BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3363

Length=1244
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009596831.1|  PREDICTED: YTH domain-containing family prot...  66.2    3e-09   Nicotiana tomentosiformis
ref|XP_009799895.1|  PREDICTED: uncharacterized protein LOC104245...  68.6    6e-09   Nicotiana sylvestris
ref|XP_009799894.1|  PREDICTED: uncharacterized protein LOC104245...  63.5    2e-07   Nicotiana sylvestris
emb|CBI16561.3|  unnamed protein product                              62.8    4e-07   Vitis vinifera
ref|XP_010651400.1|  PREDICTED: uncharacterized protein LOC100253...  62.8    4e-07   Vitis vinifera
ref|XP_002285750.1|  PREDICTED: uncharacterized protein LOC100253...  62.4    4e-07   Vitis vinifera
ref|XP_004504213.1|  PREDICTED: YTH domain family protein 2-like ...  59.7    3e-06   Cicer arietinum [garbanzo]
ref|XP_004504214.1|  PREDICTED: YTH domain family protein 2-like ...  59.7    3e-06   Cicer arietinum [garbanzo]
gb|KDO54496.1|  hypothetical protein CISIN_1g005158mg                 58.5    7e-06   Citrus sinensis [apfelsine]
gb|KDO54490.1|  hypothetical protein CISIN_1g005158mg                 58.5    7e-06   Citrus sinensis [apfelsine]
ref|XP_009597421.1|  PREDICTED: uncharacterized protein LOC104093...  58.5    7e-06   Nicotiana tomentosiformis
ref|XP_006488954.1|  PREDICTED: uncharacterized protein LOC102626...  58.5    8e-06   Citrus sinensis [apfelsine]
ref|XP_006445566.1|  hypothetical protein CICLE_v10014439mg           58.5    8e-06   Citrus clementina [clementine]
ref|XP_006445565.1|  hypothetical protein CICLE_v10014439mg           58.5    8e-06   
gb|KDO54492.1|  hypothetical protein CISIN_1g005158mg                 58.5    8e-06   Citrus sinensis [apfelsine]
ref|XP_004504212.1|  PREDICTED: YTH domain family protein 2-like ...  58.2    9e-06   
ref|XP_009764452.1|  PREDICTED: uncharacterized protein LOC104216...  56.6    3e-05   Nicotiana sylvestris
ref|XP_009764450.1|  PREDICTED: uncharacterized protein LOC104216...  56.6    3e-05   Nicotiana sylvestris
gb|EYU32828.1|  hypothetical protein MIMGU_mgv1a002229mg              55.5    7e-05   Erythranthe guttata [common monkey flower]
ref|XP_009597426.1|  PREDICTED: uncharacterized protein LOC104093...  53.9    2e-04   Nicotiana tomentosiformis
ref|XP_009601164.1|  PREDICTED: uncharacterized protein LOC104096490  53.5    3e-04   
ref|XP_009597413.1|  PREDICTED: uncharacterized protein LOC104093...  53.5    3e-04   Nicotiana tomentosiformis
ref|XP_007014622.1|  Evolutionarily conserved C-terminal region 2...  53.1    4e-04   
ref|XP_007014623.1|  Evolutionarily conserved C-terminal region 2...  53.1    4e-04   
gb|AET04399.2|  evolutionarily carboxy-terminal region protein        52.8    5e-04   Medicago truncatula
gb|KEH20708.1|  evolutionarily carboxy-terminal region protein        52.8    5e-04   Medicago truncatula



>ref|XP_009596831.1| PREDICTED: YTH domain-containing family protein 1-like [Nicotiana 
tomentosiformis]
Length=194

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 68/97 (70%), Gaps = 3/97 (3%)
 Frame = -1

Query  1229  QDKKAQQQLFLKQ--VSDIkateekkkeaTNGELKSQIPAEVACEAIKKATPIAQSNGDI  1056
             Q+KKA+QQLF KQ  + + KATEEK K+ +NGELKSQ  +EV+    K+++P AQSNG++
Sbjct  96    QEKKAKQQLFQKQSHLWEGKATEEKNKDNSNGELKSQKLSEVSAVLSKESSPAAQSNGEV  155

Query  1055  KPSENGSVANSGDLPSTAK-VTPSESKSIANGVVNGS  948
             K  ENGS+   GD    AK VT S+ K +A G+ NG+
Sbjct  156   KLVENGSITKLGDDVKVAKLVTVSDKKPVAKGIANGA  192



>ref|XP_009799895.1| PREDICTED: uncharacterized protein LOC104245894 isoform X2 [Nicotiana 
sylvestris]
Length=699

 Score = 68.6 bits (166),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 66/94 (70%), Gaps = 1/94 (1%)
 Frame = -1

Query  1229  QDKKAQQQLFLKQVSDIkateekkkeaTNGELKSQIPAEVACEAIKKATPIAQSNGDIKP  1050
             Q+KKA+QQLF KQV + KATEEK K+ +NGELKSQ  +EV+    K + P AQ+NG++K 
Sbjct  603   QEKKAKQQLFQKQVWEGKATEEKNKDNSNGELKSQKLSEVSAVLNKGSLPAAQANGEVKL  662

Query  1049  SENGSVANSGDLPSTAK-VTPSESKSIANGVVNG  951
             +ENGSV   GD    AK VT S+ K +A G+ NG
Sbjct  663   AENGSVTKLGDDVKVAKPVTVSDKKPVAKGIANG  696



>ref|XP_009799894.1| PREDICTED: uncharacterized protein LOC104245894 isoform X1 [Nicotiana 
sylvestris]
Length=701

 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = -1

Query  1229  QDKKAQQQLFLKQ--VSDIkateekkkeaTNGELKSQIPAEVACEAIKKATPIAQSNGDI  1056
             Q+KKA+QQLF KQ  V + KATEEK K+ +NGELKSQ  +EV+    K + P AQ+NG++
Sbjct  603   QEKKAKQQLFQKQSQVWEGKATEEKNKDNSNGELKSQKLSEVSAVLNKGSLPAAQANGEV  662

Query  1055  KPSENGSVANSGDLPSTAK-VTPSESKSIANGVVNG  951
             K +ENGSV   GD    AK VT S+ K +A G+ NG
Sbjct  663   KLAENGSVTKLGDDVKVAKPVTVSDKKPVAKGIANG  698



>emb|CBI16561.3| unnamed protein product [Vitis vinifera]
Length=675

 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = -1

Query  1145  NGELKSQIPAEVACEAIKKATPIAQSNGDIKPSENGSVANSGDLPSTAKVT-PSESKSIA  969
             NGELK Q   EVA + IK++TP  Q+NGD K  ENGSVA SGD P   K +  SE + +A
Sbjct  605   NGELKPQKSLEVASDLIKESTPAVQANGDRKVFENGSVAKSGDAPKAFKPSIVSEKRIVA  664

Query  968   NGVVNG  951
             NGV NG
Sbjct  665   NGVANG  670



>ref|XP_010651400.1| PREDICTED: uncharacterized protein LOC100253534 isoform X2 [Vitis 
vinifera]
Length=704

 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = -1

Query  1145  NGELKSQIPAEVACEAIKKATPIAQSNGDIKPSENGSVANSGDLPSTAKVT-PSESKSIA  969
             NGELK Q   EVA + IK++TP  Q+NGD K  ENGSVA SGD P   K +  SE + +A
Sbjct  634   NGELKPQKSLEVASDLIKESTPAVQANGDRKVFENGSVAKSGDAPKAFKPSIVSEKRIVA  693

Query  968   NGVVNG  951
             NGV NG
Sbjct  694   NGVANG  699



>ref|XP_002285750.1| PREDICTED: uncharacterized protein LOC100253534 isoform X1 [Vitis 
vinifera]
Length=705

 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = -1

Query  1145  NGELKSQIPAEVACEAIKKATPIAQSNGDIKPSENGSVANSGDLPSTAKVT-PSESKSIA  969
             NGELK Q   EVA + IK++TP  Q+NGD K  ENGSVA SGD P   K +  SE + +A
Sbjct  635   NGELKPQKSLEVASDLIKESTPAVQANGDRKVFENGSVAKSGDAPKAFKPSIVSEKRIVA  694

Query  968   NGVVNG  951
             NGV NG
Sbjct  695   NGVANG  700



>ref|XP_004504213.1| PREDICTED: YTH domain family protein 2-like isoform X2 [Cicer 
arietinum]
Length=678

 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 56/92 (61%), Gaps = 4/92 (4%)
 Frame = -1

Query  1226  DKKAQQQLFLKQVSDIkateekkkeaTNGELKSQIPAEVACEAIKKATPIAQSNGDIKPS  1047
             +KKA+QQ + KQV +       +K   NGE+ +Q P EV  E +K++T   + NGD K S
Sbjct  590   EKKAKQQ-YPKQVWE--GKPADEKIEVNGEINTQKP-EVTSELLKESTLAEKDNGDAKHS  645

Query  1046  ENGSVANSGDLPSTAKVTPSESKSIANGVVNG  951
             ENG VA +GD P  AK   SESK + NGV NG
Sbjct  646   ENGVVAKTGDAPKGAKPVVSESKIVPNGVANG  677



>ref|XP_004504214.1| PREDICTED: YTH domain family protein 2-like isoform X3 [Cicer 
arietinum]
Length=677

 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 56/92 (61%), Gaps = 4/92 (4%)
 Frame = -1

Query  1226  DKKAQQQLFLKQVSDIkateekkkeaTNGELKSQIPAEVACEAIKKATPIAQSNGDIKPS  1047
             +KKA+QQ + KQV +       +K   NGE+ +Q P EV  E +K++T   + NGD K S
Sbjct  589   EKKAKQQ-YPKQVWE--GKPADEKIEVNGEINTQKP-EVTSELLKESTLAEKDNGDAKHS  644

Query  1046  ENGSVANSGDLPSTAKVTPSESKSIANGVVNG  951
             ENG VA +GD P  AK   SESK + NGV NG
Sbjct  645   ENGVVAKTGDAPKGAKPVVSESKIVPNGVANG  676



>gb|KDO54496.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
Length=637

 Score = 58.5 bits (140),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = -1

Query  1145  NGELKSQIPAEVACEAIKKATPIAQSNGDIKPSENGSVANSGDLPSTAK-VTPSESKSIA  969
             NGELK+Q  +EVA + +++ T   QSNGD++ SENGSVA +GD    +K V  SE   +A
Sbjct  571   NGELKTQKSSEVASDLVEERTTTVQSNGDLRLSENGSVAKTGDAHKGSKPVVVSEKVILA  630

Query  968   NGVVNG  951
             NGV NG
Sbjct  631   NGVANG  636



>gb|KDO54490.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
Length=710

 Score = 58.5 bits (140),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = -1

Query  1145  NGELKSQIPAEVACEAIKKATPIAQSNGDIKPSENGSVANSGDLPSTAK-VTPSESKSIA  969
             NGELK+Q  +EVA + +++ T   QSNGD++ SENGSVA +GD    +K V  SE   +A
Sbjct  644   NGELKTQKSSEVASDLVEERTTTVQSNGDLRLSENGSVAKTGDAHKGSKPVVVSEKVILA  703

Query  968   NGVVNG  951
             NGV NG
Sbjct  704   NGVANG  709



>ref|XP_009597421.1| PREDICTED: uncharacterized protein LOC104093384 isoform X2 [Nicotiana 
tomentosiformis]
Length=703

 Score = 58.5 bits (140),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  1229  QDKKAQQQLFLKQVSDIkateekkkeaTNGELKSQIPAEVACEAIKKATPIAQSNGDIKP  1050
             Q+KK +QQLF KQV + KATEEKKKE T  E KSQ P+EV     K++ P A +NG++K 
Sbjct  606   QEKKVKQQLFQKQVWEGKATEEKKKENTKVEPKSQKPSEVPAGLNKESLPAAPTNGEVKL  665

Query  1049  SENGSVANSGDLPSTAKVTPSESKSIANGVVNG  951
             +ENGSV    D+     VT +E K +A G+  G
Sbjct  666   TENGSVTKGDDMKGAKSVTVAEKKPVAKGIAKG  698



>ref|XP_006488954.1| PREDICTED: uncharacterized protein LOC102626352 isoform X2 [Citrus 
sinensis]
 gb|KDO54491.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
Length=710

 Score = 58.5 bits (140),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = -1

Query  1145  NGELKSQIPAEVACEAIKKATPIAQSNGDIKPSENGSVANSGDLPSTAK-VTPSESKSIA  969
             NGELK+Q  +EVA + +++ T   QSNGD++ SENGSVA +GD    +K V  SE   +A
Sbjct  644   NGELKTQKSSEVASDLVEERTTTVQSNGDLRLSENGSVAKTGDAHKGSKPVVVSEKVILA  703

Query  968   NGVVNG  951
             NGV NG
Sbjct  704   NGVANG  709



>ref|XP_006445566.1| hypothetical protein CICLE_v10014439mg [Citrus clementina]
 ref|XP_006488953.1| PREDICTED: uncharacterized protein LOC102626352 isoform X1 [Citrus 
sinensis]
 gb|ESR58806.1| hypothetical protein CICLE_v10014439mg [Citrus clementina]
 gb|KDO54487.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
 gb|KDO54488.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
Length=711

 Score = 58.5 bits (140),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = -1

Query  1145  NGELKSQIPAEVACEAIKKATPIAQSNGDIKPSENGSVANSGDLPSTAK-VTPSESKSIA  969
             NGELK+Q  +EVA + +++ T   QSNGD++ SENGSVA +GD    +K V  SE   +A
Sbjct  645   NGELKTQKSSEVASDLVEERTTTVQSNGDLRLSENGSVAKTGDAHKGSKPVVVSEKVILA  704

Query  968   NGVVNG  951
             NGV NG
Sbjct  705   NGVANG  710



>ref|XP_006445565.1| hypothetical protein CICLE_v10014439mg [Citrus clementina]
 gb|ESR58805.1| hypothetical protein CICLE_v10014439mg [Citrus clementina]
 gb|KDO54497.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
 gb|KDO54498.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
Length=642

 Score = 58.5 bits (140),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = -1

Query  1145  NGELKSQIPAEVACEAIKKATPIAQSNGDIKPSENGSVANSGDLPSTAK-VTPSESKSIA  969
             NGELK+Q  +EVA + +++ T   QSNGD++ SENGSVA +GD    +K V  SE   +A
Sbjct  576   NGELKTQKSSEVASDLVEERTTTVQSNGDLRLSENGSVAKTGDAHKGSKPVVVSEKVILA  635

Query  968   NGVVNG  951
             NGV NG
Sbjct  636   NGVANG  641



>gb|KDO54492.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
Length=708

 Score = 58.5 bits (140),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = -1

Query  1145  NGELKSQIPAEVACEAIKKATPIAQSNGDIKPSENGSVANSGDLPSTAK-VTPSESKSIA  969
             NGELK+Q  +EVA + +++ T   QSNGD++ SENGSVA +GD    +K V  SE   +A
Sbjct  642   NGELKTQKSSEVASDLVEERTTTVQSNGDLRLSENGSVAKTGDAHKGSKPVVVSEKVILA  701

Query  968   NGVVNG  951
             NGV NG
Sbjct  702   NGVANG  707



>ref|XP_004504212.1| PREDICTED: YTH domain family protein 2-like isoform X1 [Cicer 
arietinum]
Length=685

 Score = 58.2 bits (139),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 42/65 (65%), Gaps = 1/65 (2%)
 Frame = -1

Query  1145  NGELKSQIPAEVACEAIKKATPIAQSNGDIKPSENGSVANSGDLPSTAKVTPSESKSIAN  966
             NGE+ +Q P EV  E +K++T   + NGD K SENG VA +GD P  AK   SESK + N
Sbjct  621   NGEINTQKP-EVTSELLKESTLAEKDNGDAKHSENGVVAKTGDAPKGAKPVVSESKIVPN  679

Query  965   GVVNG  951
             GV NG
Sbjct  680   GVANG  684



>ref|XP_009764452.1| PREDICTED: uncharacterized protein LOC104216148 isoform X2 [Nicotiana 
sylvestris]
Length=574

 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 57/98 (58%), Gaps = 2/98 (2%)
 Frame = -1

Query  1238  EKNQDKKAQQQLFLKQVSDIkateekkkeaTNGEL--KSQIPAEVACEAIKKATPIAQSN  1065
             ++NQ+KKA+QQLF KQ    +    ++K+  N +L  KSQ P+EV     K++ P A +N
Sbjct  472   KRNQEKKAKQQLFQKQSQAWEGKATEEKKKENTKLEPKSQKPSEVPAGLNKESLPTAPTN  531

Query  1064  GDIKPSENGSVANSGDLPSTAKVTPSESKSIANGVVNG  951
             G +K +EN SV    D      VT +E K +A G+ NG
Sbjct  532   GVVKLTENASVTKGDDTNGAKPVTVAEKKPVAKGIANG  569



>ref|XP_009764450.1| PREDICTED: uncharacterized protein LOC104216148 isoform X1 [Nicotiana 
sylvestris]
Length=709

 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 57/98 (58%), Gaps = 2/98 (2%)
 Frame = -1

Query  1238  EKNQDKKAQQQLFLKQVSDIkateekkkeaTNGEL--KSQIPAEVACEAIKKATPIAQSN  1065
             ++NQ+KKA+QQLF KQ    +    ++K+  N +L  KSQ P+EV     K++ P A +N
Sbjct  607   KRNQEKKAKQQLFQKQSQAWEGKATEEKKKENTKLEPKSQKPSEVPAGLNKESLPTAPTN  666

Query  1064  GDIKPSENGSVANSGDLPSTAKVTPSESKSIANGVVNG  951
             G +K +EN SV    D      VT +E K +A G+ NG
Sbjct  667   GVVKLTENASVTKGDDTNGAKPVTVAEKKPVAKGIANG  704



>gb|EYU32828.1| hypothetical protein MIMGU_mgv1a002229mg [Erythranthe guttata]
 gb|EYU32829.1| hypothetical protein MIMGU_mgv1a002229mg [Erythranthe guttata]
Length=698

 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 57/96 (59%), Gaps = 7/96 (7%)
 Frame = -1

Query  1229  QDKKAQQQLFLKQVSDIkateekkkeaTNGELKSQIPAEVACEAIKKATPIAQSNGDIKP  1050
             Q+KKA+QQ + KQ        +  +E TNG+LKSQ P+E A + +K+ T   Q+NG+IK 
Sbjct  606   QEKKAKQQQYHKQAQ--VWEGKPTEERTNGDLKSQNPSEPASDLVKEVTSAVQTNGEIKA  663

Query  1049  SENGSVANSGDLPSTAKVTP---SESKSIANGVVNG  951
              EN  +  SGD  S   V P   +E K +ANG+ NG
Sbjct  664   VENVVLTKSGD--SIKTVKPADVAEKKLVANGIANG  697



>ref|XP_009597426.1| PREDICTED: uncharacterized protein LOC104093384 isoform X3 [Nicotiana 
tomentosiformis]
Length=572

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 60/95 (63%), Gaps = 2/95 (2%)
 Frame = -1

Query  1229  QDKKAQQQLFLKQ--VSDIkateekkkeaTNGELKSQIPAEVACEAIKKATPIAQSNGDI  1056
             Q+KK +QQLF KQ  V + KATEEKKKE T  E KSQ P+EV     K++ P A +NG++
Sbjct  473   QEKKVKQQLFQKQSQVWEGKATEEKKKENTKVEPKSQKPSEVPAGLNKESLPAAPTNGEV  532

Query  1055  KPSENGSVANSGDLPSTAKVTPSESKSIANGVVNG  951
             K +ENGSV    D+     VT +E K +A G+  G
Sbjct  533   KLTENGSVTKGDDMKGAKSVTVAEKKPVAKGIAKG  567



>ref|XP_009601164.1| PREDICTED: uncharacterized protein LOC104096490, partial [Nicotiana 
tomentosiformis]
Length=709

 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 60/95 (63%), Gaps = 2/95 (2%)
 Frame = -1

Query  1229  QDKKAQQQLFLKQ--VSDIkateekkkeaTNGELKSQIPAEVACEAIKKATPIAQSNGDI  1056
             Q+KK +QQLF KQ  V + KATEEKKKE T  E KSQ P+EV     K++ P A +NG++
Sbjct  610   QEKKVKQQLFQKQSQVWEGKATEEKKKENTKVEPKSQKPSEVPAGLNKESLPAAPTNGEV  669

Query  1055  KPSENGSVANSGDLPSTAKVTPSESKSIANGVVNG  951
             K +ENGSV    D+     VT +E K +A G+  G
Sbjct  670   KLTENGSVTKGDDMKGAKSVTVAEKKPVAKGIAKG  704



>ref|XP_009597413.1| PREDICTED: uncharacterized protein LOC104093384 isoform X1 [Nicotiana 
tomentosiformis]
Length=705

 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 60/95 (63%), Gaps = 2/95 (2%)
 Frame = -1

Query  1229  QDKKAQQQLFLKQ--VSDIkateekkkeaTNGELKSQIPAEVACEAIKKATPIAQSNGDI  1056
             Q+KK +QQLF KQ  V + KATEEKKKE T  E KSQ P+EV     K++ P A +NG++
Sbjct  606   QEKKVKQQLFQKQSQVWEGKATEEKKKENTKVEPKSQKPSEVPAGLNKESLPAAPTNGEV  665

Query  1055  KPSENGSVANSGDLPSTAKVTPSESKSIANGVVNG  951
             K +ENGSV    D+     VT +E K +A G+  G
Sbjct  666   KLTENGSVTKGDDMKGAKSVTVAEKKPVAKGIAKG  700



>ref|XP_007014622.1| Evolutionarily conserved C-terminal region 2 isoform 1 [Theobroma 
cacao]
 gb|EOY32241.1| Evolutionarily conserved C-terminal region 2 isoform 1 [Theobroma 
cacao]
Length=742

 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -1

Query  1130  SQIPAEVACEAIKKATPIAQSNGDIKPSENGSVANSGDLPSTAK-VTPSESKSIANGVVN  954
             SQ   +   + IK+++ IA SNGD+KPSENGSV  S D P  AK V  SE + ++NG+ N
Sbjct  681   SQKSMDAGSDLIKESSVIAHSNGDLKPSENGSVTKSRDAPKGAKPVVVSEKRVLSNGIAN  740

Query  953   G  951
             G
Sbjct  741   G  741



>ref|XP_007014623.1| Evolutionarily conserved C-terminal region 2 isoform 2 [Theobroma 
cacao]
 gb|EOY32242.1| Evolutionarily conserved C-terminal region 2 isoform 2 [Theobroma 
cacao]
Length=710

 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -1

Query  1130  SQIPAEVACEAIKKATPIAQSNGDIKPSENGSVANSGDLPSTAK-VTPSESKSIANGVVN  954
             SQ   +   + IK+++ IA SNGD+KPSENGSV  S D P  AK V  SE + ++NG+ N
Sbjct  649   SQKSMDAGSDLIKESSVIAHSNGDLKPSENGSVTKSRDAPKGAKPVVVSEKRVLSNGIAN  708

Query  953   G  951
             G
Sbjct  709   G  709



>gb|AET04399.2| evolutionarily carboxy-terminal region protein [Medicago truncatula]
Length=670

 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 56/92 (61%), Gaps = 5/92 (5%)
 Frame = -1

Query  1226  DKKAQQQLFLKQVSDIkateekkkeaTNGELKSQIPAEVACEAIKKATPIAQSNGDIKPS  1047
             +KKA+QQ F KQV +       +K   NGE  +Q  +EV  E +K++T +A+ N D K S
Sbjct  583   EKKAKQQ-FPKQVWE--GKPTDEKIEVNGETNTQK-SEVNSELLKEST-LAKDNDDNKHS  637

Query  1046  ENGSVANSGDLPSTAKVTPSESKSIANGVVNG  951
             ENG+V  +GD P  AK   SESK + NGV NG
Sbjct  638   ENGAVPTTGDAPKGAKPVVSESKIVPNGVANG  669



>gb|KEH20708.1| evolutionarily carboxy-terminal region protein [Medicago truncatula]
Length=605

 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 56/92 (61%), Gaps = 5/92 (5%)
 Frame = -1

Query  1226  DKKAQQQLFLKQVSDIkateekkkeaTNGELKSQIPAEVACEAIKKATPIAQSNGDIKPS  1047
             +KKA+QQ F KQV +       +K   NGE  +Q  +EV  E +K++T +A+ N D K S
Sbjct  518   EKKAKQQ-FPKQVWE--GKPTDEKIEVNGETNTQK-SEVNSELLKEST-LAKDNDDNKHS  572

Query  1046  ENGSVANSGDLPSTAKVTPSESKSIANGVVNG  951
             ENG+V  +GD P  AK   SESK + NGV NG
Sbjct  573   ENGAVPTTGDAPKGAKPVVSESKIVPNGVANG  604



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3529228228238