17706.1|  unknown                                                 172   6e-45    Picea sitchensis
ref|XP_005716854.1|  Phosphoglucan water dikinase, PWD                  179   3e-44    Chondrus crispus [carageen]
emb|CDI76079.1|  Carbohydrate-binding module family 20 protein, r...    167   1e-41    Eimeria acervulina
ref|XP_005827807.1|  hypothetical protein GUITHDRAFT_164559             171   1e-41    Guillardia theta CCMP2712
emb|CDJ47310.1|  Carbohydrate-binding module family 20 protein, r...    155   1e-37    Eimeria brunetti
gb|EJY83942.1|  hypothetical protein OXYTRI_18322                       156   9e-37    Oxytricha trifallax
gb|KEH44553.1|  phosphoglucan, water dikinase, putative                 155   2e-36    Medicago truncatula
emb|CDW77583.1|  water chloroplastic-like                               153   8e-36    Stylonychia lemnae
gb|ABK26307.1|  unknown                                                 141   8e-35    Picea sitchensis
ref|XP_011129379.1|  putative phosphoglucan, water dikinase             128   9e-28    Gregarina niphandrodes
ref|XP_002502953.1|  carbohydrate-binding module family 20 protein      119   8e-25    Micromonas commoda
ref|XP_003881249.1|  phosphoenolpyruvate synthase, related              114   3e-23    Neospora caninum Liverpool
emb|CDJ67755.1|  phosphoglucan, water dikinase protein, putative        111   2e-22    Eimeria necatrix
ref|XP_007513823.1|  predicted protein                                95.1    5e-17    Bathycoccus prasinos
ref|XP_010040448.1|  PREDICTED: phosphoglucan, water dikinase, ch...  77.0    7e-13    
ref|XP_009778046.1|  PREDICTED: uncharacterized protein LOC104227496  63.2    3e-07    Nicotiana sylvestris
ref|XP_005849860.1|  hypothetical protein CHLNCDRAFT_57278            63.2    5e-07    Chlorella variabilis
gb|KIY94688.1|  hypothetical protein MNEG_13275                       59.7    1e-06    Monoraphidium neglectum
gb|KKA29558.1|  hypothetical protein TD95_001685                      60.1    4e-06    Thielaviopsis punctulata
ref|XP_002956065.1|  hypothetical protein VOLCADRAFT_97031            59.3    4e-06    Volvox carteri f. nagariensis
ref|WP_033217558.1|  cyclomaltodextrin glucanotransferase             55.8    6e-06    
ref|XP_009587696.1|  PREDICTED: uncharacterized protein LOC104085387  58.5    8e-06    Nicotiana tomentosiformis
gb|KIZ07546.1|  hypothetical protein MNEG_0408                        58.5    9e-06    Monoraphidium neglectum
ref|XP_001696825.1|  hypothetical protein CHLREDRAFT_150073           57.8    1e-05    Chlamydomonas reinhardtii
ref|XP_004302646.1|  PREDICTED: uncharacterized protein LOC101312742  58.2    1e-05    Fragaria vesca subsp. vesca
ref|XP_005642714.1|  starch-binding domain-like protein               56.6    2e-05    Coccomyxa subellipsoidea C-169
gb|ABK25218.1|  unknown                                               57.0    2e-05    Picea sitchensis
ref|XP_006398635.1|  hypothetical protein EUTSA_v10013736mg           57.0    2e-05    
ref|WP_030916433.1|  hypothetical protein                             55.8    2e-05    Streptomyces sp. NRRL S-384
ref|WP_033216324.1|  hypothetical protein                             55.8    2e-05    Kitasatospora phosalacinea
emb|CBI30404.3|  unnamed protein product                              57.0    3e-05    Vitis vinifera
ref|XP_010543884.1|  PREDICTED: uncharacterized protein LOC104816652  56.6    4e-05    Tarenaya hassleriana [spider flower]
ref|XP_006398636.1|  hypothetical protein EUTSA_v10013736mg           55.8    5e-05    
ref|XP_005844056.1|  hypothetical protein CHLNCDRAFT_139625           54.7    6e-05    Chlorella variabilis
ref|XP_006596061.1|  PREDICTED: phosphoglucan, water dikinase, ch...  52.4    6e-05    
ref|XP_001258586.1|  starch binding domain protein                    55.8    6e-05    Aspergillus fischeri NRRL 181
ref|XP_002974170.1|  hypothetical protein SELMODRAFT_414445           55.5    7e-05    Selaginella moellendorffii
ref|XP_005844815.1|  hypothetical protein CHLNCDRAFT_54374            55.8    8e-05    Chlorella variabilis
ref|XP_005644337.1|  hypothetical protein COCSUDRAFT_48869            56.2    8e-05    Coccomyxa subellipsoidea C-169
ref|XP_002968806.1|  hypothetical protein SELMODRAFT_440606           55.5    8e-05    Selaginella moellendorffii
ref|XP_010654173.1|  PREDICTED: uncharacterized protein LOC104880162  55.5    9e-05    Vitis vinifera
gb|KJB46631.1|  hypothetical protein B456_007G379100                  54.7    9e-05    Gossypium raimondii
gb|KIZ03831.1|  hypothetical protein MNEG_4121                        55.1    9e-05    Monoraphidium neglectum
ref|XP_001701978.1|  predicted protein                                52.4    1e-04    Chlamydomonas reinhardtii
gb|KHN47425.1|  Phosphoglucan, water dikinase, chloroplastic          53.5    1e-04    Glycine soja [wild soybean]
emb|CAN60108.1|  hypothetical protein VITISV_044328                   55.1    1e-04    Vitis vinifera
ref|WP_030918859.1|  cyclomaltodextrin glucanotransferase             52.0    1e-04    
ref|XP_007026748.1|  Carbohydrate-binding-like fold, putative iso...  55.1    1e-04    
ref|XP_007026749.1|  Carbohydrate-binding-like fold, putative iso...  54.7    1e-04    
gb|KJB46630.1|  hypothetical protein B456_007G379100                  54.3    1e-04    Gossypium raimondii
ref|XP_001702927.1|  predicted protein                                52.0    2e-04    Chlamydomonas reinhardtii
ref|XP_004506775.1|  PREDICTED: protein ycf2-like isoform X1          54.7    2e-04    Cicer arietinum [garbanzo]
gb|KJB46629.1|  hypothetical protein B456_007G379100                  53.5    2e-04    Gossypium raimondii
ref|XP_002974668.1|  hypothetical protein SELMODRAFT_415024           53.9    2e-04    
gb|EMS59541.1|  Alpha-amylase                                         54.3    2e-04    Triticum urartu
ref|XP_002963384.1|  hypothetical protein SELMODRAFT_438530           54.3    2e-04    
dbj|GAM27795.1|  hypothetical protein SAMD00019534_109710             51.2    2e-04    Acytostelium subglobosum LB1
ref|XP_006576534.1|  PREDICTED: phosphoglucan, water dikinase, ch...  52.4    3e-04    
emb|CDY11209.1|  BnaA03g00450D                                        53.9    3e-04    Brassica napus [oilseed rape]
ref|XP_002502726.1|  carbohydrate-binding module family 20 protein    53.1    3e-04    Micromonas commoda
gb|KHN48367.1|  Alpha-amylase                                         53.9    3e-04    Glycine soja [wild soybean]
ref|XP_006576539.1|  PREDICTED: phosphoglucan, water dikinase, ch...  52.4    3e-04    
ref|WP_030499128.1|  alpha-amylase                                    53.9    3e-04    Micromonospora purpureochromogenes
gb|KIY98013.1|  hypothetical protein MNEG_9950                        52.8    3e-04    Monoraphidium neglectum
ref|XP_005644670.1|  hypothetical protein COCSUDRAFT_67495            53.9    3e-04    Coccomyxa subellipsoidea C-169
gb|KHN36405.1|  Phosphoglucan, water dikinase, chloroplastic          52.0    4e-04    Glycine soja [wild soybean]
emb|CAB42581.1|  putative degreening-enhanced protein                 52.0    4e-04    Auxenochlorella protothecoides
ref|XP_006576535.1|  PREDICTED: phosphoglucan, water dikinase, ch...  52.0    4e-04    
ref|XP_005847512.1|  hypothetical protein CHLNCDRAFT_52636            53.5    4e-04    Chlorella variabilis
ref|XP_003520734.1|  PREDICTED: uncharacterized protein LOC100778097  53.1    4e-04    
ref|XP_003516949.1|  PREDICTED: ribonuclease E/G-like protein, ch...  53.1    4e-04    Glycine max [soybeans]
gb|ACU23169.1|  unknown                                               53.1    4e-04    Glycine max [soybeans]
ref|XP_011399502.1|  Phosphoglucan, water dikinase, chloroplastic     52.4    5e-04    Auxenochlorella protothecoides
ref|XP_005846256.1|  hypothetical protein CHLNCDRAFT_135558           52.8    5e-04    Chlorella variabilis
gb|KHN45754.1|  Phosphoglucan, water dikinase, chloroplastic          53.1    5e-04    Glycine soja [wild soybean]
gb|EHK25059.1|  glycoside hydrolase family 15 protein                 53.1    5e-04    Trichoderma virens Gv29-8
gb|KHN46339.1|  Phosphoglucan, water dikinase, chloroplastic          53.1    5e-04    Glycine soja [wild soybean]
ref|WP_013286849.1|  MULTISPECIES: alpha-amylase                      53.1    5e-04    Micromonospora
ref|XP_009130665.1|  PREDICTED: uncharacterized protein LOC103855...  52.8    6e-04    Brassica rapa
ref|WP_034223083.1|  glycosidase                                      53.1    6e-04    
ref|WP_030461968.1|  hypothetical protein                             51.6    6e-04    
ref|XP_004506776.1|  PREDICTED: protein ycf2-like isoform X2          52.8    6e-04    
ref|WP_026447047.1|  hypothetical protein                             53.1    7e-04    Acidobacteriaceae bacterium URHE0068
gb|KHG02392.1|  Phosphoglucan, water dikinase, chloroplastic -lik...  52.8    7e-04    Gossypium arboreum [tree cotton]
ref|XP_006576537.1|  PREDICTED: phosphoglucan, water dikinase, ch...  52.0    7e-04    
ref|XP_002947049.1|  hypothetical protein VOLCADRAFT_103274           52.8    8e-04    Volvox carteri f. nagariensis
ref|XP_004183886.1|  hypothetical protein EIN_170650                  49.7    8e-04    Entamoeba invadens IP1
ref|XP_008243940.1|  PREDICTED: uncharacterized protein LOC103342132  52.4    9e-04    Prunus mume [ume]
ref|XP_006576541.1|  PREDICTED: ribonuclease E/G-like protein, ch...  52.4    0.001    
ref|XP_006576533.1|  PREDICTED: phosphoglucan, water dikinase, ch...  51.6    0.001    



>ref|XP_004248008.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Solanum 
lycopersicum]
Length=1202

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/405 (73%), Positives = 341/405 (84%), Gaps = 6/405 (1%)
 Frame = +1

Query  367   LILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQV  546
             L L P    G  M+R  +G+    +C VSSVETRE + KGK K S+ E ++L+  LDHQV
Sbjct  46    LTLLPATNLGFFMDRRVKGI----VCGVSSVETRENQNKGKNK-SSSEKVQLRFRLDHQV  100

Query  547   EYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWET  726
             EYGEHIA++GS KELGSWKKN+MMDWTE GW+ E+E++ GE +E+KFVIVGKDKN+LWE 
Sbjct  101   EYGEHIAVLGSAKELGSWKKNIMMDWTENGWIGELEVRSGEILEYKFVIVGKDKNMLWEN  160

Query  727   GDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDS-EGEYEAQVLADNGPVVTKDSTDPDM  903
             G NR+LKLP GGSF++VCQWNVTD+P+ LL LD  E E   +  +DNG  +T  +  PD+
Sbjct  161   GSNRILKLPEGGSFELVCQWNVTDEPVNLLSLDPFEVEKLVEETSDNGATITSQAVVPDV  220

Query  904   QVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVV  1083
               S FVEQWQG+A SFVRSNDQ   +KNRKWDTSGL  I LKLVEGDKN++NWWRKLEVV
Sbjct  221   VTSPFVEQWQGRAASFVRSNDQLDSDKNRKWDTSGLTGISLKLVEGDKNARNWWRKLEVV  280

Query  1084  RDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERI  1263
             R+L+VEN++S+HRLEALTY+A+YLKWINTGQIPC EDGGHHRPNRHAEISRLIF E+E++
Sbjct  281   RELVVENMDSSHRLEALTYAAVYLKWINTGQIPCLEDGGHHRPNRHAEISRLIFREVEKV  340

Query  1264  LGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQN  1443
             L RKD TLQEILVIRK+ PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQN
Sbjct  341   LSRKDTTLQEILVIRKMQPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQN  400

Query  1444  KLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             KLHRNAGPEDLV+TE MLERITK PG+YSEAFVEQFKIFH+ELKD
Sbjct  401   KLHRNAGPEDLVSTEAMLERITKQPGQYSEAFVEQFKIFHNELKD  445



>ref|XP_006358812.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Solanum tuberosum]
Length=1206

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/408 (71%), Positives = 339/408 (83%), Gaps = 8/408 (2%)
 Frame = +1

Query  367   LILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAH---ENLKLKIWLD  537
             L L P    G  M+R  +G+    +C VSSVETRE + KGK K ++    E ++L+  LD
Sbjct  42    LTLLPTRNLGFFMDRRVKGI----VCGVSSVETRENQNKGKNKNNSGSSTEKVQLRFRLD  97

Query  538   HQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLL  717
             HQVEYGEHIA++GS KELGSWKKN+MMDWTE GW+ E+E++ GE +E+KFVIVGKDK +L
Sbjct  98    HQVEYGEHIAVLGSAKELGSWKKNIMMDWTENGWIGELEVRSGETLEYKFVIVGKDKKML  157

Query  718   WETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDS-EGEYEAQVLADNGPVVTKDSTD  894
             WE G NR+LKLP GG F++VCQWNVTD+P+ LLPLD  E E   +  +DNG  +   +  
Sbjct  158   WENGSNRILKLPEGGGFELVCQWNVTDEPVNLLPLDPFEVEKVVEETSDNGAKIISQAAV  217

Query  895   PDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKL  1074
             PD+  S FVEQWQG+A SFVRSNDQ   +KNRKWDTSGL  I LKLVEGDKN++NWWRKL
Sbjct  218   PDVVTSPFVEQWQGRAASFVRSNDQLDSDKNRKWDTSGLTGISLKLVEGDKNARNWWRKL  277

Query  1075  EVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCEL  1254
             EVVR+L+VEN++S+HRLEALTY+A+YLKWINTGQIPC EDGGHHRPNRHAEISRLIF E+
Sbjct  278   EVVRELVVENMDSSHRLEALTYAAVYLKWINTGQIPCLEDGGHHRPNRHAEISRLIFREV  337

Query  1255  ERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHT  1434
             E++L R+D TLQEILVIRK+ PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHT
Sbjct  338   EKVLSRRDTTLQEILVIRKMQPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHT  397

Query  1435  IQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             IQNKLHRNAGPEDLV+TE MLERITK PG+YSEAFVEQFKIFH+ELKD
Sbjct  398   IQNKLHRNAGPEDLVSTEAMLERITKQPGQYSEAFVEQFKIFHNELKD  445



>ref|XP_006358813.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Solanum tuberosum]
Length=1202

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/408 (71%), Positives = 339/408 (83%), Gaps = 8/408 (2%)
 Frame = +1

Query  367   LILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAH---ENLKLKIWLD  537
             L L P    G  M+R  +G+    +C VSSVETRE + KGK K ++    E ++L+  LD
Sbjct  42    LTLLPTRNLGFFMDRRVKGI----VCGVSSVETRENQNKGKNKNNSGSSTEKVQLRFRLD  97

Query  538   HQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLL  717
             HQVEYGEHIA++GS KELGSWKKN+MMDWTE GW+ E+E++ GE +E+KFVIVGKDK +L
Sbjct  98    HQVEYGEHIAVLGSAKELGSWKKNIMMDWTENGWIGELEVRSGETLEYKFVIVGKDKKML  157

Query  718   WETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDS-EGEYEAQVLADNGPVVTKDSTD  894
             WE G NR+LKLP GG F++VCQWNVTD+P+ LLPLD  E E   +  +DNG  +   +  
Sbjct  158   WENGSNRILKLPEGGGFELVCQWNVTDEPVNLLPLDPFEVEKVVEETSDNGAKIISQAAV  217

Query  895   PDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKL  1074
             PD+  S FVEQWQG+A SFVRSNDQ   +KNRKWDTSGL  I LKLVEGDKN++NWWRKL
Sbjct  218   PDVVTSPFVEQWQGRAASFVRSNDQLDSDKNRKWDTSGLTGISLKLVEGDKNARNWWRKL  277

Query  1075  EVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCEL  1254
             EVVR+L+VEN++S+HRLEALTY+A+YLKWINTGQIPC EDGGHHRPNRHAEISRLIF E+
Sbjct  278   EVVRELVVENMDSSHRLEALTYAAVYLKWINTGQIPCLEDGGHHRPNRHAEISRLIFREV  337

Query  1255  ERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHT  1434
             E++L R+D TLQEILVIRK+ PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHT
Sbjct  338   EKVLSRRDTTLQEILVIRKMQPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHT  397

Query  1435  IQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             IQNKLHRNAGPEDLV+TE MLERITK PG+YSEAFVEQFKIFH+ELKD
Sbjct  398   IQNKLHRNAGPEDLVSTEAMLERITKQPGQYSEAFVEQFKIFHNELKD  445



>ref|NP_001274870.1| glucan/water dikinase [Solanum tuberosum]
 gb|ACZ66259.1| glucan/water dikinase [Solanum tuberosum]
Length=1202

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/408 (71%), Positives = 339/408 (83%), Gaps = 8/408 (2%)
 Frame = +1

Query  367   LILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAH---ENLKLKIWLD  537
             L L P    G  M+R  +G+    +C VSSVETRE + KGK K ++    E ++L+  LD
Sbjct  42    LTLLPTRNLGFFMDRRVKGI----VCGVSSVETRENQNKGKNKNNSGSSTEKVQLRFRLD  97

Query  538   HQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLL  717
             HQVEYGEHIA++GS KELGSWKKN+MMDWTE GW+ E+E++ GE +E+KFVIVGKDK +L
Sbjct  98    HQVEYGEHIAVLGSAKELGSWKKNIMMDWTENGWIGELEVRSGETLEYKFVIVGKDKKML  157

Query  718   WETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDS-EGEYEAQVLADNGPVVTKDSTD  894
             WE G NR+LKLP GG F++VCQWNVTD+P+ LLPLD  E E   +  +DNG  +   +  
Sbjct  158   WENGSNRILKLPEGGGFELVCQWNVTDEPVNLLPLDPFEVEKVVEETSDNGAKIISQAAV  217

Query  895   PDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKL  1074
             PD+  S FVEQWQG+A SFVRSNDQ   +KNRKWDTSGL  I LKLVEGDKN++NWWRKL
Sbjct  218   PDVVTSPFVEQWQGRAASFVRSNDQLDSDKNRKWDTSGLTGISLKLVEGDKNARNWWRKL  277

Query  1075  EVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCEL  1254
             EVVR+L+VEN++S+HRLEALTY+A+YLKWINTGQIPC EDGGHHRPNRHAEISRLIF E+
Sbjct  278   EVVRELVVENMDSSHRLEALTYAAVYLKWINTGQIPCLEDGGHHRPNRHAEISRLIFREV  337

Query  1255  ERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHT  1434
             E++L R+D TLQEILVIRK+ PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHT
Sbjct  338   EKVLSRRDTTLQEILVIRKMQPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHT  397

Query  1435  IQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             IQNKLHRNAGPEDLV+TE MLERITK PG+YSEAFVEQFKIFH+ELKD
Sbjct  398   IQNKLHRNAGPEDLVSTEAMLERITKRPGQYSEAFVEQFKIFHNELKD  445



>ref|XP_009777858.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Nicotiana 
sylvestris]
Length=1200

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/447 (67%), Positives = 354/447 (79%), Gaps = 11/447 (2%)
 Frame = +1

Query  259   MDSLRALH-----NAKYAYPYRHIPSARRTSLGKL-KFSEPRLILEPQGIPGSIMNRPTR  420
             MDSL   H     NAK   P+  I S + T L +L + S    IL P+   G +M+   R
Sbjct  1     MDSLHFTHCYSTLNAKKRQPHNQI-SKQFTVLPQLSQTSVKNSILLPRKKLGFLMDYKGR  59

Query  421   GLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  600
             G  +  + AVSSVETRE ++KGK  +++ E ++L++ L HQVE+GEHIA++GS KELGSW
Sbjct  60    G--TGIVRAVSSVETREKQQKGKNNKNS-EKVQLRVRLKHQVEFGEHIAVLGSAKELGSW  116

Query  601   KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVC  780
             KKN+MMDWTE GW+SE+EL  GE +E+KFVIVGKDKN+LWE G NR+L LP GGSF++VC
Sbjct  117   KKNIMMDWTENGWISELELPAGESLEYKFVIVGKDKNMLWENGSNRILMLPEGGSFELVC  176

Query  781   QWNVTDKPLELLPLDSEGEYEAQVLA-DNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVR  957
             QWNVTD+P+ LL LD     E    A DNG  +T ++   D   S FVEQWQG+A SFVR
Sbjct  177   QWNVTDEPVNLLQLDPFVVEEEVEEATDNGATITGETAVLDAVTSPFVEQWQGRAASFVR  236

Query  958   SNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALT  1137
             S D+   + NRKWDTSGL  I LKLVEGDKN++NWWRKLEVVR+L+VEN++S+ RLEALT
Sbjct  237   SKDELDSQTNRKWDTSGLTGISLKLVEGDKNARNWWRKLEVVRELVVENMDSSQRLEALT  296

Query  1138  YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIH  1317
             Y+A+YLKWINTGQIPC EDGGHHRPNRHAEISRLIF E+E++L R+D TLQEILVIRK+ 
Sbjct  297   YAAVYLKWINTGQIPCLEDGGHHRPNRHAEISRLIFREVEKLLSRRDTTLQEILVIRKMQ  356

Query  1318  PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELML  1497
             PCLPSFKAEFT SVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLV+TE ML
Sbjct  357   PCLPSFKAEFTQSVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVSTEAML  416

Query  1498  ERITKNPGEYSEAFVEQFKIFHHELKD  1578
             ERITK PG+YSEAFVEQFKIFH+ELKD
Sbjct  417   ERITKKPGQYSEAFVEQFKIFHNELKD  443



>ref|XP_009599199.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Nicotiana 
tomentosiformis]
Length=1202

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/447 (66%), Positives = 352/447 (79%), Gaps = 9/447 (2%)
 Frame = +1

Query  259   MDSLRALH-----NAKYAYPYRHIPSARRTSLGKLKFSEPR-LILEPQGIPGSIMNRPTR  420
             MDSL   +     NAK   P+ HI S + T L +L  +  +  IL P+     +M+   +
Sbjct  1     MDSLHFSYCYSTLNAKKKQPHNHI-SKKFTVLPQLSHTSVKNSILFPRKKLVFLMDCRIK  59

Query  421   GLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  600
             G  +  + A SSVE RE ++KGK  +++ E ++L++ L HQVE+GEHIA++GS KELGSW
Sbjct  60    GRGTGIVRAASSVEIREKQQKGKNNKNS-EKVQLRVRLKHQVEFGEHIAVLGSAKELGSW  118

Query  601   KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVC  780
             KKN+MMDWTE GW+SE+E   GE +E+KFVIVGKDKN+LWE G NR+LKLP GGSF++ C
Sbjct  119   KKNIMMDWTENGWISELEFPAGESLEYKFVIVGKDKNMLWENGSNRILKLPEGGSFELDC  178

Query  781   QWNVTDKPLELLPLDSEGEYEAQVLA-DNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVR  957
             QWNVTD+P+ LL LD     E    A DNG  +T +    D   S FVEQWQG+A SFVR
Sbjct  179   QWNVTDEPVNLLQLDPFVVEEEVEEASDNGAAITGEVAVLDAVTSPFVEQWQGRAASFVR  238

Query  958   SNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALT  1137
             S D+   EKNRKWDTSGL  I LKLVEGDKN++NWWRKLEVVR+L+VEN++S+ RLEALT
Sbjct  239   SKDELDSEKNRKWDTSGLTGISLKLVEGDKNARNWWRKLEVVRELVVENMDSSQRLEALT  298

Query  1138  YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIH  1317
             Y+A+YLKWINTGQIPC EDGGHHRPNRHAEISRLIF E+E++L R+DATLQEILVIRK+ 
Sbjct  299   YAAVYLKWINTGQIPCLEDGGHHRPNRHAEISRLIFREVEKVLSRRDATLQEILVIRKMQ  358

Query  1318  PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELML  1497
             PCLPSFKAEFT SVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLV+TE ML
Sbjct  359   PCLPSFKAEFTQSVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVSTEAML  418

Query  1498  ERITKNPGEYSEAFVEQFKIFHHELKD  1578
             ERITK PG+YSEAFVEQFKIFH+ELKD
Sbjct  419   ERITKKPGQYSEAFVEQFKIFHNELKD  445



>emb|CDP10310.1| unnamed protein product [Coffea canephora]
Length=1144

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/389 (72%), Positives = 313/389 (80%), Gaps = 5/389 (1%)
 Frame = +1

Query  427   SSRTICAVSSVETREVEKKGKE----KRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELG  594
             SSR +  VSSVET   E+K ++     R   E + +K+ L+HQVE+GEHIA++GS KELG
Sbjct  5     SSRILSGVSSVETSRKEEKKQKKTKQSRQGQEKVLMKVLLNHQVEFGEHIALLGSAKELG  64

Query  595   SWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKM  774
             SWKK +MMDWTE GWV E+ELKGGEPVE KFVIV KDK   WE+GDNRVL LP GGSFK 
Sbjct  65    SWKKELMMDWTEDGWVCELELKGGEPVECKFVIVRKDKRRAWESGDNRVLMLPEGGSFKT  124

Query  775   VCQWNVTDKPLELLPLDSEGEYEAQVLA-DNGPVVTKDSTDPDMQVSAFVEQWQGKAVSF  951
             V +W+ T + +E LPLD E E E  V A  NG  V  D  D ++  S  VEQWQGK VSF
Sbjct  125   VFRWDRTGEAVEFLPLDLEKEEEGGVGATGNGSAVADDVADTEIVASPLVEQWQGKVVSF  184

Query  952   VRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEA  1131
             VRS +Q  +EK RKWD SGL  I LKLVEGDK S+NWWRKLEVVR+++V N+ES HRLEA
Sbjct  185   VRSKEQLNIEKERKWDISGLEGIALKLVEGDKKSRNWWRKLEVVREIVVGNIESGHRLEA  244

Query  1132  LTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRK  1311
             L YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELERI   KD + QEILVIRK
Sbjct  245   LAYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELERISYGKDTSPQEILVIRK  304

Query  1312  IHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATEL  1491
             IH CLPSFKAEFT SVPLTRIRDIAHRNDIPH+LKQEIKHTIQNKLHRNAGPEDLVATE+
Sbjct  305   IHACLPSFKAEFTTSVPLTRIRDIAHRNDIPHELKQEIKHTIQNKLHRNAGPEDLVATEV  364

Query  1492  MLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             MLE++TKNPGEY+EAFVEQFKIFH ELKD
Sbjct  365   MLEKVTKNPGEYNEAFVEQFKIFHRELKD  393



>emb|CBI39424.3| unnamed protein product [Vitis vinifera]
Length=1149

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/447 (63%), Positives = 337/447 (75%), Gaps = 22/447 (5%)
 Frame = +1

Query  259   MDSLRALH---NAKYAYPYR---HIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTR  420
             MDSLR L    +A+Y Y  R     P   R++     F +PR+         S   R   
Sbjct  1     MDSLRVLQCSTSAQYQYHLRKQLEFPLQCRSN-----FLKPRI---------SHSFRNLG  46

Query  421   GLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  600
              L+ R +C VSSV TRE EKK +  R+    +KL I L HQV++GEH+ ++GSTKELGSW
Sbjct  47    FLNRRILCGVSSVLTREEEKKMR-TRTGSGKVKLSILLKHQVKFGEHVVMLGSTKELGSW  105

Query  601   KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVC  780
             KKNV M+WTE GWV ++EL+G E +E+KFVIV +DK++ WE  +NRVLKLP GGSF +VC
Sbjct  106   KKNVPMNWTENGWVCKLELRGDESIEYKFVIVKRDKSMTWEGANNRVLKLPKGGSFGVVC  165

Query  781   QWNVTDKPLELLPLDSE-GEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVR  957
              WN T + ++LLPLDSE  E E   + + G  V   ++  ++Q S FVEQWQG++VSF+R
Sbjct  166   LWNATGEAVDLLPLDSEKDEVEFDHMDEIGSAVVDSASVLEVQTSPFVEQWQGRSVSFMR  225

Query  958   SNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALT  1137
             SN+ R  E  R+WDTSGL  +  KLVEGD+N++NWW+KLEVVR+L+V N+ES  RLEAL 
Sbjct  226   SNEHRNQETERRWDTSGLEGLARKLVEGDRNARNWWQKLEVVRELLVGNLESGDRLEALI  285

Query  1138  YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIH  1317
             +SAIYLKWINTGQIPCFE GGHHRPNRHAEISRLIF ELERI   KD + QE+LVIRKIH
Sbjct  286   FSAIYLKWINTGQIPCFEGGGHHRPNRHAEISRLIFRELERISCMKDTSPQEVLVIRKIH  345

Query  1318  PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELML  1497
             PCLPSFKAEFTASVPLTRIRDIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDLVAT+ ML
Sbjct  346   PCLPSFKAEFTASVPLTRIRDIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLVATDAML  405

Query  1498  ERITKNPGEYSEAFVEQFKIFHHELKD  1578
              RIT+NPGEYSE FVEQFKIFHHELKD
Sbjct  406   ARITRNPGEYSETFVEQFKIFHHELKD  432



>ref|XP_011074900.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Sesamum 
indicum]
Length=1209

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/392 (72%), Positives = 317/392 (81%), Gaps = 14/392 (4%)
 Frame = +1

Query  436   TICAVSSVETREVEKKG------KEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  597
             T+ AVSSVETRE E K       + K S  + +KLK+ LDHQVE+GEH+AI+GS  ELGS
Sbjct  66    TVSAVSSVETREEEMKKDKKKKRQSKTSGADKVKLKVRLDHQVEFGEHVAILGSAIELGS  125

Query  598   WKKNVMMDWTEKGWVSEMELKGGE-PVEFKFVIVGKDKN-LLWETGDNRVLKLPAGGSFK  771
             WK  VMMDWTE GWV ++EL   E PVE+KFVIV KDK  L+WE+GDNR+LK    G+F 
Sbjct  126   WKNKVMMDWTENGWVCDLELNSNEEPVEYKFVIVSKDKGKLVWESGDNRILKFSGNGNFN  185

Query  772   MVCQWNVTDKPLELLPLD---SEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKA  942
             +VC+WN T++ +E+LP D   +EG    Q+   NG VVT  S +  +  SAFVEQWQGK 
Sbjct  186   IVCRWNKTNEQVEVLPWDGKDAEGVEAEQI--KNGNVVTA-SIEEAVTSSAFVEQWQGKD  242

Query  943   VSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHR  1122
             V+FVRS D    EKNR WDTSGL  I LKLVEGD++++NWWRKLEVVR+L+VEN+E+  R
Sbjct  243   VAFVRSKDHFDAEKNRNWDTSGLEGIALKLVEGDRSARNWWRKLEVVRELVVENIENAKR  302

Query  1123  LEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILV  1302
             LEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELERI  RKD +LQEILV
Sbjct  303   LEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELERISSRKDTSLQEILV  362

Query  1303  IRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVA  1482
             IRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVA
Sbjct  363   IRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVA  422

Query  1483  TELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             TE ML RITK PGEYSEAFVEQFKIFH ELKD
Sbjct  423   TEAMLARITKKPGEYSEAFVEQFKIFHRELKD  454



>ref|XP_002265211.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Vitis 
vinifera]
Length=1188

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/447 (63%), Positives = 337/447 (75%), Gaps = 22/447 (5%)
 Frame = +1

Query  259   MDSLRALH---NAKYAYPYR---HIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTR  420
             MDSLR L    +A+Y Y  R     P   R++     F +PR+         S   R   
Sbjct  1     MDSLRVLQCSTSAQYQYHLRKQLEFPLQCRSN-----FLKPRI---------SHSFRNLG  46

Query  421   GLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  600
              L+ R +C VSSV TRE EKK +  R+    +KL I L HQV++GEH+ ++GSTKELGSW
Sbjct  47    FLNRRILCGVSSVLTREEEKKMR-TRTGSGKVKLSILLKHQVKFGEHVVMLGSTKELGSW  105

Query  601   KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVC  780
             KKNV M+WTE GWV ++EL+G E +E+KFVIV +DK++ WE  +NRVLKLP GGSF +VC
Sbjct  106   KKNVPMNWTENGWVCKLELRGDESIEYKFVIVKRDKSMTWEGANNRVLKLPKGGSFGVVC  165

Query  781   QWNVTDKPLELLPLDSE-GEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVR  957
              WN T + ++LLPLDSE  E E   + + G  V   ++  ++Q S FVEQWQG++VSF+R
Sbjct  166   LWNATGEAVDLLPLDSEKDEVEFDHMDEIGSAVVDSASVLEVQTSPFVEQWQGRSVSFMR  225

Query  958   SNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALT  1137
             SN+ R  E  R+WDTSGL  +  KLVEGD+N++NWW+KLEVVR+L+V N+ES  RLEAL 
Sbjct  226   SNEHRNQETERRWDTSGLEGLARKLVEGDRNARNWWQKLEVVRELLVGNLESGDRLEALI  285

Query  1138  YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIH  1317
             +SAIYLKWINTGQIPCFE GGHHRPNRHAEISRLIF ELERI   KD + QE+LVIRKIH
Sbjct  286   FSAIYLKWINTGQIPCFEGGGHHRPNRHAEISRLIFRELERISCMKDTSPQEVLVIRKIH  345

Query  1318  PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELML  1497
             PCLPSFKAEFTASVPLTRIRDIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDLVAT+ ML
Sbjct  346   PCLPSFKAEFTASVPLTRIRDIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLVATDAML  405

Query  1498  ERITKNPGEYSEAFVEQFKIFHHELKD  1578
              RIT+NPGEYSE FVEQFKIFHHELKD
Sbjct  406   ARITRNPGEYSETFVEQFKIFHHELKD  432



>ref|XP_010069404.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW57742.1| hypothetical protein EUGRSUZ_H00494 [Eucalyptus grandis]
Length=1189

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/392 (70%), Positives = 317/392 (81%), Gaps = 4/392 (1%)
 Frame = +1

Query  415   TRGLSSRTICAVSSVETREVEKKGKEKRSAH--ENLKLKIWLDHQVEYGEHIAIMGSTKE  588
              RG  S  +  VSS ETRE EKKGK+ +S    E + L + LDHQVE+GE +AI+GS +E
Sbjct  59    ARGRPSTVVRGVSSTETREGEKKGKKIKSKPGGEKVHLSVRLDHQVEFGESVAILGSARE  118

Query  589   LGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSF  768
             LGSWKK V MDWT+ GWV E+ELKGGE VE+KFVI  KDK++ WE+GDNRVLKLP GG +
Sbjct  119   LGSWKKKVAMDWTKSGWVCELELKGGESVEYKFVIDRKDKSVAWESGDNRVLKLPKGGKY  178

Query  769   KMVCQWNVTDKPLELLPLDSE--GEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKA  942
              MVC WN T + ++L+P+DSE  GE       +NG  V   +   + + S FVEQWQGKA
Sbjct  179   GMVCMWNATKEAVKLMPMDSEETGEELFSNDENNGAAVNDTAALAEAETSPFVEQWQGKA  238

Query  943   VSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHR  1122
             VSF+ SN+ R  E   +WDTSGL  + LKLVEGD+N++NWWRKLEVVR+LIVEN++  +R
Sbjct  239   VSFMSSNEHRNRETEMRWDTSGLEGVALKLVEGDRNARNWWRKLEVVRELIVENLQGENR  298

Query  1123  LEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILV  1302
             LEAL  SAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELERI  RKDA+ +E+LV
Sbjct  299   LEALVNSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELERIACRKDASPKEVLV  358

Query  1303  IRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVA  1482
             +RKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+A
Sbjct  359   VRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIA  418

Query  1483  TELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             TE ML RITKNPG+YSEAFVEQFKIFHHELKD
Sbjct  419   TEAMLARITKNPGQYSEAFVEQFKIFHHELKD  450



>ref|XP_012078419.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Jatropha 
curcas]
Length=1177

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/443 (64%), Positives = 332/443 (75%), Gaps = 17/443 (4%)
 Frame = +1

Query  259   MDSLRALHNAKYAYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRT  438
             MDSLR  H          + S+ RT+  + +      +L P+ I   + NR T    +R 
Sbjct  1     MDSLRVSH---------LLNSSPRTNFYRKQLKFQHSLLNPR-ISFPLRNRSTS--FNRI  48

Query  439   ICAVSSVETREVEKKGK--EKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNV  612
             IC VSS +TRE EKK K  + +S    ++L   LDHQVE+G+H+ I+GSTKELG WKKN+
Sbjct  49    ICGVSSTQTREEEKKMKTNKSKSGSGKVRLNFRLDHQVEFGDHVVILGSTKELGLWKKNL  108

Query  613   MMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNV  792
              M WTE GWV ++ LKGGE +EFKFVI  KDK L+WE GDNR LKLP GG +++VC+WN 
Sbjct  109   PMTWTESGWVCDLVLKGGESIEFKFVIARKDKTLVWEGGDNRTLKLPKGGHYEIVCKWNA  168

Query  793   TDKPLELLPLDSEG-EYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQ  969
             T + ++LL LD EG + E   +++N  V    +T  D++ S FV QWQGKA SF+RSN+ 
Sbjct  169   TAEHIDLLTLDLEGNDMEVGDISENRYV--SGTTPLDVETSPFVGQWQGKAASFMRSNEH  226

Query  970   RGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAI  1149
                E  RKWDTSGL  +   LVEGD+N++NWWRKLE+VR L+VEN++   RLEAL YSAI
Sbjct  227   HNRETERKWDTSGLEGLAFALVEGDRNARNWWRKLELVRQLLVENLQIADRLEALVYSAI  286

Query  1150  YLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLP  1329
             YLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELERI  RKD + +EILVIRKIHPCLP
Sbjct  287   YLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELERISCRKDTSPKEILVIRKIHPCLP  346

Query  1330  SFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERIT  1509
             SFKAEFTASVPLTRIRDIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDLVATE ML RIT
Sbjct  347   SFKAEFTASVPLTRIRDIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLVATEAMLARIT  406

Query  1510  KNPGEYSEAFVEQFKIFHHELKD  1578
             KNPGEYSEAFVEQFKIFH ELKD
Sbjct  407   KNPGEYSEAFVEQFKIFHQELKD  429



>ref|XP_002518612.1| chloroplast alpha-glucan water dikinase, putative [Ricinus communis]
 gb|EEF43754.1| chloroplast alpha-glucan water dikinase, putative [Ricinus communis]
Length=1174

 Score =   551 bits (1419),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 280/444 (63%), Positives = 337/444 (76%), Gaps = 21/444 (5%)
 Frame = +1

Query  259   MDSLRALHNAKYAYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSS-R  435
             MDSLR LH +  +     IPS  R       F  P +            + P R  SS R
Sbjct  1     MDSLRVLHLSNSSPKIIQIPS--RNQFHPFVFFNPGI------------SFPLRQSSSFR  46

Query  436   TI-CAVSSVETR--EVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKK  606
             TI C VSS ETR  E + K  + +S    ++L + LDHQVEYGEH+AI+GSTKELG WKK
Sbjct  47    TIICGVSSTETRGEEKKMKKTKSKSGRGKVRLFVHLDHQVEYGEHVAILGSTKELGLWKK  106

Query  607   NVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQW  786
             NV+M+WTE GWV ++ELKG + + FKFV++  DK+++WE GDNR++KLP GGS+K+VC+W
Sbjct  107   NVLMNWTESGWVCDLELKGDDSIGFKFVVLRTDKSVVWEGGDNRIIKLPKGGSYKIVCRW  166

Query  787   NVTDKPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSND  966
             + T +P++LLP D E E E  V  +NG +    +T  +++ S FV QW+GK +SF+RSN+
Sbjct  167   HATAEPIDLLPWDLE-ENEVDVEGENGSI--SGATLLEVETSPFVGQWKGKDISFMRSNE  223

Query  967   QRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSA  1146
              R  E  RKWDTSGL  + L LVEGD++++NWWRKLEVVR L+V ++++  RL+AL YSA
Sbjct  224   HRDRETERKWDTSGLEGLALALVEGDRDARNWWRKLEVVRQLLVGSLQTADRLDALIYSA  283

Query  1147  IYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCL  1326
             IYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELERI  RKD + +EILVIRKIHPCL
Sbjct  284   IYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELERISCRKDTSPKEILVIRKIHPCL  343

Query  1327  PSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERI  1506
             PSFKAEFTASVPLTRIRDIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDLVATE ML RI
Sbjct  344   PSFKAEFTASVPLTRIRDIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLVATEAMLARI  403

Query  1507  TKNPGEYSEAFVEQFKIFHHELKD  1578
             T+NPGEYS+AFVEQFKIFHHELKD
Sbjct  404   TRNPGEYSDAFVEQFKIFHHELKD  427



>ref|XP_002301739.2| hypothetical protein POPTR_0002s23550g [Populus trichocarpa]
 gb|EEE81012.2| hypothetical protein POPTR_0002s23550g [Populus trichocarpa]
Length=1138

 Score =   550 bits (1416),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 279/447 (62%), Positives = 329/447 (74%), Gaps = 22/447 (5%)
 Frame = +1

Query  259   MDSLRALHNAKYAY--PYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSS  432
             MDSLRAL  + + Y  P R+            +F     +    G      N        
Sbjct  1     MDSLRALLRSDFIYLTPTRN------------QFQSLHKVAPAGGTSTPFFNPRISIPIR  48

Query  433   RT-ICAVSSVETREVEKKGKEKRSAHE--NLKLKIWLDHQVEYGEHIAIMGSTKELGSWK  603
             R  +C VSS ++RE EK  ++ RS  E   ++L + +DHQVE+GE I I+GSTKELGSWK
Sbjct  49    RRIVCGVSSTQSREQEKAMRKSRSRLERGKVRLNVRVDHQVEFGEQIVILGSTKELGSWK  108

Query  604   KNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQ  783
             K V M+WTE GWV ++E+KGG  VEFKFVIV KD++ +WE+GDNR L+LP GGSF +VC+
Sbjct  109   KRVPMNWTENGWVCDLEMKGGGIVEFKFVIVSKDRSFVWESGDNRALRLPRGGSFAVVCK  168

Query  784   WNVTDKPLELLPLDSE--GEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVR  957
             W+ T + + LLPL+ E  GE E +   +NG          +++ S FV QWQGKA+SF+R
Sbjct  169   WDATGEAVNLLPLELEHNGE-EVEDAGENGS--ASAGVLLEVETSPFVGQWQGKAISFMR  225

Query  958   SNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALT  1137
             SN+ R  E  R+WDTSGL    LKLV+GD N++NWWRKLEVVR+L+V +++S  RLE L 
Sbjct  226   SNEHRNREAERRWDTSGLQGFALKLVQGDLNARNWWRKLEVVRELLVGSLQSEDRLEVLV  285

Query  1138  YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIH  1317
             YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELERI  RKD + QE+LVIRKIH
Sbjct  286   YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELERISSRKDTSPQEVLVIRKIH  345

Query  1318  PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELML  1497
             PCLPSFKAEFTASVPLTRIRDIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDLVATE ML
Sbjct  346   PCLPSFKAEFTASVPLTRIRDIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLVATEAML  405

Query  1498  ERITKNPGEYSEAFVEQFKIFHHELKD  1578
              RITKNPGEYSEAFVEQFKIFHHELKD
Sbjct  406   ARITKNPGEYSEAFVEQFKIFHHELKD  432



>gb|KDO57834.1| hypothetical protein CISIN_1g015140mg [Citrus sinensis]
Length=412

 Score =   523 bits (1346),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 253/358 (71%), Positives = 295/358 (82%), Gaps = 9/358 (3%)
 Frame = +1

Query  511   NLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFV  690
             N+++   LDHQVE+GEH+ I+GSTKELGSWKKNV M W+E GW+ ++E KGGE +E+KFV
Sbjct  10    NVRISFRLDHQVEFGEHVVILGSTKELGSWKKNVPMKWSESGWLCDLEFKGGESIEYKFV  69

Query  691   IVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQVLADNGP  870
             IV  DK+  WE GDNR+LKLP GGSF++VC WN T + ++LL L        + + DNG 
Sbjct  70    IVRNDKSKAWEAGDNRILKLPKGGSFEIVCHWNKTGEAVDLLHL-------VEDVLDNGS  122

Query  871   VVTKDSTDPDMQV--SAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGD  1044
             VVT  + D  ++V  S FV QWQGK+ SF+R++D    E  RKWDTSGL  + LKLVEGD
Sbjct  123   VVTDAAPDALLEVGTSPFVGQWQGKSASFMRADDHWNREMERKWDTSGLQGLTLKLVEGD  182

Query  1045  KNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHA  1224
             + ++NWWRKLEVVR+LIVEN++S  RLEAL YSAIYLKWINTG+IPCFEDGGHHRPNRHA
Sbjct  183   QRARNWWRKLEVVRELIVENLQSDERLEALIYSAIYLKWINTGKIPCFEDGGHHRPNRHA  242

Query  1225  EISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIP  1404
             EISRLIF ELE+I  RKDA+ QE+LVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIP
Sbjct  243   EISRLIFRELEQISCRKDASPQEVLVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIP  302

Query  1405  HDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             HDLK EIKHTIQNKLHRNAGPEDLVATE ML +ITKNPGEYSE+FVEQFK+FH ELKD
Sbjct  303   HDLKLEIKHTIQNKLHRNAGPEDLVATEAMLAKITKNPGEYSESFVEQFKMFHSELKD  360



>gb|EYU23932.1| hypothetical protein MIMGU_mgv1a000391mg [Erythranthe guttata]
Length=1190

 Score =   547 bits (1409),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 275/399 (69%), Positives = 314/399 (79%), Gaps = 12/399 (3%)
 Frame = +1

Query  409   RPTRGLSSR-TICAVSSVETREVEKKG------KEKRSAHENLKLKIWLDHQVEYGEHIA  567
             R TR  S R T+ AVSS ETRE E K       + K+S    + LK+ L HQVEYGEH+A
Sbjct  51    RHTRKASVRMTVSAVSSTETREKESKNENNKERQSKKSGGNKVNLKLRLAHQVEYGEHVA  110

Query  568   IMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGE-PVEFKFVIVGKDKN-LLWETGDNRV  741
             I+GS KE GSWK  VMMDWTE GWV  MEL   E PVE+KFVIVG DK  L WE GDNR 
Sbjct  111   ILGSAKEFGSWKNKVMMDWTENGWVCTMELSNKEEPVEYKFVIVGNDKERLTWENGDNRT  170

Query  742   LKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFV  921
             LK P  GSF +VC+W+ T++ +ELLP D E E +A+  + NG  V+  + +  ++ SAFV
Sbjct  171   LKFPENGSFNVVCKWDKTNEQVELLPWDQE-EVQAEK-SGNGAAVSA-ALEEGVKKSAFV  227

Query  922   EQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVE  1101
              QWQGK  SFVRSND+   EKN  WDTSGL  I LKLVEGD++++NWWRKLEVVR+L+ E
Sbjct  228   GQWQGKDASFVRSNDRTNEEKNINWDTSGLEGISLKLVEGDRSARNWWRKLEVVRELVAE  287

Query  1102  NVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDA  1281
             N+E+ +RLEALTYSA+YLKWINTGQIPC EDG HHRPN+HAEISRLIF E+ERI GRKD 
Sbjct  288   NIENGNRLEALTYSAVYLKWINTGQIPCSEDGAHHRPNKHAEISRLIFREIERISGRKDT  347

Query  1282  TLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNA  1461
             +LQEILVIRKIHPCLPSFKAEFTA VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHR A
Sbjct  348   SLQEILVIRKIHPCLPSFKAEFTAPVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRCA  407

Query  1462  GPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             GPEDL++TE ML RITKNPGEY+EAFVEQFKIFH ELKD
Sbjct  408   GPEDLISTEAMLARITKNPGEYNEAFVEQFKIFHRELKD  446



>ref|XP_006421075.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
 gb|ESR34315.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
Length=445

 Score =   520 bits (1340),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 262/387 (68%), Positives = 308/387 (80%), Gaps = 13/387 (3%)
 Frame = +1

Query  430   SRTICAVSS-VETREVEKKGKEKRSAHE-NLKLKIWLDHQVEYGEHIAIMGSTKELGSWK  603
             S  +C VS+     E +KK  + +S H  N+++   LDHQVE+GEH+ I+GSTKELGSWK
Sbjct  59    SGVVCGVSTETSEEEKKKKKMKPKSGHGGNVRISFRLDHQVEFGEHVVILGSTKELGSWK  118

Query  604   KNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQ  783
             KNV M W+E GW+ ++E KGGE +E+KFVIV  DK+  WE G NR+LKLP GGSF++VC 
Sbjct  119   KNVPMKWSECGWLCDLEFKGGESIEYKFVIVRNDKSKAWEAGANRILKLPKGGSFEIVCH  178

Query  784   WNVTDKPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQV--SAFVEQWQGKAVSFVR  957
             WN T + ++LL L+ +         DNG VVT  + D  ++V  S FV QWQGK+ SF+R
Sbjct  179   WNKTGEAVDLLHLEED---------DNGSVVTDAAPDALLEVGTSPFVGQWQGKSASFMR  229

Query  958   SNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALT  1137
             ++D    E  RKWDTSGL  + LKLVEGD+ ++NWWRKLEVVR+LIVEN++S  RLEAL 
Sbjct  230   ADDHWNREMERKWDTSGLQGLTLKLVEGDQRARNWWRKLEVVRELIVENLQSDERLEALI  289

Query  1138  YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIH  1317
             YSAIYLKWINTG+IPCFEDGGHHRPNRHAEISRLIF ELERI  RKDA+ QE+LVIRKIH
Sbjct  290   YSAIYLKWINTGKIPCFEDGGHHRPNRHAEISRLIFRELERISCRKDASPQEVLVIRKIH  349

Query  1318  PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELML  1497
             PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLK EIKHTIQNKLHRNAGPEDLVATE ML
Sbjct  350   PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKLEIKHTIQNKLHRNAGPEDLVATEAML  409

Query  1498  ERITKNPGEYSEAFVEQFKIFHHELKD  1578
              +ITKNPGEYSE+FVEQFK+FH ELKD
Sbjct  410   AKITKNPGEYSESFVEQFKMFHSELKD  436



>ref|XP_011042749.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Populus euphratica]
Length=1178

 Score =   540 bits (1391),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 277/447 (62%), Positives = 327/447 (73%), Gaps = 22/447 (5%)
 Frame = +1

Query  259   MDSLRALHNAKYAY--PYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSS  432
             MDSLRAL  + + Y  P R+            +F     +    G      N        
Sbjct  1     MDSLRALLRSDFMYLTPTRN------------QFQSLHKVAPAGGTSTPFFNPRISIPIR  48

Query  433   RT-ICAVSSVETREVEKKGKEKRSAHE--NLKLKIWLDHQVEYGEHIAIMGSTKELGSWK  603
             R  +C VSS ++RE EK  K+ RS  E   ++L + +DHQVE+GE I I+GS KELGSWK
Sbjct  49    RRIVCGVSSPQSREQEKAMKKSRSRSERGKVRLNVRVDHQVEFGEQIVILGSDKELGSWK  108

Query  604   KNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQ  783
             K V M+WTE GWV ++++KGG  VEFKFVIV KD++ +WE+GDNR L+LP GGSF +VC+
Sbjct  109   KRVPMNWTESGWVCDLKMKGGGIVEFKFVIVRKDRSFVWESGDNRALRLPRGGSFAVVCK  168

Query  784   WNVTDKPLELLPLDSE--GEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVR  957
             W+ T + + LLPLD E  GE E +   +NG          +++ S FV Q QGKA+SF+R
Sbjct  169   WDATGEAVNLLPLDLEHNGE-EVEDAGENGS--ASAGVLLEVETSPFVGQGQGKAISFMR  225

Query  958   SNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALT  1137
             SN+ R  +  R+WDTSGL    LKLV+GD N++NWWRKLEVVR+L+V +++S  RLEAL 
Sbjct  226   SNEHRNRKAERRWDTSGLQGFALKLVQGDLNARNWWRKLEVVRELLVGSLQSEDRLEALV  285

Query  1138  YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIH  1317
              SAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELERI  RKD + QE+LVIRKIH
Sbjct  286   CSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELERISSRKDTSPQEVLVIRKIH  345

Query  1318  PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELML  1497
             PCLPSFKAEFTASVPLTRIRDIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDLVATE ML
Sbjct  346   PCLPSFKAEFTASVPLTRIRDIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLVATEAML  405

Query  1498  ERITKNPGEYSEAFVEQFKIFHHELKD  1578
              RITKNPGEYSEAFVEQFKIFHHELKD
Sbjct  406   ARITKNPGEYSEAFVEQFKIFHHELKD  432



>gb|KJB71923.1| hypothetical protein B456_011G147600 [Gossypium raimondii]
Length=1127

 Score =   536 bits (1382),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 257/361 (71%), Positives = 300/361 (83%), Gaps = 3/361 (1%)
 Frame = +1

Query  499   SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVE  678
             S    + L I LDHQV++GEH+ I+GSTKELGSWKK V M+W+E GW+ ++ELKGGE VE
Sbjct  18    SGSGKVGLNICLDHQVQFGEHVVILGSTKELGSWKKQVPMNWSEDGWICDLELKGGESVE  77

Query  679   FKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQVLA  858
             FKFV+V KDK++ WE G+NRVLKLP GGSF M+C WN T++ LELLPL SE EY+  V  
Sbjct  78    FKFVVVSKDKSVAWEGGNNRVLKLPQGGSFGMICHWNSTEETLELLPLSSE-EYDDSV-D  135

Query  859   DNGPVVTKDSTDP-DMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLV  1035
             D G   +  +TD  +++ S FV QWQG+  SF+RSN+    E  R+WDT+GL  + LKLV
Sbjct  136   DAGHSESTSTTDALEVEASPFVGQWQGRPASFMRSNEHHNRELERRWDTTGLEGLALKLV  195

Query  1036  EGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPN  1215
             EGDK+++NWWRKLEVVR+L+V +++S  RLEAL  SAIYLKWINTGQIPCFEDGGHHRPN
Sbjct  196   EGDKSARNWWRKLEVVRELLVGSLQSEERLEALICSAIYLKWINTGQIPCFEDGGHHRPN  255

Query  1216  RHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRN  1395
             RHAEISRLIF ELERI  RKD++ QE+LVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRN
Sbjct  256   RHAEISRLIFRELERISSRKDSSPQELLVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRN  315

Query  1396  DIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELK  1575
             DIPHDLKQEIKHTIQNKLHRNAGPEDLVATE ML RIT++PG+YSEAFVEQFKIFH ELK
Sbjct  316   DIPHDLKQEIKHTIQNKLHRNAGPEDLVATEAMLARITRDPGQYSEAFVEQFKIFHLELK  375

Query  1576  D  1578
             D
Sbjct  376   D  376



>gb|KJB71922.1| hypothetical protein B456_011G147600 [Gossypium raimondii]
Length=1186

 Score =   536 bits (1382),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 257/361 (71%), Positives = 300/361 (83%), Gaps = 3/361 (1%)
 Frame = +1

Query  499   SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVE  678
             S    + L I LDHQV++GEH+ I+GSTKELGSWKK V M+W+E GW+ ++ELKGGE VE
Sbjct  77    SGSGKVGLNICLDHQVQFGEHVVILGSTKELGSWKKQVPMNWSEDGWICDLELKGGESVE  136

Query  679   FKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQVLA  858
             FKFV+V KDK++ WE G+NRVLKLP GGSF M+C WN T++ LELLPL SE EY+  V  
Sbjct  137   FKFVVVSKDKSVAWEGGNNRVLKLPQGGSFGMICHWNSTEETLELLPLSSE-EYDDSV-D  194

Query  859   DNGPVVTKDSTDP-DMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLV  1035
             D G   +  +TD  +++ S FV QWQG+  SF+RSN+    E  R+WDT+GL  + LKLV
Sbjct  195   DAGHSESTSTTDALEVEASPFVGQWQGRPASFMRSNEHHNRELERRWDTTGLEGLALKLV  254

Query  1036  EGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPN  1215
             EGDK+++NWWRKLEVVR+L+V +++S  RLEAL  SAIYLKWINTGQIPCFEDGGHHRPN
Sbjct  255   EGDKSARNWWRKLEVVRELLVGSLQSEERLEALICSAIYLKWINTGQIPCFEDGGHHRPN  314

Query  1216  RHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRN  1395
             RHAEISRLIF ELERI  RKD++ QE+LVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRN
Sbjct  315   RHAEISRLIFRELERISSRKDSSPQELLVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRN  374

Query  1396  DIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELK  1575
             DIPHDLKQEIKHTIQNKLHRNAGPEDLVATE ML RIT++PG+YSEAFVEQFKIFH ELK
Sbjct  375   DIPHDLKQEIKHTIQNKLHRNAGPEDLVATEAMLARITRDPGQYSEAFVEQFKIFHLELK  434

Query  1576  D  1578
             D
Sbjct  435   D  435



>gb|KJB71921.1| hypothetical protein B456_011G147600 [Gossypium raimondii]
Length=1186

 Score =   536 bits (1382),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 257/361 (71%), Positives = 300/361 (83%), Gaps = 3/361 (1%)
 Frame = +1

Query  499   SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVE  678
             S    + L I LDHQV++GEH+ I+GSTKELGSWKK V M+W+E GW+ ++ELKGGE VE
Sbjct  77    SGSGKVGLNICLDHQVQFGEHVVILGSTKELGSWKKQVPMNWSEDGWICDLELKGGESVE  136

Query  679   FKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQVLA  858
             FKFV+V KDK++ WE G+NRVLKLP GGSF M+C WN T++ LELLPL SE EY+  V  
Sbjct  137   FKFVVVSKDKSVAWEGGNNRVLKLPQGGSFGMICHWNSTEETLELLPLSSE-EYDDSV-D  194

Query  859   DNGPVVTKDSTDP-DMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLV  1035
             D G   +  +TD  +++ S FV QWQG+  SF+RSN+    E  R+WDT+GL  + LKLV
Sbjct  195   DAGHSESTSTTDALEVEASPFVGQWQGRPASFMRSNEHHNRELERRWDTTGLEGLALKLV  254

Query  1036  EGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPN  1215
             EGDK+++NWWRKLEVVR+L+V +++S  RLEAL  SAIYLKWINTGQIPCFEDGGHHRPN
Sbjct  255   EGDKSARNWWRKLEVVRELLVGSLQSEERLEALICSAIYLKWINTGQIPCFEDGGHHRPN  314

Query  1216  RHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRN  1395
             RHAEISRLIF ELERI  RKD++ QE+LVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRN
Sbjct  315   RHAEISRLIFRELERISSRKDSSPQELLVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRN  374

Query  1396  DIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELK  1575
             DIPHDLKQEIKHTIQNKLHRNAGPEDLVATE ML RIT++PG+YSEAFVEQFKIFH ELK
Sbjct  375   DIPHDLKQEIKHTIQNKLHRNAGPEDLVATEAMLARITRDPGQYSEAFVEQFKIFHLELK  434

Query  1576  D  1578
             D
Sbjct  435   D  435



>ref|XP_010673296.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010673297.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=1189

 Score =   536 bits (1382),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 262/403 (65%), Positives = 317/403 (79%), Gaps = 12/403 (3%)
 Frame = +1

Query  388   IPGSIMNRPTRGLSSRTICAVSSVETREVEK--KGKEKRSAHEN--LKLKIWLDHQVEYG  555
             +P S  +R      S+  C +SSV+TRE E+     + RS  EN  ++L I L HQV++G
Sbjct  44    LPSSTTSR------SQIFCGISSVQTREEEEIMNNNKTRSRRENGKVQLSILLKHQVQFG  97

Query  556   EHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDN  735
             E + I GS+KE+GSW+K V M+WT+ GWV ++ELKGG+  EFKFVI+GKDK+L WE+GDN
Sbjct  98    ECVVIFGSSKEMGSWEKPVTMNWTDNGWVLDLELKGGDSGEFKFVIMGKDKSLTWESGDN  157

Query  736   RVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEY-EAQVLADNGPVVTKDS-TDPDMQV  909
             R L++P GG F + C WN+T + LE+LP +SE +   A+VL DN   V+  + TD + Q 
Sbjct  158   RKLQIPGGGKFTLFCHWNMTAEALEILPAESEDDQGSAEVLVDNRSSVSDATVTDSEAQT  217

Query  910   SAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRD  1089
             S FVEQWQGKA SF+RSN+    E +R+WDTSGL  + LKLV+ D+N++NWWRKLEVVR+
Sbjct  218   SPFVEQWQGKAASFMRSNEHHNRESDRRWDTSGLEGLALKLVQDDQNARNWWRKLEVVRE  277

Query  1090  LIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILG  1269
             L+V ++++   LEALT SAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELERI  
Sbjct  278   LVVGSLDNNDHLEALTLSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELERIYC  337

Query  1270  RKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKL  1449
             R+D + QE LVIRKIHP LPSFKAEFTASVPLTRIRDIAHRNDIPHD KQEIKHTIQNKL
Sbjct  338   RRDTSPQERLVIRKIHPSLPSFKAEFTASVPLTRIRDIAHRNDIPHDFKQEIKHTIQNKL  397

Query  1450  HRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             HRNAGPEDLVATE ML RITKNPGE+++AFVEQFKIFH ELKD
Sbjct  398   HRNAGPEDLVATEAMLARITKNPGEFNDAFVEQFKIFHEELKD  440



>gb|KDP32558.1| hypothetical protein JCGZ_13108 [Jatropha curcas]
Length=1114

 Score =   533 bits (1372),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 256/367 (70%), Positives = 295/367 (80%), Gaps = 3/367 (1%)
 Frame = +1

Query  481   KGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELK  660
             K  + +S    ++L   LDHQVE+G+H+ I+GSTKELG WKKN+ M WTE GWV ++ LK
Sbjct  2     KTNKSKSGSGKVRLNFRLDHQVEFGDHVVILGSTKELGLWKKNLPMTWTESGWVCDLVLK  61

Query  661   GGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEG-E  837
             GGE +EFKFVI  KDK L+WE GDNR LKLP GG +++VC+WN T + ++LL LD EG +
Sbjct  62    GGESIEFKFVIARKDKTLVWEGGDNRTLKLPKGGHYEIVCKWNATAEHIDLLTLDLEGND  121

Query  838   YEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAE  1017
              E   +++N  V    +T  D++ S FV QWQGKA SF+RSN+    E  RKWDTSGL  
Sbjct  122   MEVGDISENRYV--SGTTPLDVETSPFVGQWQGKAASFMRSNEHHNRETERKWDTSGLEG  179

Query  1018  IPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDG  1197
             +   LVEGD+N++NWWRKLE+VR L+VEN++   RLEAL YSAIYLKWINTGQIPCFEDG
Sbjct  180   LAFALVEGDRNARNWWRKLELVRQLLVENLQIADRLEALVYSAIYLKWINTGQIPCFEDG  239

Query  1198  GHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIR  1377
             GHHRPNRHAEISRLIF ELERI  RKD + +EILVIRKIHPCLPSFKAEFTASVPLTRIR
Sbjct  240   GHHRPNRHAEISRLIFRELERISCRKDTSPKEILVIRKIHPCLPSFKAEFTASVPLTRIR  299

Query  1378  DIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKI  1557
             DIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDLVATE ML RITKNPGEYSEAFVEQFKI
Sbjct  300   DIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLVATEAMLARITKNPGEYSEAFVEQFKI  359

Query  1558  FHHELKD  1578
             FH ELKD
Sbjct  360   FHQELKD  366



>ref|XP_008393850.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Malus domestica]
Length=937

 Score =   527 bits (1358),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 277/447 (62%), Positives = 325/447 (73%), Gaps = 22/447 (5%)
 Frame = +1

Query  259   MDSLRALHNAKYAYPYRHIPSARRTSLGKLKFSEPR--LILEPQGIPGSIMNRPTRGL--  426
             MD + ALH +  A P  H    RR    +L+   PR   +     +P     R  R L  
Sbjct  1     MDCVHALHTSSSA-PQLH----RRK---QLRCLHPRHQCLGSLAVVPFFAHKRGFRPLYH  52

Query  427   ---SSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  597
                + + IC VSS ++ + E+K    +S    ++L I LDHQVE+GE +AI+GS KELGS
Sbjct  53    KSNTCQIICGVSSAQSID-EEKDSMMKSESGKVRLNIRLDHQVEFGESVAILGSVKELGS  111

Query  598   WKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  777
             WKK V M+WTE GWV  +E KGGE VE+KF+ V  DK++LWE G NRVLKLP GGSF+MV
Sbjct  112   WKKKVPMNWTESGWVCTLEFKGGESVEYKFLTVRADKSMLWEGGHNRVLKLPNGGSFEMV  171

Query  778   CQWNVTDKPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVR  957
             C WN T + + L P   EGE   Q    NG  V       +++ S FV QW+G A+SF+R
Sbjct  172   CHWNATTEAVGL-PSSEEGEDVGQ----NGSTVADTVGAEEVESSPFVGQWKGNAISFMR  226

Query  958   SNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALT  1137
             SN+  G  K  KWDTSGL  + LKLVEGD+N++NWW+KLEVVRDL+V +++S  RL+AL 
Sbjct  227   SNEH-GNRKGGKWDTSGLEGLALKLVEGDRNARNWWKKLEVVRDLLVGSLQSEDRLDALI  285

Query  1138  YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIH  1317
              SAIYLKWINTGQIPCFEDGGHHRPNRHAEISR+IF ELERI  RKD + QE+LVIRKIH
Sbjct  286   NSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRVIFRELERISCRKDTSPQEVLVIRKIH  345

Query  1318  PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELML  1497
             PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE ML
Sbjct  346   PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATEAML  405

Query  1498  ERITKNPGEYSEAFVEQFKIFHHELKD  1578
              RITKNPGEY+ AFVEQFKIFHHELKD
Sbjct  406   ARITKNPGEYNGAFVEQFKIFHHELKD  432



>ref|XP_008393849.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Malus domestica]
Length=965

 Score =   527 bits (1358),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 277/447 (62%), Positives = 325/447 (73%), Gaps = 22/447 (5%)
 Frame = +1

Query  259   MDSLRALHNAKYAYPYRHIPSARRTSLGKLKFSEPR--LILEPQGIPGSIMNRPTRGL--  426
             MD + ALH +  A P  H    RR    +L+   PR   +     +P     R  R L  
Sbjct  1     MDCVHALHTSSSA-PQLH----RRK---QLRCLHPRHQCLGSLAVVPFFAHKRGFRPLYH  52

Query  427   ---SSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  597
                + + IC VSS ++ + E+K    +S    ++L I LDHQVE+GE +AI+GS KELGS
Sbjct  53    KSNTCQIICGVSSAQSID-EEKDSMMKSESGKVRLNIRLDHQVEFGESVAILGSVKELGS  111

Query  598   WKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  777
             WKK V M+WTE GWV  +E KGGE VE+KF+ V  DK++LWE G NRVLKLP GGSF+MV
Sbjct  112   WKKKVPMNWTESGWVCTLEFKGGESVEYKFLTVRADKSMLWEGGHNRVLKLPNGGSFEMV  171

Query  778   CQWNVTDKPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVR  957
             C WN T + + L P   EGE   Q    NG  V       +++ S FV QW+G A+SF+R
Sbjct  172   CHWNATTEAVGL-PSSEEGEDVGQ----NGSTVADTVGAEEVESSPFVGQWKGNAISFMR  226

Query  958   SNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALT  1137
             SN+  G  K  KWDTSGL  + LKLVEGD+N++NWW+KLEVVRDL+V +++S  RL+AL 
Sbjct  227   SNEH-GNRKGGKWDTSGLEGLALKLVEGDRNARNWWKKLEVVRDLLVGSLQSEDRLDALI  285

Query  1138  YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIH  1317
              SAIYLKWINTGQIPCFEDGGHHRPNRHAEISR+IF ELERI  RKD + QE+LVIRKIH
Sbjct  286   NSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRVIFRELERISCRKDTSPQEVLVIRKIH  345

Query  1318  PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELML  1497
             PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE ML
Sbjct  346   PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATEAML  405

Query  1498  ERITKNPGEYSEAFVEQFKIFHHELKD  1578
              RITKNPGEY+ AFVEQFKIFHHELKD
Sbjct  406   ARITKNPGEYNGAFVEQFKIFHHELKD  432



>ref|XP_011000022.1| PREDICTED: LOW QUALITY PROTEIN: phosphoglucan, water dikinase, 
chloroplastic-like [Populus euphratica]
Length=1172

 Score =   533 bits (1373),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 280/455 (62%), Positives = 322/455 (71%), Gaps = 44/455 (10%)
 Frame = +1

Query  259   MDSLRALH--------NAKYAYPYRHIPSARR-TSLGKLKFSEPRLILEPQGIPGSIMNR  411
             MDSLR LH          ++ + + H   AR         F  PR+ +            
Sbjct  1     MDSLRLLHFVIPTPTRRNQFHHSHSHHKLARPPGQCATTTFFNPRISI------------  48

Query  412   PTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKEL  591
             P RG   R +CAVSS +TRE E+       A    KL + +DHQVE+GEHI I+GS+KE+
Sbjct  49    PIRG---RIVCAVSSTQTREEER-------ATMKSKLNVRIDHQVEFGEHIVIVGSSKEM  98

Query  592   GSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFK  771
             GSWKK V M WTE GWV E+ELKGGE VEFKF IV KD  L+WE G NR LKLP  GSF 
Sbjct  99    GSWKKKVPMKWTENGWVCELELKGGEAVEFKFAIVSKDNGLVWENGHNRALKLPREGSFA  158

Query  772   MVCQWNVTDKPLELLPLDSE--GEYEAQVLADNGPVVTKDSTDPDMQVSA----FVEQWQ  933
             +VC+W  T + +  LPL+ E  GE EA+ + +N      DS   D+ + A    FV QWQ
Sbjct  159   IVCRWGATGEAVNFLPLEFEQNGE-EAKDVGEN------DSAGADITLEAGTSPFVGQWQ  211

Query  934   GKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVES  1113
             GKAVSF+RSND       R+WDTSGL    LKLVEGD N++NW RKLEVV +L+V +++S
Sbjct  212   GKAVSFMRSNDHGNRGSERRWDTSGLQGSVLKLVEGDLNARNWRRKLEVVCELLVGSLQS  271

Query  1114  THRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQE  1293
               RLEAL YSAIYLKWINTGQ+PCFEDGGHHRPNRHAEISRLIF ELE++  R+D + QE
Sbjct  272   KDRLEALIYSAIYLKWINTGQVPCFEDGGHHRPNRHAEISRLIFQELEQVSSRRDTSAQE  331

Query  1294  ILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPED  1473
             +LVIRKIHPCLPSFKAEFTASVPLTRIRDIAHR DIPHDLKQEI HTIQNKLHRNAGPED
Sbjct  332   VLVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRGDIPHDLKQEIXHTIQNKLHRNAGPED  391

Query  1474  LVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             LVATE ML RITKNPGEYSEAFVEQFKIFHHELKD
Sbjct  392   LVATEAMLARITKNPGEYSEAFVEQFKIFHHELKD  426



>gb|KHF99077.1| Phosphoglucan, water dikinase, chloroplastic -like protein [Gossypium 
arboreum]
Length=1169

 Score =   533 bits (1373),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 283/447 (63%), Positives = 334/447 (75%), Gaps = 25/447 (6%)
 Frame = +1

Query  265   SLRALHNAKYAYPYR----HIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSS  432
             SLR+LH   +  P R     +P A   S        PR+       PG  +NR  R  S 
Sbjct  5     SLRSLH---FQIPARKQLKFLPDATIFS--------PRISFPFPFPPG--INR-HRKHSH  50

Query  433   RTICAVSSVETREVEKKGKEKR----SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  600
               + AVSS  TRE EKK K  +    S    + L + LDHQV++GEH+ I+GSTKELGSW
Sbjct  51    SLVFAVSSTPTREEEKKKKMTKVKPMSGSGKVGLNVCLDHQVQFGEHVVILGSTKELGSW  110

Query  601   KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVC  780
             KK V M+W+E GW+ ++ELKGGE VEFKFV+V KDK++ WE G+NRVLKLP GG+F M+C
Sbjct  111   KKQVPMNWSEDGWICDLELKGGESVEFKFVVVSKDKSVAWEGGNNRVLKLPQGGNFGMIC  170

Query  781   QWNVTDKPLELLPLDSEGEYEAQVLADNGPVVTKDSTDP-DMQVSAFVEQWQGKAVSFVR  957
              WN T++ LELLPL SE EY+  V  D G   +  +TD  +++ S FV QWQG+  SF+R
Sbjct  171   HWNSTEETLELLPLSSE-EYDDSV-DDAGHSESTSTTDALEVEASPFVGQWQGRPASFMR  228

Query  958   SNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALT  1137
             SN+    E  R+WDT+GL  + LKLVEGDK+++NWWRKLEVVR+L+V +++   RLEAL 
Sbjct  229   SNEHHNRELERRWDTTGLEGLALKLVEGDKSARNWWRKLEVVRELLVGSLQREERLEALI  288

Query  1138  YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIH  1317
              SAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELERI  RKD++ QE+LVIRKIH
Sbjct  289   CSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELERISCRKDSSPQELLVIRKIH  348

Query  1318  PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELML  1497
             PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE ML
Sbjct  349   PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATEAML  408

Query  1498  ERITKNPGEYSEAFVEQFKIFHHELKD  1578
              RIT+ PG+YSEAFVEQFKIFH ELKD
Sbjct  409   ARITREPGQYSEAFVEQFKIFHRELKD  435



>ref|XP_004296959.2| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=1191

 Score =   533 bits (1372),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 255/389 (66%), Positives = 303/389 (78%), Gaps = 10/389 (3%)
 Frame = +1

Query  427   SSRTICAVS-----SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKEL  591
             S R +C V      S+E  +  K   + +  H  + L I LDHQVE+GE IA++GS+KEL
Sbjct  57    SLRILCGVGVSPPQSIEEEKETKMKSKSKDRHGKVWLNIRLDHQVEFGESIAVLGSSKEL  116

Query  592   GSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFK  771
             GSWKK V ++WTE GWV ++E KG E +E+KFV V  DK++LWE GDNRVLKLP+ GSF 
Sbjct  117   GSWKKKVPLNWTESGWVCQLEFKGDEVIEYKFVTVRADKSMLWEGGDNRVLKLPSRGSFG  176

Query  772   MVCQWNVTDKPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSF  951
             MVC WN   + ++L PLD E   E +     G  V + ++ P++  S FV QW+G A+SF
Sbjct  177   MVCHWNAIGENVDLFPLDKEDGVELK-----GSSVAETASTPEVGTSPFVGQWKGNAISF  231

Query  952   VRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEA  1131
             +RSN+ R  E  R WDTSGL  + LKLVEGD+N++NWWRKLEVVRD+++E+ +S  RL A
Sbjct  232   MRSNEHRDRESGRNWDTSGLEGLSLKLVEGDRNARNWWRKLEVVRDILLESSQSEERLSA  291

Query  1132  LTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRK  1311
             L  S+IYLKWINTGQIPCFEDGGHHRPNRHAEISR+IF ELERI  +KD + QE+LVIRK
Sbjct  292   LINSSIYLKWINTGQIPCFEDGGHHRPNRHAEISRVIFRELERISCKKDTSPQEVLVIRK  351

Query  1312  IHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATEL  1491
             IHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE 
Sbjct  352   IHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEA  411

Query  1492  MLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             ML RITKNPG+YSEAFVEQFKIFHHELKD
Sbjct  412   MLARITKNPGQYSEAFVEQFKIFHHELKD  440



>ref|XP_002320442.2| hypothetical protein POPTR_0014s14510g [Populus trichocarpa]
 gb|EEE98757.2| hypothetical protein POPTR_0014s14510g [Populus trichocarpa]
Length=1159

 Score =   530 bits (1364),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 275/451 (61%), Positives = 322/451 (71%), Gaps = 36/451 (8%)
 Frame = +1

Query  259   MDSLRALH--------NAKYAYPYRHIPSARRTSL-GKLKFSEPRLILEPQGIPGSIMNR  411
             MDSLR LH          ++ + + H   AR   L     F  PR+ +            
Sbjct  1     MDSLRLLHFVTPTPTRRNQFHHSHSHHKLARPPGLRATTTFFNPRISI------------  48

Query  412   PTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKEL  591
             P RG   R +CAVSS +TRE E+  K+         L + +DHQVE+GE+I I+GS+KE+
Sbjct  49    PIRG---RIVCAVSSTQTREEERATKKS-------MLNVRIDHQVEFGENIVIVGSSKEM  98

Query  592   GSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFK  771
             GSWKK V M WTE GWV ++ELKGGE VEFKF I  KD +L+WE+GDNR LKLP  GSF 
Sbjct  99    GSWKKKVPMKWTENGWVCKLELKGGEVVEFKFAIASKDNSLVWESGDNRALKLPREGSFA  158

Query  772   MVCQWNVTDKPLELLPLDSE--GEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAV  945
             +VC+W  T + +   PL+ E  GE EA+ + +NG      + +     S FV QWQGKA 
Sbjct  159   IVCRWGATGEAINFSPLELEQNGE-EAEDVGENGSAGADITLEAG--TSPFVGQWQGKAA  215

Query  946   SFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRL  1125
             SF+RSND       R+WDTSGL    LKLVEGD N++NW RKLEVV +L+V +++S  RL
Sbjct  216   SFMRSNDHGNRGSERRWDTSGLQGSVLKLVEGDLNARNWRRKLEVVCELLVGSLQSKDRL  275

Query  1126  EALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVI  1305
             EAL YSAIYLKWINTGQ+PCFEDGGHHRPNRHAEISRLIF ELE++  R+D + QE+LVI
Sbjct  276   EALIYSAIYLKWINTGQVPCFEDGGHHRPNRHAEISRLIFQELEQVSSRRDTSAQEVLVI  335

Query  1306  RKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVAT  1485
             RKIHPCLPSFKAEFTASVPLTRIRDIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDLVAT
Sbjct  336   RKIHPCLPSFKAEFTASVPLTRIRDIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLVAT  395

Query  1486  ELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             E ML RITKNPGEYSEAFVEQFKIFHHELKD
Sbjct  396   EAMLARITKNPGEYSEAFVEQFKIFHHELKD  426



>ref|XP_006493516.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Citrus sinensis]
Length=1190

 Score =   530 bits (1364),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 253/358 (71%), Positives = 295/358 (82%), Gaps = 9/358 (3%)
 Frame = +1

Query  511   NLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFV  690
             N+++   LDHQVE+GEH+ I+GSTKELGSWKKNV M W+E GW+ ++E KGGE +E+KFV
Sbjct  88    NVRISFRLDHQVEFGEHVVILGSTKELGSWKKNVPMKWSESGWLCDLEFKGGESIEYKFV  147

Query  691   IVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQVLADNGP  870
             IV  DK+  WE GDNR+LKLP GGSF++VC WN T + ++LL L        + + DNG 
Sbjct  148   IVRNDKSKAWEAGDNRILKLPKGGSFEIVCHWNKTGEAVDLLHL-------VEDVLDNGS  200

Query  871   VVTKDSTDPDMQV--SAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGD  1044
             VVT  + D  ++V  S FV QWQGK+ SF+R++D    E  RKWDTSGL  + LKLVEGD
Sbjct  201   VVTDAAPDALLEVGTSPFVGQWQGKSASFMRADDHWNREMERKWDTSGLQGLTLKLVEGD  260

Query  1045  KNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHA  1224
             + ++NWWRKLEVVR+LIVEN++S  RLEAL YSAIYLKWINTG+IPCFEDGGHHRPNRHA
Sbjct  261   QRARNWWRKLEVVRELIVENLQSDERLEALIYSAIYLKWINTGKIPCFEDGGHHRPNRHA  320

Query  1225  EISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIP  1404
             EISRLIF ELE+I  RKDA+ QE+LVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIP
Sbjct  321   EISRLIFRELEQISCRKDASPQEVLVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIP  380

Query  1405  HDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             HDLK EIKHTIQNKLHRNAGPEDLVATE ML +ITKNPGEYSE+FVEQFK+FH ELKD
Sbjct  381   HDLKLEIKHTIQNKLHRNAGPEDLVATEAMLAKITKNPGEYSESFVEQFKMFHSELKD  438



>ref|XP_008222722.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Prunus 
mume]
Length=1190

 Score =   529 bits (1362),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 257/385 (67%), Positives = 305/385 (79%), Gaps = 6/385 (2%)
 Frame = +1

Query  424   LSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK  603
             L S  + +  S+E  +  K   + +S +E ++L + LDHQVE+GE + I+GS KELGSWK
Sbjct  59    LCSAGVSSAQSIEEEKESKMKSKSKSGNEKVRLNVRLDHQVEFGESVVILGSIKELGSWK  118

Query  604   KNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQ  783
             K V M+WTE GWV  +E KGGE VE+KF+ V  DK++LWE GDNRVLKLP GG+F +V  
Sbjct  119   KRVPMNWTESGWVCSLEFKGGESVEYKFLTVRADKSVLWEGGDNRVLKLPKGGNFGIVSH  178

Query  784   WNVTDKPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSN  963
             WN T + ++LLPL+ E +     + +NG +V   ST P++  S FV QW+G A+SF+RSN
Sbjct  179   WNATGEAVDLLPLEKEED-----VGNNGSIVDTVST-PEVGTSPFVGQWKGNAISFMRSN  232

Query  964   DQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYS  1143
             +    E  R WDTSGL  + LKLVEGD+N++NWWRKLEVVRDL+V + +S  RL+AL  S
Sbjct  233   EHGNREAGRIWDTSGLEGLALKLVEGDRNARNWWRKLEVVRDLLVGSSQSEDRLDALINS  292

Query  1144  AIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPC  1323
             AIYLKWINTGQIPCFEDGGHHRPNRHAEISR+IF ELERI  RKD + QE+LV+RKIHPC
Sbjct  293   AIYLKWINTGQIPCFEDGGHHRPNRHAEISRVIFRELERISCRKDTSTQEVLVVRKIHPC  352

Query  1324  LPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLER  1503
             LPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE ML R
Sbjct  353   LPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATEAMLAR  412

Query  1504  ITKNPGEYSEAFVEQFKIFHHELKD  1578
             ITKNPGEY+EAFVEQFKIFHHELKD
Sbjct  413   ITKNPGEYNEAFVEQFKIFHHELKD  437



>ref|XP_010107197.1| Phosphoglucan, water dikinase [Morus notabilis]
 gb|EXC14221.1| Phosphoglucan, water dikinase [Morus notabilis]
Length=894

 Score =   519 bits (1337),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 246/362 (68%), Positives = 292/362 (81%), Gaps = 7/362 (2%)
 Frame = +1

Query  499   SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVE  678
             S  + ++L I LDHQV++GEH+ I+GSTKELGSWKK V ++WTE+GWV ++ELKGG  +E
Sbjct  5     SGRDKVQLSIRLDHQVKFGEHVVILGSTKELGSWKKKVHLNWTERGWVCQLELKGGNSIE  64

Query  679   FKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQVLA  858
             +KFVI+GKD++LLWE+G+NRVL LP  G + +VC WN T + ++LL L+ E +     + 
Sbjct  65    YKFVILGKDESLLWESGENRVLGLPERGIYGIVCHWNKTGEAVDLLALEEEDD-----VG  119

Query  859   DNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWD--TSGLAEIPLKL  1032
             +NG +    +    ++ S FV QWQGKA SF+RSN+ R  E  R WD  TS L  + LKL
Sbjct  120   ENGSLTADTAAPLGVETSPFVGQWQGKAASFMRSNEHRAHETERTWDRDTSDLERLALKL  179

Query  1033  VEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRP  1212
             VEGD+N++NWWRKLE++R+L+ EN ES  RL+AL YSAIYLKWINTGQIPC EDGGHHRP
Sbjct  180   VEGDRNARNWWRKLEIIRELVAENSESEDRLDALIYSAIYLKWINTGQIPCLEDGGHHRP  239

Query  1213  NRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHR  1392
             NRHAEISRLIF ELE I  RKD +LQE LVIRKIHPCLPSFKAEFTASVPLTRIRDIAHR
Sbjct  240   NRHAEISRLIFRELEWIYSRKDTSLQERLVIRKIHPCLPSFKAEFTASVPLTRIRDIAHR  299

Query  1393  NDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHEL  1572
             NDIPHDLKQEIKHTIQNKLHRNAGPEDLV+TE ML RITKN GEYSEAFV+QFKIFH EL
Sbjct  300   NDIPHDLKQEIKHTIQNKLHRNAGPEDLVSTEAMLARITKNTGEYSEAFVDQFKIFHQEL  359

Query  1573  KD  1578
             KD
Sbjct  360   KD  361



>gb|KJB37918.1| hypothetical protein B456_006G226300 [Gossypium raimondii]
Length=872

 Score =   518 bits (1333),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 255/380 (67%), Positives = 299/380 (79%), Gaps = 5/380 (1%)
 Frame = +1

Query  439   ICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMM  618
             + AVS+  T E E+K + K SA   + L I LDHQV+YGEH+  +GS KELGSWKK V M
Sbjct  53    VFAVSAAPTIE-EEKTRMKLSAPGKVCLNICLDHQVKYGEHVVFLGSAKELGSWKKQVPM  111

Query  619   DWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTD  798
              W+E+GWV + E  GG+  EFKFVIVG DK L+WETG+NR+LKLP GGS+ +VC WN T 
Sbjct  112   SWSERGWVCDFEFDGGQSAEFKFVIVGNDKTLVWETGNNRILKLPEGGSYVIVCHWNSTG  171

Query  799   KPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGM  978
             +P++LLPL  E +Y  +V    G   T D+++  +  S FV QWQG+A SF++SN+    
Sbjct  172   EPVKLLPLGLE-DYRDRV-EGVGHKPTVDASE--VGTSPFVGQWQGRAASFIQSNEHHDR  227

Query  979   EKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLK  1158
             E  RKWDT+GL    LKLVE DKN++NWWRKLEVVR+LI E++E    LEAL  SA+YLK
Sbjct  228   EVERKWDTTGLKGFALKLVEEDKNARNWWRKLEVVRELIHESLEIGELLEALICSAVYLK  287

Query  1159  WINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFK  1338
             W+NTGQIPCFEDGGHHRPN+HAEISR IFCELE+I  RKD + QE+LVIRKIHPCLPSFK
Sbjct  288   WVNTGQIPCFEDGGHHRPNKHAEISRDIFCELEKITCRKDTSPQELLVIRKIHPCLPSFK  347

Query  1339  AEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNP  1518
             AEFTA VPLTRIRDIAHRNDI HDLKQEIKHTIQNKLHRNAGPEDLV+TE ML RITKNP
Sbjct  348   AEFTAPVPLTRIRDIAHRNDISHDLKQEIKHTIQNKLHRNAGPEDLVSTEAMLARITKNP  407

Query  1519  GEYSEAFVEQFKIFHHELKD  1578
             GEYSEAF+EQFKIFH ELKD
Sbjct  408   GEYSEAFIEQFKIFHQELKD  427



>ref|XP_007034117.1| Catalytics,carbohydrate kinases,phosphoglucan [Theobroma cacao]
 gb|EOY05043.1| Catalytics,carbohydrate kinases,phosphoglucan [Theobroma cacao]
Length=1180

 Score =   524 bits (1350),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 264/380 (69%), Positives = 302/380 (79%), Gaps = 5/380 (1%)
 Frame = +1

Query  445   AVSSVETREVEKKGKEKR--SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMM  618
             AVSS  TRE EKK  + +  S    + L + LDHQVE+GEH+AI+GSTKELGSWKK V M
Sbjct  53    AVSSTLTREEEKKKMKAKPKSGRGKVGLNVCLDHQVEFGEHVAILGSTKELGSWKKQVPM  112

Query  619   DWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTD  798
             +WTE GWV ++ELKG E VE+KFVIV KDK+++WE GDNRVLKLP  G+F MVC WN T 
Sbjct  113   NWTEGGWVCDLELKGDESVEYKFVIVRKDKSVVWEGGDNRVLKLPQSGNFGMVCHWNSTG  172

Query  799   KPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGM  978
             + +ELLPL  E EY  +V  D     T +  +  ++ S FV  WQG+  SF+RSN+    
Sbjct  173   ETVELLPLSLE-EYGDRVEDDGHNESTAEVLE--VETSPFVRNWQGRPASFMRSNEHHNR  229

Query  979   EKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLK  1158
             E  RKWDT+GL  + LKLVEGDK+S+NWWRKLEVV +L+V +++S   LEAL  SAIYLK
Sbjct  230   ELERKWDTTGLEGLALKLVEGDKSSRNWWRKLEVVHELLVGSLQSGELLEALICSAIYLK  289

Query  1159  WINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFK  1338
             WINTGQIPCFEDGGHHRPNRHAEISR IFCELERI  RKD + QE+LVIRKIHPCLPSFK
Sbjct  290   WINTGQIPCFEDGGHHRPNRHAEISRHIFCELERISSRKDTSPQEVLVIRKIHPCLPSFK  349

Query  1339  AEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNP  1518
             AEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVAT+ ML R+TKNP
Sbjct  350   AEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATDAMLARVTKNP  409

Query  1519  GEYSEAFVEQFKIFHHELKD  1578
             GEYSE FVEQFKIFH ELKD
Sbjct  410   GEYSEPFVEQFKIFHQELKD  429



>ref|XP_009371117.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Pyrus x bretschneideri]
Length=965

 Score =   518 bits (1333),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 273/447 (61%), Positives = 322/447 (72%), Gaps = 22/447 (5%)
 Frame = +1

Query  259   MDSLRALHNAKYAYPYRHIPSARRTSLGKLKFSEPR--LILEPQGIPGSIMNRPTRGL--  426
             MD + ALH +  A P  H    RR    +L+   PR   +     +P     R  R L  
Sbjct  1     MDCVHALHTSSSA-PQLH----RRK---QLRCLHPRHQFLGSLAVVPFFAHKRGFRPLYH  52

Query  427   ---SSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  597
                + + IC VSS ++ + EK    K  + + ++L I LDHQVE+GE +AI+GS KELGS
Sbjct  53    KSNTCQIICGVSSAQSIDEEKDNMMKPESGK-VRLNIRLDHQVEFGESVAILGSVKELGS  111

Query  598   WKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  777
             WKK V M+WTE GWV  +E KGGE VE+KF+ V  DK++LWE G NR+LKLP GGSF+MV
Sbjct  112   WKKKVPMNWTESGWVCTLEFKGGESVEYKFLTVRADKSMLWEGGQNRILKLPKGGSFEMV  171

Query  778   CQWNVTDKPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVR  957
             C WN T + + L P   EGE   Q    NG  V       +++ S FV QW+G A+SF+R
Sbjct  172   CHWNATTEAVGL-PSSEEGEDVDQ----NGSTVADTVGAEEVESSPFVGQWKGNAISFMR  226

Query  958   SNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALT  1137
             SN+  G  +  KWDTSGL  + LKLVEGD+N++NWWRKLEVVRDL+V +++S  RL+AL 
Sbjct  227   SNEH-GNREGGKWDTSGLEGLALKLVEGDRNARNWWRKLEVVRDLLVGSLQSEDRLDALI  285

Query  1138  YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIH  1317
              S IYLKWINTGQIPCFE GGHHRPNRHAEISR+IF ELERI  RKD + QE+LVIRKIH
Sbjct  286   NSTIYLKWINTGQIPCFEGGGHHRPNRHAEISRVIFRELERISCRKDTSPQEVLVIRKIH  345

Query  1318  PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELML  1497
             PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE ML
Sbjct  346   PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATEAML  405

Query  1498  ERITKNPGEYSEAFVEQFKIFHHELKD  1578
              RITKNPGEY+ AFVEQFKIFH ELKD
Sbjct  406   ARITKNPGEYNGAFVEQFKIFHRELKD  432



>ref|XP_007225436.1| hypothetical protein PRUPE_ppa000429mg [Prunus persica]
 gb|EMJ26635.1| hypothetical protein PRUPE_ppa000429mg [Prunus persica]
Length=1191

 Score =   523 bits (1347),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 252/385 (65%), Positives = 301/385 (78%), Gaps = 5/385 (1%)
 Frame = +1

Query  424   LSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK  603
             + S  + +  S+E  +  K   + +S +E ++L + LDHQVE+GE + I+GS KELGSWK
Sbjct  59    VCSAGVSSAQSIEEEKESKMKSKSKSGNEKVRLNVRLDHQVEFGESVVILGSIKELGSWK  118

Query  604   KNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQ  783
             K V M+WTE GWV  +E KGGE VE+KF+ V  DK +LWE GDNRVLKLP GG+F +V  
Sbjct  119   KKVPMNWTESGWVCSLEFKGGESVEYKFLTVRADKTVLWEGGDNRVLKLPKGGNFGIVSH  178

Query  784   WNVTDKPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSN  963
             WN T + ++LLPL+ E +     + +NG  +    + P++  S FV QW+G A+SF+RSN
Sbjct  179   WNATGEAVDLLPLEKEED-----VGNNGSTIVDTVSTPEVGTSPFVGQWKGNAISFMRSN  233

Query  964   DQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYS  1143
             +    E  R  DTSGL  + LKLVEGD+N++NWWRKLEVVRDL+V + +S  RL+AL  S
Sbjct  234   EHGNREAGRILDTSGLQGLALKLVEGDRNARNWWRKLEVVRDLLVGSSQSEDRLDALINS  293

Query  1144  AIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPC  1323
             AIYLKWINTGQIPCFEDGGHHRPNRHAEISR+IF ELERI  RKD + QE+LV+RKIHPC
Sbjct  294   AIYLKWINTGQIPCFEDGGHHRPNRHAEISRVIFRELERISCRKDTSPQEVLVVRKIHPC  353

Query  1324  LPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLER  1503
             LPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE ML R
Sbjct  354   LPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATEAMLAR  413

Query  1504  ITKNPGEYSEAFVEQFKIFHHELKD  1578
             ITKNPGEY+EAFVEQFKIFHHELKD
Sbjct  414   ITKNPGEYNEAFVEQFKIFHHELKD  438



>gb|AFO83531.1| glucan water dikinase 3, partial [Manihot esculenta]
Length=1084

 Score =   518 bits (1334),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 248/367 (68%), Positives = 294/367 (80%), Gaps = 3/367 (1%)
 Frame = +1

Query  481   KGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELK  660
             K  +  S +  ++L + L  +VE+GEH+ I+GS KELG WKK V M+WTE GWV  +EL+
Sbjct  2     KKTKSMSGNGKVRLNVRLGCEVEFGEHVVILGSAKELGLWKKKVPMNWTESGWVCNVELR  61

Query  661   GGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD-SEGE  837
             GGE +EFKFV+V KD+++LWE G NR LKLP GGS+++VCQWN T +P+ LLPLD  E E
Sbjct  62    GGESIEFKFVVVKKDESMLWEGGGNRTLKLPKGGSYEIVCQWNATVEPMNLLPLDLKENE  121

Query  838   YEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAE  1017
              E + +   G V    +T  + + S FV QWQGK++SF+RSN+ R  E  R WDTS L  
Sbjct  122   VEKENVDKKGSV--SGATLLEGETSPFVGQWQGKSISFMRSNEHRNRETERTWDTSDLEG  179

Query  1018  IPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDG  1197
             + L +VEGD+N++NWWRKLEVVR+L+VEN+++  RLEAL  SAIYLKWINTGQIPCFEDG
Sbjct  180   LALTVVEGDRNARNWWRKLEVVRELLVENLDTGDRLEALICSAIYLKWINTGQIPCFEDG  239

Query  1198  GHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIR  1377
             GHHRPNRHAEISRLIF  LE+I  RKD +  EILVIRKIHPCLPSFKAEFTASVPLTRIR
Sbjct  240   GHHRPNRHAEISRLIFRGLEQISCRKDTSPNEILVIRKIHPCLPSFKAEFTASVPLTRIR  299

Query  1378  DIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKI  1557
             DIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDLVATE ML RITKNPGE+S+AFVEQF+I
Sbjct  300   DIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLVATEAMLARITKNPGEFSDAFVEQFRI  359

Query  1558  FHHELKD  1578
             FHHELKD
Sbjct  360   FHHELKD  366



>ref|XP_010244064.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Nelumbo nucifera]
 ref|XP_010244065.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Nelumbo nucifera]
Length=1197

 Score =   521 bits (1341),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 255/384 (66%), Positives = 302/384 (79%), Gaps = 4/384 (1%)
 Frame = +1

Query  427   SSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKK  606
             SSR  C VSSVE R+ EKK + ++   + L L + L+HQVE+GEH+A++GS+KELGSWKK
Sbjct  59    SSRITCGVSSVEERKEEKKMESRKRRGKVL-LSVRLNHQVEFGEHVAMLGSSKELGSWKK  117

Query  607   NVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQW  786
              V +DWTE GWV ++E+KGGE VE+KFVI+ KDK+++WE GDNR LKLP GG F+M+C W
Sbjct  118   KVNLDWTENGWVCDLEMKGGEEVEYKFVILRKDKSIIWENGDNRSLKLPEGGRFEMICHW  177

Query  787   NVTDKPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSND  966
             N T + + LLPL   G  E +  +DNG  V    T P+ + S FVEQWQGKA SF+RSN+
Sbjct  178   NKTGEAVNLLPL---GATEKEDTSDNGSAVVDAETVPEGEPSPFVEQWQGKAASFMRSNE  234

Query  967   QRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSA  1146
                 E  R W+T GL  + LK VEGD++++NWWRKLEVVR L+VE++++  R EAL YSA
Sbjct  235   HTNRETERTWNTEGLEGLALKFVEGDRSARNWWRKLEVVRKLLVESLKNGDRFEALIYSA  294

Query  1147  IYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCL  1326
             IYLKWINTGQIPCFEDGGH RPN HAEIS  IF ELERI   KD + QE LVI KIHPCL
Sbjct  295   IYLKWINTGQIPCFEDGGHRRPNMHAEISMFIFRELERISYGKDTSAQEKLVISKIHPCL  354

Query  1327  PSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERI  1506
             PSFK+EFTASVPLTRIRDIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE ML RI
Sbjct  355   PSFKSEFTASVPLTRIRDIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEAMLARI  414

Query  1507  TKNPGEYSEAFVEQFKIFHHELKD  1578
             T+ PGEYSEAF+EQFKIFH ELKD
Sbjct  415   TRTPGEYSEAFLEQFKIFHRELKD  438



>gb|KJB37917.1| hypothetical protein B456_006G226300 [Gossypium raimondii]
Length=1161

 Score =   519 bits (1337),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 255/380 (67%), Positives = 299/380 (79%), Gaps = 5/380 (1%)
 Frame = +1

Query  439   ICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMM  618
             + AVS+  T E E+K + K SA   + L I LDHQV+YGEH+  +GS KELGSWKK V M
Sbjct  53    VFAVSAAPTIE-EEKTRMKLSAPGKVCLNICLDHQVKYGEHVVFLGSAKELGSWKKQVPM  111

Query  619   DWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTD  798
              W+E+GWV + E  GG+  EFKFVIVG DK L+WETG+NR+LKLP GGS+ +VC WN T 
Sbjct  112   SWSERGWVCDFEFDGGQSAEFKFVIVGNDKTLVWETGNNRILKLPEGGSYVIVCHWNSTG  171

Query  799   KPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGM  978
             +P++LLPL  E +Y  +V    G   T D+++  +  S FV QWQG+A SF++SN+    
Sbjct  172   EPVKLLPLGLE-DYRDRV-EGVGHKPTVDASE--VGTSPFVGQWQGRAASFIQSNEHHDR  227

Query  979   EKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLK  1158
             E  RKWDT+GL    LKLVE DKN++NWWRKLEVVR+LI E++E    LEAL  SA+YLK
Sbjct  228   EVERKWDTTGLKGFALKLVEEDKNARNWWRKLEVVRELIHESLEIGELLEALICSAVYLK  287

Query  1159  WINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFK  1338
             W+NTGQIPCFEDGGHHRPN+HAEISR IFCELE+I  RKD + QE+LVIRKIHPCLPSFK
Sbjct  288   WVNTGQIPCFEDGGHHRPNKHAEISRDIFCELEKITCRKDTSPQELLVIRKIHPCLPSFK  347

Query  1339  AEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNP  1518
             AEFTA VPLTRIRDIAHRNDI HDLKQEIKHTIQNKLHRNAGPEDLV+TE ML RITKNP
Sbjct  348   AEFTAPVPLTRIRDIAHRNDISHDLKQEIKHTIQNKLHRNAGPEDLVSTEAMLARITKNP  407

Query  1519  GEYSEAFVEQFKIFHHELKD  1578
             GEYSEAF+EQFKIFH ELKD
Sbjct  408   GEYSEAFIEQFKIFHQELKD  427



>ref|XP_009371116.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Pyrus x bretschneideri]
Length=1185

 Score =   520 bits (1339),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 273/447 (61%), Positives = 322/447 (72%), Gaps = 22/447 (5%)
 Frame = +1

Query  259   MDSLRALHNAKYAYPYRHIPSARRTSLGKLKFSEPR--LILEPQGIPGSIMNRPTRGL--  426
             MD + ALH +  A P  H    RR    +L+   PR   +     +P     R  R L  
Sbjct  1     MDCVHALHTSSSA-PQLH----RRK---QLRCLHPRHQFLGSLAVVPFFAHKRGFRPLYH  52

Query  427   ---SSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  597
                + + IC VSS ++ + EK    K  + + ++L I LDHQVE+GE +AI+GS KELGS
Sbjct  53    KSNTCQIICGVSSAQSIDEEKDNMMKPESGK-VRLNIRLDHQVEFGESVAILGSVKELGS  111

Query  598   WKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  777
             WKK V M+WTE GWV  +E KGGE VE+KF+ V  DK++LWE G NR+LKLP GGSF+MV
Sbjct  112   WKKKVPMNWTESGWVCTLEFKGGESVEYKFLTVRADKSMLWEGGQNRILKLPKGGSFEMV  171

Query  778   CQWNVTDKPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVR  957
             C WN T + + L P   EGE   Q    NG  V       +++ S FV QW+G A+SF+R
Sbjct  172   CHWNATTEAVGL-PSSEEGEDVDQ----NGSTVADTVGAEEVESSPFVGQWKGNAISFMR  226

Query  958   SNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALT  1137
             SN+  G  +  KWDTSGL  + LKLVEGD+N++NWWRKLEVVRDL+V +++S  RL+AL 
Sbjct  227   SNEH-GNREGGKWDTSGLEGLALKLVEGDRNARNWWRKLEVVRDLLVGSLQSEDRLDALI  285

Query  1138  YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIH  1317
              S IYLKWINTGQIPCFE GGHHRPNRHAEISR+IF ELERI  RKD + QE+LVIRKIH
Sbjct  286   NSTIYLKWINTGQIPCFEGGGHHRPNRHAEISRVIFRELERISCRKDTSPQEVLVIRKIH  345

Query  1318  PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELML  1497
             PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE ML
Sbjct  346   PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATEAML  405

Query  1498  ERITKNPGEYSEAFVEQFKIFHHELKD  1578
              RITKNPGEY+ AFVEQFKIFH ELKD
Sbjct  406   ARITKNPGEYNGAFVEQFKIFHRELKD  432



>ref|XP_010546804.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=1174

 Score =   512 bits (1319),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 261/435 (60%), Positives = 323/435 (74%), Gaps = 17/435 (4%)
 Frame = +1

Query  286   AKYAYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVET  465
             + +    R I  +R +SL       PRL+   + +P     R     S R  C VS+  +
Sbjct  5     SSHCCSSRCIFFSRSSSL-------PRLVFFSRRVPFGRSQRFNHS-SCRITCTVSASAS  56

Query  466   REVE--KKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGW  639
               +E  ++ K+ RS  + + LK+ LDHQV++GEH+AI+GS+KE+GSWKK V + WTEKGW
Sbjct  57    STIEEQRQKKDDRSG-KKVMLKLRLDHQVKFGEHVAILGSSKEIGSWKKKVPLIWTEKGW  115

Query  640   VSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLP  819
             V E+EL GG+ +E+KFVIV KD +L WE+G+NRVL+LP  GSF +VC+W+ T +PL+L P
Sbjct  116   VCELELSGGQVLEYKFVIVRKDGSLAWESGENRVLQLPNSGSFSVVCRWDATREPLDL-P  174

Query  820   LDS--EGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRK  993
              ++  + ++E  V   +  +V  D     +  S    QWQGK  SF+RSN+ R  E +R 
Sbjct  175   QEAGIDDDHEDDVGEQDDHIVNNDGVQ--IGKSTLAGQWQGKDASFMRSNEHRNREVDRI  232

Query  994   WDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTG  1173
             W+T+GL    LKLVEGD+N++NWWRKLEVVR+LIV ++E   RLEAL YSAIYLKWINTG
Sbjct  233   WNTTGLEGSALKLVEGDRNARNWWRKLEVVRELIVGSIEREERLEALLYSAIYLKWINTG  292

Query  1174  QIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTA  1353
             QIPC EDGGHHRPNRHAEISR IF ELERI   KDA+ +E+LV RKIHPCLPSFKAEFTA
Sbjct  293   QIPCLEDGGHHRPNRHAEISRFIFRELERICC-KDASAEEVLVARKIHPCLPSFKAEFTA  351

Query  1354  SVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSE  1533
             SVPLTRIRDIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE MLERITKNPGEY+E
Sbjct  352   SVPLTRIRDIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEAMLERITKNPGEYNE  411

Query  1534  AFVEQFKIFHHELKD  1578
             AFVEQF+IFH+ELKD
Sbjct  412   AFVEQFRIFHNELKD  426



>ref|XP_010546803.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=1176

 Score =   512 bits (1319),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 261/435 (60%), Positives = 323/435 (74%), Gaps = 17/435 (4%)
 Frame = +1

Query  286   AKYAYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVET  465
             + +    R I  +R +SL       PRL+   + +P     R     S R  C VS+  +
Sbjct  5     SSHCCSSRCIFFSRSSSL-------PRLVFFSRRVPFGRSQRFNHS-SCRITCTVSASAS  56

Query  466   REVE--KKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGW  639
               +E  ++ K+ RS  + + LK+ LDHQV++GEH+AI+GS+KE+GSWKK V + WTEKGW
Sbjct  57    STIEEQRQKKDDRSG-KKVMLKLRLDHQVKFGEHVAILGSSKEIGSWKKKVPLIWTEKGW  115

Query  640   VSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLP  819
             V E+EL GG+ +E+KFVIV KD +L WE+G+NRVL+LP  GSF +VC+W+ T +PL+L P
Sbjct  116   VCELELSGGQVLEYKFVIVRKDGSLAWESGENRVLQLPNSGSFSVVCRWDATREPLDL-P  174

Query  820   LDS--EGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRK  993
              ++  + ++E  V   +  +V  D     +  S    QWQGK  SF+RSN+ R  E +R 
Sbjct  175   QEAGIDDDHEDDVGEQDDHIVNNDGVQ--IGKSTLAGQWQGKDASFMRSNEHRNREVDRI  232

Query  994   WDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTG  1173
             W+T+GL    LKLVEGD+N++NWWRKLEVVR+LIV ++E   RLEAL YSAIYLKWINTG
Sbjct  233   WNTTGLEGSALKLVEGDRNARNWWRKLEVVRELIVGSIEREERLEALLYSAIYLKWINTG  292

Query  1174  QIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTA  1353
             QIPC EDGGHHRPNRHAEISR IF ELERI   KDA+ +E+LV RKIHPCLPSFKAEFTA
Sbjct  293   QIPCLEDGGHHRPNRHAEISRFIFRELERICC-KDASAEEVLVARKIHPCLPSFKAEFTA  351

Query  1354  SVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSE  1533
             SVPLTRIRDIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE MLERITKNPGEY+E
Sbjct  352   SVPLTRIRDIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEAMLERITKNPGEYNE  411

Query  1534  AFVEQFKIFHHELKD  1578
             AFVEQF+IFH+ELKD
Sbjct  412   AFVEQFRIFHNELKD  426



>ref|XP_010454991.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=895

 Score =   502 bits (1293),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 250/423 (59%), Positives = 308/423 (73%), Gaps = 2/423 (0%)
 Frame = +1

Query  310   HIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGK  489
             H  S+  T + +   + P+L+   + +  S  +   R  SSR  C  SS  +  +E++ K
Sbjct  8     HCCSSPFTFITRNSSTLPKLVNFTRRVHLSHQSHRLRNSSSRLTCTASSSSSSTIEEQRK  67

Query  490   EKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGE  669
             +K  +   +KL + LDHQV +GEH+A+ GS KE+GSWKK   ++WTEKGWV E+EL GG+
Sbjct  68    KKDGSGTKVKLNVRLDHQVNFGEHVAMFGSAKEIGSWKKKSPLNWTEKGWVCELELDGGQ  127

Query  670   PVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQ  849
              +E+KFVIV  D +L WE+GDNRVLKLP  G+F +VC W+ T + L+L       +    
Sbjct  128   VLEYKFVIVKNDGSLSWESGDNRVLKLPNSGNFSVVCHWDATRETLDLPQEVCNDDGGGG  187

Query  850   VLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLK  1029
                D   V +++     +Q S    QWQGK  SF+RSND    E  R WDT+GL    LK
Sbjct  188   DERDTQDVGSENGAQ--LQKSTLGGQWQGKDASFMRSNDHGNREVGRNWDTTGLEGTALK  245

Query  1030  LVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHR  1209
             +VEGD+NS+NWWRKLE+VR++IV +VE   RL+AL YSAIYLKWINTGQIPCFEDGGHHR
Sbjct  246   MVEGDRNSRNWWRKLEMVREVIVGSVEREERLKALIYSAIYLKWINTGQIPCFEDGGHHR  305

Query  1210  PNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAH  1389
             PNRHAEISRLIF ELE I  +KDAT +E+LV RKIHPCLPSFKAEFTA+VPLTRIRDIAH
Sbjct  306   PNRHAEISRLIFRELEHICSKKDATAEEVLVARKIHPCLPSFKAEFTAAVPLTRIRDIAH  365

Query  1390  RNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHE  1569
             RNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE ML+RIT+ PG+YS  FVEQFKIFH+E
Sbjct  366   RNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEAMLQRITETPGKYSGDFVEQFKIFHNE  425

Query  1570  LKD  1578
             LKD
Sbjct  426   LKD  428



>ref|XP_006394878.1| hypothetical protein EUTSA_v10003634mg [Eutrema salsugineum]
 gb|ESQ32164.1| hypothetical protein EUTSA_v10003634mg [Eutrema salsugineum]
Length=880

 Score =   498 bits (1281),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 244/411 (59%), Positives = 302/411 (73%), Gaps = 9/411 (2%)
 Frame = +1

Query  355   SEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWL  534
             S PR++   + +     ++  R   SR  CA SS     +E++ K+K  +   +KL + L
Sbjct  21    SLPRIVNFTRSVHLGRQSQRLRNSPSRLTCAASST----IEEQRKKKDGSGTKVKLNVRL  76

Query  535   DHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNL  714
             +HQV +GEH+A+ GS KE+GSWKK   + WTE GWV E+EL GG+ +E+KFVIV  D +L
Sbjct  77    NHQVNFGEHVAMFGSAKEIGSWKKKSPLTWTENGWVCELELSGGQVLEYKFVIVHNDGSL  136

Query  715   LWETGDNRVLKLPAGGSFKMVCQWNVTDKPLEL---LPLDSEGEYEAQVLADNGPVVTKD  885
              WE+GDNRVLKLP  GSF +VC W+ T + L+    +  D   + +   + D+  V +++
Sbjct  137   SWESGDNRVLKLPNSGSFSVVCHWDATGETLDFPQEVASDGHDDSDKHDVVDDRVVGSEN  196

Query  886   STDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWW  1065
                  +  S    QWQGK  SF+RSN+    E  R WDT+GL    LK+VEGD+NS+NWW
Sbjct  197   GAQ--LHKSTLAGQWQGKDASFMRSNEHGNREVGRNWDTTGLEGSALKMVEGDRNSRNWW  254

Query  1066  RKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF  1245
             RKLE+VR++IV ++E   RL+AL YSA+YLKWINTGQIPCFEDGGHHRPNRHAEISRLIF
Sbjct  255   RKLEMVREVIVGSLEREERLKALIYSAVYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF  314

Query  1246  CELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEI  1425
              ELE I  +KDAT +E+LV RKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEI
Sbjct  315   RELEHICSKKDATAEEVLVSRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEI  374

Query  1426  KHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             KHTIQNKLHRNAGPEDL+ATE MLERIT+ PG+YS  FVEQFKIFH+ELKD
Sbjct  375   KHTIQNKLHRNAGPEDLIATEAMLERITETPGQYSGDFVEQFKIFHNELKD  425



>ref|XP_006845104.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Amborella 
trichopoda]
 gb|ERN06779.1| hypothetical protein AMTR_s00005p00168970 [Amborella trichopoda]
Length=1176

 Score =   506 bits (1302),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 262/445 (59%), Positives = 314/445 (71%), Gaps = 14/445 (3%)
 Frame = +1

Query  259   MDSLRALHNAKYAYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRT  438
             M S R L +   +  Y     +  +SL  LK   PR  L P    GS  +          
Sbjct  1     MASFR-LFSCSSSSLYTDYDESSSSSLHILKL-RPRFFLLP-CFEGSRFSSHVLSRRLYP  57

Query  439   ICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMM  618
             +    SV  RE +    +++     + ++I LDHQV++GEHIAI GS+KELGSWKKNV M
Sbjct  58    VVCRGSVSEREAKMAPVDRKKG--KVAIRIRLDHQVKFGEHIAITGSSKELGSWKKNVDM  115

Query  619   DWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTD  798
              WTE GWV++++LKGGE VE+KFVI+ K+K  +WE GDNR LKLP  G F+MVC WN T 
Sbjct  116   SWTEDGWVADLKLKGGENVEYKFVILAKEKTTIWEEGDNRALKLPKEGKFEMVCHWNQTR  175

Query  799   KPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQV-----SAFVEQWQGKAVSFVRSN  963
             + + L   + E E  ++ +A    VV  +S    + V     SAFV+ WQGK VSF++SN
Sbjct  176   EAVNLPAFEDEVEVGSEEVA----VVDDNSNSSPLLVEVQEPSAFVQGWQGKVVSFMKSN  231

Query  964   DQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYS  1143
                  E  R+W+T  L    LKLV+GD+N++NWWRKLEVVR+L+ +N E   RLE+L YS
Sbjct  232   KHGETESARRWNTESLEGPALKLVKGDQNARNWWRKLEVVRELLTQNTEEESRLESLIYS  291

Query  1144  AIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPC  1323
             AIYLK INTGQIPCFEDGGHHRPNRHAEISRLIFC+LERI   K+   +EIL+IRKIHPC
Sbjct  292   AIYLKLINTGQIPCFEDGGHHRPNRHAEISRLIFCDLERISYSKNTLPEEILIIRKIHPC  351

Query  1324  LPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLER  1503
             LPSFK+EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE ML R
Sbjct  352   LPSFKSEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEAMLSR  411

Query  1504  ITKNPGEYSEAFVEQFKIFHHELKD  1578
             ITKNPGEYSEAFVEQFKIFH ELKD
Sbjct  412   ITKNPGEYSEAFVEQFKIFHGELKD  436



>ref|XP_010907528.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Elaeis 
guineensis]
Length=926

 Score =   498 bits (1282),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 245/382 (64%), Positives = 296/382 (77%), Gaps = 20/382 (5%)
 Frame = +1

Query  472   VEKKGKEKRSA---HENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWV  642
             VE+  +EKR A      +++++ LDHQVE+GEH+A++GSTKELG WK+ V MDWT +GWV
Sbjct  57    VERIEEEKRKASGKRRKVRMRVQLDHQVEFGEHVAVLGSTKELGLWKRQVPMDWTPEGWV  116

Query  643   SEMELKGGEPVEFKFVIVGKDK-NLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLP  819
              E+EL GGE +E+KFVI+ K K  ++WE GDNRVLKLP  G F MVC+WN T + ++LL 
Sbjct  117   CELELCGGEVLEYKFVILRKGKMGMIWEDGDNRVLKLPEEGMFDMVCRWNKTGEAVDLLG  176

Query  820   LDSEGEYEAQV---------LADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQR  972
              D + E   ++          +D+G  V+K    P      FVE WQG+A SF+RSN+ +
Sbjct  177   ADIDDEKVEELESEDGGDATASDDGGFVSKRKPSP------FVEHWQGRAASFMRSNEHK  230

Query  973   GMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIY  1152
               E  R WDT GL  + LKLVEGD+ ++NWWRKLEVVR+L++EN++    LEAL Y AIY
Sbjct  231   SRETERTWDTDGLDGVVLKLVEGDRVARNWWRKLEVVRELLMENIKGDC-LEALIYFAIY  289

Query  1153  LKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPS  1332
             LKWIN GQIPCFEDGGHHRPNRHAEISRLIFCELERI   K+ + Q++LVI+KIHPCLPS
Sbjct  290   LKWINMGQIPCFEDGGHHRPNRHAEISRLIFCELERIYYGKNTSPQDLLVIQKIHPCLPS  349

Query  1333  FKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITK  1512
             FKAEFTASVPLTRIRDIAHR+DIPH+LKQEIKHTIQNKLHRNAGPEDLVATE ML +ITK
Sbjct  350   FKAEFTASVPLTRIRDIAHRSDIPHNLKQEIKHTIQNKLHRNAGPEDLVATEAMLAKITK  409

Query  1513  NPGEYSEAFVEQFKIFHHELKD  1578
              PGEYSEAF+EQFKIFHHELKD
Sbjct  410   TPGEYSEAFIEQFKIFHHELKD  431



>ref|XP_010551754.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Tarenaya hassleriana]
Length=1183

 Score =   504 bits (1298),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 254/431 (59%), Positives = 308/431 (71%), Gaps = 28/431 (6%)
 Frame = +1

Query  325   RRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVE--KKGKEKR  498
             R +SL +L     R+  +  G      N P    S R  C VS+  +  +E  +K K   
Sbjct  18    RSSSLPRLGLFSRRVRFDRSGR----FNYP----SCRITCTVSASASSTIEEQRKSKGDD  69

Query  499   SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVE  678
              + + +KL + LDHQVE+GEH++I GS++E+GSWKK V + WTE GWV E+EL GG+ +E
Sbjct  70    KSGKTVKLNLRLDHQVEFGEHVSIFGSSEEIGSWKKKVPLAWTENGWVCELELSGGQVLE  129

Query  679   FKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLEL-----------LPLD  825
             +KFVIV KD +L WE+GDNRVL+LP  GSF + C+W+ T +PL+L              +
Sbjct  130   YKFVIVRKDGSLAWESGDNRVLQLPNSGSFSVSCRWDATREPLDLPQEAAADDDDDDDNE  189

Query  826   SEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTS  1005
              +G  E     +N  V         ++ S+   QWQGK VSF+RSN+ R  E +R WDT+
Sbjct  190   QDGHDEVDYTVNNDGV-------QQLEKSSLAGQWQGKDVSFMRSNEHRNREVDRIWDTT  242

Query  1006  GLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPC  1185
             GL    LKLVEGD+N++NWWRKLEVVR+LIV ++E   RLEAL YSAIYLKWINTGQIPC
Sbjct  243   GLEGSALKLVEGDRNARNWWRKLEVVRELIVGSIERKERLEALIYSAIYLKWINTGQIPC  302

Query  1186  FEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPL  1365
             FEDG H+RPNRHAEISRLIF ELE I   KDA+ +E+LV RKIHPCLPSFKAEFT SVPL
Sbjct  303   FEDGSHYRPNRHAEISRLIFRELEHICCTKDASAEEVLVARKIHPCLPSFKAEFTVSVPL  362

Query  1366  TRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVE  1545
             TRIRDIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE MLERITKNPGEYS  FVE
Sbjct  363   TRIRDIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEAMLERITKNPGEYSADFVE  422

Query  1546  QFKIFHHELKD  1578
             QF+IFH+ELKD
Sbjct  423   QFRIFHNELKD  433



>ref|NP_001119280.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
 gb|AED93556.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
Length=865

 Score =   494 bits (1273),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 250/435 (57%), Positives = 308/435 (71%), Gaps = 17/435 (4%)
 Frame = +1

Query  295   AYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREV  474
             + P+  I     +SL       PRL+     +  S  +   R  +SR  C  +S  T  +
Sbjct  10    SSPFTFITRNSSSSL-------PRLVNITHRVNLSHQSHRLRNSNSRLTCTATSSST--I  60

Query  475   EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEME  654
             E++ K+K  +   ++L + LDHQV +G+H+A+ GS KE+GSWKK   ++W+E GWV E+E
Sbjct  61    EEQRKKKDGSGTKVRLNVRLDHQVNFGDHVAMFGSAKEIGSWKKKSPLNWSENGWVCELE  120

Query  655   LKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEG  834
             L GG+ +E+KFVIV  D +L WE+GDNRVLK+P  G+F +VC W+ T + L+L P +   
Sbjct  121   LDGGQVLEYKFVIVKNDGSLSWESGDNRVLKVPNSGNFSVVCHWDATRETLDL-PQEVGN  179

Query  835   EYEAQVLA---DNGPV----VTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRK  993
             + +        DN  V    V        +Q S    QWQGK  SF+RSND    E  R 
Sbjct  180   DDDVGDGGHERDNHDVGDDRVVGSENGAQLQKSTLGGQWQGKDASFMRSNDHGNREVGRN  239

Query  994   WDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTG  1173
             WDTSGL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+AL YSAIYLKWINTG
Sbjct  240   WDTSGLEGTALKMVEGDRNSKNWWRKLEMVREVIVGSVEREERLKALIYSAIYLKWINTG  299

Query  1174  QIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTA  1353
             QIPCFEDGGHHRPNRHAEISRLIF ELE I  +KDAT +E+LV RKIHPCLPSFKAEFTA
Sbjct  300   QIPCFEDGGHHRPNRHAEISRLIFRELEHICSKKDATPEEVLVARKIHPCLPSFKAEFTA  359

Query  1354  SVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSE  1533
             +VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE ML+RIT+ PG+YS 
Sbjct  360   AVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEAMLQRITETPGKYSG  419

Query  1534  AFVEQFKIFHHELKD  1578
              FVEQFKIFH+ELKD
Sbjct  420   DFVEQFKIFHNELKD  434



>ref|XP_010454990.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=1182

 Score =   503 bits (1295),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 250/423 (59%), Positives = 308/423 (73%), Gaps = 2/423 (0%)
 Frame = +1

Query  310   HIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGK  489
             H  S+  T + +   + P+L+   + +  S  +   R  SSR  C  SS  +  +E++ K
Sbjct  8     HCCSSPFTFITRNSSTLPKLVNFTRRVHLSHQSHRLRNSSSRLTCTASSSSSSTIEEQRK  67

Query  490   EKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGE  669
             +K  +   +KL + LDHQV +GEH+A+ GS KE+GSWKK   ++WTEKGWV E+EL GG+
Sbjct  68    KKDGSGTKVKLNVRLDHQVNFGEHVAMFGSAKEIGSWKKKSPLNWTEKGWVCELELDGGQ  127

Query  670   PVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQ  849
              +E+KFVIV  D +L WE+GDNRVLKLP  G+F +VC W+ T + L+L       +    
Sbjct  128   VLEYKFVIVKNDGSLSWESGDNRVLKLPNSGNFSVVCHWDATRETLDLPQEVCNDDGGGG  187

Query  850   VLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLK  1029
                D   V +++     +Q S    QWQGK  SF+RSND    E  R WDT+GL    LK
Sbjct  188   DERDTQDVGSENGAQ--LQKSTLGGQWQGKDASFMRSNDHGNREVGRNWDTTGLEGTALK  245

Query  1030  LVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHR  1209
             +VEGD+NS+NWWRKLE+VR++IV +VE   RL+AL YSAIYLKWINTGQIPCFEDGGHHR
Sbjct  246   MVEGDRNSRNWWRKLEMVREVIVGSVEREERLKALIYSAIYLKWINTGQIPCFEDGGHHR  305

Query  1210  PNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAH  1389
             PNRHAEISRLIF ELE I  +KDAT +E+LV RKIHPCLPSFKAEFTA+VPLTRIRDIAH
Sbjct  306   PNRHAEISRLIFRELEHICSKKDATAEEVLVARKIHPCLPSFKAEFTAAVPLTRIRDIAH  365

Query  1390  RNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHE  1569
             RNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE ML+RIT+ PG+YS  FVEQFKIFH+E
Sbjct  366   RNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEAMLQRITETPGKYSGDFVEQFKIFHNE  425

Query  1570  LKD  1578
             LKD
Sbjct  426   LKD  428



>ref|XP_010493900.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Camelina sativa]
Length=1194

 Score =   503 bits (1295),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 245/391 (63%), Positives = 291/391 (74%), Gaps = 6/391 (2%)
 Frame = +1

Query  418   RGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  597
             R  SSR  C  SS  T  +E++ K+K  +   +KL + LDHQV +GEH+A+ GS KE+GS
Sbjct  44    RNSSSRLTCTASSSST--IEEQRKKKDGSGTKVKLNVRLDHQVNFGEHVAMFGSAKEIGS  101

Query  598   WKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  777
             WKK   ++WT+KGWV ++EL GG+ +E+KFVIV  D +L WE+GDNRVLKLP  G+F +V
Sbjct  102   WKKKSPLNWTDKGWVCQLELDGGQVLEYKFVIVKNDGSLSWESGDNRVLKLPNSGNFSVV  161

Query  778   CQWNVTDKPLELLPLDSEGEYEAQVLADNGPV----VTKDSTDPDMQVSAFVEQWQGKAV  945
             C W+ T + L+L               DN  V    V        +Q S    QWQGK  
Sbjct  162   CHWDATRETLDLPQEVGNDGGGGGDERDNHEVSDERVVGSENGAQLQKSTLGGQWQGKDA  221

Query  946   SFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRL  1125
             SF+RSND    E  R WDT+GL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL
Sbjct  222   SFMRSNDHGNREVGRNWDTTGLEGTALKMVEGDRNSRNWWRKLEMVREVIVGSVEREERL  281

Query  1126  EALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVI  1305
             +AL YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELE I  +KDAT +E+LV 
Sbjct  282   KALIYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELEHICSKKDATAEEVLVA  341

Query  1306  RKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVAT  1485
             RKIHPCLPSFKAEFTA+VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+AT
Sbjct  342   RKIHPCLPSFKAEFTAAVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIAT  401

Query  1486  ELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             E ML+RIT+ PG+YS  FVEQFKIFH+ELKD
Sbjct  402   EAMLQRITETPGKYSGDFVEQFKIFHNELKD  432



>ref|XP_010493901.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Camelina sativa]
Length=1194

 Score =   503 bits (1295),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 245/391 (63%), Positives = 291/391 (74%), Gaps = 6/391 (2%)
 Frame = +1

Query  418   RGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  597
             R  SSR  C  SS  T  +E++ K+K  +   +KL + LDHQV +GEH+A+ GS KE+GS
Sbjct  44    RNSSSRLTCTASSSST--IEEQRKKKDGSGTKVKLNVRLDHQVNFGEHVAMFGSAKEIGS  101

Query  598   WKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  777
             WKK   ++WT+KGWV ++EL GG+ +E+KFVIV  D +L WE+GDNRVLKLP  G+F +V
Sbjct  102   WKKKSPLNWTDKGWVCQLELDGGQVLEYKFVIVKNDGSLSWESGDNRVLKLPNSGNFSVV  161

Query  778   CQWNVTDKPLELLPLDSEGEYEAQVLADNGPV----VTKDSTDPDMQVSAFVEQWQGKAV  945
             C W+ T + L+L               DN  V    V        +Q S    QWQGK  
Sbjct  162   CHWDATRETLDLPQEVGNDGGGGGDERDNHEVSDERVVGSENGAQLQKSTLGGQWQGKDA  221

Query  946   SFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRL  1125
             SF+RSND    E  R WDT+GL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL
Sbjct  222   SFMRSNDHGNREVGRNWDTTGLEGTALKMVEGDRNSRNWWRKLEMVREVIVGSVEREERL  281

Query  1126  EALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVI  1305
             +AL YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELE I  +KDAT +E+LV 
Sbjct  282   KALIYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELEHICSKKDATAEEVLVA  341

Query  1306  RKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVAT  1485
             RKIHPCLPSFKAEFTA+VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+AT
Sbjct  342   RKIHPCLPSFKAEFTAAVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIAT  401

Query  1486  ELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             E ML+RIT+ PG+YS  FVEQFKIFH+ELKD
Sbjct  402   EAMLQRITETPGKYSGDFVEQFKIFHNELKD  432



>gb|KHG00248.1| Phosphoglucan, water dikinase, chloroplastic -like protein [Gossypium 
arboreum]
Length=1052

 Score =   499 bits (1285),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 246/374 (66%), Positives = 286/374 (76%), Gaps = 16/374 (4%)
 Frame = +1

Query  493   KRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEP  672
             K SA   + L I LD QV+YGEH+ I+GS KELGSWKK V M W+E+GWV + E  GG+ 
Sbjct  4     KLSAPGKVCLNICLDLQVKYGEHVVILGSAKELGSWKKQVPMSWSERGWVCDFEFDGGQS  63

Query  673   VEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQV  852
              EFKFVIVG DK L+WETG+NR+LKLP GGS+ +VC WN T +P +LLPL  E EY  +V
Sbjct  64    AEFKFVIVGNDKTLVWETGNNRILKLPEGGSYVIVCHWNSTGEPAKLLPLGLE-EYRDRV  122

Query  853   LADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKL  1032
               D G   T D+ +  +  S FV QWQG+A SF++SN+    E  RKWDT+GL  + LKL
Sbjct  123   -EDVGHKPTADAYE--LGTSPFVGQWQGRAASFMQSNEHHDREVERKWDTTGLKGLALKL  179

Query  1033  VEGDKNSQNWWRK------------LEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQ  1176
             VE DKN++NWWRK            LEVVR++I E++E    LEAL  SA+YLKW+NTGQ
Sbjct  180   VEEDKNARNWWRKVCPFIILDIAQHLEVVREIIHESLEVGELLEALICSAVYLKWVNTGQ  239

Query  1177  IPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTAS  1356
             IPCFEDGGHHRPN+HAEISR IFCELE+I   KD + QE+LVIRKIHPCLPSFKAEFTA 
Sbjct  240   IPCFEDGGHHRPNKHAEISRDIFCELEKITCSKDTSPQELLVIRKIHPCLPSFKAEFTAP  299

Query  1357  VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEA  1536
             VPLTRIRDIAHRNDI HDLKQEIKHTIQNKLHRNAGPEDLV+TE ML RITK+PGEYSEA
Sbjct  300   VPLTRIRDIAHRNDISHDLKQEIKHTIQNKLHRNAGPEDLVSTEAMLARITKDPGEYSEA  359

Query  1537  FVEQFKIFHHELKD  1578
             F+E FKIFH ELKD
Sbjct  360   FIEHFKIFHQELKD  373



>ref|XP_007142602.1| hypothetical protein PHAVU_007G001400g [Phaseolus vulgaris]
 gb|ESW14596.1| hypothetical protein PHAVU_007G001400g [Phaseolus vulgaris]
Length=952

 Score =   496 bits (1276),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 241/386 (62%), Positives = 286/386 (74%), Gaps = 6/386 (2%)
 Frame = +1

Query  439   ICAVSSVETREVEKKGKE------KRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  600
             + AVSS E++  +++ +E        S    ++L++ LDHQV++G+H+AI GSTKELGSW
Sbjct  54    LSAVSSPESQTRDEQQQEGDNNPSSVSMDRKVRLQVRLDHQVQFGDHVAIRGSTKELGSW  113

Query  601   KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVC  780
             K NV + WT+ GWV  +E KG + +EFKF+ V KD  ++WE G NRVLKLP  G F  V 
Sbjct  114   KTNVPLSWTKNGWVCLLEFKGTDHIEFKFITVKKDSTMVWEAGQNRVLKLPVAGHFTTVA  173

Query  781   QWNVTDKPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRS  960
              W+ T   LEL PLD + + + Q            S     + S FV QWQGK VSF+RS
Sbjct  174   TWDATQTNLELHPLDEQLQLQVQGEEGKPYDGATSSVSETAEASPFVGQWQGKPVSFMRS  233

Query  961   NDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTY  1140
             ND R  E   KWDTSGL  +PLK V+ D+N++NWWRKL++VRD+I   ++   RLEAL Y
Sbjct  234   NDHRTHETQMKWDTSGLHGLPLKFVQADQNARNWWRKLDIVRDIIAGGLQGEDRLEALLY  293

Query  1141  SAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHP  1320
             SAIYLKWINTGQI CFEDGGHHRPNRHAEISRLIF ELER   RKD + QE+LVIRKIHP
Sbjct  294   SAIYLKWINTGQITCFEDGGHHRPNRHAEISRLIFRELERHTARKDISPQEVLVIRKIHP  353

Query  1321  CLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLE  1500
             CLPSFKAEFTASVPLTRIRDIAHRNDIPHDLK +IKHTIQNKLHRNAGPEDLVATE ML 
Sbjct  354   CLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKLQIKHTIQNKLHRNAGPEDLVATEAMLA  413

Query  1501  RITKNPGEYSEAFVEQFKIFHHELKD  1578
             +ITKNPGEYSE FV++FKIFH ELKD
Sbjct  414   KITKNPGEYSEPFVKEFKIFHLELKD  439



>ref|XP_002872212.1| hypothetical protein ARALYDRAFT_489476 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48471.1| hypothetical protein ARALYDRAFT_489476 [Arabidopsis lyrata subsp. 
lyrata]
Length=1193

 Score =   500 bits (1287),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 249/427 (58%), Positives = 308/427 (72%), Gaps = 6/427 (1%)
 Frame = +1

Query  310   HIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGK  489
             H  S+  T + +   S P+L+   + +  S  +   R  SSR  C  +S  T  +E++ K
Sbjct  7     HCCSSPFTFITRNTSSLPKLVNFTRRVNLSHQSHRLRNSSSRLTCTATSSST--IEEQRK  64

Query  490   EKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGE  669
             +K  +   +KL + LD+QV++GEH+A+ GS KE+GSWKK   ++WTE GWV E+EL GG+
Sbjct  65    KKDGSGTKVKLNVRLDYQVKFGEHVAMFGSAKEIGSWKKKSPLNWTENGWVCELELDGGQ  124

Query  670   PVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQ  849
              +E+KFVIV  D +L WE+GDNRVLK+P  G+F +VC W+ T + L+L       +    
Sbjct  125   VLEYKFVIVKDDGSLSWESGDNRVLKVPNSGNFSVVCHWDATRETLDLPQEVGIDDGGGG  184

Query  850   VLADNGPV----VTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAE  1017
                DN  V    V        +Q S    QWQGK  SF+RSND    E  R WDT+GL  
Sbjct  185   DERDNHDVGDERVMGSENGAQLQKSTLGGQWQGKDASFMRSNDHGNREVGRNWDTTGLEG  244

Query  1018  IPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDG  1197
               LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+AL YS+IYLKWINTGQIPCFEDG
Sbjct  245   TALKMVEGDRNSKNWWRKLEMVREVIVGSVEKEERLKALIYSSIYLKWINTGQIPCFEDG  304

Query  1198  GHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIR  1377
             GHHRPNRHAEISRLIF ELE+I  +KDAT +E+LV RKIHPCLPSFKAEFTA+VPLTRIR
Sbjct  305   GHHRPNRHAEISRLIFRELEQICSKKDATAEEVLVARKIHPCLPSFKAEFTAAVPLTRIR  364

Query  1378  DIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKI  1557
             DIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE ML+RIT+ PG+YS  FVEQFKI
Sbjct  365   DIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEAMLQRITETPGKYSGDFVEQFKI  424

Query  1558  FHHELKD  1578
             FH+ELKD
Sbjct  425   FHNELKD  431



>ref|XP_004497422.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=1180

 Score =   498 bits (1281),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 238/387 (61%), Positives = 297/387 (77%), Gaps = 8/387 (2%)
 Frame = +1

Query  430   SRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN  609
             S T+  +S+  + + + +  +     EN+ L + LDHQV++G+H+A++GSTK+LGSWK N
Sbjct  47    SHTLPLLSAFSSTQTQPRKSKNNIKIENVHLHVRLDHQVQFGDHVALLGSTKQLGSWKTN  106

Query  610   VMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWN  789
             V ++WT+ GWV +++ KGG+ +EFKF+IV  D  ++WE G NR+L LPA G F+ V  WN
Sbjct  107   VPLNWTQNGWVCDLDFKGGDHIEFKFLIVTNDGTVVWEAGQNRLLNLPAAGHFQTVATWN  166

Query  790   VTDKPLELLPLDSEGEYEAQVLADNGPVVTKD----STDPDMQVSAFVEQWQGKAVSFVR  957
              T++ +ELLPL+   E + Q   D+     +D    S+  +   S FV +WQGK++SF+R
Sbjct  167   TTNQIMELLPLN---EQQQQQQQDDNLEHIEDTAASSSHSEAGPSPFVGEWQGKSISFMR  223

Query  958   SNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALT  1137
             +N+ +  E  R WDTS L  +PLKLV+GD+  +NWWRKL++VRD IV NVE   RLEAL 
Sbjct  224   TNEHQSNEAGRTWDTSDLQGLPLKLVQGDQTGRNWWRKLDIVRD-IVGNVEGEDRLEALI  282

Query  1138  YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIH  1317
             Y +IYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF +LER   RKD + QE+LVIRKIH
Sbjct  283   YCSIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRDLERYTSRKDISPQEVLVIRKIH  342

Query  1318  PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELML  1497
             PCLPSFKAEFTASVPLTRIRDIAHRNDIPHD+K +IKHTIQNKLHRNAGPEDLVATE ML
Sbjct  343   PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDVKLQIKHTIQNKLHRNAGPEDLVATEAML  402

Query  1498  ERITKNPGEYSEAFVEQFKIFHHELKD  1578
              +ITKNPGEYSEAFVEQFKIFH ELKD
Sbjct  403   AKITKNPGEYSEAFVEQFKIFHEELKD  429



>ref|XP_009416602.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=1264

 Score =   500 bits (1287),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 244/368 (66%), Positives = 291/368 (79%), Gaps = 6/368 (2%)
 Frame = +1

Query  487   KEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGG  666
             +E       +++++ LDHQVE+GEH+A++GSTKELGSW+K+VMM+WT  GWV ++EL+GG
Sbjct  149   REASGERGAVRVRVRLDHQVEFGEHVAVLGSTKELGSWRKHVMMEWTPDGWVQDIELRGG  208

Query  667   EPVEFKFVIV--GKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELL--PLDSEG  834
             E VEFKFV++  GK K+++WE G NRVL LP  G+F MVC WN TD+ LELL   L  E 
Sbjct  209   ESVEFKFVVLLRGK-KDVVWEGGGNRVLTLPEKGAFDMVCHWNRTDEALELLGTSLGEED  267

Query  835   EYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLA  1014
             E       ++  +V   S + +   S FVEQWQG+A SF+RSND    E  RKW+T GL 
Sbjct  268   EELQSADVEDVSLVEDRSFESEAGASPFVEQWQGRAASFMRSNDHASRETERKWNTDGLD  327

Query  1015  EIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFED  1194
                LKLVEGD++++NWWRKLEVVR+L+  N+   + LEAL YSAIYLKWINTGQIPCFED
Sbjct  328   GAALKLVEGDRSARNWWRKLEVVRELLTGNI-GGNCLEALIYSAIYLKWINTGQIPCFED  386

Query  1195  GGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRI  1374
             GGHHRPNRHAEISRLIF ELERI   KD + Q++LVIRKIHPCLPSFK+EFTASVPLTRI
Sbjct  387   GGHHRPNRHAEISRLIFRELERIHYMKDTSPQDVLVIRKIHPCLPSFKSEFTASVPLTRI  446

Query  1375  RDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFK  1554
             RDIAHR DIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE ML RITK PGEYS+AFVEQFK
Sbjct  447   RDIAHRGDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEAMLARITKTPGEYSDAFVEQFK  506

Query  1555  IFHHELKD  1578
             IF++ELKD
Sbjct  507   IFYNELKD  514



>gb|KFK26410.1| hypothetical protein AALP_AA8G245000 [Arabis alpina]
Length=1180

 Score =   497 bits (1280),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 246/392 (63%), Positives = 293/392 (75%), Gaps = 9/392 (2%)
 Frame = +1

Query  418   RGLSSRTIC-AVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELG  594
             R   SR  C A SS  T E ++K   K ++   +KLK+ LDHQV +GEH+A+ GS KE+G
Sbjct  42    RNSHSRLTCTASSSSSTIEDQRK---KDASGTKVKLKVRLDHQVNFGEHVAMFGSAKEIG  98

Query  595   SWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKM  774
             SWKK   ++WTE GWV ++EL GG+ +E+KFVIV  D +L WE+GDNRVL+LP  GSF +
Sbjct  99    SWKKKSPLNWTENGWVCDLELSGGQVLEYKFVIVQNDGSLSWESGDNRVLRLPNSGSFSV  158

Query  775   VCQWNVTDKPLELLPLDSEGEYEAQVLADNGPV----VTKDSTDPDMQVSAFVEQWQGKA  942
             VC WN T + L++ P +   +      +DN  V    V        ++ S    QWQGK 
Sbjct  159   VCHWNATGETLDV-PQEVANDASVHDHSDNTDVGDDRVVGSENGAQLKKSTLAGQWQGKD  217

Query  943   VSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHR  1122
              SF+RSND    E  R WDT+GL    LK+VEGD+NS+NWWRKLE+VR+LIV ++E   R
Sbjct  218   ASFMRSNDHSNREVGRNWDTTGLKGTALKIVEGDQNSKNWWRKLEMVRELIVGSLEREER  277

Query  1123  LEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILV  1302
             L+AL YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF +LE I  +KDAT +E+LV
Sbjct  278   LQALIYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRQLEHICSKKDATAEEVLV  337

Query  1303  IRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVA  1482
              RKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHR AGPEDL+A
Sbjct  338   ARKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRCAGPEDLIA  397

Query  1483  TELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             TE MLERIT+ PG+YS  FVEQFKIFH+ELKD
Sbjct  398   TEAMLERITETPGKYSADFVEQFKIFHNELKD  429



>ref|XP_008799788.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Phoenix dactylifera]
Length=758

 Score =   484 bits (1247),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 241/376 (64%), Positives = 295/376 (78%), Gaps = 9/376 (2%)
 Frame = +1

Query  472   VEKKGKEKRSA---HENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWV  642
             VE+  +EKR A      + +++ LDHQVE+GE +A++GSTKELG WKK V MDWT +GWV
Sbjct  58    VERVEEEKRKASGKRRRVHIRVRLDHQVEFGEQVAVLGSTKELGLWKKQVPMDWTPEGWV  117

Query  643   SEMELKGGEPVEFKFVIVGKD-KNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLP  819
              E+EL GGE +E+KFVI+ K  K ++WE GDNRVLKLP  G F MVC+WN T + ++L  
Sbjct  118   CELELCGGEVLEYKFVILMKGRKGMIWEDGDNRVLKLPEEGMFDMVCRWNKTGEAVDLSG  177

Query  820   LDSEGEYEAQVLADNG---PVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNR  990
               ++G  E ++ ++NG   P         +++ S F EQWQG+A SF+RSN+ +  E  R
Sbjct  178   AATDGVVE-ELDSENGGGAPASEDGGVVSELEPSPFAEQWQGRAASFMRSNEHKSWEAER  236

Query  991   KWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINT  1170
             +WDT GL  + LKLVEGD+ ++NWWRKLEVVR+L++EN++    LEAL YSAIYLKWINT
Sbjct  237   RWDTDGLDGVVLKLVEGDRVARNWWRKLEVVRELLMENIKGDC-LEALIYSAIYLKWINT  295

Query  1171  GQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFT  1350
             GQIPCFEDGGH RPNRHAEISRLIF ELE I   K+ + Q++LVIRKIHPCLPSFK+EFT
Sbjct  296   GQIPCFEDGGHRRPNRHAEISRLIFRELEWIYYGKNTSPQDLLVIRKIHPCLPSFKSEFT  355

Query  1351  ASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYS  1530
             ASVPLTRIRDIAHR+DIPH+LKQEIKHTIQNKLHRNAGPEDL+ATE ML +ITK PGEYS
Sbjct  356   ASVPLTRIRDIAHRSDIPHNLKQEIKHTIQNKLHRNAGPEDLIATEAMLAKITKTPGEYS  415

Query  1531  EAFVEQFKIFHHELKD  1578
             EAF+EQFKIFHHELKD
Sbjct  416   EAFIEQFKIFHHELKD  431



>ref|XP_004497421.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=1212

 Score =   497 bits (1280),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 238/387 (61%), Positives = 297/387 (77%), Gaps = 8/387 (2%)
 Frame = +1

Query  430   SRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN  609
             S T+  +S+  + + + +  +     EN+ L + LDHQV++G+H+A++GSTK+LGSWK N
Sbjct  47    SHTLPLLSAFSSTQTQPRKSKNNIKIENVHLHVRLDHQVQFGDHVALLGSTKQLGSWKTN  106

Query  610   VMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWN  789
             V ++WT+ GWV +++ KGG+ +EFKF+IV  D  ++WE G NR+L LPA G F+ V  WN
Sbjct  107   VPLNWTQNGWVCDLDFKGGDHIEFKFLIVTNDGTVVWEAGQNRLLNLPAAGHFQTVATWN  166

Query  790   VTDKPLELLPLDSEGEYEAQVLADNGPVVTKD----STDPDMQVSAFVEQWQGKAVSFVR  957
              T++ +ELLPL+   E + Q   D+     +D    S+  +   S FV +WQGK++SF+R
Sbjct  167   TTNQIMELLPLN---EQQQQQQQDDNLEHIEDTAASSSHSEAGPSPFVGEWQGKSISFMR  223

Query  958   SNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALT  1137
             +N+ +  E  R WDTS L  +PLKLV+GD+  +NWWRKL++VRD IV NVE   RLEAL 
Sbjct  224   TNEHQSNEAGRTWDTSDLQGLPLKLVQGDQTGRNWWRKLDIVRD-IVGNVEGEDRLEALI  282

Query  1138  YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIH  1317
             Y +IYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF +LER   RKD + QE+LVIRKIH
Sbjct  283   YCSIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRDLERYTSRKDISPQEVLVIRKIH  342

Query  1318  PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELML  1497
             PCLPSFKAEFTASVPLTRIRDIAHRNDIPHD+K +IKHTIQNKLHRNAGPEDLVATE ML
Sbjct  343   PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDVKLQIKHTIQNKLHRNAGPEDLVATEAML  402

Query  1498  ERITKNPGEYSEAFVEQFKIFHHELKD  1578
              +ITKNPGEYSEAFVEQFKIFH ELKD
Sbjct  403   AKITKNPGEYSEAFVEQFKIFHEELKD  429



>ref|NP_198009.3| phosphoglucan, water dikinase [Arabidopsis thaliana]
 sp|Q6ZY51.1|PWD_ARATH RecName: Full=Phosphoglucan, water dikinase, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAG25776.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
 gb|AED93555.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
Length=1196

 Score =   496 bits (1276),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 250/435 (57%), Positives = 308/435 (71%), Gaps = 17/435 (4%)
 Frame = +1

Query  295   AYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREV  474
             + P+  I     +SL       PRL+     +  S  +   R  +SR  C  +S  T  +
Sbjct  10    SSPFTFITRNSSSSL-------PRLVNITHRVNLSHQSHRLRNSNSRLTCTATSSST--I  60

Query  475   EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEME  654
             E++ K+K  +   ++L + LDHQV +G+H+A+ GS KE+GSWKK   ++W+E GWV E+E
Sbjct  61    EEQRKKKDGSGTKVRLNVRLDHQVNFGDHVAMFGSAKEIGSWKKKSPLNWSENGWVCELE  120

Query  655   LKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEG  834
             L GG+ +E+KFVIV  D +L WE+GDNRVLK+P  G+F +VC W+ T + L+L P +   
Sbjct  121   LDGGQVLEYKFVIVKNDGSLSWESGDNRVLKVPNSGNFSVVCHWDATRETLDL-PQEVGN  179

Query  835   EYEAQVLA---DNGPV----VTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRK  993
             + +        DN  V    V        +Q S    QWQGK  SF+RSND    E  R 
Sbjct  180   DDDVGDGGHERDNHDVGDDRVVGSENGAQLQKSTLGGQWQGKDASFMRSNDHGNREVGRN  239

Query  994   WDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTG  1173
             WDTSGL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+AL YSAIYLKWINTG
Sbjct  240   WDTSGLEGTALKMVEGDRNSKNWWRKLEMVREVIVGSVEREERLKALIYSAIYLKWINTG  299

Query  1174  QIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTA  1353
             QIPCFEDGGHHRPNRHAEISRLIF ELE I  +KDAT +E+LV RKIHPCLPSFKAEFTA
Sbjct  300   QIPCFEDGGHHRPNRHAEISRLIFRELEHICSKKDATPEEVLVARKIHPCLPSFKAEFTA  359

Query  1354  SVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSE  1533
             +VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE ML+RIT+ PG+YS 
Sbjct  360   AVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEAMLQRITETPGKYSG  419

Query  1534  AFVEQFKIFHHELKD  1578
              FVEQFKIFH+ELKD
Sbjct  420   DFVEQFKIFHNELKD  434



>ref|XP_010424348.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Camelina sativa]
Length=1126

 Score =   491 bits (1264),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 237/373 (64%), Positives = 286/373 (77%), Gaps = 5/373 (1%)
 Frame = +1

Query  475   EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEME  654
             E++ K+K  +   +KL + LDHQV++GEH+A+ GS KE+GSWKK   ++WT+KGWV E+E
Sbjct  50    EEQRKKKDGSGTKVKLNVRLDHQVQFGEHVAMFGSAKEIGSWKKKSPLNWTDKGWVCEIE  109

Query  655   LKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLEL-LPLDSE  831
             L GG+ +E+KFVIV  D +L WE+GDNRVLKLP  G+F +VC W+ T + L+L   + ++
Sbjct  110   LDGGQVLEYKFVIVKNDGSLSWESGDNRVLKLPNSGNFSVVCHWDATRETLDLPQEVGND  169

Query  832   GEYEAQVLADNGPV----VTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWD  999
                      DN  V    V        +Q S    QWQGK  SF+RSND    E  R WD
Sbjct  170   DGGGGGDERDNHEVSDERVVGSENGGQLQKSTLGGQWQGKDASFMRSNDHGNREVGRNWD  229

Query  1000  TSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQI  1179
             T+GL    L++VEGD+NS+NWWRKLE+VR++IV +VE   RL+AL YSAIYLKWINTGQI
Sbjct  230   TTGLEGTALRMVEGDRNSRNWWRKLEMVREVIVGSVEREERLKALIYSAIYLKWINTGQI  289

Query  1180  PCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASV  1359
             PCFEDGGHHRPNRHAEISRLIF ELE I  +KDAT +E+LV RKIHPCLPSFKAEFTA+V
Sbjct  290   PCFEDGGHHRPNRHAEISRLIFRELEHICSKKDATAEEVLVARKIHPCLPSFKAEFTAAV  349

Query  1360  PLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAF  1539
             PLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE ML+RIT+ PG+YS  F
Sbjct  350   PLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEAMLQRITETPGKYSGDF  409

Query  1540  VEQFKIFHHELKD  1578
             VEQFKIFH+ELKD
Sbjct  410   VEQFKIFHNELKD  422



>gb|AAU93516.1| chloroplast alpha-glucan water dikinase isoform 3 [Arabidopsis 
thaliana]
Length=1196

 Score =   489 bits (1258),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 249/435 (57%), Positives = 306/435 (70%), Gaps = 17/435 (4%)
 Frame = +1

Query  295   AYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREV  474
             + P+  I     +SL       PRL+     +  S  +   R  +SR     +S  T  +
Sbjct  10    SSPFTFITRNSSSSL-------PRLVNITHRVNLSHQSHRLRNSNSRLTRTATSSST--I  60

Query  475   EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEME  654
             E++ K+K  +   ++L + LDHQV +G+H+A+ GS KE+GSWKK   ++W+E GWV E+E
Sbjct  61    EEQRKKKDGSGTKVRLNVRLDHQVNFGDHVAMFGSAKEIGSWKKKSPLNWSENGWVCELE  120

Query  655   LKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEG  834
             L GG+ +E KFVIV  D +L WE+GDNRVLK+P  G+F +VC W+ T + L+L P +   
Sbjct  121   LDGGQVLECKFVIVKNDGSLSWESGDNRVLKVPNSGNFSVVCHWDATRETLDL-PQEVGN  179

Query  835   EYEAQVLA---DNGPV----VTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRK  993
             + +        DN  V    V        +Q S    QWQGK  SF+RSND    E  R 
Sbjct  180   DDDVGDGGHERDNHDVGDDRVVGSENGAQLQKSTLGGQWQGKDASFMRSNDHGNREVGRN  239

Query  994   WDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTG  1173
             WDTSGL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+AL YSAIYLKWINTG
Sbjct  240   WDTSGLEGTALKMVEGDRNSKNWWRKLEMVREVIVGSVEREERLKALIYSAIYLKWINTG  299

Query  1174  QIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTA  1353
             QIPCFEDGGHHRPNRHAEISRLIF ELE I  +KDAT +E+LV RKIHPCLPSFKAEFTA
Sbjct  300   QIPCFEDGGHHRPNRHAEISRLIFRELEHICSKKDATPEEVLVARKIHPCLPSFKAEFTA  359

Query  1354  SVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSE  1533
             +VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE ML+RIT+ PG+YS 
Sbjct  360   AVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEAMLQRITETPGKYSG  419

Query  1534  AFVEQFKIFHHELKD  1578
              FVEQFKIFH+ELKD
Sbjct  420   DFVEQFKIFHNELKD  434



>emb|CDY65142.1| BnaC02g48400D [Brassica napus]
Length=1315

 Score =   491 bits (1264),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 235/384 (61%), Positives = 284/384 (74%), Gaps = 8/384 (2%)
 Frame = +1

Query  427   SSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKK  606
             S R  C+ SS    E          + + +KL + L+HQV++GEH+AI GS +E+GSWK+
Sbjct  41    SRRLTCSASSSTIEEQRMNKDGSGPSRKKVKLNVRLNHQVKFGEHVAIFGSAEEIGSWKE  100

Query  607   NVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQW  786
                + WTE GWV E+ L GG+P+EFKFVI+  D +L WE+GDNRVL LP  G+F +VC W
Sbjct  101   KSPLTWTETGWVCELHLNGGQPLEFKFVIMKTDGSLSWESGDNRVLNLPKSGAFSVVCHW  160

Query  787   NVTDKPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSND  966
             + T + L+++  +  GE E         VV        ++ S    +W+GK  SF+ SN+
Sbjct  161   DATREALDVVSQEEVGEGER--------VVGSSENGAQLRKSTLAGEWKGKEASFMSSNE  212

Query  967   QRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSA  1146
                 E  R WDTSGL    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+AL YSA
Sbjct  213   HGSREVGRSWDTSGLEGPCLKMVEGDRNSRNWWRKLEMVREVIVGSVEREERLKALIYSA  272

Query  1147  IYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCL  1326
             +YLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELE I  +KDAT +E+LV RKIHPCL
Sbjct  273   VYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELENICSKKDATAEEVLVARKIHPCL  332

Query  1327  PSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERI  1506
             PSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE MLERI
Sbjct  333   PSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEAMLERI  392

Query  1507  TKNPGEYSEAFVEQFKIFHHELKD  1578
             T+ PG+YS  FVEQFKIFH+ELKD
Sbjct  393   TETPGKYSGDFVEQFKIFHNELKD  416



>ref|XP_006286926.1| hypothetical protein CARUB_v10000070mg [Capsella rubella]
 gb|EOA19824.1| hypothetical protein CARUB_v10000070mg [Capsella rubella]
Length=1195

 Score =   488 bits (1256),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 243/391 (62%), Positives = 291/391 (74%), Gaps = 6/391 (2%)
 Frame = +1

Query  418   RGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  597
             R  SSR  C+ +S  +   E++ KE  S  + +KL + LDHQV +GEH+A+ GS KE+GS
Sbjct  45    RNSSSRLTCSAASSSSTIEEQRKKEDGSGTK-VKLNVRLDHQVNFGEHVAMFGSAKEIGS  103

Query  598   WKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  777
             WKK   ++WTE GWV E+ L GG+ +E+KFVIV  D +L WE+GDNRVLKLP  G+F +V
Sbjct  104   WKKKSPLNWTENGWVCELNLDGGQVLEYKFVIVKDDGSLSWESGDNRVLKLPNSGNFSVV  163

Query  778   CQWNVT----DKPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAV  945
             C W+ T    D P E+   D  GE        +  VV  ++    +Q S    QWQGK  
Sbjct  164   CHWDATRETLDLPHEVGGNDGGGEERGNHDVGDERVVGSEN-GAQLQKSTLGGQWQGKDA  222

Query  946   SFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRL  1125
             SF+RSND    E  R W+T+GL    LK+VEGD+NS+NWWRKLE+VR++IV  VE   +L
Sbjct  223   SFMRSNDHGNREVGRNWNTTGLEGTALKMVEGDRNSKNWWRKLEMVREVIVGTVEREEKL  282

Query  1126  EALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVI  1305
             +AL YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELE I  +KDA+ +E+LV 
Sbjct  283   KALIYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELEHICSKKDASAEEVLVA  342

Query  1306  RKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVAT  1485
             RKIHPCLPSFKAEFTA+VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+AT
Sbjct  343   RKIHPCLPSFKAEFTAAVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIAT  402

Query  1486  ELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             E ML RIT+ PG+YS  FVEQFKIFH+ELKD
Sbjct  403   EAMLLRITETPGKYSGDFVEQFKIFHNELKD  433



>ref|XP_009111699.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Brassica 
rapa]
Length=1184

 Score =   484 bits (1247),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 236/381 (62%), Positives = 290/381 (76%), Gaps = 5/381 (1%)
 Frame = +1

Query  436   TICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVM  615
             T C+ +S  T  +E++ K +  +   ++L + LD QV++GEH+A+ GS KE+GSWK+   
Sbjct  51    TCCSSASSST--IEEQRKNRDGSGPKVRLNVRLDRQVKFGEHVAVFGSAKEIGSWKEKSP  108

Query  616   MDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVT  795
             + W+EKGWV E+EL GGE +EFKFV+V KD +L WE+GDNRVLKLP  GSF +VC W+ T
Sbjct  109   LAWSEKGWVCELELSGGEALEFKFVVVKKDGSLSWESGDNRVLKLPKSGSFSVVCHWDAT  168

Query  796   DKPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRG  975
              + L+L  +D +G  E     D+  V   D+    ++ S    QWQGK  SF+RSN+   
Sbjct  169   GETLDLPLVDDDGGGEES--GDSHDVGGGDN-GAQLRKSTLGGQWQGKDASFMRSNEHGN  225

Query  976   MEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYL  1155
              E  R WD SGL    LK+VEGD++S+NW +KLE+V ++IV +VE   RL+AL YSA+YL
Sbjct  226   REVGRNWDASGLKGSALKMVEGDRSSRNWRKKLELVSEVIVGSVEREERLKALIYSAVYL  285

Query  1156  KWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSF  1335
             KWINTGQIPCFEDGGHHRPN HAEISRLIF ELE I  +KDAT +E+LV RKIHPCLPSF
Sbjct  286   KWINTGQIPCFEDGGHHRPNHHAEISRLIFRELENICSKKDATAEEVLVARKIHPCLPSF  345

Query  1336  KAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKN  1515
             KAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE MLERIT+ 
Sbjct  346   KAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEAMLERITET  405

Query  1516  PGEYSEAFVEQFKIFHHELKD  1578
             PG+YS  FVEQF+IFH+ELKD
Sbjct  406   PGKYSGDFVEQFRIFHNELKD  426



>gb|KHN37254.1| Phosphoglucan, water dikinase, chloroplastic [Glycine soja]
Length=1179

 Score =   484 bits (1246),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 238/391 (61%), Positives = 292/391 (75%), Gaps = 20/391 (5%)
 Frame = +1

Query  439   ICAVSS---VETR-----EVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELG  594
             I AVSS    +TR     E E++  + +S    ++L++ LDHQV++G+H+ I GSTKELG
Sbjct  52    ISAVSSSPQTQTRDDQDQEHEQEQGKNKSLKNKVRLQVRLDHQVQFGDHVVIRGSTKELG  111

Query  595   SWKKNVMMDWTEKGWVSEMELKGGEP---VEFKFVIVGKDKNLLWETGDNRVLKLPAGGS  765
             SW  +V ++WT+ GWV ++E + G+    +EFKFV V KD  L+WE G+NRVLK+P  G+
Sbjct  112   SWTNSVPLNWTQNGWVCDLEFEQGQGTLHIEFKFVTVNKDDTLVWEAGENRVLKVPGAGN  171

Query  766   FKMVCQWNVTDKPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAV  945
             F  V  W+ T + LEL  LD + + +    AD    V++    P      FV QWQGK +
Sbjct  172   FATVATWDATQETLELHSLDDDEQVQD---ADINESVSESEASP------FVGQWQGKPI  222

Query  946   SFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRL  1125
             SF+RSN+ R  E  RKWDTSGL  +PLK V+ D++++NWWRKL++VRD+I  +++   RL
Sbjct  223   SFMRSNEHRSHETERKWDTSGLQGLPLKFVQADQSARNWWRKLDIVRDIIAGSLQGEDRL  282

Query  1126  EALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVI  1305
             EAL YSAIYLKWINTGQI CFEDGGHHRPNRHAEISRLIF ELER   RKD + QE+LVI
Sbjct  283   EALLYSAIYLKWINTGQISCFEDGGHHRPNRHAEISRLIFRELERHTSRKDISPQEVLVI  342

Query  1306  RKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVAT  1485
             RKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLK +IKHTIQNKLHRNAGPEDLVAT
Sbjct  343   RKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKLQIKHTIQNKLHRNAGPEDLVAT  402

Query  1486  ELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             E ML +ITKNP EYSE FV++FKIFH ELKD
Sbjct  403   EAMLAKITKNPAEYSEPFVKEFKIFHQELKD  433



>ref|XP_009129923.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Brassica rapa]
Length=1156

 Score =   483 bits (1244),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 246/430 (57%), Positives = 304/430 (71%), Gaps = 26/430 (6%)
 Frame = +1

Query  292   YAYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETRE  471
             Y  P+  I   R +SL +L    PR I           +  ++  S R +   +S  T E
Sbjct  9     YTSPFASI--TRNSSLPRLLHFTPRAI-----------HIRSQSDSRRLLTCSASSSTIE  55

Query  472   VEKKGKEKRS-AHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSE  648
               +K K+    + + +KL + L+HQV++GEH+AI GS +E+GSWK+   + WTE GWV E
Sbjct  56    EHRKNKDGSGPSRKKVKLNVRLNHQVKFGEHVAIFGSAEEIGSWKEKSPLTWTETGWVCE  115

Query  649   MELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDS  828
             + L G + +EFKFVIV  D +L WE+GDNRVL LP  G+F +VC W+ T + L+++   S
Sbjct  116   LHLNGDQALEFKFVIVKTDGSLSWESGDNRVLNLPKSGAFSVVCHWDATREALDVV---S  172

Query  829   EGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSG  1008
             + E      ++NG  + K         SA   +W+GK  SF+ SN+    E  R WDTSG
Sbjct  173   QEEVGEGESSENGAQLRK---------SALAGEWKGKEASFMSSNEHGDREVGRSWDTSG  223

Query  1009  LAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCF  1188
             L    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+AL YSA+YLKWINTGQIPCF
Sbjct  224   LEGPGLKMVEGDRNSRNWWRKLEMVREVIVGSVEREERLKALIYSAVYLKWINTGQIPCF  283

Query  1189  EDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLT  1368
             EDGGHHRPNRHAEISRLIF ELE I  +KDAT +E+LV RKIHPCLPSFKAEFTASVPLT
Sbjct  284   EDGGHHRPNRHAEISRLIFRELENICSKKDATAEEVLVARKIHPCLPSFKAEFTASVPLT  343

Query  1369  RIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQ  1548
             RIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE MLERIT+ PG+YS  FVEQ
Sbjct  344   RIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEAMLERITETPGKYSGDFVEQ  403

Query  1549  FKIFHHELKD  1578
             FKIFH+ELKD
Sbjct  404   FKIFHNELKD  413



>ref|XP_006589801.1| PREDICTED: LOW QUALITY PROTEIN: phosphoglucan, water dikinase, 
chloroplastic-like [Glycine max]
Length=1186

 Score =   482 bits (1241),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 232/368 (63%), Positives = 280/368 (76%), Gaps = 13/368 (4%)
 Frame = +1

Query  484   GKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKG  663
             GK K S    ++L++ LDHQV++G+H+ I GSTKELGSW  +V ++WT+ GWV ++E + 
Sbjct  78    GKNK-SLKNKVRLQVRLDHQVQFGDHVVIRGSTKELGSWTNSVPLNWTQNGWVCDLEFEQ  136

Query  664   GEP---VEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEG  834
             G+    +EFKFV V KD  L+WE G+NRVLK+P  G+F  V  W+ T + LEL  LD + 
Sbjct  137   GQGTLHIEFKFVTVNKDDTLVWEAGENRVLKVPGAGNFATVATWDATQETLELHSLDDDE  196

Query  835   EYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLA  1014
             + +    AD    V++    P      FV QWQGK +SF+RSN+ R  E  RKWDTSGL 
Sbjct  197   QVQD---ADINESVSESEASP------FVGQWQGKPISFMRSNEHRSHETERKWDTSGLQ  247

Query  1015  EIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFED  1194
              +PLK V+ D++++NWWRKL++VRD+I  +++   RLEAL YSAIYLKWINTGQI CFED
Sbjct  248   GLPLKFVQADQSARNWWRKLDIVRDIIAGSLQGEDRLEALLYSAIYLKWINTGQISCFED  307

Query  1195  GGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRI  1374
             GGHHRPNRHAEISRLIF ELER   RKD + QE+LVIRKIHPCLPSFKAEFTASVPLTRI
Sbjct  308   GGHHRPNRHAEISRLIFRELERHTSRKDISPQEVLVIRKIHPCLPSFKAEFTASVPLTRI  367

Query  1375  RDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFK  1554
             RDIAHRNDIPHDLK  IKHTIQNKLHRNAGPEDLVATE ML RIT+NP EYSE FV++FK
Sbjct  368   RDIAHRNDIPHDLKXRIKHTIQNKLHRNAGPEDLVATEAMLARITRNPAEYSEPFVKEFK  427

Query  1555  IFHHELKD  1578
             IFH ELKD
Sbjct  428   IFHQELKD  435



>emb|CDY19771.1| BnaA09g04240D [Brassica napus]
Length=1179

 Score =   482 bits (1240),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 235/381 (62%), Positives = 290/381 (76%), Gaps = 5/381 (1%)
 Frame = +1

Query  436   TICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVM  615
             T C+ +S  T  +E++ K +  +   ++L + LD QV++GEH+A+ GS KE+GSWK+   
Sbjct  51    TCCSSASSST--IEEQRKNRDGSGPKVRLNVRLDRQVKFGEHVAVFGSAKEIGSWKEKSP  108

Query  616   MDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVT  795
             + W+EKGWV E+EL GGE +EFKFV+V KD +L WE+GDNRVLKLP  GSF +VC W+ T
Sbjct  109   LAWSEKGWVCELELNGGEALEFKFVVVKKDGSLSWESGDNRVLKLPKSGSFSVVCHWDAT  168

Query  796   DKPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRG  975
              + L+L  +  +G  E    +D+  V   D+    ++ S    QWQGK  SF+RSN+   
Sbjct  169   GETLDLPLVGDDGGGEES--SDSHDVGGGDN-GAQLRKSTLGGQWQGKDASFMRSNEHGN  225

Query  976   MEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYL  1155
              E  R WD SGL    LK+VEGD++S+NW +KLE+V ++IV +VE   RL+AL YSA+YL
Sbjct  226   REVGRNWDASGLEGSALKMVEGDRSSRNWRKKLELVSEVIVGSVEREERLKALIYSAVYL  285

Query  1156  KWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSF  1335
             KWINTGQIPCFEDGGHHRPN HAEISRLIF ELE I  +KDAT +E+LV RKIHPCLPSF
Sbjct  286   KWINTGQIPCFEDGGHHRPNHHAEISRLIFRELENICSKKDATAEEVLVARKIHPCLPSF  345

Query  1336  KAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKN  1515
             KAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE MLERIT+ 
Sbjct  346   KAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEAMLERITET  405

Query  1516  PGEYSEAFVEQFKIFHHELKD  1578
             PG+YS  FVEQF+IFH+ELKD
Sbjct  406   PGKYSGDFVEQFRIFHNELKD  426



>emb|CDX87051.1| BnaC09g03660D [Brassica napus]
Length=1182

 Score =   481 bits (1237),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 236/375 (63%), Positives = 283/375 (75%), Gaps = 16/375 (4%)
 Frame = +1

Query  472   VEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEM  651
             +E++ K +  +   +KL + LD QV++GEH+A+ GS KE+G WK+   + W+EKGWV E+
Sbjct  65    IEEQRKNRDGSGGKVKLNVRLDRQVKFGEHVAMFGSAKEIGCWKEKSPLAWSEKGWVCEL  124

Query  652   ELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPL---  822
             EL GGE +EFKFV+V KD +L WE+GDNRVLKLP  GSF +VC W+ T + L+L PL   
Sbjct  125   ELSGGEALEFKFVVVKKDGSLSWESGDNRVLKLPDSGSFSVVCHWDATGEALDL-PLVDD  183

Query  823   DSEGEYEAQ---VLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRK  993
             D+ GE       V  DNG  + K         S    QWQGK  SF+RSN+    E  R 
Sbjct  184   DAGGEESGDSYDVGGDNGVQLRK---------STLGGQWQGKDASFMRSNEHGSREVGRN  234

Query  994   WDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTG  1173
             WD SGL    LK+VEGD++S+NW +KLE+V ++IV +VE   RL+AL YSA+YLKWINTG
Sbjct  235   WDASGLEGSALKMVEGDRSSRNWRKKLELVSEVIVGSVEREERLKALIYSAVYLKWINTG  294

Query  1174  QIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTA  1353
             QIPCFEDGGHHRPN HAEISRLIF ELE I  +KDAT +E+LV RKIHPCLPSFKAEFTA
Sbjct  295   QIPCFEDGGHHRPNHHAEISRLIFRELENICSKKDATAEEVLVARKIHPCLPSFKAEFTA  354

Query  1354  SVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSE  1533
             SVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE MLERIT+ PG+YS 
Sbjct  355   SVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEAMLERITETPGKYSG  414

Query  1534  AFVEQFKIFHHELKD  1578
              FVEQF+IFH+ELKD
Sbjct  415   DFVEQFRIFHNELKD  429



>ref|XP_008454006.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Cucumis melo]
Length=1237

 Score =   481 bits (1237),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 244/426 (57%), Positives = 303/426 (71%), Gaps = 42/426 (10%)
 Frame = +1

Query  427   SSRTICAVSSVETREV----EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELG  594
             S R +C VSS     +    E+    K  +   + LK+ LDHQV++GE + I+GS++ELG
Sbjct  55    SRRIVCGVSSASQETIREDEEQMMTGKLGSGGKVLLKVRLDHQVQFGESVVILGSSEELG  114

Query  595   SWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKM  774
             SWK   +++W++ GWV ++E +G E VEFKFVI+GKD ++LWE+GDNRVL+LP  G F +
Sbjct  115   SWKNYTLLNWSKDGWVCDLEHRGDERVEFKFVILGKDGSVLWESGDNRVLQLPKVGKFSL  174

Query  775   VCQWNVTDKPLELLPL---------------------------DSEG---EYEAQVLADN  864
             V +WN T + +++LPL                           D+EG   E  A +  +N
Sbjct  175   VYKWNKTGEAVDMLPLKVEEINGDGTLPLDAKAIGERNETLPLDAEGVNKEVGASLFDEN  234

Query  865   ----GPVVTKDSTDPDM----QVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEI  1020
                 G    KD  D +     + S FV QW+GK +SF+RSN+    E  R W+TS L  +
Sbjct  235   EINEGDEKNKDVEDGNGSLVDEASPFVGQWKGKEISFMRSNEHHNRESERIWNTSDLKGL  294

Query  1021  PLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGG  1200
              L+LVEGDKN++NW RKL+VVR+L+VENV + + LE+L YSAIYLKWINTGQIPCFEDGG
Sbjct  295   ALQLVEGDKNARNWRRKLDVVRELLVENVHAENCLESLIYSAIYLKWINTGQIPCFEDGG  354

Query  1201  HHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRD  1380
             HHRPNRHAEISR+IF ELER+  +KD + Q  L+IRKIHPCLPSFK+EFTASVPLTRIRD
Sbjct  355   HHRPNRHAEISRIIFRELERLSSKKDISPQVALIIRKIHPCLPSFKSEFTASVPLTRIRD  414

Query  1381  IAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIF  1560
             IAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE ML RITKNPGEYSEAFVEQFKIF
Sbjct  415   IAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEAMLTRITKNPGEYSEAFVEQFKIF  474

Query  1561  HHELKD  1578
             + ELKD
Sbjct  475   YQELKD  480



>gb|KEH27294.1| phosphoglucan, water dikinase [Medicago truncatula]
Length=1202

 Score =   479 bits (1234),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 233/391 (60%), Positives = 288/391 (74%), Gaps = 12/391 (3%)
 Frame = +1

Query  436   TICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVM  615
             ++ A SS +T+        K+    N+ L + LDHQV++G+H+ ++GSTK+LGSW  +V 
Sbjct  63    SVAASSSTQTQP-RNNTNNKKEEDINVHLHLRLDHQVQFGDHVVLLGSTKQLGSWTTHVP  121

Query  616   MDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVT  795
             ++WT  GWV +     G+ +EFKF+IV +D  L WE+GDNRVL LP  G F+ + +WN T
Sbjct  122   LNWTPNGWVCDFHFNAGDHLEFKFIIVHQDGTLHWESGDNRVLNLPNAGHFQTIAKWNKT  181

Query  796   DKPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQVSA----------FVEQWQGKAV  945
              + +ELLPL+   + + Q    +      D  + +   SA          FV +WQGK+V
Sbjct  182   HQTMELLPLNFNEQQQHQSHDHDQNNNNNDDDEKEAAASAPLSDAAGPSPFVGEWQGKSV  241

Query  946   SFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRL  1125
             SF+RSND +  E  R WDTSG+  +PLK V+GD++++NWWRKL++VRD IV +V    +L
Sbjct  242   SFMRSNDHQTHETQRTWDTSGIQGLPLKFVQGDQSARNWWRKLDLVRD-IVGSVHGEDQL  300

Query  1126  EALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVI  1305
             EAL YS+IYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF ELE+   RKD + QE+LVI
Sbjct  301   EALIYSSIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFRELEQHTSRKDISPQEVLVI  360

Query  1306  RKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVAT  1485
             RKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLK +IKHTIQNKLHRNAGPEDLVAT
Sbjct  361   RKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKTQIKHTIQNKLHRNAGPEDLVAT  420

Query  1486  ELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             E ML +ITKNPGEYSE FVEQFKIFH ELKD
Sbjct  421   EAMLAKITKNPGEYSETFVEQFKIFHRELKD  451



>ref|XP_011653043.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Cucumis sativus]
 gb|KGN53052.1| hypothetical protein Csa_4G012480 [Cucumis sativus]
Length=1241

 Score =   478 bits (1231),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 241/424 (57%), Positives = 299/424 (71%), Gaps = 42/424 (10%)
 Frame = +1

Query  433   RTICAVSSVETREV----EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  600
             R +C VSS     +    E+K   K  +   + LK+ L HQVE+GE + I+GS++ELGSW
Sbjct  57    RIVCGVSSASQETIREDEEQKMTGKLGSGGKVLLKLRLAHQVEFGESVVILGSSEELGSW  116

Query  601   KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVC  780
             K   +++W++ GWV ++E +G E VEFKFVI+GKD ++ WE+GDNRVL+LP  G F +  
Sbjct  117   KNYTLLNWSKDGWVCDLEHRGDERVEFKFVILGKDGSVSWESGDNRVLQLPKVGKFSLAY  176

Query  781   QWNVTDKPLELLPL---------------------------DSEG--EYEAQVLADNGPV  873
             QWN T + +E+LPL                           D+EG  +    +L D   +
Sbjct  177   QWNKTGEVVEMLPLKLEEINGDGTLPLDAKAIEERNETLPLDAEGVDKGVGALLFDVNEI  236

Query  874   VTKDSTDPDMQ---------VSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPL  1026
                D  D D++          S FV QW+GK +SF+RSN+    E  R W+TS L  + L
Sbjct  237   NEGDEKDKDVEDGNGSLVDEASPFVGQWKGKEISFMRSNEHHSRESERVWNTSDLKGLAL  296

Query  1027  KLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHH  1206
             +LVEGDKN++NW RKL+VVR+L+VENV + + LE+L YSAIYLKWINTGQIPCFEDGGHH
Sbjct  297   QLVEGDKNARNWRRKLDVVRELLVENVHAENCLESLIYSAIYLKWINTGQIPCFEDGGHH  356

Query  1207  RPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIA  1386
             RPNRHAEISR+IF ELER+  +KD + Q  L++RKIHPCLPSFK+EFTASVPLTRIRDIA
Sbjct  357   RPNRHAEISRIIFRELERLSSKKDISPQVALIVRKIHPCLPSFKSEFTASVPLTRIRDIA  416

Query  1387  HRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHH  1566
             HRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE ML RITKNPGEYSEAFVEQFKIF+ 
Sbjct  417   HRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEAMLTRITKNPGEYSEAFVEQFKIFYQ  476

Query  1567  ELKD  1578
             ELKD
Sbjct  477   ELKD  480



>emb|CDY05529.1| BnaA02g31620D [Brassica napus]
Length=1312

 Score =   479 bits (1234),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 245/430 (57%), Positives = 303/430 (70%), Gaps = 26/430 (6%)
 Frame = +1

Query  292   YAYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETRE  471
             Y  P+  I   R +SL +L    PR I           +  ++  S R +   +S  T E
Sbjct  9     YTSPFASI--TRNSSLPRLLHFTPRAI-----------HIRSQSDSRRLLTCSASSSTIE  55

Query  472   VEKKGKEKRS-AHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSE  648
               +K K+    + + +KL + L+HQV++GEH+AI GS +E+GSWK+   + WTE GWV E
Sbjct  56    EHRKNKDGSGPSRKKVKLNVRLNHQVKFGEHVAIFGSAEEIGSWKEKSPLTWTETGWVCE  115

Query  649   MELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDS  828
             + L G + +EFKFVIV  D +L WE+GDNRVL LP  G+F +VC W+ T + L+++   S
Sbjct  116   LHLNGDQALEFKFVIVKTDGSLSWESGDNRVLNLPKSGAFSVVCHWDATREALDVV---S  172

Query  829   EGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSG  1008
             + E      ++NG  + K         SA   +W+GK  SF+ SN+    E  R WDTSG
Sbjct  173   QEEVGEGESSENGAQLRK---------SALAGEWKGKEASFMSSNEHGDREVGRSWDTSG  223

Query  1009  LAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCF  1188
             L    LK+VEGD+NS+NWWRKLE+VR++IV +VE   RL+AL YSA+YLKWINTGQIPCF
Sbjct  224   LEGPGLKMVEGDRNSRNWWRKLEMVREVIVGSVEREERLKALIYSAVYLKWINTGQIPCF  283

Query  1189  EDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLT  1368
             EDGGHHRPNRHAEISRLIF ELE I  +KDAT +E+LV RKIH CLPSFKAEFTASVPLT
Sbjct  284   EDGGHHRPNRHAEISRLIFRELENICSKKDATAEEVLVARKIHLCLPSFKAEFTASVPLT  343

Query  1369  RIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQ  1548
             RIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE MLERIT+ PG+YS  FVEQ
Sbjct  344   RIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEAMLERITETPGKYSGDFVEQ  403

Query  1549  FKIFHHELKD  1578
             FKIFH+ELKD
Sbjct  404   FKIFHNELKD  413



>ref|XP_008454007.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Cucumis melo]
Length=1161

 Score =   476 bits (1224),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 236/391 (60%), Positives = 290/391 (74%), Gaps = 38/391 (10%)
 Frame = +1

Query  520   LKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVG  699
             LK+ LDHQV++GE + I+GS++ELGSWK   +++W++ GWV ++E +G E VEFKFVI+G
Sbjct  14    LKVRLDHQVQFGESVVILGSSEELGSWKNYTLLNWSKDGWVCDLEHRGDERVEFKFVILG  73

Query  700   KDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPL-------------------  822
             KD ++LWE+GDNRVL+LP  G F +V +WN T + +++LPL                   
Sbjct  74    KDGSVLWESGDNRVLQLPKVGKFSLVYKWNKTGEAVDMLPLKVEEINGDGTLPLDAKAIG  133

Query  823   --------DSEG---EYEAQVLADN----GPVVTKDSTDPDM----QVSAFVEQWQGKAV  945
                     D+EG   E  A +  +N    G    KD  D +     + S FV QW+GK +
Sbjct  134   ERNETLPLDAEGVNKEVGASLFDENEINEGDEKNKDVEDGNGSLVDEASPFVGQWKGKEI  193

Query  946   SFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRL  1125
             SF+RSN+    E  R W+TS L  + L+LVEGDKN++NW RKL+VVR+L+VENV + + L
Sbjct  194   SFMRSNEHHNRESERIWNTSDLKGLALQLVEGDKNARNWRRKLDVVRELLVENVHAENCL  253

Query  1126  EALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVI  1305
             E+L YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISR+IF ELER+  +KD + Q  L+I
Sbjct  254   ESLIYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRIIFRELERLSSKKDISPQVALII  313

Query  1306  RKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVAT  1485
             RKIHPCLPSFK+EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+AT
Sbjct  314   RKIHPCLPSFKSEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIAT  373

Query  1486  ELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             E ML RITKNPGEYSEAFVEQFKIF+ ELKD
Sbjct  374   EAMLTRITKNPGEYSEAFVEQFKIFYQELKD  404



>ref|XP_011653044.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Cucumis sativus]
Length=1177

 Score =   473 bits (1217),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 236/406 (58%), Positives = 292/406 (72%), Gaps = 38/406 (9%)
 Frame = +1

Query  475   EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEME  654
             E+K   K  +   + LK+ L HQVE+GE + I+GS++ELGSWK   +++W++ GWV ++E
Sbjct  11    EQKMTGKLGSGGKVLLKLRLAHQVEFGESVVILGSSEELGSWKNYTLLNWSKDGWVCDLE  70

Query  655   LKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPL----  822
              +G E VEFKFVI+GKD ++ WE+GDNRVL+LP  G F +  QWN T + +E+LPL    
Sbjct  71    HRGDERVEFKFVILGKDGSVSWESGDNRVLQLPKVGKFSLAYQWNKTGEVVEMLPLKLEE  130

Query  823   -----------------------DSEG--EYEAQVLADNGPVVTKDSTDPDMQ-------  906
                                    D+EG  +    +L D   +   D  D D++       
Sbjct  131   INGDGTLPLDAKAIEERNETLPLDAEGVDKGVGALLFDVNEINEGDEKDKDVEDGNGSLV  190

Query  907   --VSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEV  1080
                S FV QW+GK +SF+RSN+    E  R W+TS L  + L+LVEGDKN++NW RKL+V
Sbjct  191   DEASPFVGQWKGKEISFMRSNEHHSRESERVWNTSDLKGLALQLVEGDKNARNWRRKLDV  250

Query  1081  VRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELER  1260
             VR+L+VENV + + LE+L YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISR+IF ELER
Sbjct  251   VRELLVENVHAENCLESLIYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRIIFRELER  310

Query  1261  ILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQ  1440
             +  +KD + Q  L++RKIHPCLPSFK+EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQ
Sbjct  311   LSSKKDISPQVALIVRKIHPCLPSFKSEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQ  370

Query  1441  NKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             NKLHRNAGPEDL+ATE ML RITKNPGEYSEAFVEQFKIF+ ELKD
Sbjct  371   NKLHRNAGPEDLIATEAMLTRITKNPGEYSEAFVEQFKIFYQELKD  416



>ref|XP_004952076.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Setaria italica]
Length=1206

 Score =   473 bits (1218),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 233/401 (58%), Positives = 293/401 (73%), Gaps = 17/401 (4%)
 Frame = +1

Query  418   RGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  597
             RG S R   A S+ +     K+ K  + + + ++L++ LDHQV++GEH+ I+GSTKE+GS
Sbjct  47    RGFSCRAGSAASAAQRT---KEKKRTKPSKDRVQLRVCLDHQVKFGEHVGIIGSTKEVGS  103

Query  598   WKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKD-KNLLWETGDNRVLKLPAGGSFKM  774
             WK  V M+WT  GWV +++L G   +EFKFVI  K+ K  +WE GDNRV+ LP  G+F +
Sbjct  104   WKSQVEMEWTPDGWVCQLDLPGETLMEFKFVIFLKEGKEKVWEDGDNRVVNLPKDGAFDI  163

Query  775   VCQWNVTDKPLELL------PLDSEGEYE-AQVLADNGPVVTKDSTDPDMQVSAFVEQ--  927
             +C WN T + L+LL       L  E + E  +    +G +  +++   D  ++  +E   
Sbjct  164   LCHWNRTKESLDLLLGTPEVKLSGEADEEIGEGATVSGNIAVEEAVAGDGYLTLELESSK  223

Query  928   ----WQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLI  1095
                 WQG    F+RSN+    +  RKWDT+GL  +PL+LVEGDK S+NWWRKLE++R L+
Sbjct  224   LGGLWQGSDAVFMRSNEHGNKDSERKWDTTGLGAVPLQLVEGDKVSRNWWRKLELIRGLL  283

Query  1096  VENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRK  1275
              ++V+   RLEALTYSAIYLKWI TGQIPCFEDGGHHRPN+HAEISR IF E+ERI   K
Sbjct  284   SKSVDDQSRLEALTYSAIYLKWIYTGQIPCFEDGGHHRPNKHAEISREIFREIERIYYGK  343

Query  1276  DATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHR  1455
             + + Q++LVIRKIHPCLPSFK+EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHR
Sbjct  344   NTSAQDLLVIRKIHPCLPSFKSEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHR  403

Query  1456  NAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             NAGPEDL+ATE ML RITK PGEYSEAFVEQFKIF+ ELKD
Sbjct  404   NAGPEDLIATEAMLARITKTPGEYSEAFVEQFKIFYSELKD  444



>gb|ABG21981.1| chloroplast alpha-glucan water dikinase isoform 3, putative, 
expressed [Oryza sativa Japonica Group]
Length=728

 Score =   459 bits (1182),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 242/430 (56%), Positives = 294/430 (68%), Gaps = 30/430 (7%)
 Frame = +1

Query  367   LILEPQGIPGSIMNR-------PTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLK  525
             L+L P G+   ++ R         RG + R   A S+ E R  EKK ++  S    + L+
Sbjct  21    LVLPPPGVGAGVLLRRGAMALPGRRGFACRGRSAASAAE-RTKEKKRRDS-SKQPLVHLQ  78

Query  526   IWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIV---  696
             + L+HQV++GEH+ I+GSTKELGSW++ V ++WT  GWV +++L G   VEFKFVI    
Sbjct  79    VCLEHQVKFGEHVGIIGSTKELGSWEEQVELEWTTNGWVCQLKLPGETLVEFKFVIFLVG  138

Query  697   GKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELL---PLDSEGEYEAQVLADNG  867
             GKDK  +WE G+NRV++LP  G F +VC WN T++PLELL     +  GE E     D  
Sbjct  139   GKDK--IWEDGNNRVVELPKDGKFDIVCHWNRTEEPLELLGTPKFELVGEAEKNTGEDAS  196

Query  868   PVVT-------------KDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSG  1008
               VT                  P+ + S F  QWQG    F+RSN+    E +R WDT+G
Sbjct  197   ASVTFAPEKVQDISVVENGDPAPEAESSKFGGQWQGSKTVFMRSNEHLNKEADRMWDTTG  256

Query  1009  LAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCF  1188
             L  I LKLVEGDK S+NWWRKLEVVR ++ E+ +   RL AL YSAIYLKWI TGQI CF
Sbjct  257   LDGIALKLVEGDKASRNWWRKLEVVRGILSESFDDQSRLGALVYSAIYLKWIYTGQISCF  316

Query  1189  EDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLT  1368
             EDGGHHRPN+HAEISR IF ELE +   K  + +++LVIRKIHP LPSFK+EFTASVPLT
Sbjct  317   EDGGHHRPNKHAEISRQIFRELEMMYYGKTTSAKDVLVIRKIHPFLPSFKSEFTASVPLT  376

Query  1369  RIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQ  1548
             RIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE+ML RITK PGEYSE FVEQ
Sbjct  377   RIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEVMLARITKTPGEYSETFVEQ  436

Query  1549  FKIFHHELKD  1578
             F IF+ ELKD
Sbjct  437   FTIFYSELKD  446



>ref|XP_002453659.1| hypothetical protein SORBIDRAFT_04g010020 [Sorghum bicolor]
 gb|EES06635.1| hypothetical protein SORBIDRAFT_04g010020 [Sorghum bicolor]
Length=1212

 Score =   469 bits (1207),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 238/404 (59%), Positives = 283/404 (70%), Gaps = 24/404 (6%)
 Frame = +1

Query  433   RTICAVSSVETREVEKKGKEKR---SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK  603
             RT     +  T+ + +  +EK+   S  + ++L + LDHQV +GEH+ I+GS KELGSWK
Sbjct  53    RTRGTGVAASTKHITRTKEEKQTDPSKQDIVRLHVCLDHQVMFGEHVGIIGSAKELGSWK  112

Query  604   KNVMMDWTEKGWVSEMELKGGEPVEFKFVIV---GKDKNLLWETGDNRVLKLPAGGSFKM  774
               V MDWT  GWV +++L G   +EFKFV+    GKDK  +WE GDNRV+ LP  GSF M
Sbjct  113   SPVEMDWTPNGWVCQLDLPGETLLEFKFVVFLNRGKDK--IWEDGDNRVVNLPKNGSFDM  170

Query  775   VCQWNVTDKPLELLPL-------DSEGEYEAQV-------LADNGPVVTKDSTD--PDMQ  906
              C WN T +PL LL         D+E E +          L + G +      D  P ++
Sbjct  171   ACHWNKTKEPLNLLGTSEIKLSGDTEKEKDEDAKLSRNIALEEMGNISNAGDGDLTPKLE  230

Query  907   VSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVR  1086
              S     WQG    F+RSN+ R  E +RKWD +GL  + LKLVEGDK S+NWWRKLE+VR
Sbjct  231   SSTLGGLWQGSDTVFMRSNEHRNNESDRKWDMTGLDAVSLKLVEGDKASRNWWRKLELVR  290

Query  1087  DLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERIL  1266
              L+ E V     LEALTYSAIYLKWI TGQIPCFEDGGHHRPN+HAEISR IF E+ERI 
Sbjct  291   GLVSEYVHDQSHLEALTYSAIYLKWIYTGQIPCFEDGGHHRPNKHAEISRQIFREIERIY  350

Query  1267  GRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNK  1446
               ++ + Q++LVIRKIHPCLPSFK+EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNK
Sbjct  351   YGENTSAQDLLVIRKIHPCLPSFKSEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNK  410

Query  1447  LHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             LHRNAGPEDL+ATE ML RITK PGEYSEAFVEQFK F+ ELKD
Sbjct  411   LHRNAGPEDLIATEAMLARITKTPGEYSEAFVEQFKTFYSELKD  454



>ref|XP_006663965.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Oryza brachyantha]
Length=1206

 Score =   465 bits (1197),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 239/431 (55%), Positives = 300/431 (70%), Gaps = 34/431 (8%)
 Frame = +1

Query  367   LILEPQGIPGSIMNRPT------RGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKI  528
             L+  P+ + G++  R        RG S R   A S+ E   +++K +   S    + L++
Sbjct  23    LLPPPRVVAGAMFRREAIALPGRRGFSCRGGSAASAAE--RIKEKQRGDSSKKPLVHLQV  80

Query  529   WLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKD-  705
             +L+HQV++GEHI ++GSTKELGSWK+ V ++WT  GWV +++L G   VEFKFVI  K  
Sbjct  81    YLEHQVKFGEHIGVIGSTKELGSWKEQVELEWTPDGWVCQLKLPGETLVEFKFVIFLKGI  140

Query  706   KNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQVLADNGPVVTKD  885
             K+  WE G+NRV++LP  G + +VC WN T +PLELL     G  + +++ + G    +D
Sbjct  141   KDKTWEDGNNRVVELPKDGKYDIVCHWNRTKEPLELL-----GTPKLELVGEAGKNSRED  195

Query  886   ST-----------------DPDMQ---VSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTS  1005
             +T                 D D+Q    S F  QWQG    F+RS++ R  E +R WDT+
Sbjct  196   ATASVNIVPEDAENISVDGDVDLQEADSSTFSGQWQGSETVFMRSSEHRNKETDRMWDTT  255

Query  1006  GLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPC  1185
             GL EI LKLVEGDK S+NWWRKLEVVR ++ E+ +   RLEAL Y+AIYLKWI TGQ+ C
Sbjct  256   GLKEIALKLVEGDKASRNWWRKLEVVRGILSESYDDQSRLEALIYAAIYLKWIYTGQVAC  315

Query  1186  FEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPL  1365
             FEDGGHHRPN+HAEISR IF +LE +   K  + Q+ILVIRK+H CLPSFK+EFTASVPL
Sbjct  316   FEDGGHHRPNKHAEISRQIFRQLEMMYYGKTTSAQDILVIRKMHTCLPSFKSEFTASVPL  375

Query  1366  TRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVE  1545
             TRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE ML RITK PGEYSEAFVE
Sbjct  376   TRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEAMLARITKTPGEYSEAFVE  435

Query  1546  QFKIFHHELKD  1578
             QFKIF+ ELKD
Sbjct  436   QFKIFYSELKD  446



>ref|NP_001066613.1| Os12g0297500 [Oryza sativa Japonica Group]
 sp|Q2QTC2.2|PWD_ORYSJ RecName: Full=Phosphoglucan, water dikinase, chloroplastic; Flags: 
Precursor [Oryza sativa Japonica Group]
 gb|ABA97816.2| chloroplast alpha-glucan water dikinase isoform 3, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF29632.1| Os12g0297500 [Oryza sativa Japonica Group]
Length=1206

 Score =   462 bits (1189),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 244/434 (56%), Positives = 296/434 (68%), Gaps = 32/434 (7%)
 Frame = +1

Query  361   PR--LILEPQGIPGSIMNR-------PTRGLSSRTICAVSSVETREVEKKGKEKRSAHEN  513
             PR  L+L P G+   ++ R         RG + R   A S+ E R  EKK ++  S    
Sbjct  17    PRRGLVLPPPGVGAGVLLRRGAMALPGRRGFACRGRSAASAAE-RTKEKKRRDS-SKQPL  74

Query  514   LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVI  693
             + L++ L+HQV++GEH+ I+GSTKELGSW++ V ++WT  GWV +++L G   VEFKFVI
Sbjct  75    VHLQVCLEHQVKFGEHVGIIGSTKELGSWEEQVELEWTTNGWVCQLKLPGETLVEFKFVI  134

Query  694   V---GKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELL---PLDSEGEYEAQVL  855
                 GKDK  +WE G+NRV++LP  G F +VC WN T++PLELL     +  GE E    
Sbjct  135   FLVGGKDK--IWEDGNNRVVELPKDGKFDIVCHWNRTEEPLELLGTPKFELVGEAEKNTG  192

Query  856   ADNGPVVT-------------KDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKW  996
              D    VT                  P+ + S F  QWQG    F+RSN+    E +R W
Sbjct  193   EDASASVTFAPEKVQDISVVENGDPAPEAESSKFGGQWQGSKTVFMRSNEHLNKEADRMW  252

Query  997   DTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQ  1176
             DT+GL  I LKLVEGDK S+NWWRKLEVVR ++ E+ +   RL AL YSAIYLKWI TGQ
Sbjct  253   DTTGLDGIALKLVEGDKASRNWWRKLEVVRGILSESFDDQSRLGALVYSAIYLKWIYTGQ  312

Query  1177  IPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTAS  1356
             I CFEDGGHHRPN+HAEISR IF ELE +   K  + +++LVIRKIHP LPSFK+EFTAS
Sbjct  313   ISCFEDGGHHRPNKHAEISRQIFRELEMMYYGKTTSAKDVLVIRKIHPFLPSFKSEFTAS  372

Query  1357  VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEA  1536
             VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE+ML RITK PGEYSE 
Sbjct  373   VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEVMLARITKTPGEYSET  432

Query  1537  FVEQFKIFHHELKD  1578
             FVEQF IF+ ELKD
Sbjct  433   FVEQFTIFYSELKD  446



>ref|XP_010228078.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Brachypodium 
distachyon]
Length=1182

 Score =   455 bits (1170),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 220/366 (60%), Positives = 276/366 (75%), Gaps = 22/366 (6%)
 Frame = +1

Query  520   LKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIV-  696
             L+++L+HQV++GEH+ ++GSTKELGSWKK+V + WT+ GWV ++EL     VEFKFVI+ 
Sbjct  76    LRVFLEHQVKFGEHVGVIGSTKELGSWKKHVELVWTQDGWVGQLELPAETLVEFKFVIIL  135

Query  697   --GKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQVLADNGP  870
               GK K   WE G+NRV++LP GG+F +VC WN+T++PL+L          ++V  ++  
Sbjct  136   EGGKGKT--WEDGNNRVIELPKGGTFDIVCHWNMTEEPLDL-------SGTSKVHKESRN  186

Query  871   VVTKDSTD----------PDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEI  1020
             +  K+  D          P+   S F  QWQG    F+RSN+      +R WDTSGL  +
Sbjct  187   ITPKEVRDVSVTGNGDLAPETDSSNFGGQWQGSDAVFMRSNEHHNKSSDRMWDTSGLGGM  246

Query  1021  PLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGG  1200
              LKLVEGDK S+NWW+KLE+VR+L+ E V+   RLEAL  SAIYLKWI TGQI CFEDGG
Sbjct  247   TLKLVEGDKVSRNWWKKLELVRELLSEPVDDQSRLEALICSAIYLKWIYTGQISCFEDGG  306

Query  1201  HHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRD  1380
             H+RPN+HAEISR IF ELE++   K  + +++LVIRKIHPCLPSFK+EFTA+VPLTRIRD
Sbjct  307   HYRPNKHAEISRQIFRELEKMYYTKGISAEDVLVIRKIHPCLPSFKSEFTATVPLTRIRD  366

Query  1381  IAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIF  1560
             IAHRNDIPHDLKQEIKHTIQNKLHR+AGPEDL+ATE ML R+TKNPGEY+EAFVEQFKIF
Sbjct  367   IAHRNDIPHDLKQEIKHTIQNKLHRSAGPEDLIATEAMLTRVTKNPGEYNEAFVEQFKIF  426

Query  1561  HHELKD  1578
             + ELKD
Sbjct  427   YSELKD  432



>gb|EMT02873.1| Phosphoglucan, water dikinase, chloroplastic [Aegilops tauschii]
Length=998

 Score =   447 bits (1149),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 215/373 (58%), Positives = 272/373 (73%), Gaps = 1/373 (0%)
 Frame = +1

Query  463   TREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWV  642
             +R  ++K +   S   ++ L++ L+HQV+YGEH+ I+GS KELG+WK++V +DWT+ GWV
Sbjct  7     SRRTKEKSRADPSKSGSVLLQVCLEHQVKYGEHVGIIGSAKELGAWKQHVELDWTQDGWV  66

Query  643   SEMELKGGEPVEFKFVIVGKDKN-LLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLP  819
              ++EL     VEFKFVIV K  N   WE GDNR ++LP GG+  + C W+ T++PL    
Sbjct  67    CQLELPSEALVEFKFVIVSKGGNDKTWEGGDNRAIQLPKGGTLDIACNWDKTEEPLGPSG  126

Query  820   LDSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWD  999
                       V+      V+  S+ P    S+F  QWQG    F+RSN+      +R WD
Sbjct  127   TPKVDRAPKHVVPQTAGDVSAASSAPGTDSSSFGGQWQGSEAVFMRSNEHGNKSSDRMWD  186

Query  1000  TSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQI  1179
             T+GL  + LKLVEGDK+S+NWW+KL++VR L+ E V+   RLEAL  SAIYLKWI TGQI
Sbjct  187   TAGLGGMALKLVEGDKSSKNWWQKLDLVRRLVSEPVDDQSRLEALICSAIYLKWIYTGQI  246

Query  1180  PCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASV  1359
              C EDGGH+RPN+HAEISR IF ELE++   K  + +++LVIRKIHPCLPSFK+EFTA+V
Sbjct  247   SCSEDGGHYRPNKHAEISRQIFRELEKMYYTKGISPEDVLVIRKIHPCLPSFKSEFTATV  306

Query  1360  PLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAF  1539
             PLTRIRDIAHRNDIPH+LKQEIKHTIQNKLHR+AGPEDLVATE ML RITKNPGEY+ AF
Sbjct  307   PLTRIRDIAHRNDIPHELKQEIKHTIQNKLHRSAGPEDLVATEAMLTRITKNPGEYNGAF  366

Query  1540  VEQFKIFHHELKD  1578
             VEQF+IF+ ELKD
Sbjct  367   VEQFQIFYSELKD  379



>gb|AAC26245.1| contains similarity glycosyl hydrolases [Arabidopsis thaliana]
Length=491

 Score =   429 bits (1104),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 231/458 (50%), Positives = 284/458 (62%), Gaps = 69/458 (15%)
 Frame = +1

Query  295   AYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREV  474
             + P+  I     +SL       PRL+     +  S  +   R  +SR  C  +S  T  +
Sbjct  10    SSPFTFITRNSSSSL-------PRLVNITHRVNLSHQSHRLRNSNSRLTCTATSSST--I  60

Query  475   EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEME  654
             E++ K+K  +   ++L + LDHQV +G+H+A+ GS KE+GSWKK   ++W+E GWV E+E
Sbjct  61    EEQRKKKDGSGTKVRLNVRLDHQVNFGDHVAMFGSAKEIGSWKKKSPLNWSENGWVCELE  120

Query  655   LKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEG  834
             L GG+ +E+KFVIV  D +L WE+GDNRVLK+P  G+F +VC W+ T + L+L P +   
Sbjct  121   LDGGQVLEYKFVIVKNDGSLSWESGDNRVLKVPNSGNFSVVCHWDATRETLDL-PQEVGN  179

Query  835   EYEAQVLA---DNGPV----VTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRK  993
             + +        DN  V    V        +Q S    QWQGK  SF+RSND    E  R 
Sbjct  180   DDDVGDGGHERDNHDVGDDRVVGSENGAQLQKSTLGGQWQGKDASFMRSNDHGNREVGRN  239

Query  994   WDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTG  1173
             WDTSGL    LK+VEGD+NS+NWWRK                             WINTG
Sbjct  240   WDTSGLEGTALKMVEGDRNSKNWWRK-----------------------------WINTG  270

Query  1174  QIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQ---------------------  1290
             QIPCFEDGGHHRPNRHAEISRLIF ELE I  +KDAT +                     
Sbjct  271   QIPCFEDGGHHRPNRHAEISRLIFRELEHICSKKDATPEVTHFFAFKISTFKSLFSNICS  330

Query  1291  --EILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAG  1464
               E+LV RKIHPCLPSFKAEFTA+VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAG
Sbjct  331   WCEVLVARKIHPCLPSFKAEFTAAVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAG  390

Query  1465  PEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             PEDL+ATE ML+RIT+ PG+YS  FVEQFKIFH+ELKD
Sbjct  391   PEDLIATEAMLQRITETPGKYSGDFVEQFKIFHNELKD  428



>gb|EEE53074.1| hypothetical protein OsJ_35828 [Oryza sativa Japonica Group]
Length=1188

 Score =   447 bits (1149),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 237/426 (56%), Positives = 285/426 (67%), Gaps = 43/426 (10%)
 Frame = +1

Query  418   RGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  597
             RG + R   A S+ E R  EKK ++  S    + L++ L+HQV++GEH+ I+GSTKELGS
Sbjct  7     RGFACRGRSAASAAE-RTKEKKRRDS-SKQPLVHLQVCLEHQVKFGEHVGIIGSTKELGS  64

Query  598   WKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIV---GKDKNLLWETGDNRVLKLPAGGSF  768
             W++ V ++WT  GWV +++L G   VEFKFVI    GKDK  +WE G+NRV++LP  G F
Sbjct  65    WEEQVELEWTTNGWVCQLKLPGETLVEFKFVIFLVGGKDK--IWEDGNNRVVELPKDGKF  122

Query  769   KMVCQWNVTDKPLELL---PLDSEGEYEAQVLADNGPVVT-------------KDSTDPD  900
              +VC WN T++PLELL     +  GE E     D    VT                  P+
Sbjct  123   DIVCHWNRTEEPLELLGTPKFELVGEAEKNTGEDASASVTFAPEKVQDISVVENGDPAPE  182

Query  901   MQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRK---  1071
              + S F  QWQG    F+RSN+    E +R WDT+GL  I LKLVEGDK S+NWWRK   
Sbjct  183   AESSKFGGQWQGSKTVFMRSNEHLNKEADRMWDTTGLDGIALKLVEGDKASRNWWRKECT  242

Query  1072  -----------------LEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGG  1200
                              LEVVR ++ E+ +   RL AL YSAIYLKWI TGQI CFEDGG
Sbjct  243   LCSDPASKALSYNASVLLEVVRGILSESFDDQSRLGALVYSAIYLKWIYTGQISCFEDGG  302

Query  1201  HHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRD  1380
             HHRPN+HAEISR IF ELE +   K  + +++LVIRKIHP LPSFK+EFTASVPLTRIRD
Sbjct  303   HHRPNKHAEISRQIFRELEMMYYGKTTSAKDVLVIRKIHPFLPSFKSEFTASVPLTRIRD  362

Query  1381  IAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIF  1560
             IAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL+ATE+ML RITK PGEYSE FVEQF IF
Sbjct  363   IAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEVMLARITKTPGEYSETFVEQFTIF  422

Query  1561  HHELKD  1578
             + ELKD
Sbjct  423   YSELKD  428



>gb|EEC69133.1| hypothetical protein OsI_38056 [Oryza sativa Indica Group]
Length=1191

 Score =   441 bits (1134),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 229/411 (56%), Positives = 279/411 (68%), Gaps = 43/411 (10%)
 Frame = +1

Query  469   EVEKKGKEKRSAHEN--LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWV  642
             ++  K K++R + +   + L++ L+HQV++GEH+ I+GSTKELGSW++ V ++WT  GWV
Sbjct  23    DILTKEKKRRDSSKQPLVHLQVCLEHQVKFGEHVGIIGSTKELGSWEEQVELEWTTNGWV  82

Query  643   SEMELKGGEPVEFKFVIV---GKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLEL  813
              +++L G   VEFKFVI    GKDK  +WE G+NRV++LP  G F +VC WN T++PLEL
Sbjct  83    CQLKLPGETLVEFKFVIFLVGGKDK--IWEDGNNRVVELPKDGKFDIVCHWNRTEEPLEL  140

Query  814   L---PLDSEGEYEAQVLADNGPVVT-------------KDSTDPDMQVSAFVEQWQGKAV  945
             L     +  GE E     D    VT                   + + S FV QWQG   
Sbjct  141   LGTPKFELVGEAEKNTGEDASASVTFAPEKVQDISVVENGDLASEAESSKFVGQWQGSKT  200

Query  946   SFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRK------------------  1071
              F+RSN+    E +R WDT+GL  I LKLVEGDK S+NWWRK                  
Sbjct  201   VFMRSNEHLNKEADRMWDTTGLDGIALKLVEGDKASRNWWRKECTLCSDPASKALSYNAS  260

Query  1072  --LEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF  1245
               LEVVR ++ E+ +   RL AL YSAIYLKWI TGQI CFEDGGHHRPN+HAEISR IF
Sbjct  261   VLLEVVRGILSESFDDQSRLGALVYSAIYLKWIYTGQISCFEDGGHHRPNKHAEISRQIF  320

Query  1246  CELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEI  1425
              ELE     K  + +++LVIRKIHP LPSFK+EFTASVPLTRIRDIAHRNDIPHDLKQEI
Sbjct  321   RELEMTYYGKTTSAKDVLVIRKIHPFLPSFKSEFTASVPLTRIRDIAHRNDIPHDLKQEI  380

Query  1426  KHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             KHTIQNKLHRNAGPEDL+ATE+ML RITK PGEYSE+FVEQF IF+ ELKD
Sbjct  381   KHTIQNKLHRNAGPEDLIATEVMLARITKTPGEYSESFVEQFTIFYSELKD  431



>ref|XP_002973212.1| hypothetical protein SELMODRAFT_99378 [Selaginella moellendorffii]
 gb|EFJ25586.1| hypothetical protein SELMODRAFT_99378 [Selaginella moellendorffii]
Length=1104

 Score =   425 bits (1092),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 214/361 (59%), Positives = 261/361 (72%), Gaps = 11/361 (3%)
 Frame = +1

Query  514   LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVI  693
             +K ++ LDHQVE+GEH A++GS   +GSWK +V M WTE GWV+++E   G+  EFK+VI
Sbjct  10    VKFRLRLDHQVEFGEHHAVIGSADFMGSWKNHVSMTWTESGWVADIEASPGDRAEFKYVI  69

Query  694   VGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQV-----LA  858
             V  D  L WE G NRVL +P+GGS ++V QW   D  +      +E   EA V       
Sbjct  70    VAGDGRLTWEEGPNRVLDVPSGGS-EIVSQWENPDLVVTTNGAAAEAHVEAPVHEKKDKK  128

Query  859   DNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVE  1038
             +        S+D DM   +F + WQGK V+F+++N+    +   KW+T+GL    L++VE
Sbjct  129   EKAKETVTASSDGDM---SFSQGWQGKNVAFMKANEHTSRQGG-KWETAGLEGAALRIVE  184

Query  1039  GDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNR  1218
             GDK S NWWRKLEVVRDL+ +++    RL+AL YS+ YLKWI+TGQI CFEDGGH+RPN+
Sbjct  185   GDKKSGNWWRKLEVVRDLLTDDLGKADRLDALVYSSTYLKWISTGQIQCFEDGGHYRPNK  244

Query  1219  HAEISRLIFCELERILGRKDATLQEI-LVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRN  1395
             HAEISR+IF ELE I   K  T  E  +VIRKIHPCLPSFKAEFTA+VPLTRIRDIAHRN
Sbjct  245   HAEISRMIFRELESIYSDKTTTTTEERVVIRKIHPCLPSFKAEFTAAVPLTRIRDIAHRN  304

Query  1396  DIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELK  1575
             DIPHDLKQEIKHTIQNKLHRNAGPEDLVATE +L R+TK PGEYS AFVEQ KIFH ELK
Sbjct  305   DIPHDLKQEIKHTIQNKLHRNAGPEDLVATEALLARVTKTPGEYSAAFVEQLKIFHGELK  364

Query  1576  D  1578
             D
Sbjct  365   D  365



>ref|XP_002976638.1| hypothetical protein SELMODRAFT_105597 [Selaginella moellendorffii]
 gb|EFJ22307.1| hypothetical protein SELMODRAFT_105597 [Selaginella moellendorffii]
Length=1101

 Score =   420 bits (1079),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 211/362 (58%), Positives = 261/362 (72%), Gaps = 12/362 (3%)
 Frame = +1

Query  514   LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVI  693
             +KL++ LDHQV++GEH A++GS   +GSWK +V M WTE GWV+++E   G+  EFK+VI
Sbjct  10    VKLRLRLDHQVKFGEHHAVIGSADFMGSWKNHVSMTWTESGWVADIEASPGDRAEFKYVI  69

Query  694   VGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQV-----LA  858
             V  D  L WE G NRVL +P+GGS ++V QW   D  +      +E   EA V       
Sbjct  70    VAGDGRLTWEEGPNRVLDVPSGGS-EIVSQWENPDLVVTTNGASAEAHVEAPVHEKKDKK  128

Query  859   DNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVE  1038
             +        S+D DM   +F + WQGK V+F+++N+    +   KW+T+GL    L++VE
Sbjct  129   EKAKETVTASSDGDM---SFSQGWQGKNVAFMKANEHTSRQGG-KWETAGLDGAVLRIVE  184

Query  1039  GDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNR  1218
             GDK S NWWRKLEVVR+L+ +++    RL+AL YS+ YLKWI+TGQI CFEDGGH+RP +
Sbjct  185   GDKKSGNWWRKLEVVRELLTDDLGKADRLDALVYSSTYLKWISTGQIQCFEDGGHYRPKK  244

Query  1219  HAEISRLIFCELERILGRKDATL--QEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHR  1392
             HAEISR+IF ELE I   K  T   +E +VIR IHPCLPSFKAEFTA+VPLTRIRDIAHR
Sbjct  245   HAEISRMIFRELESIYSDKTTTTTTEERVVIRNIHPCLPSFKAEFTAAVPLTRIRDIAHR  304

Query  1393  NDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHEL  1572
             NDIPHDLKQEIKHTIQNKLHRNAGPEDLVATE +L R+TK PGEYS AFVEQ KIFH EL
Sbjct  305   NDIPHDLKQEIKHTIQNKLHRNAGPEDLVATEALLARVTKTPGEYSAAFVEQLKIFHGEL  364

Query  1573  KD  1578
             KD
Sbjct  365   KD  366



>ref|XP_001752167.1| predicted protein [Physcomitrella patens]
 gb|EDQ82900.1| predicted protein [Physcomitrella patens]
Length=1094

 Score =   412 bits (1060),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 204/359 (57%), Positives = 260/359 (72%), Gaps = 13/359 (4%)
 Frame = +1

Query  508   ENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKF  687
             E +K+++ LDHQV++GE  AI+GS K +G+W++ V M WTE GWV ++E   GE VE+K 
Sbjct  11    EKVKVRVRLDHQVQFGETHAILGSAKSIGAWQEKVPMTWTEAGWVVDLEGDSGETVEYKH  70

Query  688   VIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQVLADNG  867
             +IV  D  ++WE G NR + LP  G F++V  W  T +     P    G       +DNG
Sbjct  71    IIVTHDGGVIWEEGPNRTISLPDEGDFELVTHWGCTQED----PQFQGGRSPKSHGSDNG  126

Query  868   PVVTKDSTDPDMQVSAFVEQ--WQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEG  1041
                  +        S+ VE+  WQG +V      D++  E++ KWDT+GL    L++VEG
Sbjct  127   HAGKAEEQTEGKAESSKVEEAEWQGASV-----KDRK--ERSGKWDTTGLGGPTLQIVEG  179

Query  1042  DKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRH  1221
             DK++ NWWRKL+VVRDL+        RL+AL  +A+YLKWINTGQI C+EDG H+RPN+H
Sbjct  180   DKSASNWWRKLDVVRDLLSGEAGKKDRLKALINAAVYLKWINTGQIVCYEDGQHYRPNKH  239

Query  1222  AEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDI  1401
             AEISR IF ELERI G+KD  L+E+LVI+KIHPCLP+FKAEFTASVPLTRIRDIAHRNDI
Sbjct  240   AEISRRIFVELERISGQKDVDLKELLVIQKIHPCLPAFKAEFTASVPLTRIRDIAHRNDI  299

Query  1402  PHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             PHDLKQEIKHTIQNKLHR+AGPEDLVATE ML RIT+NPG+Y+EAFV++F+IF+ ELKD
Sbjct  300   PHDLKQEIKHTIQNKLHRSAGPEDLVATENMLARITRNPGQYNEAFVKEFQIFYAELKD  358



>gb|EPS59827.1| glucan/water dikinase, partial [Genlisea aurea]
Length=315

 Score =   385 bits (989),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 200/327 (61%), Positives = 240/327 (73%), Gaps = 22/327 (7%)
 Frame = +1

Query  466   REVEKKGKEKRSAHENL----KLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEK  633
             RE E+K   K+    N+    +++  L+HQV +GEH+A++GS KELG WKK +MM+WTE 
Sbjct  1     REGEEKNLMKKERQLNVVGKVEVEFRLEHQVAFGEHVALLGSVKELGFWKKKLMMNWTEN  60

Query  634   GWVSEMELKGGEP-VEFKFVIVGKDK-NLLWETGDNRVLKLPAGG-SFKMVCQWNVTDKP  804
             GW+  + L   E  VE+KF IVGKDK NL+WE+G+NR L LP  G SF +VC+W+ TD+ 
Sbjct  61    GWICNLNLDTSEQLVEYKFAIVGKDKQNLIWESGENRTLTLPEKGRSFSVVCKWDKTDEM  120

Query  805   LELLPL---DSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRG  975
             +++LP    D E EYE    AD G +V+          SAFVEQWQGK   FV S D   
Sbjct  121   VQVLPSEVPDEETEYEN---ADAGELVS---------TSAFVEQWQGKDALFVHSKDHLD  168

Query  976   MEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYL  1155
              EK   WDT GL  I LKLVEGD+N++NWWRKLEVVR +IVEN+E  +RL+A  YSAIYL
Sbjct  169   SEKKAYWDTDGLDGIALKLVEGDRNARNWWRKLEVVRGIIVENIEDGNRLDAFIYSAIYL  228

Query  1156  KWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSF  1335
             KWINTGQIPC EDGGHHRPN+HAEIS+LIF ELER  GRKD  ++E+LVIRKIHPCLPSF
Sbjct  229   KWINTGQIPCLEDGGHHRPNKHAEISQLIFRELERAYGRKDIPIEEMLVIRKIHPCLPSF  288

Query  1336  KAEFTASVPLTRIRDIAHRNDIPHDLK  1416
             KAEFTASVPLTRIRDIAHRNDIPH LK
Sbjct  289   KAEFTASVPLTRIRDIAHRNDIPHGLK  315



>ref|XP_001758857.1| predicted protein [Physcomitrella patens]
 gb|EDQ76363.1| predicted protein [Physcomitrella patens]
Length=1126

 Score =   360 bits (925),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 188/376 (50%), Positives = 250/376 (66%), Gaps = 38/376 (10%)
 Frame = +1

Query  514   LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVI  693
             +K+++ +DHQV++GE  AI+GS++  G+W++ V + WTE GWV E+E   GE  E+K +I
Sbjct  8     VKVRLRIDHQVQFGESHAILGSSQCTGAWRERVPLQWTESGWVVELEANPGETFEYKHII  67

Query  694   VGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQVLADNGPV  873
             V    +++WE G NRVL +P  G F++V  W  T + L+L     +GE   QV+  +GPV
Sbjct  68    VTHGGDVIWEGGPNRVLSVPDEGEFEVVTHWGCTHEELQL-----QGE---QVI--DGPV  117

Query  874   -VTKDSTDPDMQVS--------------------AFVEQWQGKAVSFVRSNDQRGMEKNR  990
              V K S +   Q S                    +FV QW G A        + G E+  
Sbjct  118   DVGKGSKEEPGQASETSSGQQRERSVCELGEISTSFVHQWLGGAA-------KDGQERAC  170

Query  991   KWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINT  1170
             KWDT+GL    L LVEGDKN++NWW+KLEVVR L+     +T RL+ L Y ++YLKWI T
Sbjct  171   KWDTTGLDGPALHLVEGDKNAKNWWQKLEVVRSLVSGEFGNTERLKTLVYISVYLKWIRT  230

Query  1171  GQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFT  1350
             GQI C ED  H+  ++HAEISR IF ELERI+  + A+L+EILV+RKI P LP+FK ++T
Sbjct  231   GQIACCEDAKHYSLDQHAEISRKIFAELERIIDDRSASLREILVVRKILPSLPAFKVQYT  290

Query  1351  ASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYS  1530
             AS PLTRIRDIAHRNDIP DLK+EI+HT+Q+KL R+AGPEDLVATE +L R+ + PGEYS
Sbjct  291   ASDPLTRIRDIAHRNDIPQDLKKEIEHTLQSKLDRSAGPEDLVATEALLSRVNQKPGEYS  350

Query  1531  EAFVEQFKIFHHELKD  1578
             E FVE+ K F+ ELKD
Sbjct  351   EVFVEELKFFYTELKD  366



>ref|XP_006421076.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
 gb|ESR34316.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
Length=356

 Score =   338 bits (867),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 174/291 (60%), Positives = 216/291 (74%), Gaps = 13/291 (4%)
 Frame = +1

Query  430   SRTICAVSS-VETREVEKKGKEKRSAHE-NLKLKIWLDHQVEYGEHIAIMGSTKELGSWK  603
             S  +C VS+     E +KK  + +S H  N+++   LDHQVE+GEH+ I+GSTKELGSWK
Sbjct  59    SGVVCGVSTETSEEEKKKKKMKPKSGHGGNVRISFRLDHQVEFGEHVVILGSTKELGSWK  118

Query  604   KNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQ  783
             KNV M W+E GW+ ++E KGGE +E+KFVIV  DK+  WE G NR+LKLP GGSF++VC 
Sbjct  119   KNVPMKWSECGWLCDLEFKGGESIEYKFVIVRNDKSKAWEAGANRILKLPKGGSFEIVCH  178

Query  784   WNVTDKPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQV--SAFVEQWQGKAVSFVR  957
             WN T + ++LL L+ +         DNG VVT  + D  ++V  S FV QWQGK+ SF+R
Sbjct  179   WNKTGEAVDLLHLEED---------DNGSVVTDAAPDALLEVGTSPFVGQWQGKSASFMR  229

Query  958   SNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALT  1137
             ++D    E  RKWDTSGL  + LKLVEGD+ ++NWWRKLEVVR+LIVEN++S  RLEAL 
Sbjct  230   ADDHWNREMERKWDTSGLQGLTLKLVEGDQRARNWWRKLEVVRELIVENLQSDERLEALI  289

Query  1138  YSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQ  1290
             YSAIYLKWINTG+IPCFEDGGHHRPNRHAEISRLIF ELERI  RKDA+ Q
Sbjct  290   YSAIYLKWINTGKIPCFEDGGHHRPNRHAEISRLIFRELERISCRKDASPQ  340



>gb|EMS54440.1| Phosphoglucan, water dikinase, chloroplastic [Triticum urartu]
Length=1059

 Score =   351 bits (901),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 184/361 (51%), Positives = 242/361 (67%), Gaps = 21/361 (6%)
 Frame = +1

Query  439   ICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMM  618
             IC      T+E   K +   S   ++ L++ L HQV+YGEH+ I+GS KELG+WK++V +
Sbjct  4     ICVSVYCRTKE---KNRADPSKSGSVLLQVCLQHQVKYGEHVGIIGSAKELGAWKQHVKL  60

Query  619   DWTEKGWVSEMELKGGEPVEFKFVIVGKDKN-LLWETGDNRVLKLPAGGSFKMVCQWNVT  795
             DW+E GWV ++EL G   VEFKFVIV K  N   WE GDNR ++LP GG+  +VC W+ T
Sbjct  61    DWSEDGWVCQLELPGEAAVEFKFVIVSKGGNDKTWEGGDNRAIQLPKGGTLDIVCNWDKT  120

Query  796   DKPLE---LLPLDSEGEYEA-QVLADNGPVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSN  963
             ++PL       +D   ++ A Q + D    V+  +  P+   S+F  QWQG    F+RSN
Sbjct  121   EEPLGPSGTPKVDRAPKHAAPQTVGD----VSAANLAPETDSSSFGGQWQGSEAVFMRSN  176

Query  964   DQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYS  1143
             +      +R WDT+GL  + LKLVEGDK+S+NWW+KL++VR L+ E V+   RLEAL  S
Sbjct  177   EHGNKSSDRMWDTAGLGGMALKLVEGDKSSKNWWQKLDLVRRLVSEPVDDQSRLEALICS  236

Query  1144  AIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPC  1323
             AIYLKWI TGQI C EDGGH+RPN+HAEISR IF ELE++   K  + +++LVIRKIHPC
Sbjct  237   AIYLKWIYTGQISCSEDGGHYRPNKHAEISRQIFRELEKMYYTKGISPEDVLVIRKIHPC  296

Query  1324  LPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKH--TIQN-------KLHRNAGPEDL  1476
             LPSFK+EFTA+VPLTRIRDIAHRNDIPH+LK+      T+ N       +L RN   EDL
Sbjct  297   LPSFKSEFTATVPLTRIRDIAHRNDIPHELKKTCMSLGTVWNCSIKRKKELPRNKRIEDL  356

Query  1477  V  1479
             +
Sbjct  357   L  357



>emb|CAX51387.1| phosphoglucan water dikinase [Hordeum vulgare subsp. vulgare]
Length=261

 Score =   304 bits (779),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 170/194 (88%), Gaps = 1/194 (1%)
 Frame = +1

Query  1000  TSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVE-STHRLEALTYSAIYLKWINTGQ  1176
             T+GL  + LKLVEGDK+S+NWW+KL++VR L+ E V+  + RLEAL  SAIYLKWI TGQ
Sbjct  1     TAGLGGMALKLVEGDKSSKNWWQKLDLVRRLVSEPVDDQSSRLEALICSAIYLKWIYTGQ  60

Query  1177  IPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTAS  1356
             I C EDGGH+RPN+HAEISR IF E+E++  RK  + +++LVIRKIHPCLPSFK+EFTA+
Sbjct  61    ISCSEDGGHYRPNKHAEISRQIFREIEKMYYRKGISPEDVLVIRKIHPCLPSFKSEFTAT  120

Query  1357  VPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEA  1536
             VPLTRIRDIAHRNDIPH+LKQEIKHTIQNKLHR+AGPEDLVATE ML RITKNPGEY++A
Sbjct  121   VPLTRIRDIAHRNDIPHELKQEIKHTIQNKLHRSAGPEDLVATEAMLTRITKNPGEYNDA  180

Query  1537  FVEQFKIFHHELKD  1578
             FVEQFKIF+ ELKD
Sbjct  181   FVEQFKIFYSELKD  194



>ref|XP_005849428.1| hypothetical protein CHLNCDRAFT_21770 [Chlorella variabilis]
 gb|EFN57326.1| hypothetical protein CHLNCDRAFT_21770 [Chlorella variabilis]
Length=1182

 Score =   288 bits (738),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 177/422 (42%), Positives = 244/422 (58%), Gaps = 54/422 (13%)
 Frame = +1

Query  409   RPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKE  588
             RP RGL++  +CA                +   +++ ++  +  +V++GE + ++GS   
Sbjct  14    RPARGLAA-PVCA----------------QGGGDDVLVRFSVQREVKFGEAVRLVGSHPS  56

Query  589   LGSWK--KNVMMDWTEKG-WVSEMELKGGEPVEFKFVIV-GKDK-NLLWETGDNRVLKLP  753
             LG+WK  K   M W E   WV+E+ L  G  +EFK V V G+D  +  WE GDNR L +P
Sbjct  57    LGNWKVRKAPSMGWREGHIWVAEVALPPGTALEFKCVRVKGEDGGDGRWEDGDNRSLVVP  116

Query  754   AGG--SFKMVCQWN------VTDKPLELLPLDS------EGEYEAQVLADN-------GP  870
             AGG  S  ++ +W             EL  L+       E E+E               P
Sbjct  117   AGGASSLSVLLEWGGEMHVQAAGAGEELPGLEGAHQQQREREWERSRSGSGSDSDDSWAP  176

Query  871   VVTKDSTDPDMQVSAFVEQWQGKAVSFVRSN----DQRGMEKNRKWDTSGLAEIPLKLVE  1038
               +  S        A + QWQGK + F++SN    D+RG+     WDT+GL    L LV 
Sbjct  177   PSSGGSGSSFDDSMALLPQWQGKELRFMQSNEHSRDRRGV-----WDTAGLEGPALHLVA  231

Query  1039  GDKNSQNWWRKLEVVRDLIVENV-ESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPN  1215
             GD+++ NW  KLEVV+ L+V+N  E    L+AL ++ IY++W+ TG + C E GGHHRPN
Sbjct  232   GDRDAANWLGKLEVVKKLLVDNAPELRPSLDALAHAYIYMQWLATGAVECVEGGGHHRPN  291

Query  1216  RHAEISRLIFCELERILGRKDATLQEI-LVIRKIHPCLPSFKAEFTASVPLTRIRDIAHR  1392
             RHAE++R +F  LE ++G +      + L  R++   LPSF  +FT SVPLTRIRDIAHR
Sbjct  292   RHAELARSMFRSLEWVIGEQGHVSPAVALAGRRLQSRLPSFTEQFTQSVPLTRIRDIAHR  351

Query  1393  NDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHEL  1572
             NDIP DLK EIKHT+QNKLHRNAGPEDL  TE ML R+T NPGE+SE+FV +F++F  EL
Sbjct  352   NDIPRDLKAEIKHTLQNKLHRNAGPEDLHTTEAMLARVTANPGEFSESFVHEFRVFTAEL  411

Query  1573  KD  1578
             +D
Sbjct  412   RD  413



>ref|XP_008662597.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Zea mays]
Length=287

 Score =   269 bits (687),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 173/265 (65%), Gaps = 20/265 (8%)
 Frame = +1

Query  550   YGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIV---GKDKNLLW  720
             +GEH+ I+GSTKELGSWK  V MDWT  GWV ++++ G   +EFKFVI+   GKDK  +W
Sbjct  2     FGEHVGIIGSTKELGSWKSQVDMDWTPNGWVCQLDVPGEALLEFKFVIILNKGKDK--IW  59

Query  721   ETGDNRVLKLPAGGSFKMVCQWNVTDKPLELL-------PLDSEGEYEAQVLADN-----  864
             E GDNRV+ LP  GSF M C WN T +PL+LL         D+E   E   L++N     
Sbjct  60    EDGDNRVVNLPKNGSFDMPCHWNKTKEPLDLLGSSEIKLSGDTEVIGEDAKLSENIALEE  119

Query  865   -GPVVTKDSTD--PDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLV  1035
              G +      D  P  + S    QWQG    F+RSN+    E  RKWD +GL  + LKLV
Sbjct  120   MGSICNAGVGDLTPKHESSTLGGQWQGSDTVFMRSNEHHNTENCRKWDMTGLDAVSLKLV  179

Query  1036  EGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPN  1215
             EGDK S+NWWRKLE+VR L+ E V+    LEALTYSAIYLKWI TGQIPCFEDGGHHRPN
Sbjct  180   EGDKASRNWWRKLELVRVLLSEYVQDQSHLEALTYSAIYLKWIYTGQIPCFEDGGHHRPN  239

Query  1216  RHAEISRLIFCELERILGRKDATLQ  1290
             +HAEISR IF E+ERI   K+ + Q
Sbjct  240   KHAEISRQIFGEIERIYYGKNTSSQ  264



>gb|KIZ07735.1| hypothetical protein MNEG_0234 [Monoraphidium neglectum]
Length=832

 Score =   274 bits (701),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 167/381 (44%), Positives = 219/381 (57%), Gaps = 37/381 (10%)
 Frame = +1

Query  541   QVEYGEHIAIMGSTKELGSW--KKNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKN  711
             QV YG+ + ++G+   LG W   + + + W+E   W  E+EL  G  VEFK V VGKD +
Sbjct  14    QVNYGQQLRVVGNAPGLGGWDTARGLHLKWSEGHVWSGEVELDAGSHVEFKLVCVGKDSD  73

Query  712   LLWETGDNRVLK-LPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQVL-----------  855
               WE G+NR +K L AG S  + C+W  T +         EG+   + L           
Sbjct  74    A-WEDGNNRGIKVLGAGYSQDVHCEWGRTKENDVRARELQEGQPRFEDLAAAVGARAAAD  132

Query  856   -------ADNGPVVTKDSTDPDMQVSAFVEQ----WQGKAVSFVRSNDQRGMEKNRKWDT  1002
                    +++ P    D        S   EQ    WQG+ V F+RSND    E+  +WDT
Sbjct  133   AQQRRLGSESYPTTDTDEGGFSSTASGDDEQLTPAWQGREVRFMRSNDHS-RERAGRWDT  191

Query  1003  SGLAEIP-LKLVEGDKNSQNWWRKLEVVRDLIVENVESTH-RLEALTYSAIYLKWINTGQ  1176
             SGLA  P L+LV GD+ + NW  KL V R L+V+          +L  + +YL W+N+G 
Sbjct  192   SGLAAGPVLELVRGDEGAPNWLGKLGVARGLLVDAAPRMRPETPSLAAALVYLSWVNSGA  251

Query  1177  IPCFEDGGHHRPNRHAEISRLIFCELE------RILGRKDATLQEILVIRKIHPCL-PSF  1335
             I C E GGH+RPN HA  ++ IF  LE      R  G  D TL+   ++ +      PSF
Sbjct  252   IACAEGGGHYRPNHHARTAQQIFRSLEWAIEEDRPRGMSDTTLRLRALLARRLHARLPSF  311

Query  1336  KAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKN  1515
              A FT +VPLTRIRDIAHR+DIPHDLKQEIKHT+QNKLHRNAGPEDLVAT+ ML RIT N
Sbjct  312   NANFTQTVPLTRIRDIAHRSDIPHDLKQEIKHTLQNKLHRNAGPEDLVATQAMLARITAN  371

Query  1516  PGEYSEAFVEQFKIFHHELKD  1578
             PGEYS AFV++F++F  EL++
Sbjct  372   PGEYSGAFVDEFRVFAAELRE  392



>ref|XP_006421074.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
 gb|ESR34314.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
Length=353

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 136/247 (55%), Positives = 176/247 (71%), Gaps = 13/247 (5%)
 Frame = +1

Query  430   SRTICAVSS-VETREVEKKGKEKRSAHE-NLKLKIWLDHQVEYGEHIAIMGSTKELGSWK  603
             S  +C VS+     E +KK  + +S H  N+++   LDHQVE+GEH+ I+GSTKELGSWK
Sbjct  59    SGVVCGVSTETSEEEKKKKKMKPKSGHGGNVRISFRLDHQVEFGEHVVILGSTKELGSWK  118

Query  604   KNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQ  783
             KNV M W+E GW+ ++E KGGE +E+KFVIV  DK+  WE G NR+LKLP GGSF++VC 
Sbjct  119   KNVPMKWSECGWLCDLEFKGGESIEYKFVIVRNDKSKAWEAGANRILKLPKGGSFEIVCH  178

Query  784   WNVTDKPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQV--SAFVEQWQGKAVSFVR  957
             WN T + ++LL L+ +         DNG VVT  + D  ++V  S FV QWQGK+ SF+R
Sbjct  179   WNKTGEAVDLLHLEED---------DNGSVVTDAAPDALLEVGTSPFVGQWQGKSASFMR  229

Query  958   SNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALT  1137
             ++D    E  RKWDTSGL  + LKLVEGD+ ++NWWRKLEVVR+LIVEN++S  RLEAL 
Sbjct  230   ADDHWNREMERKWDTSGLQGLTLKLVEGDQRARNWWRKLEVVRELIVENLQSDERLEALI  289

Query  1138  YSAIYLK  1158
             YSAIYLK
Sbjct  290   YSAIYLK  296



>gb|KEH27295.1| phosphoglucan, water dikinase [Medicago truncatula]
Length=893

 Score =   270 bits (690),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +1

Query  1153  LKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPS  1332
             ++WINTGQIPCFEDGGHHRPNRHAEISRLIF ELE+   RKD + QE+LVIRKIHPCLPS
Sbjct  1     MQWINTGQIPCFEDGGHHRPNRHAEISRLIFRELEQHTSRKDISPQEVLVIRKIHPCLPS  60

Query  1333  FKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITK  1512
             FKAEFTASVPLTRIRDIAHRNDIPHDLK +IKHTIQNKLHRNAGPEDLVATE ML +ITK
Sbjct  61    FKAEFTASVPLTRIRDIAHRNDIPHDLKTQIKHTIQNKLHRNAGPEDLVATEAMLAKITK  120

Query  1513  NPGEYSEAFVEQFKIFHHELKD  1578
             NPGEYSE FVEQFKIFH ELKD
Sbjct  121   NPGEYSETFVEQFKIFHRELKD  142



>ref|XP_011396449.1| Phosphoglucan, water dikinase, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM23575.1| Phosphoglucan, water dikinase, chloroplastic [Auxenochlorella 
protothecoides]
Length=1068

 Score =   251 bits (640),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 135/308 (44%), Positives = 186/308 (60%), Gaps = 25/308 (8%)
 Frame = +1

Query  682   KFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQVLAD  861
              FV +    N+ WE+G N V+  P   +  +   W   +  ++        + EA     
Sbjct  43    SFVSI-SGSNVEWESGSNHVVPAPEADA-AVSLNWGAAEAVVK--------KAEA-----  87

Query  862   NGPVVTKDSTDPDMQVSAFVE-----QWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPL  1026
               P  +    DP  Q  A  +     +W GK   F++ N+    E+  +W+T GL    L
Sbjct  88    GSPFASSPGPDPGTQGPASDDSPVRARWSGKEPVFMQGNEHS-RERQGRWETEGLEGATL  146

Query  1027  KLVEGDKNSQNWWRKLEVVRDLIVENVESTH-RLEALTYSAIYLKWINTGQIPCFEDGGH  1203
             ++V GD+++ +W +KL V   L+V++      RL+A+  + +YL+W+  G + C E GGH
Sbjct  147   EIVNGDRDAGSWLQKLAVAEKLLVQSAPRLRPRLDAVAAAYVYLQWVGNGTLACAESGGH  206

Query  1204  HRPNRHAEISRLIFCELERIL--GRKDATLQEI-LVIRKIHPCLPSFKAEFTASVPLTRI  1374
             HRPN HAE++R +F  LE +L  G KD   Q + L+ R++   LPSF A +TAS PLTRI
Sbjct  207   HRPNHHAELARSMFRSLEWVLAEGGKDGEAQALALLARRLQAYLPSFDAAYTASTPLTRI  266

Query  1375  RDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFK  1554
             RDIAHRNDIPH+LKQEIKHTIQNKLHRNAGPEDLVATE ML RIT++PGEY +AFV +F+
Sbjct  267   RDIAHRNDIPHELKQEIKHTIQNKLHRNAGPEDLVATEAMLRRITRHPGEYPDAFVGEFR  326

Query  1555  IFHHELKD  1578
              FH EL D
Sbjct  327   RFHAELSD  334



>ref|XP_003080699.1| phosphoglucan, water dikinase (ISS), partial [Ostreococcus tauri]
Length=760

 Score =   244 bits (624),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 149/367 (41%), Positives = 207/367 (56%), Gaps = 18/367 (5%)
 Frame = +1

Query  514   LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDWTEKG-WVSEMELKGG-EPVEF  681
             + +   L  ++ YG+ + ++G    LG+W  +  V + W +   W   + +    + V F
Sbjct  45    ITINFTLRAKLSYGDSLLVVGDHASLGAWSPDNAVALTWNDDDVWRGAVTVDAATQSVAF  104

Query  682   KFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQVLAD  861
             K         + WE GDNRV+++   G+F++   +   +   E+   +     EA+V A 
Sbjct  105   KCATRRASGGVEWEGGDNRVIEIERVGAFEVKGAFG--NGAFEVTSANGT-SVEAEVRAV  161

Query  862   NGPVVTKDSTDPDMQVSAFV-EQWQGKAVSFVRSNDQRGMEKNR-KWDTSGLAEIPLK--  1029
             +G V   ++      + A   ++W G  V  + +N+      ++ +WD SGL E      
Sbjct  162   DGDVDGAEAAATGTWMEANARDKWVGGNVRMMTANEHSDERPSKMQWDVSGLEETGAARA  221

Query  1030  LVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHR  1209
             +V  D+N  +W+ KL  V + I    E T   E L   A YL+WI+TG I C E GGH R
Sbjct  222   IVFADENGGSWFEKLAAVANQIGIGREITR--EKLAVCATYLRWISTGTILCVESGGHRR  279

Query  1210  PNRHAEISRLIFCELERILG---RKDATLQEI--LVIRKIHPCLPSFKAEFTASVPLTRI  1374
             PN  A + R IF  LE+I G   R    L E+   V+R IHP LPSF AEFT+SVPLTRI
Sbjct  280   PNGPAMVGRGIFISLEQIQGAMYRHGTNLGEVERAVMRHIHPWLPSFDAEFTSSVPLTRI  339

Query  1375  RDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFK  1554
             RDIAHRNDIP +LK+ IKHTIQNKLHRNAGPEDL+ TE++LERIT   GEYS+ FV +FK
Sbjct  340   RDIAHRNDIPDELKKTIKHTIQNKLHRNAGPEDLITTEVVLERITARDGEYSKDFVREFK  399

Query  1555  IFHHELK  1575
              FH ELK
Sbjct  400   EFHRELK  406



>ref|XP_005648862.1| hypothetical protein COCSUDRAFT_47226 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24318.1| hypothetical protein COCSUDRAFT_47226 [Coccomyxa subellipsoidea 
C-169]
Length=1158

 Score =   247 bits (630),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 155/411 (38%), Positives = 218/411 (53%), Gaps = 47/411 (11%)
 Frame = +1

Query  397   SIMNRPTRGLSSRTICAVSSVETREVEKKGKEK-RSAHENLKLKIWLDHQVEYGEHIAIM  573
             +I  R +RGL  R I +  +V    V    + + +    +  ++      V +GE   I+
Sbjct  7     AINLRTSRGLHRRGIDSKFAVRGSYVTTTRRSRLQCVASDAAVRFTTKRGVAFGEVHKIV  66

Query  574   GSTKELGSWKKNVM--MDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  744
             G    LG W  +    M+W++   W  ++ +  G  +EFK V VG +  + WE G NR  
Sbjct  67    GGHPSLGDWDVDAAPTMEWSDGDVWSVDVSVPAGSSLEFKCVKVG-NGQMEWEGGGNRNF  125

Query  745   KLPAGGSFKMVCQWNVTDKPLELLPLDS--EGEYEAQVLADN-GPVVTKDSTDPDMQVSA  915
             ++  GG  K+  +W         L +D+   G    +  AD+  P    + + P      
Sbjct  126   QVE-GGEVKVGFEWGNEGS----LHVDAHANGASPPESRADSPAPAQEPEQSSPPEGTPG  180

Query  916   FV----------EQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWW  1065
                         ++WQGK+  F+RSN+  G +++  W+  GL    L +V GD+ S +W 
Sbjct  181   NGASPGDDRLPHQRWQGKSTRFMRSNEHGG-DRSGVWNREGLEGAALSIVAGDEKSGSWL  239

Query  1066  RKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF  1245
             +K++V +                        +I+TG I C E GGH+RPN+HAE++R IF
Sbjct  240   QKMQVAK-----------------------SFISTGAIECVEGGGHYRPNKHAELARDIF  276

Query  1246  CELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEI  1425
               LER+L    +  +  L+ RK H  LPSF AEFTAS PLTRIRDIAHRNDIPHDLKQEI
Sbjct  277   RALERLLADPSSAREPKLLARKTHTKLPSFNAEFTASTPLTRIRDIAHRNDIPHDLKQEI  336

Query  1426  KHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             KHTIQNKLHRNAGPEDLVATE ML RI+     YS  FV +F++F  EL+D
Sbjct  337   KHTIQNKLHRNAGPEDLVATEEMLARISAPDAGYSGDFVNEFRVFTGELRD  387



>emb|CEG01409.1| Carbohydrate binding module family 20 [Ostreococcus tauri]
Length=1117

 Score =   245 bits (626),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 149/367 (41%), Positives = 207/367 (56%), Gaps = 18/367 (5%)
 Frame = +1

Query  514   LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDWTEKG-WVSEMELKGG-EPVEF  681
             + +   L  ++ YG+ + ++G    LG+W  +  V + W +   W   + +    + V F
Sbjct  45    ITINFTLRAKLSYGDSLLVVGDHASLGAWSPDNAVALTWNDDDVWRGAVTVDAATQSVAF  104

Query  682   KFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQVLAD  861
             K         + WE GDNRV+++   G+F++   +   +   E+   +     EA+V A 
Sbjct  105   KCATRRASGGVEWEGGDNRVIEIERVGAFEVKGAFG--NGAFEVTSANGT-SVEAEVRAV  161

Query  862   NGPVVTKDSTDPDMQVSAFV-EQWQGKAVSFVRSNDQRGMEKNR-KWDTSGLAEIPLK--  1029
             +G V   ++      + A   ++W G  V  + +N+      ++ +WD SGL E      
Sbjct  162   DGDVDGAEAAATGTWMEANARDKWVGGNVRMMTANEHSDERPSKMQWDVSGLEETGAARA  221

Query  1030  LVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHR  1209
             +V  D+N  +W+ KL  V + I    E T   E L   A YL+WI+TG I C E GGH R
Sbjct  222   IVFADENGGSWFEKLAAVANQIGIGREITR--EKLAVCATYLRWISTGTILCVESGGHRR  279

Query  1210  PNRHAEISRLIFCELERILG---RKDATLQEI--LVIRKIHPCLPSFKAEFTASVPLTRI  1374
             PN  A + R IF  LE+I G   R    L E+   V+R IHP LPSF AEFT+SVPLTRI
Sbjct  280   PNGPAMVGRGIFISLEQIQGAMYRHGTNLGEVERAVMRHIHPWLPSFDAEFTSSVPLTRI  339

Query  1375  RDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFK  1554
             RDIAHRNDIP +LK+ IKHTIQNKLHRNAGPEDL+ TE++LERIT   GEYS+ FV +FK
Sbjct  340   RDIAHRNDIPDELKKTIKHTIQNKLHRNAGPEDLITTEVVLERITARDGEYSKDFVREFK  399

Query  1555  IFHHELK  1575
              FH ELK
Sbjct  400   EFHRELK  406



>gb|KDD72859.1| hypothetical protein H632_c2807p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=386

 Score =   225 bits (574),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 139/348 (40%), Positives = 187/348 (54%), Gaps = 46/348 (13%)
 Frame = +1

Query  616   MDWTEKG-WVSEM--ELKGGEPVEFKFVIV-GKDKNLLWETGDNRVLKLPAGGSFKMVCQ  783
             M+W E   W  E+  E  G    EFK V V G    + WE G NR +      +  +  +
Sbjct  1     MEWGESDVWTCELPGEAAG---AEFKIVQVDGSGSPVEWEPGSNRRVTTEELQALSLSLE  57

Query  784   WN----VTDKP-----LELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQVSAFVEQWQG  936
             W     V ++      LE     S+G+ EA                P  + +    QW G
Sbjct  58    WGRQGFVGNRAAPAHGLEAASSASDGDGEAP---------------PAHEPTDATRQWVG  102

Query  937   KAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVEST  1116
                SF+RSN+    E+  +WD+S +      LVE D  S +W  KL+ +++L+V+  E  
Sbjct  103   SFPSFMRSNEH-SRERRGRWDSSSVQGAARFLVEQDAESPSWLHKLQTLKELLVDRPERA  161

Query  1117  H-RLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRK------  1275
                L+A+  + +Y +WI TG +PC E GGHHRP  HA +SR IF  LE  + +       
Sbjct  162   RPELDAVAAAFVYAQWIATGAVPCVEGGGHHRPCHHATLSRDIFQSLEWAVEQALEGVGA  221

Query  1276  -------DATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHT  1434
                    DA+    ++ RK+   LPSF++EF  S PLT IRDIAHRNDIP DLK EIKHT
Sbjct  222   RQASEPDDASTSLAVLARKLQGRLPSFQSEFVQSTPLTSIRDIAHRNDIPQDLKLEIKHT  281

Query  1435  IQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             IQNKLHRNAGPEDL+A+E ML R+T+ PGEY  +FVE F+ F  EL+D
Sbjct  282   IQNKLHRNAGPEDLIASEAMLARVTQTPGEYEPSFVEAFRSFVSELRD  329



>ref|XP_001697099.1| phosphoglucan water dikinase [Chlamydomonas reinhardtii]
 gb|EDP00354.1| phosphoglucan water dikinase [Chlamydomonas reinhardtii]
Length=978

 Score =   232 bits (592),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 141/352 (40%), Positives = 192/352 (55%), Gaps = 52/352 (15%)
 Frame = +1

Query  541   QVEYGEHIAIMGSTKELGSW--KKNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKN  711
             QV++GE + ++G+   LGSW  KK V + WTE   W +E  +  G  VEFK V +  D  
Sbjct  37    QVDFGESVRLVGNQPFLGSWQPKKAVELRWTEGNIWKTEARVPVGTEVEFKVVKMKPDGE  96

Query  712   LLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQVLADNGPVVTKDST  891
             ++WE GDNR  K  +        + + T          S     A        V++K S 
Sbjct  97    VIWEDGDNRTFKSSS--KSSRSREASATSSVDGGDSSSSSRGSTA--------VLSKSSF  146

Query  892   DPDMQVSAFVEQWQGKAVSFVRS--NDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWW  1065
             + +   S     W G    FVRS   D+R       W T GL+ + L LV+GD+ + +W 
Sbjct  147   EEE---SGSRGAWVGAGPEFVRSRKKDER---PAGTWRTEGLSGVALALVKGDEQAASWL  200

Query  1066  RKLEVVRDLIVENVESTH-RLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLI  1242
             +KL + + L+V++  +   RL+ L+Y  +Y  W+NTG + C E G H+RPN HA ++   
Sbjct  201   KKLGLQKQLLVDSPPACRPRLDDLSYLYVYATWVNTGALACAESGSHYRPNHHANLA---  257

Query  1243  FCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQE  1422
                                        L  F+ EF  S PLTRIRDIAHRNDIP +LK E
Sbjct  258   ---------------------------LAMFRGEFRVSTPLTRIRDIAHRNDIPKELKDE  290

Query  1423  IKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             IKHT+QNKLHR+AGPEDLVATE+ML+R+T  PGEYSEAFVE+FKIF  EL++
Sbjct  291   IKHTLQNKLHRSAGPEDLVATEVMLQRVTARPGEYSEAFVEEFKIFTRELRE  342



>ref|XP_002949771.1| hypothetical protein VOLCADRAFT_90138 [Volvox carteri f. nagariensis]
 gb|EFJ49323.1| hypothetical protein VOLCADRAFT_90138 [Volvox carteri f. nagariensis]
Length=1125

 Score =   232 bits (591),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 147/384 (38%), Positives = 204/384 (53%), Gaps = 65/384 (17%)
 Frame = +1

Query  616   MDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLL-WETGDNRVLKL--PAGGSFKMVCQ  783
             M W +   W +E  +  G  V+FK V    D  ++ WE GDNR  K+  P  G  ++ C 
Sbjct  1     MSWNDGNVWKTETLVPVGADVDFKVVKAKHDSGVITWEAGDNRSFKILGPDFG-LRLTCH  59

Query  784   WN-VTDKPLELLPLDSEGEYE-------AQVLADNGPV--VTKDSTDPDMQVSAFVEQ--  927
             W    D  ++   L S+   E       A+V ++NG    VT  S +     S  V +  
Sbjct  60    WGRPQDMQIDAYKLQSQQRQEGKGAAMAAEVGSNNGATNGVTSVSGNGVAAASRGVSKAS  119

Query  928   ---------------------------------WQGKAVSFVRS--NDQRGMEKNRKWDT  1002
                                              W G    FVRS   D+  + +   W T
Sbjct  120   RNGSSAAAASMSPAGSLVMSRSSLEEESAARTAWVGAEPEFVRSRRKDEEQL-RGGVWRT  178

Query  1003  SGLAEIPLKLVEGDKNSQN---WWRKLEVVRDLIVENVESTH-RLEALTYSAIYLKWINT  1170
              GL+ + L+LV GD+ + +   W +KL + + L+V+   +    LEA++Y  +Y  W+NT
Sbjct  179   EGLSGVALELVRGDEAASSECSWLKKLGLQKRLLVDEAPACRPGLEAMSYLYVYATWVNT  238

Query  1171  GQIPCFEDGGHHRPNRHAEISRLIFCELERILG--------RKDATLQEILVIRKIHPCL  1326
             G +PC E G H+RPN HA ++  +F  LE I+G        R+  T + IL  R++H  L
Sbjct  239   GALPCAESGSHYRPNHHANLALAMFRSLEWIIGDATRGSGAREPVTERLILAARRMHSRL  298

Query  1327  PSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERI  1506
             PSF  +F AS PLTRIRDIAHRNDIP +LK EIKHT+QNKLHR AGPEDLVATE ML+R+
Sbjct  299   PSFSGQFRASTPLTRIRDIAHRNDIPKELKDEIKHTLQNKLHRCAGPEDLVATEAMLQRV  358

Query  1507  TKNPGEYSEAFVEQFKIFHHELKD  1578
             T  PG+YSE+FVE+F+IF  EL++
Sbjct  359   TAVPGQYSESFVEEFRIFTEELRE  382



>ref|XP_001419310.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97603.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=918

 Score =   209 bits (532),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 135/202 (67%), Gaps = 9/202 (4%)
 Frame = +1

Query  991   KWDTSGL--AEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWI  1164
             +WD   L  A     +V  D++  +W+ KL  V + I    E T   + L  SA YL+WI
Sbjct  15    RWDVGNLEEASAARAVVLADESGGSWFEKLAAVANQIGIGKEITR--DKLAVSATYLRWI  72

Query  1165  NTGQIPCFEDGGHHRPNRHAEISRLIFCELERILG---RKDATLQEI--LVIRKIHPCLP  1329
             +TG I C E GGH RPN  A + R IF  +E++ G   R    L E+  +V+R++HP LP
Sbjct  73    STGTIKCVESGGHRRPNGPAMVGRGIFISMEQVQGAMYRHGTDLGEVERVVMRQVHPWLP  132

Query  1330  SFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERIT  1509
             SF  EFT +VPLTRIRDIAHRNDIP DLK+ IKHTIQNKLHRNAGPEDL+ATE++LERIT
Sbjct  133   SFNEEFTNAVPLTRIRDIAHRNDIPEDLKKTIKHTIQNKLHRNAGPEDLIATEVVLERIT  192

Query  1510  KNPGEYSEAFVEQFKIFHHELK  1575
                GEYSE FV +F+ FH ELK
Sbjct  193   AREGEYSEDFVREFREFHRELK  214



>ref|XP_003059536.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56668.1| predicted protein [Micromonas pusilla CCMP1545]
Length=975

 Score =   206 bits (525),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 98/226 (43%), Positives = 145/226 (64%), Gaps = 5/226 (2%)
 Frame = +1

Query  913   AFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDL  1092
             A +  W+G AV   + + +   +++ +W+   L +   ++VEGD++S +W +KL+ +  +
Sbjct  2     ALLSNWRGSAVEL-KGHREHNKDRHNQWNVDNLPDAARRIVEGDRDSPSWRQKLQALEGV  60

Query  1093  IVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGR  1272
             +  +      ++AL Y AIYL W+  G I C EDGGH+RPN HA+ ++ ++  +ER+   
Sbjct  61    LCFDDPGAMDMDALGYGAIYLFWVGVGAIACVEDGGHYRPNHHAKAAQHMYESIERVEKH  120

Query  1273  KDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAH----RNDIPHDLKQEIKHTIQ  1440
                      ++R++HP LP+F AEFT  VPLTRIRDIAH    R+    D++ EIKHTIQ
Sbjct  121   HAGNGHVRALVRRLHPRLPAFTAEFTQQVPLTRIRDIAHGKGDRDGKCRDVRAEIKHTIQ  180

Query  1441  NKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             NKLHR AGPEDLVATE ML ++T    +Y E F+E+F+IFH ELKD
Sbjct  181   NKLHRCAGPEDLVATEAMLAKLTAPGTDYPEEFIEEFRIFHRELKD  226



>ref|XP_007511444.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17565.1| predicted protein [Bathycoccus prasinos]
Length=1340

 Score =   206 bits (525),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 144/229 (63%), Gaps = 7/229 (3%)
 Frame = +1

Query  904   QVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVV  1083
             +V A V  W G  V    +   R      +WDTS L      LV  D+++ +W +KL+ V
Sbjct  379   RVFAAVSNWVGDDVELSNNRKDRSSRDRNRWDTSNLPSFAAALVSNDQSASSWRQKLQSV  438

Query  1084  RDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERI  1263
               L+ EN +     +AL YS IYL WI+ G I C EDG H+RPN HA  +  +F ++E I
Sbjct  439   EKLLCEN-DGNDMEDALAYSTIYLFWISVGAISCVEDGTHYRPNHHAGSAERMFGKIESI  497

Query  1264  LGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPH----DLKQEIKH  1431
              G  +  +  +  IR++HP LP+F AEFT SVPLTRIRDIAH     H    +++QEIKH
Sbjct  498   EGTDN--MSTLAAIRRLHPRLPAFTAEFTQSVPLTRIRDIAHGKGDEHGKCREVRQEIKH  555

Query  1432  TIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             TIQNKLHR AGPEDLVA+E ML+++T    +Y +AFV++F+IF+ ELK+
Sbjct  556   TIQNKLHRCAGPEDLVASEKMLQKLTAPGTDYPKAFVDEFEIFYRELKE  604



>ref|XP_002504762.1| alpha phosphoglucan water dikinase [Micromonas sp. RCC299]
 gb|ACO66020.1| alpha phosphoglucan water dikinase [Micromonas sp. RCC299]
Length=1001

 Score =   200 bits (509),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 141/208 (68%), Gaps = 14/208 (7%)
 Frame = +1

Query  982   KNRKWDTSGLAEIPLKLVE-GDKNSQNWWRKLEVVRDLIVENVESTHR--LEALTYSAIY  1152
             +NR      L E P K +  GDK + +W +KLE+++ ++ +     HR  L  L  +++Y
Sbjct  5     RNRSDGGVNLPEGPAKYIAAGDKEAPSWLQKLELIQSILGQG----HRITLARLGAASVY  60

Query  1153  LKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGR-----KDATLQEILVIRKIH  1317
             L+WI+TG + C EDG HHRPNR AEI+R IF  LE + G       +    E  ++R+IH
Sbjct  61    LRWISTGALFCAEDGNHHRPNRPAEIARDIFVSLETVAGELYKHGAEVGEAERQMMRQIH  120

Query  1318  PCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELML  1497
             P LPSF +EF  S PLTRIR+IAHR+DI  DLK++IKHTIQNKLHRNAGPEDLVATE  +
Sbjct  121   PWLPSFSSEFACSEPLTRIRNIAHRSDISEDLKKQIKHTIQNKLHRNAGPEDLVATEAFI  180

Query  1498  ERIT--KNPGEYSEAFVEQFKIFHHELK  1575
             +RIT   +PGE  +AFV++F +F+ ELK
Sbjct  181   KRITVDAHPGECPQAFVDEFMLFYDELK  208



>ref|XP_001417570.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO95863.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=997

 Score =   200 bits (508),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/235 (45%), Positives = 151/235 (64%), Gaps = 17/235 (7%)
 Frame = +1

Query  913   AFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDL  1092
             A + QW+G+ V   +++   G E+N +W+T  LA+   ++VEGD++S +W +KL++V  L
Sbjct  33    AALNQWRGQEVKL-QTHKGGGGERNLQWNTDNLADAARRIVEGDRDSSSWRQKLQMVEKL  91

Query  1093  IVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERI--L  1266
             I ++      +++L Y+ +YL WI+ G I C EDG H+RPN HA  +  ++  +E     
Sbjct  92    ICDD---GADVDSLAYATVYLFWISVGAIACVEDGTHYRPNHHAGSAERMYGAIEAAERF  148

Query  1267  GRKDATLQEIL-------VIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPH----DL  1413
                 A+  +I        +IR++HP LP+F AEFT SVPLTRIRDIAH     H    ++
Sbjct  149   ANDVASGGDIYRARELRALIRRLHPRLPAFTAEFTQSVPLTRIRDIAHGKGDQHGKCREV  208

Query  1414  KQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             +QEIKHTIQNKLHR AGPEDLVATE ML ++T    +Y E FV +FKIF+ ELK+
Sbjct  209   RQEIKHTIQNKLHRCAGPEDLVATESMLAKLTAPGTDYPEEFVNEFKIFYRELKE  263



>ref|XP_003078935.1| chloroplast alpha-glucan water dikinase isoform 3 (ISS), partial 
[Ostreococcus tauri]
Length=969

 Score =   199 bits (506),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 108/239 (45%), Positives = 150/239 (63%), Gaps = 18/239 (8%)
 Frame = +1

Query  898   DMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLE  1077
             D+Q +A   QW+G+ V   R     G ++N +W+T  LA+   ++VEGD++S +W +KL+
Sbjct  69    DVQFAAL-NQWRGQEVKLQRHKGGYG-DRNLRWNTDNLADAARRIVEGDRDSSSWRQKLQ  126

Query  1078  VVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF----  1245
             +V  ++ +N      +++L Y  +YL WI+ G I C EDG H+RPN HA  +  ++    
Sbjct  127   MVEKVLCDNGAD---VDSLAYVTVYLFWISVGAIMCVEDGTHYRPNHHAGSAERMYGAIE  183

Query  1246  ----CELERILGRKDATLQEI-LVIRKIHPCLPSFKAEFTASVPLTRIRDIAH----RND  1398
                 C  E   G      +E+  +IR++HP LP+F AEFT SVPLTRIRDIAH     N 
Sbjct  184   AAERCAHEIANGGDHHRARELRALIRRLHPRLPAFTAEFTQSVPLTRIRDIAHGKGDTNG  243

Query  1399  IPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELK  1575
                D++QEIKHTIQNKLHR AGPEDLVATE ML ++T    +Y E FV +FKIF+ ELK
Sbjct  244   KCRDVRQEIKHTIQNKLHRCAGPEDLVATEAMLAKLTAPGTDYPEEFVNEFKIFYRELK  302



>emb|CEF97682.1| Pyruvate phosphate dikinase,PEP/pyruvate-binding, partial [Ostreococcus 
tauri]
Length=1107

 Score =   199 bits (507),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 108/240 (45%), Positives = 151/240 (63%), Gaps = 18/240 (8%)
 Frame = +1

Query  898   DMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLE  1077
             D+Q +A   QW+G+ V   R     G ++N +W+T  LA+   ++VEGD++S +W +KL+
Sbjct  143   DVQFAAL-NQWRGQEVKLQRHKGGYG-DRNLRWNTDNLADAARRIVEGDRDSSSWRQKLQ  200

Query  1078  VVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIF----  1245
             +V  ++ +N      +++L Y  +YL WI+ G I C EDG H+RPN HA  +  ++    
Sbjct  201   MVEKVLCDNGAD---VDSLAYVTVYLFWISVGAIMCVEDGTHYRPNHHAGSAERMYGAIE  257

Query  1246  ----CELERILGRKDATLQEI-LVIRKIHPCLPSFKAEFTASVPLTRIRDIAH----RND  1398
                 C  E   G      +E+  +IR++HP LP+F AEFT SVPLTRIRDIAH     N 
Sbjct  258   AAERCAHEIANGGDHHRARELRALIRRLHPRLPAFTAEFTQSVPLTRIRDIAHGKGDTNG  317

Query  1399  IPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
                D++QEIKHTIQNKLHR AGPEDLVATE ML ++T    +Y E FV +FKIF+ ELK+
Sbjct  318   KCRDVRQEIKHTIQNKLHRCAGPEDLVATEAMLAKLTAPGTDYPEEFVNEFKIFYRELKE  377



>gb|KJB71924.1| hypothetical protein B456_011G147600 [Gossypium raimondii]
Length=848

 Score =   193 bits (490),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +1

Query  1291  EILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPE  1470
             E+LVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPE
Sbjct  2     ELLVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPE  61

Query  1471  DLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             DLVATE ML RIT++PG+YSEAFVEQFKIFH ELKD
Sbjct  62    DLVATEAMLARITRDPGQYSEAFVEQFKIFHLELKD  97



>gb|KFG31055.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein, partial [Toxoplasma gondii p89]
Length=441

 Score =   187 bits (474),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 128/198 (65%), Gaps = 15/198 (8%)
 Frame = +1

Query  1027  KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  1176
             +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  126   RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  185

Query  1177  IPCFEDGGHHRPNRHAEISRLIFCELERIL----GRKDATLQEILVI-RKIHPCLPSFKA  1341
             I C EDG H RPN HA +SR +   LE+I+    GR D       ++ R I P LPSF A
Sbjct  186   IVCTEDGRHFRPNHHASLSRELCIILEQIVQEMSGRDDIMADATRILARSIAPSLPSFGA  245

Query  1342  EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPG  1521
              FTAS PLTRIRDIAHRNDIP DLK EIKHT+QNKLHR AGPEDLV  E +L R   NP 
Sbjct  246   PFTASQPLTRIRDIAHRNDIPSDLKNEIKHTLQNKLHRCAGPEDLVTAENLLRRFHTNPS  305

Query  1522  EYSEAFVEQFKIFHHELK  1575
              Y  AFV +F+ F+ EL+
Sbjct  306   AYPHAFVVEFERFYDELR  323



>gb|KFG99968.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein, partial [Toxoplasma gondii VAND]
Length=529

 Score =   186 bits (472),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 128/198 (65%), Gaps = 15/198 (8%)
 Frame = +1

Query  1027  KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  1176
             +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  214   RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  273

Query  1177  IPCFEDGGHHRPNRHAEISRLIFCELERIL----GRKDATLQEILVI-RKIHPCLPSFKA  1341
             I C EDG H RPN HA +SR +   LE+I+    GR D       ++ R I P LPSF A
Sbjct  274   IVCTEDGRHFRPNHHASLSRELCIILEQIVQEMSGRDDIMADATRILARSIAPSLPSFGA  333

Query  1342  EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPG  1521
              FTAS PLTRIRDIAHRNDIP DLK EIKHT+QNKLHR AGPEDLV  E +L R   NP 
Sbjct  334   PFTASQPLTRIRDIAHRNDIPSDLKNEIKHTLQNKLHRCAGPEDLVTAENLLRRFHTNPS  393

Query  1522  EYSEAFVEQFKIFHHELK  1575
              Y  AFV +F+ F+ EL+
Sbjct  394   AYPHAFVVEFERFYDELR  411



>gb|KFH05191.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein, partial [Toxoplasma gondii MAS]
Length=765

 Score =   188 bits (477),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 128/198 (65%), Gaps = 15/198 (8%)
 Frame = +1

Query  1027  KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  1176
             +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  126   RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  185

Query  1177  IPCFEDGGHHRPNRHAEISRLIFCELERIL----GRKDATLQEILVI-RKIHPCLPSFKA  1341
             I C EDG H RPN HA +SR +   LE+I+    GR D       ++ R I P LPSF A
Sbjct  186   IVCTEDGRHFRPNHHASLSRELCIILEQIVQEMSGRDDIMADATRILARSIAPSLPSFGA  245

Query  1342  EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPG  1521
              FTAS PLTRIRDIAHRNDIP DLK EIKHT+QNKLHR AGPEDLV  E +L R   NP 
Sbjct  246   PFTASQPLTRIRDIAHRNDIPSDLKNEIKHTLQNKLHRCAGPEDLVTAENLLRRFHTNPS  305

Query  1522  EYSEAFVEQFKIFHHELK  1575
              Y  AFV +F+ F+ EL+
Sbjct  306   AYPHAFVVEFERFYDELR  323



>ref|XP_002368480.1| phosphoglucan, water dikinase protein, putative [Toxoplasma gondii 
ME49]
Length=1222

 Score =   189 bits (481),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 133/394 (34%), Positives = 190/394 (48%), Gaps = 65/394 (16%)
 Frame = +1

Query  541   QVEYGEHIAIMGSTKELGSWKKNVMMDW-----TEKGWVSE--MELKGGEPVEFKFVIVG  699
             Q   G+ + ++GS   LGSW  +  +       T   W S   + +   + VEFKFVI+ 
Sbjct  17    QTHPGQTLWVVGSVPALGSWSLHAALQLETGPDTFPRWKSRDGVRVPRNQDVEFKFVIMS  76

Query  700   KDKN-LLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLP-LDSEGEYEAQVLADNGPV  873
             ++++ ++WE                 +C+W     P  L     + G   + V  D    
Sbjct  77    QNRDYVVWE----------------QICEWQSETTPWVLASKAGTVGLKLSPVAGDQQQQ  120

Query  874   VTKDSTDPDMQVSAFVEQWQGK---------------------AVSFVRSNDQRGMEKNR  990
              T     PD   S  +                           +V      +  G  + R
Sbjct  121   PTWMGRSPDTAASPVLRLSSHLDLLSSPSVSPSTSSLGGISPFSVGRRVPENAEGEARER  180

Query  991   KWDTSGLAEIP----LKLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLE  1128
               +    A +P     +LVEG++ +++W  KLEVV++++   +          E+   ++
Sbjct  181   SEEGPESATLPSSALQRLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLID  240

Query  1129  ALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERIL----GRKDATLQEI  1296
             +L Y +IYL +++ G I C EDG H RPN HA +SR +   LE+I+    GR D      
Sbjct  241   SLAYCSIYLHFVSQGDIVCTEDGRHFRPNHHASLSRELCIILEQIVQEMSGRDDIMADAT  300

Query  1297  LVI-RKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPED  1473
              ++ R I P LPSF A FTAS PLTRIRDIAHRNDIP DLK EIKHT+QNKLHR AGPED
Sbjct  301   RILARSIAPSLPSFGAPFTASQPLTRIRDIAHRNDIPSDLKNEIKHTLQNKLHRCAGPED  360

Query  1474  LVATELMLERITKNPGEYSEAFVEQFKIFHHELK  1575
             LV  E +L R   NP  Y  AFV +F+ F+ EL+
Sbjct  361   LVTAENLLRRFHTNPSAYPHAFVVEFERFYDELR  394



>gb|KFG42300.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein, partial [Toxoplasma gondii GAB2-2007-GAL-DOM2]
Length=965

 Score =   187 bits (476),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 128/198 (65%), Gaps = 15/198 (8%)
 Frame = +1

Query  1027  KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  1176
             +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  214   RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  273

Query  1177  IPCFEDGGHHRPNRHAEISRLIFCELERIL----GRKDATLQEILVI-RKIHPCLPSFKA  1341
             I C EDG H RPN HA +SR +   LE+I+    GR D       ++ R I P LPSF A
Sbjct  274   IVCTEDGRHFRPNHHASLSRELCIILEQIVQEMSGRDDIMADATRILARSIAPSLPSFGA  333

Query  1342  EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPG  1521
              FTAS PLTRIRDIAHRNDIP DLK EIKHT+QNKLHR AGPEDLV  E +L R   NP 
Sbjct  334   PFTASQPLTRIRDIAHRNDIPSDLKNEIKHTLQNKLHRCAGPEDLVTAENLLRRFHTNPS  393

Query  1522  EYSEAFVEQFKIFHHELK  1575
              Y  AFV +F+ F+ EL+
Sbjct  394   AYPHAFVVEFERFYDELR  411



>gb|EPT28056.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Toxoplasma gondii ME49]
Length=1239

 Score =   188 bits (478),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 128/198 (65%), Gaps = 15/198 (8%)
 Frame = +1

Query  1027  KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  1176
             +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  214   RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  273

Query  1177  IPCFEDGGHHRPNRHAEISRLIFCELERIL----GRKDATLQEILVI-RKIHPCLPSFKA  1341
             I C EDG H RPN HA +SR +   LE+I+    GR D       ++ R I P LPSF A
Sbjct  274   IVCTEDGRHFRPNHHASLSRELCIILEQIVQEMSGRDDIMADATRILARSIAPSLPSFGA  333

Query  1342  EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPG  1521
              FTAS PLTRIRDIAHRNDIP DLK EIKHT+QNKLHR AGPEDLV  E +L R   NP 
Sbjct  334   PFTASQPLTRIRDIAHRNDIPSDLKNEIKHTLQNKLHRCAGPEDLVTAENLLRRFHTNPS  393

Query  1522  EYSEAFVEQFKIFHHELK  1575
              Y  AFV +F+ F+ EL+
Sbjct  394   AYPHAFVVEFERFYDELR  411



>gb|ESS33912.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Toxoplasma gondii VEG]
Length=1239

 Score =   188 bits (477),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 128/198 (65%), Gaps = 15/198 (8%)
 Frame = +1

Query  1027  KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  1176
             +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  214   RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  273

Query  1177  IPCFEDGGHHRPNRHAEISRLIFCELERIL----GRKDATLQEILVI-RKIHPCLPSFKA  1341
             I C EDG H RPN HA +SR +   LE+I+    GR D       ++ R I P LPSF A
Sbjct  274   IVCTEDGRHFRPNHHASLSRELCIILEQIVQEMSGRDDIMADATRILARSIAPSLPSFGA  333

Query  1342  EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPG  1521
              FTAS PLTRIRDIAHRNDIP DLK EIKHT+QNKLHR AGPEDLV  E +L R   NP 
Sbjct  334   PFTASQPLTRIRDIAHRNDIPSDLKNEIKHTLQNKLHRCAGPEDLVTAENLLRRFHTNPS  393

Query  1522  EYSEAFVEQFKIFHHELK  1575
              Y  AFV +F+ F+ EL+
Sbjct  394   AYPHAFVVEFERFYDELR  411



>gb|EPR59823.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Toxoplasma gondii GT1]
Length=1239

 Score =   188 bits (477),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 128/198 (65%), Gaps = 15/198 (8%)
 Frame = +1

Query  1027  KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  1176
             +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  214   RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  273

Query  1177  IPCFEDGGHHRPNRHAEISRLIFCELERIL----GRKDATLQEILVI-RKIHPCLPSFKA  1341
             I C EDG H RPN HA +SR +   LE+I+    GR D       ++ R I P LPSF A
Sbjct  274   IVCTEDGRHFRPNHHASLSRELCIILEQIVQEMSGRDDIMADATRILARSIAPSLPSFGA  333

Query  1342  EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPG  1521
              FTAS PLTRIRDIAHRNDIP DLK EIKHT+QNKLHR AGPEDLV  E +L R   NP 
Sbjct  334   PFTASQPLTRIRDIAHRNDIPSDLKNEIKHTLQNKLHRCAGPEDLVTAENLLRRFHTNPS  393

Query  1522  EYSEAFVEQFKIFHHELK  1575
              Y  AFV +F+ F+ EL+
Sbjct  394   AYPHAFVVEFERFYDELR  411



>ref|XP_008889223.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Hammondia hammondi]
 gb|KEP60361.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Hammondia hammondi]
Length=1239

 Score =   188 bits (477),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 135/404 (33%), Positives = 200/404 (50%), Gaps = 68/404 (17%)
 Frame = +1

Query  541   QVEYGEHIAIMGSTKELGSWKKNVMMDW-----TEKGWVSE--MELKGGEPVEFKFVIVG  699
             Q   G+ + ++GS   LGSW  +  +       T   W S   + +   + VEFKFVI+ 
Sbjct  17    QTHPGQTLWVVGSVPALGSWSLHAALQLETRPDTFPSWKSRDGVRVPRNQEVEFKFVIMS  76

Query  700   KDKN-LLWETGDNR--------VLKLPAGGSFKMVCQWNVTDKP----LELLPLDSEGEY  840
             ++++ ++WE   NR        + K   G        W +  KP    L+L P+  + + 
Sbjct  77    QNRDYVVWEQIYNRKICTDSPIIYKSSFGEWQSETTPWALPSKPATVGLKLSPIAGDQQQ  136

Query  841   EAQVLADNGPVVTK------------------------DSTDPDMQVSAFVEQWQGKAVS  948
             +   +  +    T                           T P        E  +G+A  
Sbjct  137   QPTWMGRSPDTATSPVLRLSSQLDLLSSPSVSPSTSSLGGTSPFSVGRRVPENAEGEACE  196

Query  949   FVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENV-------  1107
               RS   R   ++    +S L     +LVEG++ +++W  KLEVV++++   +       
Sbjct  197   --RSEKAR---ESVTLPSSALQ----RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRS  247

Query  1108  ---ESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERI---LG  1269
                E+   +++L Y +IYL +++ G I C EDG H RPN HA +SR +   LE+I   + 
Sbjct  248   SPQETVTLIDSLAYCSIYLHFVSQGNIVCTEDGRHFRPNHHANLSRELCILLEQIVQEVS  307

Query  1270  RKDATLQEI--LVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQN  1443
              +D  + +   ++ R I P LPSF A FTAS PLTRIRDIAHRNDIP +LK EIKHT+QN
Sbjct  308   SRDDIMADATRILARSIAPSLPSFGAPFTASQPLTRIRDIAHRNDIPSNLKNEIKHTLQN  367

Query  1444  KLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELK  1575
             KLHR AGPEDLV  E +L R   NP  Y  AFV +F+ F+ EL+
Sbjct  368   KLHRCAGPEDLVTAENLLRRFHTNPSAYPHAFVVEFERFYDELR  411



>gb|KFG41384.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Toxoplasma gondii FOU]
Length=535

 Score =   182 bits (462),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 125/194 (64%), Gaps = 15/194 (8%)
 Frame = +1

Query  1027  KLVEGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIYLKWINTGQ  1176
             +LVEG++ +++W  KLEVV++++   +          E+   +++L Y +IYL +++ G 
Sbjct  214   RLVEGEQTARSWREKLEVVKNVLAAALKEGKSRCNPQETVTLIDSLAYCSIYLHFVSQGD  273

Query  1177  IPCFEDGGHHRPNRHAEISRLIFCELERIL----GRKDATLQEILVI-RKIHPCLPSFKA  1341
             I C EDG H RPN HA +SR +   LE+I+    GR D       ++ R I P LPSF A
Sbjct  274   IVCTEDGRHFRPNHHASLSRELCIILEQIVQEMSGRDDIMADATRILARSIAPSLPSFGA  333

Query  1342  EFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPG  1521
              FTAS PLTRIRDIAHRNDIP DLK EIKHT+QNKLHR AGPEDLV  E +L R   NP 
Sbjct  334   PFTASQPLTRIRDIAHRNDIPSDLKNEIKHTLQNKLHRCAGPEDLVTAENLLRRFHTNPS  393

Query  1522  EYSEAFVEQFKIFH  1563
              Y  AFV +F+ F+
Sbjct  394   AYPHAFVVEFERFY  407



>gb|ABR17706.1| unknown [Picea sitchensis]
Length=328

 Score =   172 bits (435),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 100/270 (37%), Positives = 151/270 (56%), Gaps = 17/270 (6%)
 Frame = +1

Query  307   RHIPSARRTSLGKL--KFSEPRLILEP-QGIPGSIMNRPTRGLSSRTICAVSSVET-REV  474
             RH P   + +  KL  K+SE RLI  P +G     +N       +  +C+ + + +    
Sbjct  23    RHNPDEPKVTCMKLGRKYSEKRLIFLPYEGF--RPLNTSFSANRASILCSNTGIASPHRD  80

Query  475   EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEME  654
             EK G   R     + L   LDHQV +GEH A++GS+K  G+WKK +MM W+E  W+ ++E
Sbjct  81    EKMGI--RCGERKVNLYFKLDHQVSFGEHHAVLGSSKAFGAWKKKLMMSWSESEWILDLE  138

Query  655   LKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD---  825
              +GGE VE+KFVIV  D  ++WE G NRVL LP  G F++VC W+ T + L+L  +D   
Sbjct  139   TRGGEKVEYKFVIVSGDGKIIWEGGHNRVLALPKEGRFEIVCHWDKTQEALDLQRMDRAL  198

Query  826   ---SEGEYEAQVLADNG-PVVTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGMEKNRK  993
                   + + +  + NG P V  ++ +   + S FV+ WQ K ++F+R N     E+ R 
Sbjct  199   AALQTLDMKKEATSSNGKPQV--ETYENVAEASPFVQGWQVKNITFMRYNGHSTRERKRS  256

Query  994   WDTSGLAEIPLKLVEGDKNSQNWWRKLEVV  1083
             W+T+ L     KLVE D+N +NWWRK+  +
Sbjct  257   WNTTCLEGSAGKLVEVDQNKRNWWRKVRFI  286



>ref|XP_005716854.1| Phosphoglucan water dikinase, PWD [Chondrus crispus]
 emb|CDF37035.1| Phosphoglucan water dikinase, PWD [Chondrus crispus]
Length=1033

 Score =   179 bits (453),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 118/351 (34%), Positives = 169/351 (48%), Gaps = 45/351 (13%)
 Frame = +1

Query  553   GEHIAIMGSTKELGSWKKNVMMDWTEK--GWVSEMELKGGEPVEFKFVIVGKDKNLLWET  726
             GE +A +GS       +  V+    +    W + + L     VE+K+VI+     + WE 
Sbjct  16    GEAVAAIGSWSAWDKHRPAVLSTTADTFPKWTASVPLPTSASVEYKYVIIRDGHVIRWEQ  75

Query  727   GDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQ  906
             G       P G + ++  +               + +     + D  P V       D  
Sbjct  76    G-------PKGVNREVALE---------------DADASTDDIFDRIPAVRTARIQKDPP  113

Query  907   VSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVR  1086
              +     W    VS            + K+  + L ++   +V      ++W ++L  VR
Sbjct  114   SAPQSRPWASDGVS---------ANGHSKFPVA-LDDLERAIVHLTNEKRSWRQRLSFVR  163

Query  1087  DLIVENVEST------HRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFC  1248
              L  E+  ++        ++ L   +++L ++ +GQ+ C EDGGHHRPN HA  +R +  
Sbjct  164   SLFTEDSAASKNSFNPQNIDHLATVSVFLTFLASGQVRCEEDGGHHRPNHHANEARQLEA  223

Query  1249  ELERILG---RKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQ  1419
              L R+     RK        VIRKI P LPS+  +FTASVPLTRIRDIAHR DIPHD KQ
Sbjct  224   ALARVAKSAPRKGTDSYTPYVIRKIFPQLPSYAPQFTASVPLTRIRDIAHRGDIPHDFKQ  283

Query  1420  EIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHHEL  1572
             EIKHT+QNKLHR AGPEDL  +  +LERI    G++S    EQF IFH EL
Sbjct  284   EIKHTLQNKLHRCAGPEDLQTSARLLERIQH--GDFSGGLKEQFAIFHAEL  332



>emb|CDI76079.1| Carbohydrate-binding module family 20 protein, related [Eimeria 
acervulina]
Length=531

 Score =   167 bits (422),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 122/198 (62%), Gaps = 18/198 (9%)
 Frame = +1

Query  1030  LVEGDKNSQNWWRKLEVVRDLIVENVESTHRL------------EALTYSAIYLKWINTG  1173
             +VEG+ ++ +W  KLE+V+  +V+N      L            +AL Y+ +Y   ++ G
Sbjct  246   IVEGNASAPSWGAKLELVKS-VVKNAGDGSSLAKASAEQLVVAIDALCYAGVYADLVSQG  304

Query  1174  QIPCFEDGGHHRPNRHAEISRLIFCELERIL----GRKDATLQEI-LVIRKIHPCLPSFK  1338
              + C EDG H RPNRHA ISR +   LE +L     R D     + LV R+I P LPSF 
Sbjct  305   ALRCSEDGRHLRPNRHANISREVSVHLELLLQAVASRTDDFASVLRLVARRILPSLPSFA  364

Query  1339  AEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNP  1518
             A F A+ PLTRIR+IAHR+DIP +LK EIKH IQNKLHR AGPEDL AT+ +L+R+    
Sbjct  365   AAFRAAQPLTRIRNIAHRDDIPMELKNEIKHKIQNKLHRCAGPEDLEATQQLLQRVHAAR  424

Query  1519  GEYSEAFVEQFKIFHHEL  1572
             G+YS  FV + + F+ EL
Sbjct  425   GQYSSGFVSELETFYKEL  442



>ref|XP_005827807.1| hypothetical protein GUITHDRAFT_164559 [Guillardia theta CCMP2712]
 gb|EKX40827.1| hypothetical protein GUITHDRAFT_164559 [Guillardia theta CCMP2712]
Length=1011

 Score =   171 bits (432),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 116/338 (34%), Positives = 174/338 (51%), Gaps = 56/338 (17%)
 Frame = +1

Query  637   WVSEMELKGGEPVEFKFVIVGKDKNLL-WE---TGDNRVLKLPAGGSFKMVCQWNVTDKP  804
             W + + L  GE +E+K+ I+G    +L WE   +  NR L          V    VT   
Sbjct  9     WKASVSLNEGENIEYKYCIIGDSGKVLRWEGQGSSSNRKL---------TVTIPKVTSDV  59

Query  805   LELLPLDSEGEYEAQVLADNGPV-VTKDSTDPDMQVSAFVEQWQGKAVSFVRSNDQRGME  981
             L      S+GE+       + PV +    +      S+ +E+  G +       D     
Sbjct  60    L------SKGEFH------DSPVGIDAGGSGSHSHSSSKIERSHGTS-----KRDDHKPS  102

Query  982   KNRKWDTSG--LAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTH------------  1119
              +  W  +   L +    +V+ ++ + +W +KLE V+ L  +  +S              
Sbjct  103   GHVDWQITSKELDKFGAAIVKANQENGSWRQKLEFVKTLFYDKSDSDPCTPGDLATASGF  162

Query  1120  -----RLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDAT  1284
                      L   AIYL +++TGQ+PC++ GGH+RPNRHA ++  I   L++I      T
Sbjct  163   NQQEPETSHLAMIAIYLHFLSTGQVPCYDVGGHNRPNRHAMLASAIDEALDKI----KKT  218

Query  1285  LQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAG  1464
              +   VIRKIHP LPS+ + +TA VPLTRIRDIAHR+DIP ++K +IKH +QNKLHR AG
Sbjct  219   PENAYVIRKIHPLLPSYSSAYTAQVPLTRIRDIAHRSDIPKEMKDDIKHNLQNKLHRCAG  278

Query  1465  PEDLVATELMLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             PEDLV  E ++++     G YS AF+EQ +IF  EL++
Sbjct  279   PEDLVTAERIMKQ--AESGHYSAAFMEQMRIFMVELRE  314



>emb|CDJ47310.1| Carbohydrate-binding module family 20 protein, related [Eimeria 
brunetti]
Length=540

 Score =   155 bits (392),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 120/204 (59%), Gaps = 26/204 (13%)
 Frame = +1

Query  1030  LVEGDKNSQNWWRKLEVVRDLI-------------VENVESTHRLEALTYSAIYLKWINT  1170
             +VEG+  + +W  KLE+V+ +I              E V +   ++AL YS +YL++I  
Sbjct  255   IVEGNAAAASWGAKLEIVKKIIQKIGDGSSFSKAPAEKVVAA--IDALCYSGVYLQFIKQ  312

Query  1171  GQIPCFEDGGHHRPNRHAEISRLIFCELERIL------GRKDATLQEILVIRKIHPCLPS  1332
             G I C EDG HHRPN HA ISR +   LE +L      G   A++ +I V R I  CLPS
Sbjct  313   GLICCSEDGEHHRPNVHANISRELSIHLELLLQGVASRGDDFASVLQI-VARDIPSCLPS  371

Query  1333  FKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERI--  1506
             F A +  S PLTRIR+IAHRNDIP +LK EIK  IQNK+HR AGPEDL AT L+L+R+  
Sbjct  372   FAAAYRVSEPLTRIRNIAHRNDIPLELKNEIKKKIQNKIHRCAGPEDLEATRLLLQRMHA  431

Query  1507  --TKNPGEYSEAFVEQFKIFHHEL  1572
                     Y   F+ + + F+ EL
Sbjct  432   AAAAAAATYPPDFLSELETFYKEL  455



>gb|EJY83942.1| hypothetical protein OXYTRI_18322 [Oxytricha trifallax]
Length=1101

 Score =   156 bits (394),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 117/375 (31%), Positives = 183/375 (49%), Gaps = 45/375 (12%)
 Frame = +1

Query  553   GEHIAIMGSTKELGSWKKNVMMDW-TEKG----W--VSEMELKGGEP---VEFKFVIVGK  702
             GE++ I+G+   L +W     +   T+K     W  V  ++L   E    +E+K++I  +
Sbjct  15    GENLFIVGNIPSLSNWNARSALPMNTDKSRYPQWDSVQSIQLNDVEALGQIEYKYII-KQ  73

Query  703   DKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQVLADNGPVV-T  879
             ++ + WE G NRV+ L     + +  +  ++D+   +     + E  +Q     G ++ T
Sbjct  74    NETVRWEDGKNRVVNLQ---QYHLGQEIIISDQAFNMDGASPQIEIASQ--TSQGLIIPT  128

Query  880   KDSTDPDMQVSAFVEQWQGKAVSFV--------RSND-------------QRGMEKNRKW  996
               + +       F +   G  +  +        +SN              Q     N+K 
Sbjct  129   NQTVNTKATCGQFYQNLGGDNLDTISEHPFEESKSNSSQEIIQTQTPQISQNPRPANQKQ  188

Query  997   DTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVE-STHRLEALTYSAIYLKWINTG  1173
               +   +I  +L   +     W +KLE+V  L+ +  E      E L   A YL ++N+ 
Sbjct  189   SDTLAQDIISQLQSLNAEKGTWKQKLEIVAQLVEKYKEFKNFPTEGLAILAAYLYFVNSH  248

Query  1174  QIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTA  1353
             QI C E+G H RPN HA I+     +L R L  +  T +   +IR +   LPSF  +FT 
Sbjct  249   QIKCAENGTHFRPNNHANIA----YDLYRTLDNELTTEENSFIIRSLKKNLPSFADQFTQ  304

Query  1354  SVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSE  1533
             +VPLTRIRDIAHRNDIP DLK +IK+ +QNKLHR A P DL   E +++R+    G YS 
Sbjct  305   TVPLTRIRDIAHRNDIPSDLKSDIKNRLQNKLHRCADPGDLKTCEELIQRVRN--GNYSG  362

Query  1534  AFVEQFKIFHHELKD  1578
              F  QF+IF+ ELK+
Sbjct  363   DFKNQFEIFYEELKE  377



>gb|KEH44553.1| phosphoglucan, water dikinase, putative [Medicago truncatula]
Length=1226

 Score =   155 bits (393),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 87/142 (61%), Gaps = 42/142 (30%)
 Frame = +1

Query  1153  LKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPS  1332
              +WINTGQIPCFEDGGHHRPNRHAEISRLIF +LE+   RKD + Q              
Sbjct  377   FRWINTGQIPCFEDGGHHRPNRHAEISRLIFRKLEQHTSRKDISPQ--------------  422

Query  1333  FKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITK  1512
                                          +IKHTIQNKLHR AGPEDLVATE ML +ITK
Sbjct  423   ----------------------------TQIKHTIQNKLHRYAGPEDLVATEAMLAKITK  454

Query  1513  NPGEYSEAFVEQFKIFHHELKD  1578
             NPGEYSE FVEQFKIFH ELKD
Sbjct  455   NPGEYSETFVEQFKIFHRELKD  476



>emb|CDW77583.1| water chloroplastic-like [Stylonychia lemnae]
Length=991

 Score =   153 bits (386),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 111/364 (30%), Positives = 175/364 (48%), Gaps = 69/364 (19%)
 Frame = +1

Query  547   EYGEHIAIMGSTKELGSW--KKNVMMD--------WTEKGWVSEMELKGGEPVEFKFVIV  696
             ++GE + + G+  +L +W  K+  +M         W     +   + +   P E+K++I 
Sbjct  13    KFGESVHVTGNIPQLSNWNAKQAPLMSTDASRYPQWDSMSSIILNDEQALSPFEYKYII-  71

Query  697   GKDKNLLWETGDNRVLKLPAGGSFKMVC----QWNVTDKPLELLPLDSEGEYEAQVLADN  864
              ++ N+ WE G+NRVL L +    K V      ++    P  L  +D E E ++ +  D+
Sbjct  72    NQNDNIKWEQGNNRVLNLSSHLGEKEVLIIDHGYDQKAAPKILDTIDEEEEKQSDISQDH  131

Query  865   GPVVTKDSTDPDMQ-----VSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLK  1029
                    S   ++Q     V   +E+ +G        N ++G                  
Sbjct  132   ILPAKPKSLQQNLQPLSTLVRDIIEELKGL-------NAEKG------------------  166

Query  1030  LVEGDKNSQNWWRKLEVVRDLIVE-NVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHH  1206
                       W +KLE+V  L+ +    S    E L   + YL ++N+ QI C E+G H 
Sbjct  167   ---------TWKQKLEIVAQLVDKFKGYSNFPTEGLAILSAYLYFVNSHQIKCSENGTHF  217

Query  1207  RPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIA  1386
             RPN HA I+  ++  L+R L  ++ T             +PSF  ++T +VPLTRIRDIA
Sbjct  218   RPNNHANIAYQLYQTLDRELTTEENTF------------IPSFADQYTQTVPLTRIRDIA  265

Query  1387  HRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQFKIFHH  1566
             HR DIP DLK +IKH +QNKLHR A P DL   E +++R+    G YS  F +QF++F+ 
Sbjct  266   HRGDIPQDLKNDIKHRLQNKLHRCADPGDLKTCEELIQRV--RSGNYSGEFKQQFELFYE  323

Query  1567  ELKD  1578
             ELK+
Sbjct  324   ELKE  327



>gb|ABK26307.1| unknown [Picea sitchensis]
Length=237

 Score =   141 bits (355),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 83/220 (38%), Positives = 122/220 (55%), Gaps = 22/220 (10%)
 Frame = +1

Query  328  RTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSV-ETREVEKKGKEKRSA  504
            +T  G+ K S  RLI  P G   S +N          +C+ + +  T+  EK G   RS 
Sbjct  25   KTIFGR-KCSGKRLIFLPSG-GFSPLNTSFSANRGSILCSSAGIASTQRSEKMGI--RSG  80

Query  505  HENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFK  684
               ++L   LDHQV +GE+ AI+GS+K LG+WKK +MM W+E GW+ ++E  GGE VE+K
Sbjct  81   EGKVQLHFRLDHQVRFGENHAILGSSKALGAWKKKLMMSWSESGWILDLETGGGEKVEYK  140

Query  685  FVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQVLADN  864
            F+IV +D  ++WE G NRVL+LP  G+F++VC W+ T + L L   D        + A  
Sbjct  141  FLIVSRDGKIIWEGGCNRVLELPKEGNFEIVCHWDKTQEALNLQGTDRA------LAASQ  194

Query  865  GPVVTKDSTDPD-----------MQVSAFVEQWQGKAVSF  951
               + KD+T  +            + S FV+ WQGK ++F
Sbjct  195  TLNIKKDATSSNGKPQVESYGNVAEASPFVQGWQGKDINF  234



>ref|XP_011129379.1| putative phosphoglucan, water dikinase [Gregarina niphandrodes]
 gb|EZG78247.1| putative phosphoglucan, water dikinase [Gregarina niphandrodes]
Length=1159

 Score =   128 bits (322),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 73/188 (39%), Positives = 106/188 (56%), Gaps = 15/188 (8%)
 Frame = +1

Query  1048  NSQNWWRKLEVVRDLIVEN-VESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHRPNRHA  1224
             N+++   +LE + +++      +   L  L   ++Y +W+ T  + C EDG H RPN  A
Sbjct  190   NTKSLRERLEFIANVVTSRPASAVEMLRTLALLSLYWEWVATRVLFCGEDGRHFRPNHVA  249

Query  1225  EISRLIFCELERIL---GRKDATLQEI---------LVIRKIHPCLPSFKAEFTASVPLT  1368
             + S+ IF  L   L   G+ DA   +          +V R++   LPSF A+FTA+VP+T
Sbjct  250   QSSKEIFDALVAYLDPAGKGDAHKGDTHSWALDVTEMVARRLMKLLPSFDAKFTATVPMT  309

Query  1369  RIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKNPGEYSEAFVEQ  1548
             RIRDIAHRNDIP D+K EIK T+QNKLHR A P+DLV    +L++        +  F+ +
Sbjct  310   RIRDIAHRNDIPSDVKTEIKTTLQNKLHRCASPQDLVTCRSLLDKYRAQ--NLNPDFLSE  367

Query  1549  FKIFHHEL  1572
             F  F  EL
Sbjct  368   FTAFESEL  375



>ref|XP_002502953.1| carbohydrate-binding module family 20 protein [Micromonas sp. 
RCC299]
 gb|ACO64211.1| carbohydrate-binding module family 20 protein [Micromonas sp. 
RCC299]
Length=1625

 Score =   119 bits (298),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 69/190 (36%), Positives = 102/190 (54%), Gaps = 10/190 (5%)
 Frame = +1

Query  1030  LVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYLKWINTGQIPCFEDGGHHR  1209
             L   D  +  W  KLE+V  +I    E T  ++ +    IY++W+    + C ED G   
Sbjct  672   LAVADDAASTWLEKLEIVSGMIGTGNEVT--VDKIAACCIYVRWLGNCDVDCGEDDGRRG  729

Query  1210  PNRHAEISRLIFCELERILG---RKDATLQEI--LVIRKIHPCLPSFKAEFT-ASVPLTR  1371
             P     ++R IF  LE   G   ++   + E+   ++R+I P LPSF  EF     P+ R
Sbjct  730   PAAACGVARDIFVNLETTAGELYKRGTRVGEVERALMRQIQPWLPSFADEFERGGAPMAR  789

Query  1372  IRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITKN--PGEYSEAFVE  1545
             IR I    ++P  L++EI  +I+NKL RNAGP  L ATE ML+ I ++  PG+Y + FV+
Sbjct  790   IRGITSMPEVPQPLREEISKSIENKLARNAGPVALFATEAMLKTIKEDAYPGQYPQRFVD  849

Query  1546  QFKIFHHELK  1575
             +F  F  ELK
Sbjct  850   EFVAFTQELK  859



>ref|XP_003881249.1| phosphoenolpyruvate synthase, related [Neospora caninum Liverpool]
 emb|CBZ51216.1| phosphoenolpyruvate synthase, related [Neospora caninum Liverpool]
Length=1180

 Score =   114 bits (285),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 101/381 (27%), Positives = 168/381 (44%), Gaps = 92/381 (24%)
 Frame = +1

Query  553   GEHIAIMGSTKELGSWK----------KNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGK  702
             G+ + ++G+   LGSW+          +     W   G   E+ +   + VEFKFVI+ +
Sbjct  21    GQTVWVVGNASALGSWRLDDALQLETGRESFPTWKSAG---EVRIPRAQDVEFKFVIMSQ  77

Query  703   DKN-LLW-ETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQVLADNGPVV  876
              K+ ++W + G+ +  +LP       V    +    L+L P  S+G+++        P  
Sbjct  78    HKDYVVWEQIGEWQSEQLP------WVPPSKILTVDLKLSP-GSDGQHQPPTWMGRSPD-  129

Query  877   TKDSTDPDMQVSAFVEQWQGKAVSFVR--------------SNDQRGMEKNRKW---DTS  1005
             T  S  P +     V        +                 + D+ G  K R     +  
Sbjct  130   TAASPLPRLSSRLDVLSSPTSLSTSSLGGSPFSVASHLLDPAADEEGETKERNQKAPEGP  189

Query  1006  GLAEIPLKLV-EGDKNSQNWWRKLEVVRDLIVENV----------ESTHRLEALTYSAIY  1152
                  PL+LV +G++ +++W  KLEVV+ ++   +          ++ + +++L Y +IY
Sbjct  190   PPGASPLRLVVDGERGAKSWREKLEVVKAVLTAALKDGKFRYNPQDTVNLIDSLAYCSIY  249

Query  1153  LKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERILGRKDATLQEILVIRKIHPCLPS  1332
             L++I+ G I C EDG H RPN HA +SR +   LE+I+                      
Sbjct  250   LRFISQGDIVCTEDGRHFRPNHHANLSRELCVLLEQIM----------------------  287

Query  1333  FKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLVATELMLERITK  1512
                           ++ A R+D+      EIKH +QNKLHR AGPEDLV  E +L+R   
Sbjct  288   --------------QEAASRDDV-----MEIKHALQNKLHRCAGPEDLVTAEKLLQRFHS  328

Query  1513  NPGEYSEAFVEQFKIFHHELK  1575
              PG Y   F+ +F+ F+ EL+
Sbjct  329   TPGRYPHEFIVEFERFYDELR  349



>emb|CDJ67755.1| phosphoglucan, water dikinase protein, putative [Eimeria necatrix]
Length=1203

 Score =   111 bits (278),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 75/225 (33%), Positives = 111/225 (49%), Gaps = 44/225 (20%)
 Frame = +1

Query  1030  LVEGDKNSQNWWRKLEVVRDLIVENVESTHR--------------------------LEA  1131
             LVEGD  + +W  KLE+++ +++     +                            ++A
Sbjct  314   LVEGDAAAPSWGAKLELLKSVLLSAAPLSSSSSSSSSSSSSSSSSLSRAPAELLVSVIDA  373

Query  1132  LTYSAIYLKWINTGQIPCFEDGGHHRPNRHAEISRLIFCELERIL---GRKDATLQEILV  1302
             + ++ IY + +    I C EDG H RPNRH+ ++R +   LE +L   G +   L  +L 
Sbjct  374   VCFAGIYSELLQQRIIICEEDGKHFRPNRHSNLAREVSVHLELLLHALGSRSDDLAAVLR  433

Query  1303  IRKIHPCLPS--FKAEFTASVPLTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDL  1476
             +           F A F A+ PLTRIR IAHRNDI  +LK+EIK+ IQNKLHR AGPEDL
Sbjct  434   LLLRLLLPSLPSFAAAFRAAQPLTRIRSIAHRNDISLELKKEIKNKIQNKLHRCAGPEDL  493

Query  1477  VATELMLERI-------------TKNPGEYSEAFVEQFKIFHHEL  1572
               T  +L+R+              +   + SE FV + ++F  EL
Sbjct  494   ETTRQLLQRVHQQQQQQQQQQQQQQQQQQVSEGFVRELELFFEEL  538



>ref|XP_007513823.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16348.1| predicted protein [Bathycoccus prasinos]
Length=1449

 Score = 95.1 bits (235),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 70/232 (30%), Positives = 110/232 (47%), Gaps = 33/232 (14%)
 Frame = +1

Query  976   MEKNRKWDTSGLAEIPLKLVEGDKNSQNWWRKLEVVRDLIVENVESTHRLEALTYSAIYL  1155
             + + R  D S      +++   D  +  W  KLE V+ ++  NV      E L  +A YL
Sbjct  349   IRRKRIIDESKFTPSVVRVANVDTMNSKWHLKLESVKGIVGFNVPELDD-EKLATAATYL  407

Query  1156  KWINTGQIPCF-----------EDGGHHRPNRHAEI-SRLIFCELERILGR-----KDAT  1284
             +W++ G I C            E+   +   R A I +R IF  +E++ G      +  T
Sbjct  408   RWVSAGTIECTHPEGAIPRNETENAEEYNEKRRAAIEARSIFASVEKVEGETYQFGQKLT  467

Query  1285  LQEILVIRKIHPCLPSFKAEFTASVPLTRIRDIA--------HRNDIPHDLKQEIKHTIQ  1440
               E  ++R I+P LPSF A F    PLT+IRD+         H++ +P  LK E+KH+I+
Sbjct  468   TSEASLVRHINPWLPSFDARFAPMAPLTKIRDLCNAVENDDEHKDAVPEWLKTEVKHSIE  527

Query  1441  NKLHRNAGPEDLVATELMLERITK--NPGEYSEA-----FVEQFKIFHHELK  1575
               L +N   + L AT  +L+++ +  N  E  EA     FV+    F+ ELK
Sbjct  528   GNLLKNFDADALTATRRILDKVRRLNNTDENEEASINESFVDDLNAFYVELK  579



>ref|XP_010040448.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Eucalyptus grandis]
Length=147

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 55/79 (70%), Gaps = 2/79 (3%)
 Frame = +1

Query  466  REVEKKGKE--KRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGW  639
            RE EKK K+   +   E + L + LD+QVE GE IAI GST+ELGS KKN+ MD T+ GW
Sbjct  3    REEEKKAKKIISKLGQEKMHLSVRLDYQVEIGESIAISGSTRELGSRKKNMAMDRTKSGW  62

Query  640  VSEMELKGGEPVEFKFVIV  696
            V  ++LKGGE V+ + +I+
Sbjct  63   VCVLKLKGGESVKLEELIL  81



>ref|XP_009778046.1| PREDICTED: uncharacterized protein LOC104227496 [Nicotiana sylvestris]
Length=440

 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 71/129 (55%), Gaps = 13/129 (10%)
 Frame = +1

Query  400  IMNRPTRGLSSRTI----CA---VSSVETR---EVEKKGKEKRSAHENLKLKIWLDHQVE  549
            I+N  +  +  +T+    CA    SS +T+   + E+      +  E +++K  L+ +  
Sbjct  49   IVNVSSLSIQRKTVQPIFCAPALQSSTDTQTHTQSEESETTDTNQSEPVRVKFQLNKECT  108

Query  550  YGEHIAIMGSTKELGSWKKN--VMMDWTE-KGWVSEMELKGGEPVEFKFVIVGKDKNLLW  720
            +G+H  I+G    LGSW  +  V +DW+E   W  E+++  G+P+ +KF++ G  + +LW
Sbjct  109  FGQHFHIVGDDPVLGSWNPSNAVPLDWSEGHAWTVELDIPSGKPISYKFILKGDAETILW  168

Query  721  ETGDNRVLK  747
            + G +R+L+
Sbjct  169  QQGPDRILQ  177



>ref|XP_005849860.1| hypothetical protein CHLNCDRAFT_57278 [Chlorella variabilis]
 gb|EFN57758.1| hypothetical protein CHLNCDRAFT_57278 [Chlorella variabilis]
Length=967

 Score = 63.2 bits (152),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 61/125 (49%), Gaps = 11/125 (9%)
 Frame = +1

Query  469  EVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTEKG-W  639
            E E+    +   H ++  +      V +G+ + ++G   +LG W   K   M+W+E   W
Sbjct  61   EEEQAASARSQGHASVTFRAC--RHVGFGQVLKVVGGPDQLGGWDADKAPAMEWSEGDQW  118

Query  640  VSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAG-----GSFKMVCQWNVTDKP  804
            +  +EL  G   EFK V+    ++  WE G NR L++P       G+F +VC+W  T   
Sbjct  119  LLTLELPEGR-HEFKMVVAQGGRSAQWEGGANRTLQVPGPQAASRGAFTVVCEWGNTAAS  177

Query  805  LELLP  819
            LE +P
Sbjct  178  LETVP  182



>gb|KIY94688.1| hypothetical protein MNEG_13275 [Monoraphidium neglectum]
Length=234

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 67/136 (49%), Gaps = 19/136 (14%)
 Frame = +1

Query  493  KRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTEKG-WVSEMELKG  663
            KRS    + ++ WL  +VEYG+ + + G +K LG+W   K   M W+E   W   ++L  
Sbjct  95   KRSDSGRVNVRFWLKFRVEYGQSLRVTGGSKVLGAWDLAKAPRMVWSEGDLWNVTLDLDA  154

Query  664  GEPVEFKFVIVGKDKN--LLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLDSEGE  837
            G   E+K+V+VG D      W+TG N V+ L          QW   DK +E+   D+ G 
Sbjct  155  GMVYEYKYVVVGWDGQTAAAWQTGGNGVIAL----------QWG--DKDVEI--FDNWGN  200

Query  838  YEAQVLADNGPVVTKD  885
                ++  +G   T++
Sbjct  201  NPGAMVITDGSEATRE  216



>gb|KKA29558.1| hypothetical protein TD95_001685 [Thielaviopsis punctulata]
Length=620

 Score = 60.1 bits (144),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 48/88 (55%), Gaps = 8/88 (9%)
 Frame = +1

Query  550  YGEHIAIMGSTKELGSWKKNVMM-----DWTEKG--WVSEMELKGGEPVEFKFVIVGKDK  708
            YGE+I ++GST   GSW  +  +      +T     W + + +  G  VEFKF+ VG D 
Sbjct  525  YGENIKLVGSTAAFGSWSPSAGILLSASSYTASNPLWTTTVSVPQGSTVEFKFIRVGSDG  584

Query  709  NLLWETGDNRVLKLPAGG-SFKMVCQWN  789
            ++ WE+G+N+VL + +   S  +   WN
Sbjct  585  SITWESGNNKVLTVGSSATSVTVSASWN  612



>ref|XP_002956065.1| hypothetical protein VOLCADRAFT_97031 [Volvox carteri f. nagariensis]
 gb|EFJ42805.1| hypothetical protein VOLCADRAFT_97031 [Volvox carteri f. nagariensis]
Length=385

 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 50/84 (60%), Gaps = 5/84 (6%)
 Frame = +1

Query  514  LKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTEKG-WVSEMELKGGEPVEFK  684
            +++K  L ++  YG+ + I+GS  +LGSW   K + +DWT+   W++ +EL  G   E+K
Sbjct  28   VQVKFCLKYRTSYGQSVKIIGSHPKLGSWDINKALNLDWTDGDRWIAAVELPAGAVYEYK  87

Query  685  FVIVGKDK--NLLWETGDNRVLKL  750
            +V+V  D    L W+ G N VL L
Sbjct  88   YVLVDHDSRATLAWQGGGNSVLAL  111



>ref|WP_033217558.1| cyclomaltodextrin glucanotransferase, partial [Kitasatospora 
phosalacinea]
Length=98

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 5/84 (6%)
 Frame = +1

Query  550  YGEHIAIMGSTKELGSWKKNVMMDWTEK-----GWVSEMELKGGEPVEFKFVIVGKDKNL  714
            YG+ + + G+  ELG W     +  T        W ++++L    PVE+K++I   D  +
Sbjct  14   YGQGLYLAGNLAELGGWDPAKAVPLTTDSGSYPAWTADLQLPSDTPVEYKYLIKDPDGTV  73

Query  715  LWETGDNRVLKLPAGGSFKMVCQW  786
            +WE GDNR    PA G+F     W
Sbjct  74   VWEDGDNRTALTPATGTFTADDTW  97



>ref|XP_009587696.1| PREDICTED: uncharacterized protein LOC104085387 [Nicotiana tomentosiformis]
Length=440

 Score = 58.5 bits (140),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = +1

Query  508  ENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDWTE-KGWVSEMELKGGEPVE  678
            E +++K  L+ +  +G+H  I+G    LGSW  +  V +DW+E   W  E+++  G+ + 
Sbjct  95   EPVRVKFQLNKECTFGQHFHIVGDDPVLGSWNPSNAVPLDWSEGHAWTVELDIPSGKTIS  154

Query  679  FKFVIVGKDKNLLWETGDNRVLK  747
            +KF++ G  + +LW+ G +R+L+
Sbjct  155  YKFILKGDAETILWQQGPDRILQ  177



>gb|KIZ07546.1| hypothetical protein MNEG_0408 [Monoraphidium neglectum]
Length=538

 Score = 58.5 bits (140),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 7/109 (6%)
 Frame = +1

Query  511  NLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVM--MDWTEKG-WVSEMELKGG-EPVE  678
            N+ ++  +  ++ +GE +A++G   ELG+W       + W+E   W  E+E+    + +E
Sbjct  176  NVDVRFSVTAELRFGEQVAVVGDAPELGAWSPEAARRLTWSEGHVWTGEVEVAAARKSLE  235

Query  679  FKFVIVGKDKNL-LWETGDNRVLKLPAGGSFKMV--CQWNVTDKPLELL  816
            FKF+++G+      WE G NR   LPA G    V    W  +   LELL
Sbjct  236  FKFIVLGESGAAERWEPGQNRAAPLPAAGHRLAVTAAAWGDSACTLELL  284



>ref|XP_001696825.1| hypothetical protein CHLREDRAFT_150073 [Chlamydomonas reinhardtii]
 gb|EDP00933.1| predicted protein [Chlamydomonas reinhardtii]
Length=323

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +1

Query  511  NLKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTEKG-WVSEMELKGGEPVEF  681
            N++++  L ++  YG+ + I+GS  +LG+W   K +++ WT+   WV+ +EL  G   E+
Sbjct  23   NVQVRFCLKYRTSYGQSVKIIGSHAKLGNWDINKALVLSWTDGDRWVATIELPAGSVYEY  82

Query  682  KFVIVGKD--KNLLWETGDNRVLKL  750
            K+V+V  D    L W+ G N VL +
Sbjct  83   KYVLVDHDGRSALAWQGGSNSVLAI  107



>ref|XP_004302646.1| PREDICTED: uncharacterized protein LOC101312742 [Fragaria vesca 
subsp. vesca]
Length=500

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 60/110 (55%), Gaps = 5/110 (5%)
 Frame = +1

Query  433  RTICAVSSVETREVEKKGKEKRSAH--ENLKLKIWLDHQVEYGEHIAIMGSTKELGSW--  600
            + +  +SS    E+E    + + ++  + + +K  L  +  +G+   I+G    LGSW  
Sbjct  59   KPLVCLSSKTQAELETPDAQIQDSYPIKTMHVKFQLQKECSFGQQFLIVGDDPILGSWDP  118

Query  601  KKNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  747
            ++ + MDW++   W  E+++  G+ ++FKF++ G   N LW+ G +R+ +
Sbjct  119  ERAIPMDWSDGNVWSVELDIPVGKSIQFKFILTGDAGNFLWQPGPDRIFQ  168



>ref|XP_005642714.1| starch-binding domain-like protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18170.1| starch-binding domain-like protein [Coccomyxa subellipsoidea 
C-169]
Length=260

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 54/85 (64%), Gaps = 5/85 (6%)
 Frame = +1

Query  514  LKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTEKG-WVSEME--LKGGEPVE  678
            ++LK+ + +   +G+H+ I+GST+ LG W   + V M+W++   W ++ +  L+ G  +E
Sbjct  55   IRLKLAIPYHCNFGQHLCIVGSTESLGGWNIDQGVPMEWSDGDLWSADFDLPLQLGTELE  114

Query  679  FKFVIVGKDKNLLWETGDNRVLKLP  753
            +K+V+  +D ++ W+ G N  +++P
Sbjct  115  YKYVVRSEDGSVYWKPGCNLCIRIP  139



>gb|ABK25218.1| unknown [Picea sitchensis]
Length=307

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 49/81 (60%), Gaps = 3/81 (4%)
 Frame = +1

Query  514  LKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTEKG-WVSEMELKGGEPVEFK  684
            + +K  L+ + ++G+   ++G   + GSW  K  V ++W+E   W  E+++  G+ +E+K
Sbjct  110  VTVKFVLEKKCKFGQQFHVVGDAPQFGSWNPKAAVPLEWSEGDMWTKEVDVPVGKQIEYK  169

Query  685  FVIVGKDKNLLWETGDNRVLK  747
            F+++GK   LLW+ G NR  +
Sbjct  170  FILIGKRGELLWQPGPNRAFE  190



>ref|XP_006398635.1| hypothetical protein EUTSA_v10013736mg [Eutrema salsugineum]
 gb|ESQ40088.1| hypothetical protein EUTSA_v10013736mg [Eutrema salsugineum]
Length=318

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 83/173 (48%), Gaps = 11/173 (6%)
 Frame = +1

Query  397  SIMNRPTRGLSSRTICAVSSVETREV-EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIM  573
            S+ +R  + +  R+     S E RE  E +  EK SA + +++   L  +  +GEH  I+
Sbjct  50   SVQSRILKPILLRSSLIKVSQENREAAEIEAVEKSSATKTVRVSFQLRRECVFGEHFFIL  109

Query  574  GSTKELG-SWK-KNVM-MDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRV  741
            G     G  W  +N + + W++   W  +++L  G  VEFKF++  K   +LW+ G NR 
Sbjct  110  GDDPVFGVPWDPENALPLSWSDGHVWTVDLDLPVGRLVEFKFILKAKTGEILWQPGPNRA  169

Query  742  LKL-PAGGSFKMVCQWNVTDKPL----ELLPLDSEGEYEAQVLADNGPVVTKD  885
            L+      + ++   W   D  +    + +PL   GE +   +  + P+V KD
Sbjct  170  LQTWETNKTIRLCEDWENADLQMMIEEDFVPL-IPGENQPSAVNFDMPIVAKD  221



>ref|WP_030916433.1| hypothetical protein [Streptomyces sp. NRRL S-384]
Length=240

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 42/84 (50%), Gaps = 5/84 (6%)
 Frame = +1

Query  550  YGEHIAIMGSTKELGSWKKNVMMDWTEKG-----WVSEMELKGGEPVEFKFVIVGKDKNL  714
            YG+++ + G+  ELG W     +  T  G     W + ++L    P+ +K++I   D  +
Sbjct  156  YGQNLYLAGNLSELGGWDPAKAVPLTTDGTSYPVWSAGLQLPPNTPIAYKYLIKNPDGTV  215

Query  715  LWETGDNRVLKLPAGGSFKMVCQW  786
            +WE GDNR    PA G+F     W
Sbjct  216  VWEGGDNRTATTPATGTFTADDTW  239



>ref|WP_033216324.1| hypothetical protein [Kitasatospora phosalacinea]
Length=239

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 42/86 (49%), Gaps = 5/86 (6%)
 Frame = +1

Query  544  VEYGEHIAIMGSTKELGSWKKNVMMDWTEKG-----WVSEMELKGGEPVEFKFVIVGKDK  708
              YG+++ + G+  ELG W     +  +  G     W + ++L    P+E+K++I   D 
Sbjct  153  TAYGQNLYLAGNLAELGGWDPAKAVPLSTDGAHYPLWTAGLQLPPNTPIEYKYLIKNPDG  212

Query  709  NLLWETGDNRVLKLPAGGSFKMVCQW  786
             ++WE G NR    PA G+F     W
Sbjct  213  TVVWENGGNRTAVTPATGTFTTNDTW  238



>emb|CBI30404.3| unnamed protein product [Vitis vinifera]
Length=382

 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/223 (22%), Positives = 101/223 (45%), Gaps = 20/223 (9%)
 Frame = +1

Query  397   SIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMG  576
             S+ ++P   +SS +    + +ET E +    +K+S    + +++ L  +  YGE   I+G
Sbjct  47    SVQHKPIHPISSSSPEPQAELETAETKI---QKKSRSNTVHVRLQLQKRCSYGEQFLIVG  103

Query  577   STKELGSWKKN--VMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  747
                  G W  +  V + W++   W +E+++  G+ ++FKF++ G    +LW+ G +R+L+
Sbjct  104   DDPMFGLWDPSSAVPLCWSDGHVWTAELDIPIGKLIQFKFILKGITGTILWQPGPDRILR  163

Query  748   LPAG-GSFKMVCQW------NVTDKPLELLPLDSEGEYEAQVLADNGPVVTKDSTDPDMQ  906
               A   +  +V  W       +T+ P+ +L        E  V+  +  +  +D T     
Sbjct  164   TWATENTITVVEDWEDAELQKITEGPVSIL-------NEEPVINSDTLIAAEDVTRTKYA  216

Query  907   VSAFVEQWQGKAVSFVRSNDQRGMEKNRKWDTSGLAEIPLKLV  1035
               + + +     V+    +++   E   K    G AEI   L+
Sbjct  217   HLSDINKESAITVTTAHPSEKPPAEAQNKLTNPGSAEIKENLI  259



>ref|XP_010543884.1| PREDICTED: uncharacterized protein LOC104816652 [Tarenaya hassleriana]
Length=401

 Score = 56.6 bits (135),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 67/130 (52%), Gaps = 16/130 (12%)
 Frame = +1

Query  529  WLDH--QVEYGEHIAIMGSTKELGSW--KKNVMMDWTEKG-WVSEMELKGGEPVEFKFVI  693
            W++   +  +GEH  I+G     G W  +  + ++W++   W  +++L  G+ +EFKF++
Sbjct  74   WMNKPKECAFGEHFFILGDDPVFGLWDPENAIPLNWSDGHVWTVDLDLPVGKSIEFKFIL  133

Query  694  VGKDKNLLWETGDNRVLKLPAGGSFKMVCQ-WNVTDKPL----ELLPLDSEGEYEAQ---  849
             GK   +LW+ G NRV +     +   +C+ W   D       EL+P++ EG+  +    
Sbjct  134  KGKTGIILWQPGQNRVFETLETSNTITICEDWENADLQSIFEEELVPVNREGQESSAGNL  193

Query  850  ---VLADNGP  870
               V+A+N P
Sbjct  194  DMPVVAENVP  203



>ref|XP_006398636.1| hypothetical protein EUTSA_v10013736mg [Eutrema salsugineum]
 gb|ESQ40089.1| hypothetical protein EUTSA_v10013736mg [Eutrema salsugineum]
Length=397

 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 83/173 (48%), Gaps = 11/173 (6%)
 Frame = +1

Query  397  SIMNRPTRGLSSRTICAVSSVETREV-EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIM  573
            S+ +R  + +  R+     S E RE  E +  EK SA + +++   L  +  +GEH  I+
Sbjct  50   SVQSRILKPILLRSSLIKVSQENREAAEIEAVEKSSATKTVRVSFQLRRECVFGEHFFIL  109

Query  574  GSTKELG-SWK-KNVM-MDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRV  741
            G     G  W  +N + + W++   W  +++L  G  VEFKF++  K   +LW+ G NR 
Sbjct  110  GDDPVFGVPWDPENALPLSWSDGHVWTVDLDLPVGRLVEFKFILKAKTGEILWQPGPNRA  169

Query  742  LKL-PAGGSFKMVCQWNVTDKPL----ELLPLDSEGEYEAQVLADNGPVVTKD  885
            L+      + ++   W   D  +    + +PL   GE +   +  + P+V KD
Sbjct  170  LQTWETNKTIRLCEDWENADLQMMIEEDFVPLIP-GENQPSAVNFDMPIVAKD  221



>ref|XP_005844056.1| hypothetical protein CHLNCDRAFT_139625 [Chlorella variabilis]
 gb|EFN51954.1| hypothetical protein CHLNCDRAFT_139625 [Chlorella variabilis]
Length=246

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 49/83 (59%), Gaps = 3/83 (4%)
 Frame = +1

Query  511  NLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTEK-GWVSEMELKGGEPVEF  681
            ++ +   L  +  YG+ + ++GS++ELG+WK    + + W+E+  W + + L  G  VE+
Sbjct  16   SVAVSFILKKETYYGQRVLLVGSSQELGAWKLDAGLPLRWSEEHKWSTTVALPAGAAVEY  75

Query  682  KFVIVGKDKNLLWETGDNRVLKL  750
            KFVI   ++  LWE+  NR L +
Sbjct  76   KFVITDPEQPPLWESCLNRSLAV  98



>ref|XP_006596061.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Glycine max]
Length=76

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  1492  MLERITKNPGEYSEAFVEQFKIFHHELKD  1578
             ML +ITKNPGEYSE F+++FKIFH ELKD
Sbjct  1     MLAKITKNPGEYSEPFLKEFKIFHQELKD  29



>ref|XP_001258586.1| starch binding domain protein [Neosartorya fischeri NRRL 181]
 gb|EAW16689.1| starch binding domain protein [Neosartorya fischeri NRRL 181]
Length=497

 Score = 55.8 bits (133),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 45/79 (57%), Gaps = 7/79 (9%)
 Frame = +1

Query  544  VEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVS-------EMELKGGEPVEFKFVIVGK  702
              YGE+I I GS  +LG+W  +  +  +  G+ S       +++L  G   ++KF+  G+
Sbjct  406  TSYGENIFISGSIDQLGNWDTSRAVALSASGYTSSNPVWSVKLDLYAGTYFQYKFIRKGQ  465

Query  703  DKNLLWETGDNRVLKLPAG  759
            D +++WE+G NR   LP+G
Sbjct  466  DGSVIWESGPNRSYTLPSG  484



>ref|XP_002974170.1| hypothetical protein SELMODRAFT_414445 [Selaginella moellendorffii]
 gb|EFJ25125.1| hypothetical protein SELMODRAFT_414445 [Selaginella moellendorffii]
Length=371

 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = +1

Query  532  LDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGK  702
            L  + +YGE  A++G++  LG+W     V MDW+E   W  +++L  GE  E+KFV+  K
Sbjct  91   LQKKCDYGERFAVVGASPLLGAWDPAAGVSMDWSEDHVWKCQIDLPVGEQYEYKFVLTSK  150

Query  703  DKNLLWETGDNRVLK  747
                 W+ G NR+ K
Sbjct  151  KAVPEWQPGPNRIFK  165



>ref|XP_005844815.1| hypothetical protein CHLNCDRAFT_54374 [Chlorella variabilis]
 gb|EFN52713.1| hypothetical protein CHLNCDRAFT_54374 [Chlorella variabilis]
Length=687

 Score = 55.8 bits (133),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = +1

Query  535  DHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE-KGWVSEMELKGGEPVEFKFVIVGKD  705
            D  +++GEH+ ++GS  E+G W  K    +DW E   WV+E+ L  GE + FK VI+  D
Sbjct  86   DCPLQFGEHLRLVGSCAEMGGWDAKSAPSLDWQEGNNWVAELALPPGEHL-FKLVIMRSD  144

Query  706  KNLLWETGDNRVL  744
                WE G+NR L
Sbjct  145  GEQQWEDGNNREL  157



>ref|XP_005644337.1| hypothetical protein COCSUDRAFT_48869 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19793.1| hypothetical protein COCSUDRAFT_48869 [Coccomyxa subellipsoidea 
C-169]
Length=1081

 Score = 56.2 bits (134),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 62/124 (50%), Gaps = 5/124 (4%)
 Frame = +1

Query  475  EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVM--MDWTEKG-WVS  645
            +++G  K  A     ++I   H+V +GE +  +G+ ++LG+W       + W E   W  
Sbjct  73   QRRGALKCEAASGSTVRITTQHEVAFGEVVKAVGTQEQLGAWDPAAAPGLTWAEGNKWSV  132

Query  646  EMELKGGEPVEFKFVIVGKDKNLL-WETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPL  822
            ++ L   +  EFK V+V +D +   WE G NR +K+   G  K+V +   +D    +L +
Sbjct  133  DLALP-PDTYEFKLVVVREDGSAAEWEPGTNREIKVEEAGDEKIVAECAWSDTATTVLSI  191

Query  823  DSEG  834
            D  G
Sbjct  192  DGAG  195



>ref|XP_002968806.1| hypothetical protein SELMODRAFT_440606 [Selaginella moellendorffii]
 gb|EFJ29922.1| hypothetical protein SELMODRAFT_440606 [Selaginella moellendorffii]
Length=392

 Score = 55.5 bits (132),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = +1

Query  532  LDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGK  702
            L  + +YGE  A++G++  LG+W     V MDW+E   W  +++L  GE  E+KFV+  K
Sbjct  91   LQKKCDYGERFAVVGASPLLGAWDPAAGVSMDWSEDHVWKCQIDLPVGEQYEYKFVLTSK  150

Query  703  DKNLLWETGDNRVLK  747
                 W+ G NR+ K
Sbjct  151  KAVPEWQPGPNRIFK  165



>ref|XP_010654173.1| PREDICTED: uncharacterized protein LOC104880162 [Vitis vinifera]
Length=455

 Score = 55.5 bits (132),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 37/150 (25%), Positives = 77/150 (51%), Gaps = 13/150 (9%)
 Frame = +1

Query  397  SIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMG  576
            S+ ++P   +SS +    + +ET E +    +K+S    + +++ L  +  YGE   I+G
Sbjct  48   SVQHKPIHPISSSSPEPQAELETAETKI---QKKSRSNTVHVRLQLQKRCSYGEQFLIVG  104

Query  577  STKELGSWKKN--VMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  747
                 G W  +  V + W++   W +E+++  G+ ++FKF++ G    +LW+ G +R+L+
Sbjct  105  DDPMFGLWDPSSAVPLCWSDGHVWTAELDIPIGKLIQFKFILKGITGTILWQPGPDRILR  164

Query  748  LPAG-GSFKMVCQW------NVTDKPLELL  816
              A   +  +V  W       +T+ P+ +L
Sbjct  165  TWATENTITVVEDWEDAELQKITEGPVSIL  194



>gb|KJB46631.1| hypothetical protein B456_007G379100 [Gossypium raimondii]
Length=305

 Score = 54.7 bits (130),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 52/100 (52%), Gaps = 9/100 (9%)
 Frame = +1

Query  457  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE  630
            +ET E + K       H   ++K  L  +  +GEH  I+G    LGSW  +  + + W+E
Sbjct  75   LETAETQPK------EHNTTRVKFQLKKECSFGEHFFIVGDHPMLGSWDPESCIPLTWSE  128

Query  631  KG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  747
               W  E+++  G  V+FKF++     ++LW+ G +R+ K
Sbjct  129  GHVWAVELDIPVGISVQFKFILKTTTGDILWQPGPDRIFK  168



>gb|KIZ03831.1| hypothetical protein MNEG_4121, partial [Monoraphidium neglectum]
Length=325

 Score = 55.1 bits (131),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 57/137 (42%), Gaps = 9/137 (7%)
 Frame = +1

Query  379  PQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGE  558
            P   P     R  R  S+R+  AV    T   +  G+    A    + +I     V +GE
Sbjct  23   PAAAPVCAAGRAPR--STRSGLAVVRFATDSAD--GEVDVDAAATARFRI--TTPVRFGE  76

Query  559  HIAIMGSTKELGSWKKNVMM--DWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETG  729
            H+ ++G    LGSW  +  +   W+E   W    +L  G+ +EFKF+I        WE G
Sbjct  77   HVRVVGGAPSLGSWSPDAALKLTWSEGDKWEGAAQLPAGQDIEFKFLICPAAGAPAWEPG  136

Query  730  DNRVLKLPAGGSFKMVC  780
             N    LP G    +V 
Sbjct  137  ANHKAALPEGAEAVIVA  153



>ref|XP_001701978.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP06953.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=106

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/92 (33%), Positives = 53/92 (58%), Gaps = 7/92 (8%)
 Frame = +1

Query  511  NLKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTEKG-WVSEMELKGGEP---  672
            +LKL   + ++V +G+ IA++GS   LG+W  K+++ M WT+   W  E+ +  G     
Sbjct  1    SLKLNFKVGYRVNFGQTIAMIGSGDALGNWDPKRSIAMKWTDGDYWTVELNVAPGRSALD  60

Query  673  VEFKFVIVGKDKNL-LWETGDNRVLKLPAGGS  765
            +E+K+V+V  D ++  W+ G N  + LP   S
Sbjct  61   LEYKYVVVNSDGHIGYWKPGSNYKVTLPLNSS  92



>gb|KHN47425.1| Phosphoglucan, water dikinase, chloroplastic [Glycine soja]
Length=225

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 56/99 (57%), Gaps = 3/99 (3%)
 Frame = +1

Query  457  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE  630
            +ET E + +  E+ +  + +++   L+    +GE   I+G    LGSW   + + M W+E
Sbjct  62   LETVEPQAQQSEQTNESKFVRVSFQLEKTCNFGEQFLIVGGGPVLGSWDPLEALPMTWSE  121

Query  631  KG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  744
               W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  122  GHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGSDRLI  160



>emb|CAN60108.1| hypothetical protein VITISV_044328 [Vitis vinifera]
Length=430

 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/150 (25%), Positives = 77/150 (51%), Gaps = 13/150 (9%)
 Frame = +1

Query  397  SIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMG  576
            S+ ++P   +SS +    + +ET E + +   K+S    + +++ L  +  YGE   I+G
Sbjct  23   SVQHKPIHPISSSSPEPQAELETAETKIQ---KKSRSNTVHVRLQLQKRCSYGEQFLIVG  79

Query  577  STKELGSWKKN--VMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  747
                 G W  +  V + W++   W +E+++  G+ ++FKF++ G    +LW+ G +R+L+
Sbjct  80   DDPMFGLWDPSSAVPLCWSDGHVWTAELDIPIGKLIQFKFILKGJTGTILWQPGPDRILR  139

Query  748  LPAG-GSFKMVCQWN------VTDKPLELL  816
              A   +  +V  W       +T+ P+ +L
Sbjct  140  TWATENTITVVEDWEDAELQKITEGPVSIL  169



>ref|WP_030918859.1| cyclomaltodextrin glucanotransferase, partial [Streptomyces sp. 
NRRL S-384]
Length=98

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 5/68 (7%)
 Frame = +1

Query  550  YGEHIAIMGSTKELGSWKKNVMMDWTEKG-----WVSEMELKGGEPVEFKFVIVGKDKNL  714
            YG+++ + G   ELG W     +  T  G     W + ++L  G P+ +K++I   D  +
Sbjct  14   YGQNLYLSGDIAELGGWDPAKAVPLTTDGTSYPVWTANLQLPAGTPIAYKYLIKNPDGTV  73

Query  715  LWETGDNR  738
            +WE+GDNR
Sbjct  74   IWESGDNR  81



>ref|XP_007026748.1| Carbohydrate-binding-like fold, putative isoform 1 [Theobroma 
cacao]
 gb|EOY07250.1| Carbohydrate-binding-like fold, putative isoform 1 [Theobroma 
cacao]
Length=449

 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 55/101 (54%), Gaps = 9/101 (9%)
 Frame = +1

Query  469  EVEKKGKEKRSAHEN----LKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE  630
            +V+ +  E + A EN    + +K  L  +  +GEH  I+G    LG W  +  + ++W  
Sbjct  72   QVDFETAETQPAEENPSKTVHVKFQLQKECSFGEHFFIVGDHPMLGIWDPESAIPLNWL-  130

Query  631  KG--WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  747
            KG  W  E+++  G+ ++FKFV+     NLLW+ G +R+ K
Sbjct  131  KGHVWTVELDIPVGKSIQFKFVLKTSTGNLLWQPGPDRIFK  171



>ref|XP_007026749.1| Carbohydrate-binding-like fold, putative isoform 2 [Theobroma 
cacao]
 gb|EOY07251.1| Carbohydrate-binding-like fold, putative isoform 2 [Theobroma 
cacao]
Length=426

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 51/94 (54%), Gaps = 9/94 (10%)
 Frame = +1

Query  490  EKRSAHEN----LKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTEKG--WVS  645
            E + A EN    + +K  L  +  +GEH  I+G    LG W  +  + ++W  KG  W  
Sbjct  45   ETQPAEENPSKTVHVKFQLQKECSFGEHFFIVGDHPMLGIWDPESAIPLNWL-KGHVWTV  103

Query  646  EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  747
            E+++  G+ ++FKFV+     NLLW+ G +R+ K
Sbjct  104  ELDIPVGKSIQFKFVLKTSTGNLLWQPGPDRIFK  137



>gb|KJB46630.1| hypothetical protein B456_007G379100 [Gossypium raimondii]
Length=335

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 52/100 (52%), Gaps = 9/100 (9%)
 Frame = +1

Query  457  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE  630
            +ET E + K       H   ++K  L  +  +GEH  I+G    LGSW  +  + + W+E
Sbjct  75   LETAETQPK------EHNTTRVKFQLKKECSFGEHFFIVGDHPMLGSWDPESCIPLTWSE  128

Query  631  KG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  747
               W  E+++  G  V+FKF++     ++LW+ G +R+ K
Sbjct  129  GHVWAVELDIPVGISVQFKFILKTTTGDILWQPGPDRIFK  168



>ref|XP_001702927.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO96780.1| predicted protein [Chlamydomonas reinhardtii]
Length=141

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 59/120 (49%), Gaps = 9/120 (8%)
 Frame = +1

Query  427  SSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKK  606
            S+  +CA + V T  V  +   +   HE   +K  L  +V  GE   I+G   ELG  K 
Sbjct  18   STVRVCAQAQVAT--VTARPAVRSVEHE---VKFTLKQKVGLGECWKIVGMCPELGRMKP  72

Query  607  NV--MMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  777
             V   M WT    W  E +++ G   EFK V+   D + LWE G +RVL++P G S K V
Sbjct  73   EVAPYMQWTNGDVWTLEAKMRPGT-YEFKAVLRKPDGSYLWEDGKDRVLEVPFGASGKNV  131



>ref|XP_004506775.1| PREDICTED: protein ycf2-like isoform X1 [Cicer arietinum]
Length=472

 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 57/99 (58%), Gaps = 3/99 (3%)
 Frame = +1

Query  457  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE  630
            +ET E   +  E+ +    ++++  L    ++GE   I+G    LGSW   + + M W++
Sbjct  75   LETVEPRVQQSEQTNESNFVRVEFQLQKDCDFGEQFLIVGDDPMLGSWNPLEALPMTWSD  134

Query  631  KG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  744
               W  E+++  G+PV++KF++ G + +++W+ G +R++
Sbjct  135  GHLWTLELDIPAGKPVQYKFILKGIEGDIIWQPGLDRII  173



>gb|KJB46629.1| hypothetical protein B456_007G379100 [Gossypium raimondii]
Length=276

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 53/104 (51%), Gaps = 9/104 (9%)
 Frame = +1

Query  445  AVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMM  618
            A   +ET E + K       H   ++K  L  +  +GEH  I+G    LGSW  +  + +
Sbjct  12   AYGELETAETQPK------EHNTTRVKFQLKKECSFGEHFFIVGDHPMLGSWDPESCIPL  65

Query  619  DWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  747
             W+E   W  E+++  G  V+FKF++     ++LW+ G +R+ K
Sbjct  66   TWSEGHVWAVELDIPVGISVQFKFILKTTTGDILWQPGPDRIFK  109



>ref|XP_002974668.1| hypothetical protein SELMODRAFT_415024 [Selaginella moellendorffii]
 gb|EFJ24188.1| hypothetical protein SELMODRAFT_415024 [Selaginella moellendorffii]
Length=407

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 53/102 (52%), Gaps = 4/102 (4%)
 Frame = +1

Query  517  KLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE-KGWVSEMELKGGEPVEFKF  687
            ++K  L  Q  +GEH  ++G    LG W  +  + ++W++   W +E+++  G   E+KF
Sbjct  135  RVKFVLQRQCMFGEHFKVIGGHPALGEWDPRAAIPLEWSDGHNWTTELDVPQGSVFEYKF  194

Query  688  VIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQ-WNVTDKPLE  810
            V+  ++  + W+ G NRV   P      +V Q W+   K +E
Sbjct  195  VLQCQNGWIHWQPGPNRVFSTPEKKPSLVVSQTWDFDAKGME  236



>gb|EMS59541.1| Alpha-amylase [Triticum urartu]
Length=440

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 65/130 (50%), Gaps = 14/130 (11%)
 Frame = +1

Query  511  NLKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTEKG-WVSEMELKGGEPVEF  681
             +++   L+ +  +G+   ++G    LG W   K   +DW+E   W +  +L     VEF
Sbjct  195  TVRVTFVLEKKCAFGQRFLVVGDDPALGLWDPAKATALDWSEGHVWTARADLPANRLVEF  254

Query  682  KFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV--------CQWNVTDKPLELLPLDSEGE  837
            KF++     ++ W+ G NR L++    S  +V        CQ  V++  L  LP+ +EG 
Sbjct  255  KFLLQDPSGHVRWQHGGNRALQVTEASSALVVYEDWDDAGCQ-EVSEAALH-LPIGAEG-  311

Query  838  YEAQVLADNG  867
             +A +LAD+G
Sbjct  312  TDALLLADDG  321



>ref|XP_002963384.1| hypothetical protein SELMODRAFT_438530 [Selaginella moellendorffii]
 gb|EFJ35255.1| hypothetical protein SELMODRAFT_438530 [Selaginella moellendorffii]
Length=516

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 53/102 (52%), Gaps = 4/102 (4%)
 Frame = +1

Query  517  KLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE-KGWVSEMELKGGEPVEFKF  687
            ++K  L  Q  +GEH  ++G    LG W  +  + ++W++   W +E+++  G   E+KF
Sbjct  192  RVKFVLQRQCMFGEHFKVIGGHPALGEWDPRAAIPLEWSDGHNWTTELDVPQGSVFEYKF  251

Query  688  VIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQ-WNVTDKPLE  810
            V+  ++  + W+ G NRV   P      +V Q W+   K +E
Sbjct  252  VLQCQNGWIHWQPGPNRVFSTPEKKPSLVVSQTWDFDAKGME  293



>dbj|GAM27795.1| hypothetical protein SAMD00019534_109710, partial [Acytostelium 
subglobosum LB1]
Length=128

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/88 (33%), Positives = 50/88 (57%), Gaps = 6/88 (7%)
 Frame = +1

Query  517  KLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE-KGWVSEMELKGGEPVEFKF  687
            K++ WL + V++G+ + + G+ ++LG+W  +K   + +++   W  E+ L     +E+K+
Sbjct  32   KIRFWLKYHVQFGQQVRVTGNCEQLGNWDPQKAFPLKFSQGDTWEGELLLGQAGRIEYKY  91

Query  688  VIVGKDKN--LLWETGDNRVLKLPAGGS  765
             I   D    L WETG NRV  L AG S
Sbjct  92   FISYYDTGDLLYWETGSNRVF-LVAGSS  118



>ref|XP_006576534.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X2 [Glycine max]
 ref|XP_006607034.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X1 [Glycine max]
Length=221

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 55/99 (56%), Gaps = 3/99 (3%)
 Frame = +1

Query  457  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE  630
            +ET E + +  E+ +  + +++   L     +GE   I+G    LGSW   + + M W+E
Sbjct  74   LETVEPQAQQSEQTNESKFVRVSFQLQKTCNFGEQFLIVGGGPVLGSWDPLEALPMTWSE  133

Query  631  KG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  744
               W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  134  GHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGLDRLI  172



>emb|CDY11209.1| BnaA03g00450D [Brassica napus]
Length=394

 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 79/170 (46%), Gaps = 13/170 (8%)
 Frame = +1

Query  451  SSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS--WK-KNVM-M  618
            SS++    E+  + + S    ++++  L  +  +GEH  I+G     G   W  +N + +
Sbjct  68   SSIKANIEEEDAETEASPGRTVRVRFQLRKECVFGEHFFILGDHPVFGGGLWDPENALPL  127

Query  619  DWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQ-WNV  792
            +W++   W  ++EL  G  VEFKF++  +   +LW+ G NR ++         +C+ W  
Sbjct  128  NWSDGHVWTLDLELPVGRLVEFKFILKAQTGEILWQPGPNRAIETWETSKTIRICEDWEN  187

Query  793  TDKPL----ELLPLDSEGEYEAQVLAD---NGPVVTKDSTDPDMQVSAFV  921
             D  +    + +P D E E    +L D   NG     +  D   Q+S+ V
Sbjct  188  ADLQMMREEDFVPFDQEEEQHVTLLTDASSNGAEEEVEVLDAVQQISSVV  237



>ref|XP_002502726.1| carbohydrate-binding module family 20 protein [Micromonas sp. 
RCC299]
 gb|ACO63984.1| carbohydrate-binding module family 20 protein [Micromonas sp. 
RCC299]
Length=300

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 49/82 (60%), Gaps = 3/82 (4%)
 Frame = +1

Query  517  KLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDWTEKG-WVSEMELKGGEPVEFKF  687
            +++  + +Q + GE + I+GS K++G W ++  + M W++ G W +++EL  G  V +K+
Sbjct  113  RVQFRIGYQTQVGEDLFIVGSHKKMGEWNQHHALPMQWSDGGNWFTDLELPAGGVVFYKY  172

Query  688  VIVGKDKNLLWETGDNRVLKLP  753
            V+   +    W+ G N +L LP
Sbjct  173  VVKQANGAYRWQEGANNLLVLP  194



>gb|KHN48367.1| Alpha-amylase [Glycine soja]
Length=392

 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 55/99 (56%), Gaps = 3/99 (3%)
 Frame = +1

Query  457  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE  630
            ++T E + +  E+ +  + +++   L+    +GE   I+G    LGSW   + + M W E
Sbjct  74   LDTAEPQAQQSEQTNESKFVRVSFQLEKNCNFGEQFLIVGDDPVLGSWDPLEALPMTWFE  133

Query  631  KG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  744
               W  E+++  G+  +FKF++ GK  +++W+ G +R++
Sbjct  134  GHVWAVELDMPAGKSFQFKFILKGKGGDIIWQPGLDRMI  172



>ref|XP_006576539.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X4 [Glycine max]
Length=221

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 55/99 (56%), Gaps = 3/99 (3%)
 Frame = +1

Query  457  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE  630
            +ET E + +  E+ +  + +++   L     +GE   I+G    LGSW   + + M W+E
Sbjct  74   LETVEPQAQQSEQTNESKFVRVSFQLQKTCNFGEQFLIVGGGPVLGSWDPLEALPMTWSE  133

Query  631  KG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  744
               W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  134  GHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGLDRLI  172



>ref|WP_030499128.1| alpha-amylase [Micromonospora purpureochromogenes]
Length=738

 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 3/82 (4%)
 Frame = +1

Query  550  YGEHIAIMGSTKELGSWKKNVMMDWTEKG---WVSEMELKGGEPVEFKFVIVGKDKNLLW  720
            YG+++ ++G+T  LGSW     +  +      W + ++L     +E+K+V    D  + W
Sbjct  656  YGQNVFVVGNTPALGSWNPAAAVALSSAAYPVWRATVDLPANTAIEYKYVKKNPDGTVTW  715

Query  721  ETGDNRVLKLPAGGSFKMVCQW  786
            E+G NR L  PAGG+  +   W
Sbjct  716  ESGANRTLTTPAGGTRAVTDTW  737



>gb|KIY98013.1| hypothetical protein MNEG_9950 [Monoraphidium neglectum]
Length=254

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 52/96 (54%), Gaps = 6/96 (6%)
 Frame = +1

Query  517  KLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDWTEKG-WVSEMELKGGEPVEFKF  687
            K+   L   VE+G  +A++GS+  LG W     V ++WTE   W +E E+  G  VE+K+
Sbjct  35   KVSFTLPLHVEFGTEVALVGSSPVLGEWDATSAVPLNWTEGDVWTAEAEVPVGSSVEYKY  94

Query  688  VI-VGKDKNLL-WE-TGDNRVLKLPAGGSFKMVCQW  786
            +I V +D  +L W+ T  N VL +P  G   +   W
Sbjct  95   IIRVPEDGKVLEWQPTPANLVLSIPEAGPVAVTDDW  130



>ref|XP_005644670.1| hypothetical protein COCSUDRAFT_67495 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20126.1| hypothetical protein COCSUDRAFT_67495 [Coccomyxa subellipsoidea 
C-169]
Length=470

 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 5/85 (6%)
 Frame = +1

Query  520  LKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE-KGWVSEMELKGGEPVEFKFV  690
            +   L +   YG+ I ++GS + LGSW  ++   + WTE   W + +EL GG   E+K+V
Sbjct  197  VHFCLQYHTSYGQQIRLVGSHENLGSWQLREGPDLRWTEGDNWRATVELPGGTVYEYKYV  256

Query  691  IVG--KDKNLLWETGDNRVLKLPAG  759
            ++       L W+ G+N VL + AG
Sbjct  257  LLDSYSGHALSWQRGNNSVLAIKAG  281



>gb|KHN36405.1| Phosphoglucan, water dikinase, chloroplastic [Glycine soja]
Length=210

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 55/99 (56%), Gaps = 3/99 (3%)
 Frame = +1

Query  457  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE  630
            +ET E + +  E+ +  + +++   L     +GE   I+G    LGSW   + + M W+E
Sbjct  74   LETVEPQAQQSEQTNESKFVRVSFQLQKTCNFGEQFLIVGGGPVLGSWDPLEALPMTWSE  133

Query  631  KG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  744
               W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  134  GHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGLDRLI  172



>emb|CAB42581.1| putative degreening-enhanced protein [Auxenochlorella protothecoides]
Length=214

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 56/102 (55%), Gaps = 8/102 (8%)
 Frame = +1

Query  499  SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKK--NVMMDWTEKG-WVSEMELKGGE  669
            +A    K++  L  +V +G+ I+I+ S      W+   ++ MDW+E   W    E+  G+
Sbjct  17   AAAGKAKVQFRLPKRVSFGQTISIVTSRS---GWEPIPDLHMDWSEGDEWKVSAEVAPGD  73

Query  670  PVEFKFVIVGKDKNLLWETGDNRVLK--LPAGGSFKMVCQWN  789
             +E+K+V++G    + W+TG NR L   +P G +  +V +W+
Sbjct  74   ELEYKYVVLGPSGIVEWQTGSNRRLAVDVPGGAAVTVVDEWH  115



>ref|XP_006576535.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X3 [Glycine max]
 ref|XP_006607035.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X2 [Glycine max]
Length=217

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 55/99 (56%), Gaps = 3/99 (3%)
 Frame = +1

Query  457  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE  630
            +ET E + +  E+ +  + +++   L     +GE   I+G    LGSW   + + M W+E
Sbjct  74   LETVEPQAQQSEQTNESKFVRVSFQLQKTCNFGEQFLIVGGGPVLGSWDPLEALPMTWSE  133

Query  631  KG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  744
               W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  134  GHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGLDRLI  172



>ref|XP_005847512.1| hypothetical protein CHLNCDRAFT_52636 [Chlorella variabilis]
 gb|EFN55410.1| hypothetical protein CHLNCDRAFT_52636 [Chlorella variabilis]
Length=541

 Score = 53.5 bits (127),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 40/75 (53%), Gaps = 4/75 (5%)
 Frame = +1

Query  541  QVEYGEHIAIMGSTKELGSWKKNV--MMDWTEKG-WVSEMELKGGEPVEFKFVIV-GKDK  708
             +++GEH+ ++G+  ELG W       + W E   W  E+ L  G  V FK VIV G   
Sbjct  135  HLQFGEHLRVVGNCPELGEWDAQAAPALIWHEDDVWKGELTLPSGRHVAFKLVIVRGDGV  194

Query  709  NLLWETGDNRVLKLP  753
             L WE G +R L++P
Sbjct  195  TLYWEPGADRRLRVP  209



>ref|XP_003520734.1| PREDICTED: uncharacterized protein LOC100778097 [Glycine max]
Length=464

 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 56/99 (57%), Gaps = 3/99 (3%)
 Frame = +1

Query  457  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE  630
            +ET E + +  E+ +  + +++   L+    +GE   I+G    LGSW   + + M W+E
Sbjct  74   LETVEPQAQQSEQTNESKFVRVSFQLEKTCNFGEQFLIVGGDPVLGSWDPLEALPMTWSE  133

Query  631  KG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  744
               W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  134  GHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGSDRLI  172



>ref|XP_003516949.1| PREDICTED: ribonuclease E/G-like protein, chloroplastic-like 
[Glycine max]
Length=462

 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 55/99 (56%), Gaps = 3/99 (3%)
 Frame = +1

Query  457  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE  630
            ++T E + +  E+ +  + +++   L+    +GE   I+G    LGSW   + + M W E
Sbjct  74   LDTAEPQAQQSEQTNESKFVRVSFQLEKNCNFGEQFLIVGDDPVLGSWDPLEALPMTWFE  133

Query  631  KG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  744
               W  E+++  G+  +FKF++ GK  +++W+ G +R++
Sbjct  134  GHVWAVELDMPAGKSFQFKFILKGKGGDIIWQPGLDRMI  172



>gb|ACU23169.1| unknown [Glycine max]
Length=464

 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 56/99 (57%), Gaps = 3/99 (3%)
 Frame = +1

Query  457  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE  630
            +ET E + +  E+ +  + +++   L+    +GE   I+G    LGSW   + + M W+E
Sbjct  74   LETVEPQAQQSEQTNESKFVRVSFQLEKTCNFGEQFLIVGGDPVLGSWDPLEALPMTWSE  133

Query  631  KG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  744
               W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  134  GHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGSDRLI  172



>ref|XP_011399502.1| Phosphoglucan, water dikinase, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM26564.1| Phosphoglucan, water dikinase, chloroplastic [Auxenochlorella 
protothecoides]
Length=287

 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 61/124 (49%), Gaps = 20/124 (16%)
 Frame = +1

Query  532  LDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE-KGWVSEMELKGGEPVEFKFVIV--  696
            L  + ++G+ + I+GS + LG+W+      M WT    WV+E++L  G   E+KFV+V  
Sbjct  32   LCFRTDWGQRLRIVGSQEGLGNWRLADGHNMKWTTGDNWVAEVDLPTGTVYEYKFVVVDH  91

Query  697  GKDKNLLWETGDNRVLKL-PAGGSFKMVCQWNVTDKPLELLPLDSEGEYEAQVLADNGPV  873
                 L W++G+N VL L P   S  +   W               GE  AQ++AD    
Sbjct  92   ASGHALAWQSGNNSVLALRPEDRSVDVFDNWG--------------GEPGAQLVADGAKP  137

Query  874  VTKD  885
            +T++
Sbjct  138  LTRE  141



>ref|XP_005846256.1| hypothetical protein CHLNCDRAFT_135558 [Chlorella variabilis]
 gb|EFN54154.1| hypothetical protein CHLNCDRAFT_135558 [Chlorella variabilis]
Length=368

 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/109 (28%), Positives = 62/109 (57%), Gaps = 7/109 (6%)
 Frame = +1

Query  511  NLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTEKG-WVSEMEL--KGGEPV  675
            ++ ++  L +  +YG+ + ++GS   LG+W   + V M+WTE   W  E+++   G   +
Sbjct  45   SVAVRFQLPYHCKYGQRLCLIGSNDNLGAWNVAQAVPMEWTEGDVWTVELQMPADGSVEL  104

Query  676  EFKFVIV-GKDKNLL-WETGDNRVLKLPAGGSFKMVCQWNVTDKPLELL  816
            E+K+V+   +DK  + W+ G N  L++P  G  ++   W+ + + +E+L
Sbjct  105  EYKYVVRHERDKTAVRWKEGGNFYLQVPPKGELRVRDTWDESMREVEVL  153



>gb|KHN45754.1| Phosphoglucan, water dikinase, chloroplastic [Glycine soja]
Length=523

 Score = 53.1 bits (126),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 56/99 (57%), Gaps = 3/99 (3%)
 Frame = +1

Query  457  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE  630
            +ET E + +  E+ +  + +++   L+    +GE   I+G    LGSW   + + M W+E
Sbjct  74   LETVEPQAQQSEQTNESKFVRVSFQLEKSCNFGEQFLIVGGDPVLGSWDPLEALPMTWSE  133

Query  631  KG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  744
               W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  134  GHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGSDRLI  172



>gb|EHK25059.1| glycoside hydrolase family 15 protein [Trichoderma virens Gv29-8]
Length=631

 Score = 53.1 bits (126),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/77 (30%), Positives = 40/77 (52%), Gaps = 7/77 (9%)
 Frame = +1

Query  547  EYGEHIAIMGSTKELGSWKKNVMMDWTEKG-------WVSEMELKGGEPVEFKFVIVGKD  705
            ++G+ I ++GS  ELG+W  N  +             W+  + L  GE V++K++ VG D
Sbjct  540  QFGQTIKVVGSVPELGNWSTNAAVALNAVNYASNHPLWLGSINLAAGEVVQYKYINVGSD  599

Query  706  KNLLWETGDNRVLKLPA  756
             ++ WE+  N    +PA
Sbjct  600  GSVTWESDPNHTYTVPA  616



>gb|KHN46339.1| Phosphoglucan, water dikinase, chloroplastic [Glycine soja]
Length=451

 Score = 53.1 bits (126),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 55/99 (56%), Gaps = 3/99 (3%)
 Frame = +1

Query  457  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE  630
            +ET E + +  E+ +  + +++   L     +GE   I+G    LGSW   + + M W+E
Sbjct  74   LETVEPQAQQSEQTNESKFVRVSFQLQKTCNFGEQFLIVGGDPVLGSWDPLEALPMTWSE  133

Query  631  KG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  744
               W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  134  GHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGSDRLI  172



>ref|WP_013286849.1| MULTISPECIES: alpha-amylase [Micromonospora]
 gb|ADL47225.1| alpha amylase catalytic region [Micromonospora aurantiaca ATCC 
27029]
 gb|ADU10176.1| alpha amylase catalytic region [Micromonospora sp. L5]
Length=734

 Score = 53.1 bits (126),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = +1

Query  550  YGEHIAIMGSTKELGSWKKNVMMDWTEKG---WVSEMELKGGEPVEFKFVIVGKDKNLLW  720
            YG+++ ++G+   LG W  +  +  +      W + ++L     VE+K+V    D  ++W
Sbjct  652  YGQNVFVVGNVPALGGWNPSAAVALSPAAYPVWRATVDLPANTAVEYKYVKKNPDGTVIW  711

Query  721  ETGDNRVLKLPAGGSFKMVCQW  786
            E+G NR    PAGG+  +   W
Sbjct  712  ESGANRTFTTPAGGTRAVSDTW  733



>ref|XP_009130665.1| PREDICTED: uncharacterized protein LOC103855431 isoform X2 [Brassica 
rapa]
Length=359

 Score = 52.8 bits (125),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/155 (25%), Positives = 76/155 (49%), Gaps = 11/155 (7%)
 Frame = +1

Query  451  SSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS--WK-KNVM-M  618
            SS++    E+  + + S    ++++  L  +  +GEH  I+G     G   W  +N + +
Sbjct  99   SSIKANIEEEDAETEASPGRTVRVRFQLRKECVFGEHFFILGDHPVFGGGLWDPENALPL  158

Query  619  DWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQ-WNV  792
            +W++   W  ++EL  G  VEFKF++  +   +LW+ G NR ++         +C+ W  
Sbjct  159  NWSDGHVWTLDLELPVGRLVEFKFILKAQTGEILWQPGPNRAIETWETSKTIRICEDWEN  218

Query  793  TDKPL----ELLPLDSEGEYEAQVLADNGPVVTKD  885
             D  +    + +P D E E ++  + D  P+V ++
Sbjct  219  ADLQMMREEDFVPFDQEEEQQSSFILDM-PLVAEN  252



>ref|WP_034223083.1| glycosidase [Actinotalea ferrariae]
 gb|EYR64530.1| glycosidase [Actinotalea ferrariae CF5-4]
Length=573

 Score = 53.1 bits (126),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/137 (23%), Positives = 58/137 (42%), Gaps = 3/137 (2%)
 Frame = +1

Query  385  GIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHI  564
            G  G  +     G  + T+ A + +      K G    +      +   ++    YG+++
Sbjct  435  GCSGRSITVNASGQFTATVNANTPLALHVNAKAGASTTTPTTQTTISFGVNATTVYGQNV  494

Query  565  AIMGSTKELGSWKKNVMMDWTEKG---WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDN  735
             ++G+   LGSW     +  +      W + +    G  VE+K+V V    N++WE+G N
Sbjct  495  RVVGNHPSLGSWNAAAGVPLSSAAYPVWRAGVAFPAGTRVEYKYVKVDGSGNVVWESGVN  554

Query  736  RVLKLPAGGSFKMVCQW  786
            RV   P+ G+  +   W
Sbjct  555  RVATAPSTGTLTLNDAW  571



>ref|WP_030461968.1| hypothetical protein [Kitasatospora sp. NRRL B-11411]
Length=239

 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 44/85 (52%), Gaps = 7/85 (8%)
 Frame = +1

Query  550  YGEHIAIMGSTKELGSW--KKNVMMDWTEKG----WVSEMELKGGEPVEFKFVIVGKDKN  711
            YG+++ + G   ELG W   K V +  T  G    W + ++L    P+ +K+++   D +
Sbjct  155  YGQNLYLAGDLAELGGWDPAKAVPLT-TGSGSYPVWSAGLQLPPNTPIAYKYLLKNPDGS  213

Query  712  LLWETGDNRVLKLPAGGSFKMVCQW  786
            ++WE+GDNR    P  G+F     W
Sbjct  214  VVWESGDNRTATTPPTGTFTADDTW  238



>ref|XP_004506776.1| PREDICTED: protein ycf2-like isoform X2 [Cicer arietinum]
Length=468

 Score = 52.8 bits (125),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 57/99 (58%), Gaps = 5/99 (5%)
 Frame = +1

Query  457  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE  630
            V+   VE + ++  S    ++++  L    ++GE   I+G    LGSW   + + M W++
Sbjct  73   VDLETVEPRVQQNESNF--VRVEFQLQKDCDFGEQFLIVGDDPMLGSWNPLEALPMTWSD  130

Query  631  KG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  744
               W  E+++  G+PV++KF++ G + +++W+ G +R++
Sbjct  131  GHLWTLELDIPAGKPVQYKFILKGIEGDIIWQPGLDRII  169



>ref|WP_026447047.1| hypothetical protein [Acidobacteriaceae bacterium URHE0068]
Length=708

 Score = 53.1 bits (126),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 41/84 (49%), Gaps = 6/84 (7%)
 Frame = +1

Query  553  GEHIAIMGSTKELGSWKKNV------MMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNL  714
            G++I + GST ELG+W          M+      W   + L  G+ V+FKF+ +  + N+
Sbjct  623  GDYIFVTGSTVELGNWATTFQTAVGPMLAPDYPNWFLNVALPAGQAVQFKFIDIQSNGNV  682

Query  715  LWETGDNRVLKLPAGGSFKMVCQW  786
            +WE G N    +P  G+  +   W
Sbjct  683  VWENGPNHSYIVPTSGTGSVNVNW  706



>gb|KHG02392.1| Phosphoglucan, water dikinase, chloroplastic -like protein [Gossypium 
arboreum]
Length=451

 Score = 52.8 bits (125),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 58/116 (50%), Gaps = 6/116 (5%)
 Frame = +1

Query  451  SSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDW  624
            S VE   VE +  EK    + + ++  L+ +  +GEH  I+G    LG W  +  V + W
Sbjct  69   SQVELETVETQ-PEKEIPSKTVNVRFQLEKECSFGEHFFIVGDHPMLGLWDPDNAVPLTW  127

Query  625  TEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL--KLPAGGSFKMVCQ  783
            +E   W  E+++  G  ++FKF++     NLLW+   +R+   +     S  +VC+
Sbjct  128  SEGHVWTVELDVPVGVSIQFKFILKTSTGNLLWQPDPDRIFESRETETNSTTVVCE  183



>ref|XP_006576537.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X2 [Glycine max]
Length=291

 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 55/99 (56%), Gaps = 3/99 (3%)
 Frame = +1

Query  457  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE  630
            +ET E + +  E+ +  + +++   L     +GE   I+G    LGSW   + + M W+E
Sbjct  74   LETVEPQAQQSEQTNESKFVRVSFQLQKTCNFGEQFLIVGGGPVLGSWDPLEALPMTWSE  133

Query  631  KG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  744
               W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  134  GHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGLDRLI  172



>ref|XP_002947049.1| hypothetical protein VOLCADRAFT_103274 [Volvox carteri f. nagariensis]
 gb|EFJ51639.1| hypothetical protein VOLCADRAFT_103274 [Volvox carteri f. nagariensis]
Length=774

 Score = 52.8 bits (125),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 68/146 (47%), Gaps = 18/146 (12%)
 Frame = +1

Query  481  KGKEKRSAHENLK---LKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTEKG-WV  642
            +G  +  A + L    + I + ++V YGE + ++GS K LG W   + + + WTE   W 
Sbjct  36   QGAARSGAPQELTASTVTIKVPYRVNYGEVLRVVGSGKVLGDWSADRGLQLIWTEGDVWT  95

Query  643  SEMELKGGEPVEFKFVIVGKDKNLL--WETGDNRVLKLPAG-GSFKMVCQWNVTD-----  798
             ++ +  G   EFK V+  +    +  WE G NR+L +    G++ + CQW  T      
Sbjct  96   VQVPISAGH-YEFKCVVYNQATKSVARWEDGGNRILDITRELGTWDVSCQWGATAGMTST  154

Query  799  ---KPLELLPLDSEGEYEAQVLADNG  867
               KP   LP  SE E  A     +G
Sbjct  155  FIPKPQPPLPAASELEPTATEATTSG  180



>ref|XP_004183886.1| hypothetical protein EIN_170650 [Entamoeba invadens IP1]
 gb|ELP84540.1| hypothetical protein EIN_170650 [Entamoeba invadens IP1]
Length=131

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 45/79 (57%), Gaps = 3/79 (4%)
 Frame = +1

Query  517  KLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTE-KGWVSEMELKGGEPVEFKFVI  693
            K +  ++++   G  +A++GS KELG W+  ++M WT    W  E+E+    P E+K+ I
Sbjct  3    KFQFNINYKTTLGCKVAVVGSCKELGEWQHGILMTWTSGNNWRCEVEIT-NVPFEYKYQI  61

Query  694  VGKDKN-LLWETGDNRVLK  747
              +  N  +WE   NR+++
Sbjct  62   TDERGNVFVWEATQNRLVQ  80



>ref|XP_008243940.1| PREDICTED: uncharacterized protein LOC103342132 [Prunus mume]
Length=511

 Score = 52.4 bits (124),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 60/120 (50%), Gaps = 6/120 (5%)
 Frame = +1

Query  439  ICAVSSVETREVEKKGKEKRSAH--ENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN-  609
            IC  S  +T E+E    + +  H  + + +K  L  +  +G+   I+G     G W  + 
Sbjct  60   ICLSSKTQT-ELEVTDDQIQETHHTKTIHVKFQLQKECSFGQQFLIVGDDPMFGLWDPSS  118

Query  610  -VMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQ  783
             + M+W++   W  E+++  G+ V+FKF++     N+LW+ G +R+ +     +   VC+
Sbjct  119  AIPMNWSDGNVWTVELDIPVGKSVQFKFILKEITGNILWQPGPDRIFQTWETKNTITVCE  178



>ref|XP_006576541.1| PREDICTED: ribonuclease E/G-like protein, chloroplastic-like 
[Glycine max]
Length=527

 Score = 52.4 bits (124),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 55/99 (56%), Gaps = 3/99 (3%)
 Frame = +1

Query  457  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE  630
            +ET E + +  E+ +  + + +   L+    +GE   I+G    LGSW   + + M W+E
Sbjct  74   LETVEPQAQQSEQTNESKFVHVSFQLEKSCNFGEQFLIVGGDPVLGSWDPLEALPMTWSE  133

Query  631  KG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  744
               W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  134  GHVWAVELDMPAGQTFQYKFILEGEGGDIIWQPGSDRLI  172



>ref|XP_006576533.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X1 [Glycine max]
Length=275

 Score = 51.6 bits (122),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 55/99 (56%), Gaps = 3/99 (3%)
 Frame = +1

Query  457  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE  630
            +ET E + +  E+ +  + +++   L     +GE   I+G    LGSW   + + M W+E
Sbjct  74   LETVEPQAQQSEQTNESKFVRVSFQLQKTCNFGEQFLIVGGGPVLGSWDPLEALPMTWSE  133

Query  631  KG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  744
               W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  134  GHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGLDRLI  172



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4924815398356