BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3351

Length=1441
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009793502.1|  PREDICTED: 26S protease regulatory subunit 6...    810   0.0     Nicotiana sylvestris
ref|XP_004242474.1|  PREDICTED: 26S protease regulatory subunit 6...    810   0.0     Solanum lycopersicum
ref|XP_004242453.1|  PREDICTED: 26S protease regulatory subunit 6...    810   0.0     Solanum lycopersicum
ref|XP_009590756.1|  PREDICTED: 26S protease regulatory subunit 6...    808   0.0     Nicotiana tomentosiformis
ref|XP_006350894.1|  PREDICTED: 26S protease regulatory subunit 6...    808   0.0     Solanum tuberosum [potatoes]
ref|XP_009589072.1|  PREDICTED: 26S protease regulatory subunit 6...    803   0.0     Nicotiana tomentosiformis
ref|NP_001275060.1|  26S protease regulatory subunit 6B homolog         802   0.0     Solanum tuberosum [potatoes]
ref|XP_009788974.1|  PREDICTED: 26S protease regulatory subunit 6...    800   0.0     Nicotiana sylvestris
ref|XP_009779674.1|  PREDICTED: 26S protease regulatory subunit 6...    795   0.0     Nicotiana sylvestris
ref|XP_006464959.1|  PREDICTED: 26S protease regulatory subunit 6...    789   0.0     Citrus sinensis [apfelsine]
ref|XP_008456254.1|  PREDICTED: 26S protease regulatory subunit 6...    788   0.0     Cucumis melo [Oriental melon]
ref|XP_004139931.1|  PREDICTED: 26S protease regulatory subunit 6...    788   0.0     Cucumis sativus [cucumbers]
ref|XP_003553190.1|  PREDICTED: 26S protease regulatory subunit 6...    786   0.0     Glycine max [soybeans]
ref|XP_007205251.1|  hypothetical protein PRUPE_ppa006246mg             786   0.0     Prunus persica
ref|XP_007010399.1|  Regulatory particle triple-A ATPase 3 isoform 1    786   0.0     Theobroma cacao [chocolate]
ref|XP_012086544.1|  PREDICTED: 26S protease regulatory subunit 6...    786   0.0     Jatropha curcas
ref|XP_009355153.1|  PREDICTED: 26S protease regulatory subunit 6...    785   0.0     Pyrus x bretschneideri [bai li]
ref|XP_008384650.1|  PREDICTED: 26S protease regulatory subunit 6...    784   0.0     Malus domestica [apple tree]
ref|XP_009374408.1|  PREDICTED: 26S protease regulatory subunit 6...    783   0.0     
ref|XP_003538340.1|  PREDICTED: 26S protease regulatory subunit 6...    783   0.0     Glycine max [soybeans]
ref|XP_002523664.1|  26S protease regulatory subunit 6b, putative       782   0.0     Ricinus communis
ref|XP_008354341.1|  PREDICTED: 26S protease regulatory subunit 6...    780   0.0     
ref|XP_008364379.1|  PREDICTED: 26S protease regulatory subunit 6...    779   0.0     Malus domestica [apple tree]
ref|XP_012077729.1|  PREDICTED: 26S protease regulatory subunit 6...    776   0.0     Jatropha curcas
gb|KJB37071.1|  hypothetical protein B456_006G188400                    776   0.0     Gossypium raimondii
ref|XP_009383285.1|  PREDICTED: 26S protease regulatory subunit 6...    775   0.0     Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010931394.1|  PREDICTED: 26S protease regulatory subunit 6...    774   0.0     Elaeis guineensis
ref|XP_007146904.1|  hypothetical protein PHAVU_006G080300g             773   0.0     Phaseolus vulgaris [French bean]
ref|XP_002322593.1|  26S proteasome subunit 7 family protein            772   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_006401107.1|  hypothetical protein EUTSA_v10013708mg             770   0.0     Eutrema salsugineum [saltwater cress]
gb|EYU46034.1|  hypothetical protein MIMGU_mgv1a007193mg                770   0.0     Erythranthe guttata [common monkey flower]
ref|XP_009410502.1|  PREDICTED: 26S protease regulatory subunit 6...    770   0.0     Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004307102.1|  PREDICTED: 26S protease regulatory subunit 6...    769   0.0     Fragaria vesca subsp. vesca
ref|XP_011089540.1|  PREDICTED: 26S protease regulatory subunit 6...    770   0.0     Sesamum indicum [beniseed]
sp|P85200.1|PRS6B_HELAN  RecName: Full=26S protease regulatory su...    770   0.0     Helianthus annuus
ref|XP_010252000.1|  PREDICTED: 26S protease regulatory subunit 6...    770   0.0     Nelumbo nucifera [Indian lotus]
gb|ABK95490.1|  unknown                                                 769   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_004294715.1|  PREDICTED: 26S protease regulatory subunit 6...    769   0.0     Fragaria vesca subsp. vesca
ref|XP_006842586.1|  PREDICTED: 26S protease regulatory subunit 6...    769   0.0     Amborella trichopoda
ref|XP_009126768.1|  PREDICTED: 26S protease regulatory subunit 6...    769   0.0     Brassica rapa
ref|NP_200637.1|  regulatory particle triple-A ATPase 3                 768   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|AFW70814.1|  26S proteasome regulatory complex ATPase RPT3           771   0.0     
emb|CDY02806.1|  BnaC02g10830D                                          768   0.0     
ref|XP_008788111.1|  PREDICTED: 26S protease regulatory subunit 6...    768   0.0     Phoenix dactylifera
ref|XP_008803008.1|  PREDICTED: 26S protease regulatory subunit 6...    768   0.0     Phoenix dactylifera
ref|XP_010553185.1|  PREDICTED: 26S protease regulatory subunit 6...    768   0.0     Tarenaya hassleriana [spider flower]
ref|XP_003538341.1|  PREDICTED: 26S protease regulatory subunit 6...    768   0.0     Glycine max [soybeans]
ref|XP_010244563.1|  PREDICTED: 26S protease regulatory subunit 6...    768   0.0     Nelumbo nucifera [Indian lotus]
ref|NP_001150600.1|  LOC100284233                                       768   0.0     Zea mays [maize]
ref|XP_010453468.1|  PREDICTED: 26S protease regulatory subunit 6...    767   0.0     Camelina sativa [gold-of-pleasure]
ref|XP_010045430.1|  PREDICTED: 26S protease regulatory subunit 6...    767   0.0     Eucalyptus grandis [rose gum]
ref|XP_010922789.1|  PREDICTED: 26S protease regulatory subunit 6...    768   0.0     Elaeis guineensis
gb|KHG28345.1|  26S protease regulatory subunit 6B -like protein        767   0.0     Gossypium arboreum [tree cotton]
ref|XP_011080639.1|  PREDICTED: 26S protease regulatory subunit 6...    767   0.0     Sesamum indicum [beniseed]
ref|XP_009404251.1|  PREDICTED: 26S protease regulatory subunit 6...    767   0.0     Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010541475.1|  PREDICTED: 26S protease regulatory subunit 6...    767   0.0     Tarenaya hassleriana [spider flower]
ref|XP_004500390.1|  PREDICTED: 26S protease regulatory subunit 6...    766   0.0     Cicer arietinum [garbanzo]
emb|CDY58566.1|  BnaC03g12460D                                          765   0.0     Brassica napus [oilseed rape]
ref|XP_011040698.1|  PREDICTED: 26S protease regulatory subunit 6...    765   0.0     Populus euphratica
emb|CDX88666.1|  BnaA03g09830D                                          764   0.0     
emb|CDY32995.1|  BnaA10g12010D                                          764   0.0     Brassica napus [oilseed rape]
gb|KFK27360.1|  hypothetical protein AALP_AA8G372700                    763   0.0     Arabis alpina [alpine rockcress]
emb|CDY43865.1|  BnaC09g33780D                                          763   0.0     Brassica napus [oilseed rape]
ref|XP_002276130.2|  PREDICTED: 26S protease regulatory subunit 6...    764   0.0     Vitis vinifera
ref|XP_009120337.1|  PREDICTED: 26S protease regulatory subunit 6...    763   0.0     Brassica rapa
ref|XP_002307945.2|  26S proteasome subunit 7 family protein            761   0.0     
ref|XP_009132068.1|  PREDICTED: 26S protease regulatory subunit 6...    761   0.0     Brassica rapa
ref|XP_003600548.1|  26S protease regulatory subunit 6B                 759   0.0     Medicago truncatula
ref|XP_010684522.1|  PREDICTED: 26S protease regulatory subunit 6...    758   0.0     Beta vulgaris subsp. vulgaris [field beet]
gb|KHG22968.1|  26S protease regulatory subunit 6B -like protein        757   0.0     Gossypium arboreum [tree cotton]
ref|XP_004500389.1|  PREDICTED: 26S protease regulatory subunit 6...    757   0.0     Cicer arietinum [garbanzo]
ref|NP_001167681.1|  26S protease regulatory subunit 6B                 754   0.0     Zea mays [maize]
gb|AFK43608.1|  unknown                                                 752   0.0     Medicago truncatula
gb|KFK27359.1|  hypothetical protein AALP_AA8G372600                    751   0.0     Arabis alpina [alpine rockcress]
ref|XP_002960799.1|  hypothetical protein SELMODRAFT_163630             750   0.0     Selaginella moellendorffii
ref|XP_003578118.1|  PREDICTED: 26S protease regulatory subunit 6...    750   0.0     Brachypodium distachyon [annual false brome]
ref|XP_004952381.1|  PREDICTED: 26S protease regulatory subunit 6...    750   0.0     Setaria italica
ref|NP_001046700.1|  Os02g0325100                                       749   0.0     
ref|XP_003572718.1|  PREDICTED: 26S protease regulatory subunit 6...    748   0.0     Brachypodium distachyon [annual false brome]
ref|XP_001778695.1|  predicted protein                                  747   0.0     
gb|AFW70813.1|  hypothetical protein ZEAMMB73_780902                    748   0.0     
ref|XP_006405326.1|  hypothetical protein EUTSA_v10027786mg             745   0.0     
ref|XP_001765848.1|  predicted protein                                  744   0.0     
ref|XP_006432050.1|  hypothetical protein CICLE_v10003767mg             743   0.0     
dbj|BAJ88792.1|  predicted protein                                      744   0.0     Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006647211.1|  PREDICTED: 26S protease regulatory subunit 6...    744   0.0     Oryza brachyantha
ref|XP_008358903.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    743   0.0     
ref|XP_001772217.1|  predicted protein                                  739   0.0     
ref|XP_001759290.1|  predicted protein                                  739   0.0     
ref|XP_010094442.1|  26S protease regulatory subunit 6B-like protein    737   0.0     
ref|XP_002994701.1|  hypothetical protein SELMODRAFT_139024             733   0.0     
gb|EEC73047.1|  hypothetical protein OsI_06998                          736   0.0     Oryza sativa Indica Group [Indian rice]
dbj|BAB78494.1|  26S proteasome regulatory particle triple-A ATPa...    726   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|EMS47104.1|  26S protease regulatory subunit 6B-like protein         723   0.0     Triticum urartu
ref|XP_005644165.1|  26S proteasome subunit P45                         715   0.0     Coccomyxa subellipsoidea C-169
ref|XP_007010402.1|  Regulatory particle triple-A ATPase 3 isoform 1    711   0.0     
ref|XP_002464184.1|  hypothetical protein SORBIDRAFT_01g013750          700   0.0     Sorghum bicolor [broomcorn]
ref|XP_002947071.1|  26S proteasome regulatory complex                  699   0.0     Volvox carteri f. nagariensis
ref|XP_003059548.1|  predicted protein                                  697   0.0     Micromonas pusilla CCMP1545
ref|XP_002502202.1|  predicted protein                                  696   0.0     Micromonas commoda
ref|XP_008366215.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    694   0.0     
ref|XP_004982342.1|  PREDICTED: 26S protease regulatory subunit 6...    692   0.0     Setaria italica
gb|KJB78679.1|  hypothetical protein B456_013G011900                    690   0.0     Gossypium raimondii
ref|XP_001419562.1|  predicted protein                                  690   0.0     Ostreococcus lucimarinus CCE9901
ref|XP_007510638.1|  26S protease regulatory subunit 6B                 686   0.0     Bathycoccus prasinos
gb|KJB37073.1|  hypothetical protein B456_006G188400                    683   0.0     Gossypium raimondii
gb|ELT94669.1|  hypothetical protein CAPTEDRAFT_159938                  684   0.0     Capitella teleta
ref|XP_009046288.1|  hypothetical protein LOTGIDRAFT_212332             684   0.0     Lottia gigantea
ref|XP_005106028.1|  PREDICTED: 26S protease regulatory subunit 6...    684   0.0     Aplysia californica
ref|NP_001105252.1|  26S proteasome regulatory complex ATPase RPT3      680   0.0     
gb|ERL88150.1|  hypothetical protein D910_05538                         682   0.0     Dendroctonus ponderosae
gb|AEE62856.1|  unknown                                                 680   0.0     Dendroctonus ponderosae
gb|AII16486.1|  26S protease regulatory subunit 6B                      679   0.0     Paracyclopina nana
ref|XP_001846717.1|  26S protease regulatory subunit 6B                 679   0.0     Culex quinquefasciatus
emb|CEI86955.1|  Putative PRS6_MANSE 26S PROTEASE REGULATORY SUBU...    678   0.0     Rhizopus microsporus
gb|KFM81157.1|  26S protease regulatory subunit 6B                      679   0.0     Stegodyphus mimosarum
ref|XP_004364047.1|  26S protease regulatory subunit 6B                 677   0.0     Capsaspora owczarzaki ATCC 30864
emb|CEG64923.1|  Putative PRS6_MANSE 26S PROTEASE REGULATORY SUBU...    677   0.0     Rhizopus microsporus
gb|ETN58492.1|  26S protease regulatory subunit 6b                      677   0.0     Anopheles darlingi [American malaria mosquito]
ref|XP_011441086.1|  PREDICTED: 26S protease regulatory subunit 6...    677   0.0     Crassostrea gigas
gb|KCW87587.1|  hypothetical protein EUGRSUZ_B040322                    675   0.0     Eucalyptus grandis [rose gum]
gb|ESA10100.1|  hypothetical protein GLOINDRAFT_335580                  676   0.0     
ref|XP_011441085.1|  PREDICTED: 26S protease regulatory subunit 6...    677   0.0     Crassostrea gigas
gb|KFB40496.1|  hypothetical protein ZHAS_00008015                      676   0.0     Anopheles sinensis
ref|XP_003436353.1|  AGAP003008-PB                                      676   0.0     Anopheles gambiae str. PEST
ref|XP_009020773.1|  hypothetical protein HELRODRAFT_82280              674   0.0     Helobdella robusta
ref|XP_003426762.1|  PREDICTED: 26S protease regulatory subunit 6...    675   0.0     Nasonia vitripennis
ref|XP_004536707.1|  PREDICTED: 26S protease regulatory subunit 6...    675   0.0     Ceratitis capitata [medfly]
gb|EIE86992.1|  26S protease regulatory subunit 6B                      675   0.0     Rhizopus delemar RA 99-880
dbj|BAN21086.1|  26S protease regulatory subunit 6b                     675   0.0     Riptortus pedestris
gb|EIE77945.1|  26S protease regulatory subunit 6B                      674   0.0     Rhizopus delemar RA 99-880
ref|XP_001992538.1|  GH24150                                            674   0.0     Drosophila grimshawi
ref|XP_001652644.1|  AAEL007297-PA                                      676   0.0     
ref|XP_001599924.1|  PREDICTED: 26S protease regulatory subunit 6...    674   0.0     Nasonia vitripennis
gb|KDR18744.1|  26S protease regulatory subunit 6B                      674   0.0     Zootermopsis nevadensis
ref|XP_967976.1|  PREDICTED: 26S protease regulatory subunit 6B         674   0.0     Tribolium castaneum [rust-red flour beetle]
ref|XP_002426965.1|  26S protease regulatory subunit 6B, putative       674   0.0     Pediculus humanus corporis [human body lice]
ref|XP_005706946.1|  AAA-type ATPase                                    674   0.0     Galdieria sulphuraria
gb|EPB90875.1|  26S protease regulatory subunit 6B                      674   0.0     Mucor circinelloides f. circinelloides 1006PhL
ref|XP_011187616.1|  PREDICTED: 26S protease regulatory subunit 6B      673   0.0     Zeugodacus cucurbitae [melon fruit fly]
emb|CEP11541.1|  hypothetical protein                                   673   0.0     Parasitella parasitica
ref|XP_012061865.1|  PREDICTED: 26S protease regulatory subunit 6B      673   0.0     Atta cephalotes
ref|XP_002067350.1|  GK16371                                            673   0.0     Drosophila willistoni
ref|XP_002058291.1|  GJ15572                                            673   0.0     Drosophila virilis
ref|XP_011691070.1|  PREDICTED: 26S protease regulatory subunit 6B      673   0.0     Wasmannia auropunctata
ref|XP_011881061.1|  PREDICTED: 26S protease regulatory subunit 6B      673   0.0     Vollenhovia emeryi
ref|XP_011213714.1|  PREDICTED: 26S protease regulatory subunit 6B      673   0.0     Bactrocera dorsalis [papaya fruit fly]
ref|XP_001963428.1|  GF20295                                            673   0.0     Drosophila ananassae
ref|XP_011343132.1|  PREDICTED: 26S protease regulatory subunit 6B      673   0.0     Ooceraea biroi
ref|XP_011262588.1|  PREDICTED: 26S protease regulatory subunit 6B      673   0.0     Camponotus floridanus
emb|CDH54035.1|  26s protease regulatory subunit 6b                     673   0.0     Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_003402114.1|  PREDICTED: 26S protease regulatory subunit 6...    673   0.0     Bombus terrestris [large earth bumblebee]
ref|XP_011141739.1|  PREDICTED: 26S protease regulatory subunit 6B      673   0.0     Harpegnathos saltator
ref|XP_003489550.1|  PREDICTED: 26S protease regulatory subunit 6...    673   0.0     Bombus impatiens
ref|XP_001945593.1|  PREDICTED: 26S protease regulatory subunit 6B      673   0.0     Acyrthosiphon pisum
ref|NP_001040338.1|  26S protease regulatory subunit 6B                 673   0.0     Bombyx mori [silk moth]
ref|XP_001977168.1|  GG18392                                            672   0.0     
ref|XP_011310104.1|  PREDICTED: 26S protease regulatory subunit 6B      672   0.0     Fopius arisanus
ref|XP_005179381.1|  PREDICTED: 26S protease regulatory subunit 6B      672   0.0     Musca domestica
gb|KHN18648.1|  26S protease regulatory subunit 6B like                 669   0.0     Glycine soja [wild soybean]
ref|XP_003251449.1|  PREDICTED: 26S protease regulatory subunit 6...    672   0.0     Apis mellifera [bee]
ref|XP_003705364.1|  PREDICTED: 26S protease regulatory subunit 6B      672   0.0     Megachile rotundata
ref|XP_001355501.1|  GA14216                                            672   0.0     Drosophila pseudoobscura pseudoobscura
ref|XP_005719329.1|  26S proteasome ATP-dependent regulatory subunit    672   0.0     Chondrus crispus [carageen]
emb|CDS13275.1|  Putative 26S protease regulatory subunit 6B            672   0.0     Lichtheimia ramosa
ref|XP_008550503.1|  PREDICTED: 26S protease regulatory subunit 6B      672   0.0     Microplitis demolitor
ref|NP_572686.1|  regulatory particle triple-A ATPase 3, isoform A      671   0.0     Drosophila melanogaster
ref|XP_002608254.1|  hypothetical protein BRAFLDRAFT_115078             671   0.0     Branchiostoma floridae
ref|XP_002100910.1|  GE15910                                            671   0.0     Drosophila yakuba
ref|XP_002130593.1|  PREDICTED: 26S protease regulatory subunit 6B      671   0.0     Ciona intestinalis [sea vase]
emb|CDP04036.1|  unnamed protein product                                666   0.0     Coffea canephora [robusta coffee]
emb|CBA35188.1|  CG16916 protein                                        670   0.0     Drosophila melanogaster
ref|XP_011499440.1|  PREDICTED: 26S protease regulatory subunit 6B      670   0.0     Ceratosolen solmsi marchali
emb|CAX70788.1|  26S proteasome regulatory subunit T3                   669   0.0     Schistosoma japonicum
emb|CCD76272.1|  putative 26s protease regulatory subunit 6b            669   0.0     Schistosoma mansoni
gb|EHJ67194.1|  26S protease regulatory subunit 6B                      669   0.0     
ref|XP_009514770.1|  hypothetical protein PHYSODRAFT_554008             668   0.0     Phytophthora sojae
ref|XP_008913005.1|  26S protease regulatory subunit 6B                 668   0.0     Phytophthora parasitica INRA-310
ref|XP_002158042.1|  PREDICTED: 26S protease regulatory subunit 6...    667   0.0     
gb|KHN24720.1|  26S protease regulatory subunit 6B like                 665   0.0     Glycine soja [wild soybean]
ref|XP_011401722.1|  26S protease regulatory subunit 6B-like protein    668   0.0     Auxenochlorella protothecoides
gb|ETI35279.1|  26S protease regulatory subunit 6B                      669   0.0     Phytophthora parasitica P1569
ref|XP_002896373.1|  26S protease regulatory subunit 6B                 667   0.0     Phytophthora infestans T30-4
ref|XP_010903654.1|  PREDICTED: 26S protease regulatory subunit 6...    668   0.0     Esox lucius
sp|P46507.1|PRS6B_MANSE  RecName: Full=26S protease regulatory su...    667   0.0     Manduca sexta [Carolina sphinx]
ref|XP_003383670.1|  PREDICTED: 26S protease regulatory subunit 6...    667   0.0     
ref|NP_001140138.1|  26S protease regulatory subunit 6B                 667   0.0     Salmo salar
gb|EFX89046.1|  hypothetical protein DAPPUDRAFT_304599                  667   0.0     Daphnia pulex
ref|XP_003737662.1|  PREDICTED: 26S protease regulatory subunit 6...    666   0.0     Galendromus occidentalis
gb|EFZ19093.1|  hypothetical protein SINV_07148                         665   0.0     
emb|CDQ64781.1|  unnamed protein product                                667   0.0     Oncorhynchus mykiss
ref|XP_010903655.1|  PREDICTED: 26S protease regulatory subunit 6...    666   0.0     Esox lucius
ref|XP_005848629.1|  hypothetical protein CHLNCDRAFT_30648              667   0.0     Chlorella variabilis
ref|XP_008119139.1|  PREDICTED: 26S protease regulatory subunit 6B      666   0.0     Anolis carolinensis [Carolina anole]
ref|XP_007432262.1|  PREDICTED: 26S protease regulatory subunit 6...    666   0.0     Python bivittatus
gb|KHN24721.1|  26S protease regulatory subunit 6B like                 662   0.0     Glycine soja [wild soybean]
gb|ENN79977.1|  hypothetical protein YQE_03591                          664   0.0     Dendroctonus ponderosae
ref|XP_004346014.1|  26S protease regulatory subunit 6B family pr...    665   0.0     Acanthamoeba castellanii str. Neff
emb|CDI98382.1|  26S proteasome regulatory subunit T3                   665   0.0     Echinococcus multilocularis
gb|EUB63262.1|  26S protease regulatory subunit 6B                      665   0.0     Echinococcus granulosus
ref|XP_001635544.1|  predicted protein                                  665   0.0     Nematostella vectensis
ref|XP_004670466.1|  PREDICTED: 26S protease regulatory subunit 6B      663   0.0     Jaculus jaculus
ref|XP_008322265.1|  PREDICTED: 26S protease regulatory subunit 6...    664   0.0     
dbj|BAE40993.1|  unnamed protein product                                664   0.0     Mus musculus [mouse]
ref|XP_004441589.1|  PREDICTED: 26S protease regulatory subunit 6...    664   0.0     Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_006641599.1|  PREDICTED: 26S protease regulatory subunit 6...    664   0.0     Lepisosteus oculatus
emb|CEF99068.1|  26S proteasome subunit P45                             664   0.0     Ostreococcus tauri
ref|XP_002762172.1|  PREDICTED: 26S protease regulatory subunit 6B      664   0.0     Callithrix jacchus [common marmoset]
ref|XP_008880342.1|  26S protease regulatory subunit 6B                 663   0.0     Aphanomyces invadans
ref|XP_004078465.1|  PREDICTED: 26S protease regulatory subunit 6B      664   0.0     Oryzias latipes [Japanese rice fish]
ref|XP_004620804.1|  PREDICTED: 26S protease regulatory subunit 6...    664   0.0     Sorex araneus [Eurasian shrew]
ref|XP_004571156.1|  PREDICTED: 26S protease regulatory subunit 6...    663   0.0     Maylandia zebra
ref|XP_005801852.1|  PREDICTED: 26S protease regulatory subunit 6...    663   0.0     Xiphophorus maculatus
ref|XP_008322264.1|  PREDICTED: 26S protease regulatory subunit 6...    663   0.0     Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008288751.1|  PREDICTED: 26S protease regulatory subunit 6B      663   0.0     Stegastes partitus
ref|XP_003462064.1|  PREDICTED: 26S protease regulatory subunit 6...    663   0.0     Cavia porcellus [guinea pig]
ref|XP_001498459.1|  PREDICTED: 26S protease regulatory subunit 6...    663   0.0     Equus caballus [domestic horse]
ref|XP_008612954.1|  26S protease regulatory subunit 6B                 662   0.0     Saprolegnia diclina VS20
ref|XP_006096781.1|  PREDICTED: 26S protease regulatory subunit 6...    663   0.0     Myotis lucifugus
ref|XP_008428901.1|  PREDICTED: 26S protease regulatory subunit 6B      663   0.0     Poecilia reticulata
ref|NP_956044.2|  26S protease regulatory subunit 6B                    663   0.0     Danio rerio [leopard danio]
ref|NP_001083300.1|  proteasome 26S ATPase subunit 4 isoform 1          663   0.0     Xenopus laevis [clawed frog]
ref|NP_006494.1|  26S protease regulatory subunit 6B isoform 1          663   0.0     Homo sapiens [man]
ref|XP_011763084.1|  PREDICTED: 26S protease regulatory subunit 6B      663   0.0     Macaca nemestrina [pigtail macaque]
gb|EPZ35598.1|  26S protease regulatory subunit 6B-like protein         662   0.0     Rozella allomycis CSF55
gb|EPQ09332.1|  26S protease regulatory subunit 6B                      663   0.0     Myotis brandtii
ref|XP_011616501.1|  PREDICTED: 26S protease regulatory subunit 6...    662   0.0     Takifugu rubripes [tiger puffer]
ref|NP_001008010.1|  proteasome 26S ATPase subunit 4 isoform 1          663   0.0     Xenopus tropicalis [western clawed frog]
ref|XP_005086609.1|  PREDICTED: 26S protease regulatory subunit 6...    663   0.0     Mesocricetus auratus [Syrian golden hamster]
gb|KDD74891.1|  AAA+ ATPase                                             663   0.0     Helicosporidium sp. ATCC 50920
ref|NP_476463.1|  26S protease regulatory subunit 6B                    663   0.0     Rattus norvegicus [brown rat]
ref|XP_004571155.1|  PREDICTED: 26S protease regulatory subunit 6...    662   0.0     Maylandia zebra
ref|XP_005868901.1|  PREDICTED: 26S protease regulatory subunit 6B      662   0.0     
gb|AAP36910.1|  Homo sapiens proteasome (prosome, macropain) 26S ...    662   0.0     synthetic construct
ref|XP_003977146.1|  PREDICTED: 26S protease regulatory subunit 6...    662   0.0     Takifugu rubripes [tiger puffer]
ref|XP_006119266.1|  PREDICTED: 26S protease regulatory subunit 6...    664   0.0     
ref|XP_003451328.1|  PREDICTED: 26S protease regulatory subunit 6B      662   0.0     Oreochromis niloticus
gb|EFB16330.1|  hypothetical protein PANDA_012963                       662   0.0     Ailuropoda melanoleuca
ref|XP_008322263.1|  PREDICTED: 26S protease regulatory subunit 6...    663   0.0     Cynoglossus semilaevis [half-smooth tongue sole]
gb|EGW06399.1|  26S protease regulatory subunit 6B                      662   0.0     Cricetulus griseus [Chinese hamsters]
dbj|BAE39598.1|  unnamed protein product                                662   0.0     Mus musculus [mouse]
gb|ACO09848.1|  26S protease regulatory subunit 6B                      662   0.0     Osmerus mordax
ref|XP_005313327.1|  PREDICTED: 26S protease regulatory subunit 6B      662   0.0     Chrysemys picta bellii
ref|XP_005371358.1|  PREDICTED: 26S protease regulatory subunit 6...    662   0.0     Microtus ochrogaster [prairie voles]
ref|XP_008322262.1|  PREDICTED: 26S protease regulatory subunit 6...    663   0.0     
ref|XP_002733557.1|  PREDICTED: 26S protease regulatory subunit 6...    660   0.0     Saccoglossus kowalevskii
gb|EPY85975.1|  26S protease regulatory subunit 6B isoform 1            662   0.0     Camelus ferus
ref|XP_007643926.1|  PREDICTED: 26S protease regulatory subunit 6...    662   0.0     Cricetulus griseus [Chinese hamsters]
ref|XP_003341107.1|  PREDICTED: 26S protease regulatory subunit 6B      661   0.0     Monodelphis domestica
ref|XP_002041940.1|  GM11458                                            678   0.0     Drosophila sechellia
ref|XP_009845596.1|  26S protease regulatory subunit 6B                 661   0.0     Aphanomyces astaci
ref|XP_006900949.1|  PREDICTED: 26S protease regulatory subunit 6...    661   0.0     Elephantulus edwardii [Cape long-eared elephant shrew]
dbj|BAC34376.1|  unnamed protein product                                661   0.0     Mus musculus [mouse]
ref|XP_003420823.2|  PREDICTED: 26S protease regulatory subunit 6B      662   0.0     Loxodonta africana [African bush elephant]
ref|XP_011158091.1|  PREDICTED: 26S protease regulatory subunit 6B      659   0.0     
gb|AAH92265.1|  Proteasome (prosome, macropain) 26S subunit, ATPa...    660   0.0     Mus musculus [mouse]
gb|AFM85810.1|  26S protease regulatory subunit 6B                      660   0.0     Callorhinchus milii [Australian ghost shark]
ref|XP_007616231.1|  PREDICTED: 26S protease regulatory subunit 6...    662   0.0     
gb|AAI53480.1|  Proteasome (prosome, macropain) 26S subunit, ATPa...    660   0.0     Danio rerio [leopard danio]
gb|ADD37935.1|  26S protease regulatory subunit 6B                      660   0.0     Lepeophtheirus salmonis
ref|XP_001747495.1|  hypothetical protein                               660   0.0     Monosiga brevicollis MX1
ref|XP_004993573.1|  Rpt3-PA                                            659   0.0     Salpingoeca rosetta
gb|AAH55215.1|  Proteasome (prosome, macropain) 26S subunit, ATPa...    659   0.0     Danio rerio [leopard danio]
gb|KFH70645.1|  26S protease regulatory subunit 6B                      659   0.0     Mortierella verticillata NRRL 6337
gb|ACO12564.1|  26S protease regulatory subunit 6B                      659   0.0     Lepeophtheirus salmonis
dbj|BAM18300.1|  26S protease regulatory subunit rpt3                   657   0.0     Papilio xuthus [Chinese swallowtail]
emb|CBY08843.1|  unnamed protein product                                659   0.0     Oikopleura dioica
dbj|BAE35936.1|  unnamed protein product                                659   0.0     Mus musculus [mouse]
ref|XP_006680406.1|  26S protease regulatory subunit 6                  659   0.0     Batrachochytrium dendrobatidis JAM81
gb|AAC32612.1|  ATPase homolog                                          658   0.0     Homo sapiens [man]
emb|CBY33520.1|  unnamed protein product                                658   0.0     Oikopleura dioica
emb|CCI44470.1|  unnamed protein product                                657   0.0     Albugo candida
gb|ELW72414.1|  26S protease regulatory subunit 6B                      660   0.0     Tupaia chinensis
gb|ADO28335.1|  26S protease regulatory subunit 6b                      657   0.0     Ictalurus furcatus
emb|CCI44469.1|  unnamed protein product                                657   0.0     Albugo candida
gb|ADD24394.1|  26S protease regulatory subunit 6B                      657   0.0     Lepeophtheirus salmonis
emb|CCA25028.1|  26S protease regulatory subunit 6B putative            657   0.0     Albugo laibachii Nc14
ref|XP_005833940.1|  26S proteasome regulatory complex, ATPase RPT3     655   0.0     Guillardia theta CCMP2712
ref|NP_001188178.1|  26S protease regulatory subunit 6b                 656   0.0     Ictalurus punctatus
ref|XP_008686926.1|  PREDICTED: 26S protease regulatory subunit 6B      654   0.0     
ref|XP_003765174.1|  PREDICTED: 26S protease regulatory subunit 6...    651   0.0     
ref|XP_011064532.1|  PREDICTED: 26S protease regulatory subunit 6B      652   0.0     
ref|XP_003890704.1|  26S protease regulatory subunit 6B                 652   0.0     
ref|XP_008889562.1|  26S proteasome regulatory subunit 6b, putative     651   0.0     
gb|EFN64061.1|  26S protease regulatory subunit 6B                      650   0.0     
ref|XP_636422.1|  26S protease regulatory subunit 6B                    650   0.0     
gb|ELK30311.1|  26S protease regulatory subunit 6B                      655   0.0     
ref|XP_003402115.1|  PREDICTED: 26S protease regulatory subunit 6...    650   0.0     
ref|XP_002367919.1|  26S protease regulatory subunit 6b, putative       650   0.0     
ref|XP_003489551.1|  PREDICTED: 26S protease regulatory subunit 6...    650   0.0     
ref|XP_007385731.1|  26S proteasome subunit P45                         650   0.0     
ref|XP_002140352.1|  26S proteasome regulatory subunit 6b               649   0.0     
dbj|GAA49754.1|  26S proteasome regulatory subunit T3                   651   0.0     
ref|XP_007416315.1|  ATP-dependent 26S proteasome regulatory subunit    650   0.0     
ref|XP_005534337.1|  PREDICTED: uncharacterized protein LOC102114577    671   0.0     
ref|XP_006038625.1|  PREDICTED: 26S protease regulatory subunit 6...    649   0.0     
gb|EJU05654.1|  Rpt3-PA                                                 649   0.0     
gb|KIK30959.1|  hypothetical protein PISMIDRAFT_669903                  648   0.0     
gb|EPT06198.1|  hypothetical protein FOMPIDRAFT_1021221                 648   0.0     
ref|XP_009495537.1|  26S protease regulatory subunit 6B                 647   0.0     
ref|XP_667627.1|  26S proteasome AAA-ATPase subunit RPT3                647   0.0     
emb|CDS28411.1|  26S proteasome regulatory subunit T3                   647   0.0     
ref|XP_625842.1|  26S proteasome regulatory subunit 26b like AAA ...    647   0.0     
gb|AAA88243.1|  ATPase                                                  647   0.0     
ref|XP_009939027.1|  PREDICTED: 26S protease regulatory subunit 6B      645   0.0     
ref|XP_007863431.1|  endopeptidase                                      646   0.0     
ref|XP_004776202.1|  PREDICTED: 26S protease regulatory subunit 6...    647   0.0     
ref|XP_007300996.1|  26S proteasome subunit P45                         646   0.0     
gb|KIM62080.1|  hypothetical protein SCLCIDRAFT_15923                   645   0.0     
gb|KIO13599.1|  hypothetical protein M404DRAFT_6562                     645   0.0     
gb|EFA83241.1|  26S protease regulatory subunit 6B                      644   0.0     
gb|KII88586.1|  hypothetical protein PLICRDRAFT_629445                  644   0.0     
gb|EMD38383.1|  hypothetical protein CERSUDRAFT_82637                   644   0.0     
gb|KGB40627.1|  26S protease regulatory subunit 6B                      642   0.0     
ref|XP_003883310.1|  putative 26S protease regulatory subunit 6b        644   0.0     
ref|XP_007764664.1|  26S proteasome subunit P45                         644   0.0     
ref|XP_007843712.1|  putative rpt3-26s proteasome regulatory subunit    644   0.0     
ref|XP_007361181.1|  26S proteasome subunit P45                         644   0.0     
ref|XP_003292425.1|  hypothetical protein DICPUDRAFT_92867              643   0.0     
gb|KDE09347.1|  26S protease regulatory subunit 6B                      643   0.0     
ref|XP_007338552.1|  26S proteasome subunit P45                         643   0.0     
gb|KDQ60753.1|  hypothetical protein JAAARDRAFT_55492                   644   0.0     
ref|XP_008045259.1|  26S proteasome subunit P45                         643   0.0     
ref|XP_007395923.1|  hypothetical protein PHACADRAFT_256332             643   0.0     
gb|KIL68605.1|  hypothetical protein M378DRAFT_176746                   642   0.0     
ref|XP_007321858.1|  hypothetical protein SERLADRAFT_475257             642   0.0     
emb|CCO27717.1|  26S protease regulatory subunit 6B AltName: Full...    642   0.0     
gb|KIJ16889.1|  hypothetical protein PAXINDRAFT_168327                  642   0.0     
gb|EWM24898.1|  ATPase, AAA-type, core                                  641   0.0     
dbj|GAM17177.1|  hypothetical protein SAMD00019534_003520               641   0.0     
gb|KIY68615.1|  26S proteasome subunit P45                              641   0.0     
gb|KIP09602.1|  hypothetical protein PHLGIDRAFT_312429                  641   0.0     
ref|XP_009172984.1|  hypothetical protein T265_08813                    641   0.0     
emb|CDO69539.1|  hypothetical protein BN946_scf184785.g44               640   0.0     
gb|EUC61691.1|  26S protease regulatory subunit 6B                      640   0.0     
gb|KFO19028.1|  26S protease regulatory subunit 6B                      642   0.0     
ref|XP_004359468.1|  26S protease regulatory subunit 6B                 640   0.0     
gb|KDQ33181.1|  hypothetical protein PLEOSDRAFT_1080521                 641   0.0     
gb|AAB24841.1|  Tat binding protein 7, TBP-7=transcriptional acti...    642   0.0     
ref|XP_006458510.1|  hypothetical protein AGABI2DRAFT_134238            640   0.0     
ref|XP_003035173.1|  hypothetical protein SCHCODRAFT_81361              639   0.0     
gb|EWM24897.1|  ATPase, AAA-type, core                                  640   0.0     
emb|CCM02399.1|  predicted protein                                      640   0.0     
gb|KIM24006.1|  hypothetical protein M408DRAFT_332060                   639   0.0     
gb|KIJ69230.1|  hypothetical protein HYDPIDRAFT_172704                  639   0.0     
ref|XP_007010403.1|  Regulatory particle triple-A ATPase 3 isoform 2    637   0.0     
gb|KIJ44087.1|  hypothetical protein M422DRAFT_47573                    639   0.0     
ref|XP_009542793.1|  26S proteasome regulatory complex, ATPase RPT3     639   0.0     
gb|KIM87024.1|  hypothetical protein PILCRDRAFT_773760                  640   0.0     
ref|XP_005855008.1|  26S proteasome regulatory subunit T3               638   0.0     
gb|KIK94302.1|  hypothetical protein PAXRUDRAFT_143187                  638   0.0     
gb|KFR15566.1|  26S protease regulatory subunit 6B                      636   0.0     
ref|XP_002010747.1|  GI21710                                            637   0.0     
gb|KIK49306.1|  hypothetical protein CY34DRAFT_70223                    639   0.0     
emb|CEL51647.1|  26S proteasome regulatory subunit T3                   639   0.0     
ref|XP_002678532.1|  predicted protein                                  637   0.0     
gb|KIY50995.1|  26S proteasome subunit P45                              638   0.0     
ref|XP_001833660.1|  Rpt3-PA                                            637   0.0     
gb|KDQ07945.1|  hypothetical protein BOTBODRAFT_119334                  637   0.0     
dbj|GAA99899.1|  hypothetical protein E5Q_06602                         636   0.0     
gb|EST06482.1|  26S proteasome regulatory complex                       636   0.0     
ref|XP_011386681.1|  putative proteasome regulatory particle base...    636   0.0     
gb|ELU44984.1|  Rpt3-PA                                                 637   0.0     
emb|CDI51469.1|  probable RPT3-26S proteasome regulatory subunit        635   0.0     
dbj|GAC99280.1|  hypothetical protein PHSY_006881                       635   0.0     
gb|KIK59806.1|  hypothetical protein GYMLUDRAFT_245016                  635   0.0     
ref|XP_010743339.1|  PREDICTED: 26S protease regulatory subunit 6B      634   0.0     
ref|XP_007326889.1|  hypothetical protein AGABI1DRAFT_89665             635   0.0     
gb|KIO26256.1|  hypothetical protein M407DRAFT_202840                   634   0.0     
dbj|GAC73787.1|  26S proteasome regulatory complex                      634   0.0     
emb|CDP95502.1|  Protein BM-RPT-3, isoform b                            633   0.0     
gb|EFO26450.2|  26S protease regulatory subunit 6B                      633   0.0     
gb|EJW88499.1|  26S protease regulatory subunit 6b                      632   0.0     
emb|CDP95501.1|  Protein BM-RPT-3, isoform a                            633   0.0     
emb|CCA69223.1|  probable RPT3-26S proteasome regulatory subunit        633   0.0     
gb|KJB37072.1|  hypothetical protein B456_006G188400                    630   0.0     
gb|KHN81256.1|  putative 26S protease regulatory subunit 6B             633   0.0     
emb|CCF49930.1|  probable RPT3-26S proteasome regulatory subunit        631   0.0     
ref|XP_004622354.1|  PREDICTED: 26S protease regulatory subunit 6...    632   0.0     
gb|KJB37074.1|  hypothetical protein B456_006G188400                    628   0.0     
ref|XP_003137618.1|  hypothetical protein LOAG_02032                    632   0.0     
ref|XP_001964466.1|  GF23193                                            629   0.0     
gb|KIM49407.1|  hypothetical protein M413DRAFT_15490                    629   0.0     
emb|CAJ41901.1|  26S protease regulatory subunit 6                      627   0.0     
emb|CBQ67959.1|  probable RPT3-26S proteasome regulatory subunit        629   0.0     
ref|NP_649938.2|  regulatory particle triple-A ATPase 3-related, ...    627   0.0     
ref|XP_007881831.1|  hypothetical protein PFL1_06102                    628   0.0     
gb|KDR81770.1|  hypothetical protein GALMADRAFT_221637                  627   0.0     
ref|XP_001878591.1|  predicted protein                                  629   0.0     
gb|KJA27501.1|  hypothetical protein HYPSUDRAFT_131066                  628   0.0     
ref|XP_007264005.1|  26S proteasome subunit P45                         625   0.0     
ref|XP_011680241.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    625   0.0     
gb|KDN38150.1|  putative RPT3-26S proteasome regulatory subunit         625   0.0     
emb|CBJ27612.1|  conserved unknown protein                              624   0.0     
emb|CBI15803.3|  unnamed protein product                                620   0.0     
gb|KFD52486.1|  hypothetical protein M513_06683                         624   0.0     
ref|XP_009037261.1|  hypothetical protein AURANDRAFT_27118              622   0.0     
gb|KCW87589.1|  hypothetical protein EUGRSUZ_B040322                    620   0.0     
emb|CDW56024.1|  26S protease regulatory subunit 6B                     620   0.0     
ref|XP_001358593.3|  GA21817                                            620   0.0     
gb|EPS63694.1|  hypothetical protein M569_11089                         616   0.0     
gb|EAR87503.2|  26S protease regulatory subunit 6B                      619   0.0     
ref|XP_006955862.1|  putative 26S protease regulatory subunit 6B        619   0.0     
gb|KIR85532.1|  26S protease regulatory subunit 6B                      619   0.0     
emb|CEF60937.1|  RE01104p                                               619   0.0     
ref|XP_003191253.1|  endopeptidase                                      619   0.0     
gb|KIK06520.1|  hypothetical protein K443DRAFT_263212                   622   0.0     
gb|EMS23793.1|  26S proteasome regulatory subunit t3                    617   0.0     
gb|EPB72720.1|  26S proteasome subunit P45 family protein               617   0.0     
ref|XP_002000050.1|  GI24873                                            616   0.0     
gb|KJH42606.1|  26S proteasome subunit P45 family protein               617   0.0     
gb|EYC42463.1|  hypothetical protein Y032_0531g3031                     618   0.0     
gb|ERG80458.1|  putative 26s protease regulatory subunit 6b             636   0.0     
gb|KIH59651.1|  26S proteasome subunit P45 family protein               617   0.0     
gb|EYC42464.1|  hypothetical protein Y032_0531g3031                     617   0.0     
gb|KGB79724.1|  endopeptidase                                           616   0.0     
gb|KIS00774.1|  26S protease regulatory subunit 6B                      615   0.0     
ref|XP_001731796.1|  hypothetical protein MGL_1064                      614   0.0     
ref|XP_009267998.1|  26S protease regulatory subunit 6B                 614   0.0     
ref|XP_012047538.1|  26S protease regulatory subunit 6B                 614   0.0     
gb|KIR32792.1|  26S protease regulatory subunit 6B                      615   0.0     
ref|XP_569326.1|  endopeptidase                                         613   0.0     
ref|XP_007007724.1|  hypothetical protein TREMEDRAFT_40960              613   0.0     
ref|XP_006641600.1|  PREDICTED: 26S protease regulatory subunit 6...    612   0.0     
gb|KEH34524.1|  26S protease regulatory subunit 6B                      612   0.0     
ref|XP_952725.1|  26s protease regulatory subunit                       612   0.0     
ref|XP_002780868.1|  26S protease regulatory subunit 6B, putative       613   0.0     
ref|XP_002775822.1|  26S protease regulatory subunit 6B, putative       613   0.0     
ref|XP_005616633.1|  PREDICTED: 26S protease regulatory subunit 6...    613   0.0     
ref|XP_005801853.1|  PREDICTED: 26S protease regulatory subunit 6...    612   0.0     
ref|XP_763666.1|  26S proteasome aaa-ATPase subunit Rpt3                612   0.0     
ref|XP_004776203.1|  PREDICTED: 26S protease regulatory subunit 6...    612   0.0     
ref|XP_004441590.1|  PREDICTED: 26S protease regulatory subunit 6...    610   0.0     
gb|ABB13464.1|  26S proteasome subunit RPT3                             610   0.0     
ref|XP_004620805.1|  PREDICTED: 26S protease regulatory subunit 6...    610   0.0     
ref|XP_001498472.1|  PREDICTED: 26S protease regulatory subunit 6...    610   0.0     
ref|XP_001610015.1|  26s proteasome aaa-ATPase subunit Rpt3             610   0.0     
ref|XP_005086610.1|  PREDICTED: 26S protease regulatory subunit 6...    610   0.0     
ref|XP_006096782.1|  PREDICTED: 26S protease regulatory subunit 6...    610   0.0     
ref|XP_007069898.1|  PREDICTED: 26S protease regulatory subunit 6...    610   0.0     
ref|NP_694546.1|  26S protease regulatory subunit 6B isoform 2          610   0.0     
ref|XP_003462065.1|  PREDICTED: 26S protease regulatory subunit 6...    610   0.0     
ref|XP_005371359.1|  PREDICTED: 26S protease regulatory subunit 6...    610   0.0     
gb|KCW87588.1|  hypothetical protein EUGRSUZ_B040322                    608   0.0     
emb|CDW88348.1|  26s protease regulatory subunit 6b homolog             627   0.0     
ref|XP_005963544.1|  PREDICTED: 26S protease regulatory subunit 6...    612   0.0     
ref|XP_006900950.1|  PREDICTED: 26S protease regulatory subunit 6...    608   0.0     
emb|CCU98091.1|  unnamed protein product                                609   0.0     
dbj|BAN64638.1|  26S proteasome aaa-ATPase subunit Rpt3, putative       607   0.0     
ref|NP_498429.1|  Protein RPT-3                                         608   0.0     
ref|XP_002641235.1|  C. briggsae CBR-RPT-3 protein                      608   0.0     
ref|XP_002293010.1|  26S proteasome ATPase regulatory subunit           606   0.0     
ref|XP_003111815.1|  hypothetical protein CRE_03184                     608   0.0     
ref|XP_005235344.1|  PREDICTED: 26S protease regulatory subunit 6...    606   0.0     
ref|XP_004648057.1|  PREDICTED: 26S protease regulatory subunit 6...    606   0.0     
gb|EGT59058.1|  hypothetical protein CAEBREN_09100                      607   0.0     
ref|XP_011123997.1|  hypothetical protein AOL_s00083g516                608   0.0     
ref|XP_002179511.1|  predicted protein                                  605   0.0     
gb|EHK43885.1|  ATPase Rpt3 of the 19S regulatory particle of the...    607   0.0     
ref|XP_004031132.1|  hypothetical protein IMG5_146690                   605   0.0     
gb|EHK23454.1|  hypothetical protein TRIVIDRAFT_74069                   606   0.0     
ref|XP_006964974.1|  predicted protein                                  606   0.0     
ref|XP_007657764.1|  PREDICTED: 26S protease regulatory subunit 6B      602   0.0     
ref|XP_007010400.1|  Regulatory particle triple-A ATPase 3 isoform 2    600   0.0     
gb|KDB18269.1|  26S protease regulatory subunit 6B                      604   0.0     
ref|XP_003665225.1|  hypothetical protein MYCTH_2095260                 604   0.0     
ref|XP_007807800.1|  26S protease regulatory subunit 6B                 604   0.0     
emb|CCX34353.1|  Similar to 26S protease regulatory subunit 6B ho...    603   0.0     
gb|EGT35664.1|  CBN-RPT-3 protein                                       603   0.0     
ref|XP_001994767.1|  GH14249                                            602   0.0     
ref|XP_003718052.1|  26S protease regulatory subunit 6B                 603   0.0     
emb|CEJ94946.1|  Putative 26S protease regulatory subunit 6B            603   0.0     
gb|EXV06715.1|  26S protease regulatory subunit 6B family protein       603   0.0     
gb|KJK81129.1|  26S protease regulatory subunit 6B                      603   0.0     
gb|KID91753.1|  26S protease regulatory subunit 6B                      603   0.0     
gb|KHN97338.1|  26S protease regulatory subunit 6B                      603   0.0     
gb|EFQ27514.1|  26S proteasome subunit P45 family protein               603   0.0     
ref|XP_009221425.1|  26S protease regulatory subunit 6B                 602   0.0     
ref|XP_001227568.1|  hypothetical protein CHGG_09641                    602   0.0     
emb|CCF32503.1|  26S protease regulatory subunit 6B                     602   0.0     
ref|XP_007917191.1|  putative 26s protease regulatory subunit 6b ...    602   0.0     
ref|XP_007284924.1|  26s protease regulatory subunit 6b                 602   0.0     
gb|ENH76669.1|  26s protease regulatory subunit 6b                      602   0.0     
ref|XP_002493117.1|  One of six ATPases of the 19S regulatory par...    601   0.0     
ref|XP_007695610.1|  hypothetical protein COCSADRAFT_33722              601   0.0     
ref|XP_003351393.1|  hypothetical protein SMAC_03700                    601   0.0     
ref|XP_007687093.1|  hypothetical protein COCMIDRAFT_25595              601   0.0     
gb|KDN71564.1|  putative 26S proteasome subunit P45 family protein      601   0.0     
ref|XP_006692135.1|  26S protease regulatory subunit 6B-like protein    601   0.0     
ref|XP_003005676.1|  26S protease regulatory subunit 6B                 601   0.0     
ref|XP_007584362.1|  putative 26s protease regulatory subunit 6b ...    600   0.0     
ref|XP_001933672.1|  26S protease regulatory subunit 6B                 600   0.0     
ref|XP_959904.1|  26S protease regulatory subunit 6B                    600   0.0     
ref|XP_648721.1|  26s proteasome subunit P45 family protein             599   0.0     
ref|XP_007599809.1|  26S protease regulatory subunit 6B                 600   0.0     
gb|EWG52819.1|  26S protease regulatory subunit 6B                      600   0.0     
ref|XP_001802448.1|  hypothetical protein SNOG_12222                    600   0.0     
gb|EPE03324.1|  26s protease regulatory subunit 6b                      600   0.0     
gb|KJZ77286.1|  26S protease regulatory subunit 6B-like protein         600   0.0     
ref|XP_011325634.1|  26S protease regulatory subunit 6B                 600   0.0     



>ref|XP_009793502.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Nicotiana 
sylvestris]
Length=413

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/417 (95%), Positives = 403/417 (97%), Gaps = 4/417 (1%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYV  252
             MATPMVLDP P P+P    P+TR D S  DV  D EDDLYARLKSLQRQLEFIEIQEEYV
Sbjct  1     MATPMVLDPKPLPEP----PSTRPDPSVHDVPSDGEDDLYARLKSLQRQLEFIEIQEEYV  56

Query  253   KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINR  432
             KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID NN+IVGSTTGSNYYVRILSTINR
Sbjct  57    KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDTNNAIVGSTTGSNYYVRILSTINR  116

Query  433   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV  612
             ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTY+DIGGCDIQKQEIREAV
Sbjct  117   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYSDIGGCDIQKQEIREAV  176

Query  613   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  792
             ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVA+HTTAAFIRVVGSEFVQKYLG
Sbjct  177   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLG  236

Query  793   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  972
             EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ
Sbjct  237   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  296

Query  973   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE  1152
             TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE
Sbjct  297   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE  356

Query  1153  DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DYVSRPDKISAAEI+AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  357   DYVSRPDKISAAEISAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  413



>ref|XP_004242474.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Solanum 
lycopersicum]
Length=414

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/418 (95%), Positives = 406/418 (97%), Gaps = 5/418 (1%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASAQDV-SYDAEDDLYARLKSLQRQLEFIEIQEEY  249
             MA+ M+LDP P+P    E+PATR D S+ DV S + EDDLYARLKSLQRQLEFIEIQEEY
Sbjct  1     MASAMILDPKPSP----ELPATRPDLSSHDVPSENGEDDLYARLKSLQRQLEFIEIQEEY  56

Query  250   VKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTIN  429
             VKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNN+IVGSTTGSNYYVRILSTIN
Sbjct  57    VKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNAIVGSTTGSNYYVRILSTIN  116

Query  430   RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREA  609
             RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREA
Sbjct  117   RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREA  176

Query  610   VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYL  789
             VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVA+HTTAAFIRVVGSEFVQKYL
Sbjct  177   VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVAHHTTAAFIRVVGSEFVQKYL  236

Query  790   GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD  969
             GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD
Sbjct  237   GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD  296

Query  970   QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDL  1149
             QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDL
Sbjct  297   QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDL  356

Query  1150  EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  357   EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  414



>ref|XP_004242453.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Solanum 
lycopersicum]
Length=414

 Score =   810 bits (2091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/418 (95%), Positives = 405/418 (97%), Gaps = 5/418 (1%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASAQDV-SYDAEDDLYARLKSLQRQLEFIEIQEEY  249
             MA  MVLDP P+P    E+PATR D S+ DV S + EDDLYARLKSLQRQLEFIEIQEEY
Sbjct  1     MAAAMVLDPKPSP----ELPATRPDLSSHDVPSENGEDDLYARLKSLQRQLEFIEIQEEY  56

Query  250   VKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTIN  429
             VKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNN+IVGSTTGSNYYVRILSTIN
Sbjct  57    VKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNAIVGSTTGSNYYVRILSTIN  116

Query  430   RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREA  609
             RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREA
Sbjct  117   RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREA  176

Query  610   VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYL  789
             VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVA+HTTAAFIRVVGSEFVQKYL
Sbjct  177   VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVAHHTTAAFIRVVGSEFVQKYL  236

Query  790   GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD  969
             GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD
Sbjct  237   GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD  296

Query  970   QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDL  1149
             QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDL
Sbjct  297   QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDL  356

Query  1150  EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  357   EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  414



>ref|XP_009590756.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Nicotiana 
tomentosiformis]
Length=413

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/417 (95%), Positives = 402/417 (96%), Gaps = 4/417 (1%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYV  252
             MATPMVLDP P P    E P+TR D   QDV  D EDDLYARLKSLQRQLEFIEIQEEYV
Sbjct  1     MATPMVLDPKPLP----EAPSTRPDPYIQDVLSDGEDDLYARLKSLQRQLEFIEIQEEYV  56

Query  253   KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINR  432
             KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID NN+IVGSTTGSNYYVRILSTINR
Sbjct  57    KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDTNNAIVGSTTGSNYYVRILSTINR  116

Query  433   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV  612
             ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTY+DIGGCDIQKQEIREAV
Sbjct  117   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYSDIGGCDIQKQEIREAV  176

Query  613   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  792
             ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVA+HTTAAFIRVVGSEFVQKYLG
Sbjct  177   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLG  236

Query  793   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  972
             EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ
Sbjct  237   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  296

Query  973   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE  1152
             TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE
Sbjct  297   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE  356

Query  1153  DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DYVSRPDKISAAEI+AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  357   DYVSRPDKISAAEISAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  413



>ref|XP_006350894.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Solanum 
tuberosum]
Length=414

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/418 (95%), Positives = 405/418 (97%), Gaps = 5/418 (1%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASAQDV-SYDAEDDLYARLKSLQRQLEFIEIQEEY  249
             MA+ M+LDP PTP    E+PATR D S+ DV S + EDDLYARLKSLQRQLEFIEIQEEY
Sbjct  1     MASAMLLDPKPTP----ELPATRPDLSSHDVPSENGEDDLYARLKSLQRQLEFIEIQEEY  56

Query  250   VKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTIN  429
             VKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNN+IVGSTTGSNYYVRILSTIN
Sbjct  57    VKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNAIVGSTTGSNYYVRILSTIN  116

Query  430   RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREA  609
             RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREA
Sbjct  117   RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREA  176

Query  610   VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYL  789
             VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVA+HTTAAFIRVVGSEFVQKYL
Sbjct  177   VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVAHHTTAAFIRVVGSEFVQKYL  236

Query  790   GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD  969
             GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD
Sbjct  237   GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD  296

Query  970   QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDL  1149
             QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDL
Sbjct  297   QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDL  356

Query  1150  EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             EDYVSRPDKISAAEI AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  357   EDYVSRPDKISAAEITAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  414



>ref|XP_009589072.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Nicotiana 
tomentosiformis]
Length=413

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/417 (94%), Positives = 401/417 (96%), Gaps = 4/417 (1%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYV  252
             MA+PMVLDP P PKP    P+TR + S      D EDDLYARLKSLQRQLEFIEIQEEYV
Sbjct  1     MASPMVLDPTPLPKP----PSTRPEPSIPSSPSDGEDDLYARLKSLQRQLEFIEIQEEYV  56

Query  253   KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINR  432
             KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID NN+IVGSTTGSNYYVRILSTINR
Sbjct  57    KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDTNNAIVGSTTGSNYYVRILSTINR  116

Query  433   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV  612
             ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV
Sbjct  117   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV  176

Query  613   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  792
             ELPLTHH+LYKQIGIDPPRGVLLYGPPGTGKTMLAKAVA+HTTAAFIRVVGSEFVQKYLG
Sbjct  177   ELPLTHHDLYKQIGIDPPRGVLLYGPPGTGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLG  236

Query  793   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  972
             EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ
Sbjct  237   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  296

Query  973   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE  1152
             TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE
Sbjct  297   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE  356

Query  1153  DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DYVSRPDKISAAEI+AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  357   DYVSRPDKISAAEISAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  413



>ref|NP_001275060.1| 26S protease regulatory subunit 6B homolog [Solanum tuberosum]
 sp|P54778.1|PRS6B_SOLTU RecName: Full=26S protease regulatory subunit 6B homolog [Solanum 
tuberosum]
 gb|AAB67835.1| POTATP1 [Solanum tuberosum]
Length=413

 Score =   802 bits (2072),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/417 (95%), Positives = 401/417 (96%), Gaps = 4/417 (1%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYV  252
             MAT MVLDP    KP+ ++PATR + S  DV  D EDDLYARLKSLQRQLEFIEIQEEYV
Sbjct  1     MATAMVLDP----KPAEKLPATRPETSITDVPSDGEDDLYARLKSLQRQLEFIEIQEEYV  56

Query  253   KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINR  432
             KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNN+IVGSTTGSNYYVRILSTINR
Sbjct  57    KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNAIVGSTTGSNYYVRILSTINR  116

Query  433   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV  612
             ELLKPSASV L RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV
Sbjct  117   ELLKPSASVGLDRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV  176

Query  613   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  792
             ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVA+HTTAAFIRVVGSEFVQKYLG
Sbjct  177   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLG  236

Query  793   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  972
             EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ
Sbjct  237   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  296

Query  973   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE  1152
             TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE
Sbjct  297   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE  356

Query  1153  DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DYVSRPDKISAAEI AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  357   DYVSRPDKISAAEITAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  413



>ref|XP_009788974.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Nicotiana 
sylvestris]
Length=412

 Score =   800 bits (2065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/417 (94%), Positives = 401/417 (96%), Gaps = 5/417 (1%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYV  252
             MA+PMVLDP P PKP    P+TR + S    S D EDDLYARLKSLQRQLEFIEIQEEYV
Sbjct  1     MASPMVLDPAPLPKP----PSTRPEPSIPS-SSDGEDDLYARLKSLQRQLEFIEIQEEYV  55

Query  253   KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINR  432
             KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID NN+IVGSTTGSNYYVRILSTINR
Sbjct  56    KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDTNNAIVGSTTGSNYYVRILSTINR  115

Query  433   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV  612
             ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDV YNDIGGCDIQKQEIREAV
Sbjct  116   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVMYNDIGGCDIQKQEIREAV  175

Query  613   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  792
             ELPLTHH+LYKQIGIDPPRGVLLYGPPGTGKTMLAKAVA+HTTAAFIRVVGSEFVQKYLG
Sbjct  176   ELPLTHHDLYKQIGIDPPRGVLLYGPPGTGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLG  235

Query  793   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  972
             EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ
Sbjct  236   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  295

Query  973   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE  1152
             TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE
Sbjct  296   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE  355

Query  1153  DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DYVSRPDKISAAEI+AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  356   DYVSRPDKISAAEISAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  412



>ref|XP_009779674.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Nicotiana 
sylvestris]
Length=414

 Score =   795 bits (2053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/418 (94%), Positives = 401/418 (96%), Gaps = 5/418 (1%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDA-EDDLYARLKSLQRQLEFIEIQEEY  249
             MATPMVLDP P  +P    PATR  +S  DV+ D  EDDLY RLKSL RQLEFI+IQEEY
Sbjct  1     MATPMVLDPTPAAEP----PATRPYSSVHDVTSDGGEDDLYGRLKSLLRQLEFIDIQEEY  56

Query  250   VKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTIN  429
             VKDELKNLRRE+LRAQEEVKRIQSVPLVIGQFMEMIDQNN+IVGSTTGSNYYVRILSTIN
Sbjct  57    VKDELKNLRRENLRAQEEVKRIQSVPLVIGQFMEMIDQNNAIVGSTTGSNYYVRILSTIN  116

Query  430   RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREA  609
             RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTY DIGGCDIQKQEIREA
Sbjct  117   RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYTDIGGCDIQKQEIREA  176

Query  610   VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYL  789
             VELPLTHH+LYKQIGIDPPRGVLLYGPPGTGKTMLAKAVA+HTTA+FIRVVGSEFVQKYL
Sbjct  177   VELPLTHHDLYKQIGIDPPRGVLLYGPPGTGKTMLAKAVAHHTTASFIRVVGSEFVQKYL  236

Query  790   GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD  969
             GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD
Sbjct  237   GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD  296

Query  970   QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDL  1149
             QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDL
Sbjct  297   QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDL  356

Query  1150  EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  357   EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  414



>ref|XP_006464959.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Citrus 
sinensis]
Length=412

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/416 (93%), Positives = 397/416 (95%), Gaps = 6/416 (1%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVK  255
             A+ MVLDP P  +P    P+TR+D + Q   +  EDDLY+RLKSLQRQLEFI+IQEEYVK
Sbjct  3     ASAMVLDPKPVSEPP---PSTRSDLTEQ---WSDEDDLYSRLKSLQRQLEFIDIQEEYVK  56

Query  256   DELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRE  435
             DE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTINRE
Sbjct  57    DEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINRE  116

Query  436   LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE  615
             LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE
Sbjct  117   LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE  176

Query  616   LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE  795
             LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE
Sbjct  177   LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE  236

Query  796   GPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQT  975
             GPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQT
Sbjct  237   GPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQT  296

Query  976   VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLED  1155
             VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVDLED
Sbjct  297   VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDLED  356

Query  1156  YVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             YVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  357   YVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  412



>ref|XP_008456254.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Cucumis 
melo]
Length=418

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/416 (93%), Positives = 394/416 (95%), Gaps = 0/416 (0%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVK  255
             A+ MVLDP  + +P    P+ R+D          EDDLY+RLKSLQRQLEFI+IQEEYVK
Sbjct  3     ASAMVLDPKSSLEPPASFPSMRSDLQGLAEQSSDEDDLYSRLKSLQRQLEFIDIQEEYVK  62

Query  256   DELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRE  435
             DE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTINRE
Sbjct  63    DEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINRE  122

Query  436   LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE  615
             LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE
Sbjct  123   LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE  182

Query  616   LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE  795
             LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE
Sbjct  183   LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE  242

Query  796   GPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQT  975
             GPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQT
Sbjct  243   GPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQT  302

Query  976   VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLED  1155
             VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLED
Sbjct  303   VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLED  362

Query  1156  YVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             YVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  363   YVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  418



>ref|XP_004139931.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Cucumis 
sativus]
 gb|KGN46764.1| hypothetical protein Csa_6G133730 [Cucumis sativus]
Length=418

 Score =   788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/416 (93%), Positives = 394/416 (95%), Gaps = 0/416 (0%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVK  255
             A+ MVLDP  + +P   +P  R+D          EDDLY+RLKSLQRQLEFI+IQEEYVK
Sbjct  3     ASAMVLDPKSSLEPPASLPPMRSDLQGLAEQSSDEDDLYSRLKSLQRQLEFIDIQEEYVK  62

Query  256   DELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRE  435
             DE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTINRE
Sbjct  63    DEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINRE  122

Query  436   LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE  615
             LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE
Sbjct  123   LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE  182

Query  616   LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE  795
             LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE
Sbjct  183   LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE  242

Query  796   GPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQT  975
             GPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQT
Sbjct  243   GPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQT  302

Query  976   VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLED  1155
             VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLED
Sbjct  303   VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLED  362

Query  1156  YVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             YVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  363   YVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  418



>ref|XP_003553190.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Glycine 
max]
Length=422

 Score =   786 bits (2031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/420 (92%), Positives = 399/420 (95%), Gaps = 4/420 (1%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRTD----ASAQDVSYDAEDDLYARLKSLQRQLEFIEIQE  243
             ++ MVLDP P+ +P   +P+T++D    +   D +   EDDLY+RLKSLQRQLEFI+IQE
Sbjct  3     SSAMVLDPKPSSEPPPFLPSTKSDYLQGSFGGDATASDEDDLYSRLKSLQRQLEFIDIQE  62

Query  244   EYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILST  423
             EYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILST
Sbjct  63    EYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILST  122

Query  424   INRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIR  603
             INRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIR
Sbjct  123   INRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIR  182

Query  604   EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK  783
             EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK
Sbjct  183   EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK  242

Query  784   YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG  963
             YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG
Sbjct  243   YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG  302

Query  964   FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEV  1143
             FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEV
Sbjct  303   FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEV  362

Query  1144  DLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  363   DLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  422



>ref|XP_007205251.1| hypothetical protein PRUPE_ppa006246mg [Prunus persica]
 ref|XP_008239747.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Prunus 
mume]
 gb|EMJ06450.1| hypothetical protein PRUPE_ppa006246mg [Prunus persica]
Length=420

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/418 (92%), Positives = 396/418 (95%), Gaps = 2/418 (0%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDA--EDDLYARLKSLQRQLEFIEIQEEY  249
              + MVLDP P P+P    P+ R+D  A    + A  EDDLY+RLKSLQRQLEFI+IQEEY
Sbjct  3     GSAMVLDPKPLPEPPASFPSIRSDLQASSEQHQASDEDDLYSRLKSLQRQLEFIDIQEEY  62

Query  250   VKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTIN  429
             VKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTIN
Sbjct  63    VKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTIN  122

Query  430   RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREA  609
             RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTY+DIGGCDIQKQEIREA
Sbjct  123   RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYSDIGGCDIQKQEIREA  182

Query  610   VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYL  789
             VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYL
Sbjct  183   VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYL  242

Query  790   GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD  969
             GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD
Sbjct  243   GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD  302

Query  970   QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDL  1149
             QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDL
Sbjct  303   QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDL  362

Query  1150  EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             EDYVSRPDKISAAEI+AICQEAGMHAVRKNRYVILPKDFEKGY+ NVKKPDTDFEFYK
Sbjct  363   EDYVSRPDKISAAEISAICQEAGMHAVRKNRYVILPKDFEKGYQINVKKPDTDFEFYK  420



>ref|XP_007010399.1| Regulatory particle triple-A ATPase 3 isoform 1 [Theobroma cacao]
 gb|EOY19209.1| Regulatory particle triple-A ATPase 3 isoform 1 [Theobroma cacao]
Length=419

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/419 (92%), Positives = 399/419 (95%), Gaps = 5/419 (1%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRTD---ASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEE  246
             A+ MV++P P+ +P F  P+TR+D   A   D +   EDDLY+RLKSLQRQLEFI+IQEE
Sbjct  3     ASAMVVEPKPSAEPPF--PSTRSDLGQALVVDPTGTEEDDLYSRLKSLQRQLEFIDIQEE  60

Query  247   YVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTI  426
             YVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTI
Sbjct  61    YVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTI  120

Query  427   NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE  606
             NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE
Sbjct  121   NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE  180

Query  607   AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY  786
             AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY
Sbjct  181   AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY  240

Query  787   LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF  966
             LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF
Sbjct  241   LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF  300

Query  967   DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVD  1146
             DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVD
Sbjct  301   DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVD  360

Query  1147  LEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             LEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  361   LEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  419



>ref|XP_012086544.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Jatropha 
curcas]
 gb|KDP25672.1| hypothetical protein JCGZ_24155 [Jatropha curcas]
Length=420

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/418 (92%), Positives = 394/418 (94%), Gaps = 2/418 (0%)
 Frame = +1

Query  76    ATPMVLDPNPT--PKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEY  249
             ++ MVLDP P   P PSF    T    S  D+S   EDDLY+RLKSLQRQLEFI+IQEEY
Sbjct  3     SSAMVLDPKPVSEPPPSFSAARTDVQHSFADLSNSDEDDLYSRLKSLQRQLEFIDIQEEY  62

Query  250   VKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTIN  429
             VKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTIN
Sbjct  63    VKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTIN  122

Query  430   RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREA  609
             RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREA
Sbjct  123   RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREA  182

Query  610   VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYL  789
             VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYL
Sbjct  183   VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYL  242

Query  790   GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD  969
             GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD
Sbjct  243   GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD  302

Query  970   QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDL  1149
             QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCT+KMNL DEVDL
Sbjct  303   QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTSKMNLSDEVDL  362

Query  1150  EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKK DTDFEFYK
Sbjct  363   EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKSDTDFEFYK  420



>ref|XP_009355153.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Pyrus 
x bretschneideri]
 ref|XP_009355159.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Pyrus 
x bretschneideri]
Length=420

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/418 (92%), Positives = 395/418 (94%), Gaps = 2/418 (0%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDA--EDDLYARLKSLQRQLEFIEIQEEY  249
              + MVLDP P P+P   +P+ R+D         A  EDDLY+RLKS QRQLEFI+IQEEY
Sbjct  3     GSAMVLDPKPLPEPPASIPSIRSDLQGYTEQSQASDEDDLYSRLKSYQRQLEFIDIQEEY  62

Query  250   VKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTIN  429
             VKDELKNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTIN
Sbjct  63    VKDELKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTIN  122

Query  430   RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREA  609
             RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTY+DIGGCDIQKQEIREA
Sbjct  123   RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYSDIGGCDIQKQEIREA  182

Query  610   VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYL  789
             VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYL
Sbjct  183   VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYL  242

Query  790   GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD  969
             GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD
Sbjct  243   GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD  302

Query  970   QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDL  1149
             QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVDL
Sbjct  303   QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDL  362

Query  1150  EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             EDYVSRPDKISAAEI+AICQEAGMHAVRKNRYVILPKDFEKGY+TNVKKPDTDFEFYK
Sbjct  363   EDYVSRPDKISAAEISAICQEAGMHAVRKNRYVILPKDFEKGYQTNVKKPDTDFEFYK  420



>ref|XP_008384650.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Malus 
domestica]
Length=420

 Score =   784 bits (2024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/419 (92%), Positives = 398/419 (95%), Gaps = 4/419 (1%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRTDA---SAQDVSYDAEDDLYARLKSLQRQLEFIEIQEE  246
              + MVLDP P P+P   +P+ R+D    + Q  + D EDDLY+RLKS QRQLEFI+IQEE
Sbjct  3     GSAMVLDPKPLPEPPASIPSIRSDLQRYTEQSQASD-EDDLYSRLKSYQRQLEFIDIQEE  61

Query  247   YVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTI  426
             YVKDELKNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTI
Sbjct  62    YVKDELKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTI  121

Query  427   NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE  606
             NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTY+DIGGCDIQKQEIRE
Sbjct  122   NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYSDIGGCDIQKQEIRE  181

Query  607   AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY  786
             AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY
Sbjct  182   AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY  241

Query  787   LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF  966
             LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF
Sbjct  242   LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF  301

Query  967   DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVD  1146
             DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVD
Sbjct  302   DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVD  361

Query  1147  LEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             LEDYVSRPDKISAAEI+AICQEAGMHAVRKNRYVILPKDFEKGY+TNVKKPDTDFEFYK
Sbjct  362   LEDYVSRPDKISAAEISAICQEAGMHAVRKNRYVILPKDFEKGYQTNVKKPDTDFEFYK  420



>ref|XP_009374408.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Pyrus 
x bretschneideri]
Length=420

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/418 (91%), Positives = 395/418 (94%), Gaps = 2/418 (0%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDA--EDDLYARLKSLQRQLEFIEIQEEY  249
              + MVLDP P P+P   +P+ R+D         A  EDDLY+RLK+ QRQLEFI+IQEEY
Sbjct  3     GSAMVLDPKPLPEPPASIPSIRSDLQGYTEQSQASDEDDLYSRLKTYQRQLEFIDIQEEY  62

Query  250   VKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTIN  429
             VKDELKNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTIN
Sbjct  63    VKDELKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTIN  122

Query  430   RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREA  609
             RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTY+DIGGCDIQKQEIREA
Sbjct  123   RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYSDIGGCDIQKQEIREA  182

Query  610   VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYL  789
             VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYL
Sbjct  183   VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYL  242

Query  790   GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD  969
             GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD
Sbjct  243   GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD  302

Query  970   QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDL  1149
             QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVDL
Sbjct  303   QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDL  362

Query  1150  EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             EDYVSRPDKISAAEI+AICQEAGMHAVRKNRYVILPKDFEKGY+TNVKKPDTDFEFYK
Sbjct  363   EDYVSRPDKISAAEISAICQEAGMHAVRKNRYVILPKDFEKGYQTNVKKPDTDFEFYK  420



>ref|XP_003538340.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Glycine 
max]
Length=423

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/421 (91%), Positives = 398/421 (95%), Gaps = 5/421 (1%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRTDA-----SAQDVSYDAEDDLYARLKSLQRQLEFIEIQ  240
             ++ MVLDP P+ +P   + +T++D      S  D +   EDDLY+RLK+LQRQLEFI+IQ
Sbjct  3     SSAMVLDPKPSSEPPPFLASTKSDYLQGGFSGSDATASDEDDLYSRLKTLQRQLEFIDIQ  62

Query  241   EEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILS  420
             EEYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILS
Sbjct  63    EEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILS  122

Query  421   TINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEI  600
             TINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEI
Sbjct  123   TINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEI  182

Query  601   REAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQ  780
             REAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQ
Sbjct  183   REAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQ  242

Query  781   KYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMD  960
             KYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMD
Sbjct  243   KYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMD  302

Query  961   GFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDE  1140
             GFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DE
Sbjct  303   GFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDE  362

Query  1141  VDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFY  1320
             VDLEDYVSRPDKISAAEI+AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFY
Sbjct  363   VDLEDYVSRPDKISAAEISAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFY  422

Query  1321  K  1323
             K
Sbjct  423   K  423



>ref|XP_002523664.1| 26S protease regulatory subunit 6b, putative [Ricinus communis]
 gb|EEF38699.1| 26S protease regulatory subunit 6b, putative [Ricinus communis]
Length=415

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/419 (92%), Positives = 395/419 (94%), Gaps = 9/419 (2%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRTDASAQ---DVSYDAEDDLYARLKSLQRQLEFIEIQEE  246
             ++ MVLDP P   PS      R+D   Q   D++   EDDLY+RLKSLQRQLEFI+IQEE
Sbjct  3     SSAMVLDPKPVSSPS------RSDLQQQSFSDLTNADEDDLYSRLKSLQRQLEFIDIQEE  56

Query  247   YVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTI  426
             YVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTI
Sbjct  57    YVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTI  116

Query  427   NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE  606
             NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE
Sbjct  117   NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE  176

Query  607   AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY  786
             AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY
Sbjct  177   AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY  236

Query  787   LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF  966
             LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF
Sbjct  237   LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF  296

Query  967   DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVD  1146
             DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCT+KMNL DEVD
Sbjct  297   DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTSKMNLSDEVD  356

Query  1147  LEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             LEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  357   LEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  415



>ref|XP_008354341.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Malus 
domestica]
Length=420

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/418 (91%), Positives = 394/418 (94%), Gaps = 2/418 (0%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDA--EDDLYARLKSLQRQLEFIEIQEEY  249
              + MVLDP P P+P   +P+ R+D         A  EDDLY+RLKS QRQLEFI+IQEEY
Sbjct  3     GSAMVLDPKPLPEPPASIPSIRSDLQGYXEQSQASDEDDLYSRLKSYQRQLEFIDIQEEY  62

Query  250   VKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTIN  429
             VKDELKNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTIN
Sbjct  63    VKDELKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTIN  122

Query  430   RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREA  609
             RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTY+DIGGCDIQKQ+IREA
Sbjct  123   RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYSDIGGCDIQKQDIREA  182

Query  610   VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYL  789
             VELPLTHHELYKQIGIDP RGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYL
Sbjct  183   VELPLTHHELYKQIGIDPXRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYL  242

Query  790   GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD  969
             GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD
Sbjct  243   GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD  302

Query  970   QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDL  1149
             QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVDL
Sbjct  303   QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDL  362

Query  1150  EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             EDYVSRPDKISAAEI+AICQEAGMHAVRKNRYVILPKDFEKGY+TNVKKPDTDFEFYK
Sbjct  363   EDYVSRPDKISAAEISAICQEAGMHAVRKNRYVILPKDFEKGYQTNVKKPDTDFEFYK  420



>ref|XP_008364379.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Malus 
domestica]
Length=415

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/416 (92%), Positives = 395/416 (95%), Gaps = 4/416 (1%)
 Frame = +1

Query  85    MVLDPNPTPKPSFEVPATRTDASA---QDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVK  255
             MVLDP P P+P   +P+ R D      Q+ + D EDDLY+RLKS QRQLEFI+IQEEYVK
Sbjct  1     MVLDPKPFPEPPASIPSIRLDLQGYTDQNQASD-EDDLYSRLKSYQRQLEFIDIQEEYVK  59

Query  256   DELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRE  435
             DE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTINRE
Sbjct  60    DEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINRE  119

Query  436   LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE  615
             LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTY+DIGGCDIQKQEIREAVE
Sbjct  120   LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYSDIGGCDIQKQEIREAVE  179

Query  616   LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE  795
             LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE
Sbjct  180   LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE  239

Query  796   GPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQT  975
             GPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQT
Sbjct  240   GPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQT  299

Query  976   VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLED  1155
             VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVDLED
Sbjct  300   VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDLED  359

Query  1156  YVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             YVSRPDKISAAEI+AICQEAGMHAVRKNRYVILPKDFEKGY+TNVKKPDTDFEFYK
Sbjct  360   YVSRPDKISAAEISAICQEAGMHAVRKNRYVILPKDFEKGYQTNVKKPDTDFEFYK  415



>ref|XP_012077729.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Jatropha 
curcas]
 gb|KDP33301.1| hypothetical protein JCGZ_13088 [Jatropha curcas]
Length=414

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/417 (92%), Positives = 393/417 (94%), Gaps = 6/417 (1%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPAT-RTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYV  252
             ++ MVLDP P  +P   +P    TD S  D     EDDLY+RLKSLQRQLEFI+IQEEYV
Sbjct  3     SSAMVLDPKPVLEPLPSIPKQPLTDQSNSD-----EDDLYSRLKSLQRQLEFIDIQEEYV  57

Query  253   KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINR  432
             KDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEMIDQNN IVGSTTGSNYYVRILSTINR
Sbjct  58    KDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMIDQNNGIVGSTTGSNYYVRILSTINR  117

Query  433   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV  612
             ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDV YNDIGGCDIQKQEIREAV
Sbjct  118   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVNYNDIGGCDIQKQEIREAV  177

Query  613   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  792
             ELPLTHH+LYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG
Sbjct  178   ELPLTHHDLYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  237

Query  793   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  972
             EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ
Sbjct  238   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  297

Query  973   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE  1152
             TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCT+KMNLGDEVDLE
Sbjct  298   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTSKMNLGDEVDLE  357

Query  1153  DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKK DTDFEFYK
Sbjct  358   DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKSDTDFEFYK  414



>gb|KJB37071.1| hypothetical protein B456_006G188400 [Gossypium raimondii]
Length=420

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/420 (92%), Positives = 396/420 (94%), Gaps = 6/420 (1%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRTDAS---AQDVSYDA-EDDLYARLKSLQRQLEFIEIQE  243
             A+ +V +P  + +P F  PATRTD       D    A EDDLY+RLKSLQRQLEFI+IQE
Sbjct  3     ASTVVAEPKSSAEPPF--PATRTDLGKCLTMDPPLGADEDDLYSRLKSLQRQLEFIDIQE  60

Query  244   EYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILST  423
             EYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM++QNN IVGSTTGSNYYVRILST
Sbjct  61    EYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVNQNNGIVGSTTGSNYYVRILST  120

Query  424   INRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIR  603
             INRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIR
Sbjct  121   INRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIR  180

Query  604   EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK  783
             EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK
Sbjct  181   EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK  240

Query  784   YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG  963
             YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG
Sbjct  241   YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG  300

Query  964   FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEV  1143
             FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEV
Sbjct  301   FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEV  360

Query  1144  DLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  361   DLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  420



>ref|XP_009383285.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Musa acuminata 
subsp. malaccensis]
Length=417

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/403 (94%), Positives = 387/403 (96%), Gaps = 2/403 (0%)
 Frame = +1

Query  115   PSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRA  294
             PSF  PA R DA       D +DDLY RLKSLQRQLEFI+IQEEYVKDELKNL+REHLRA
Sbjct  17    PSF--PAVRHDALLPPAVADEDDDLYGRLKSLQRQLEFIDIQEEYVKDELKNLKREHLRA  74

Query  295   QEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRH  474
             QEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTINRELLKPS+SVALHRH
Sbjct  75    QEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSSSVALHRH  134

Query  475   SNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIG  654
             SNALVDVLPPEADSSISLLSQSEKPDVTY DIGGCDIQKQEIREAVELPLTHHELYKQIG
Sbjct  135   SNALVDVLPPEADSSISLLSQSEKPDVTYTDIGGCDIQKQEIREAVELPLTHHELYKQIG  194

Query  655   IDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAK  834
             IDPPRGVLLYGPPGTGKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAK
Sbjct  195   IDPPRGVLLYGPPGTGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAK  254

Query  835   ENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRAD  1014
             ENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRAD
Sbjct  255   ENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRAD  314

Query  1015  TLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEI  1194
             TLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAAEI
Sbjct  315   TLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAAEI  374

Query  1195  AAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             AAICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDF+FYK
Sbjct  375   AAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFDFYK  417



>ref|XP_010931394.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Elaeis 
guineensis]
Length=418

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/421 (91%), Positives = 394/421 (94%), Gaps = 10/421 (2%)
 Frame = +1

Query  76    ATPMVLDPNPT-----PKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQ  240
             A+ MV+D N +     P PSF  PA   D S    S D E+DLY RLKSLQRQ+EF++IQ
Sbjct  3     ASAMVVDTNASLRPSGPPPSF--PALSPDVSN---SVDEEEDLYGRLKSLQRQIEFVDIQ  57

Query  241   EEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILS  420
             EEYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILS
Sbjct  58    EEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILS  117

Query  421   TINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEI  600
             TINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEI
Sbjct  118   TINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEI  177

Query  601   REAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQ  780
             REAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQ
Sbjct  178   REAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQ  237

Query  781   KYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMD  960
             KYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMD
Sbjct  238   KYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMD  297

Query  961   GFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDE  1140
             GFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DE
Sbjct  298   GFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDE  357

Query  1141  VDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFY  1320
             VDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDTDF+FY
Sbjct  358   VDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFY  417

Query  1321  K  1323
             K
Sbjct  418   K  418



>ref|XP_007146904.1| hypothetical protein PHAVU_006G080300g [Phaseolus vulgaris]
 gb|ESW18898.1| hypothetical protein PHAVU_006G080300g [Phaseolus vulgaris]
Length=420

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/419 (93%), Positives = 398/419 (95%), Gaps = 4/419 (1%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRTD---ASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEE  246
             ++ MVLDP P+ +P    PAT++D    S      D EDDLY+RLKSLQRQLEFI+IQEE
Sbjct  3     SSAMVLDPKPSSEPPPSFPATKSDYLQGSFGGGETD-EDDLYSRLKSLQRQLEFIDIQEE  61

Query  247   YVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTI  426
             YVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTI
Sbjct  62    YVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTI  121

Query  427   NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE  606
             NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE
Sbjct  122   NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE  181

Query  607   AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY  786
             AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY
Sbjct  182   AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY  241

Query  787   LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF  966
             LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF
Sbjct  242   LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF  301

Query  967   DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVD  1146
             DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVD
Sbjct  302   DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVD  361

Query  1147  LEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             LEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  362   LEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  420



>ref|XP_002322593.1| 26S proteasome subunit 7 family protein [Populus trichocarpa]
 ref|XP_011041343.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Populus 
euphratica]
 gb|ABK96620.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEF04354.1| 26S proteasome subunit 7 family protein [Populus trichocarpa]
Length=412

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/416 (92%), Positives = 389/416 (94%), Gaps = 6/416 (1%)
 Frame = +1

Query  79    TPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDD-LYARLKSLQRQLEFIEIQEEYVK  255
             + MVLDP P P         R+D      +   EDD LY+RLKSLQRQLEFIEIQEEYVK
Sbjct  2     SAMVLDPKPAPATE-----PRSDLVLDPSTIPIEDDDLYSRLKSLQRQLEFIEIQEEYVK  56

Query  256   DELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRE  435
             DE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTINRE
Sbjct  57    DEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINRE  116

Query  436   LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE  615
             LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE
Sbjct  117   LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE  176

Query  616   LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE  795
             LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE
Sbjct  177   LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE  236

Query  796   GPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQT  975
             GPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQT
Sbjct  237   GPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQT  296

Query  976   VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLED  1155
             VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVDLED
Sbjct  297   VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDLED  356

Query  1156  YVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             YVSRPDKISAAEI AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  357   YVSRPDKISAAEIQAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  412



>ref|XP_006401107.1| hypothetical protein EUTSA_v10013708mg [Eutrema salsugineum]
 gb|ESQ42560.1| hypothetical protein EUTSA_v10013708mg [Eutrema salsugineum]
Length=404

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/417 (91%), Positives = 387/417 (93%), Gaps = 13/417 (3%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYV  252
             MA  MVLDP  +P             +  D+S   E+DLY RLKSL+RQLEF +IQEEYV
Sbjct  1     MAAAMVLDPKASP-------------ALMDMSTADEEDLYGRLKSLERQLEFTDIQEEYV  47

Query  253   KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINR  432
             KDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTINR
Sbjct  48    KDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINR  107

Query  433   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV  612
             ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV
Sbjct  108   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV  167

Query  613   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  792
             ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG
Sbjct  168   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  227

Query  793   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  972
             EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ
Sbjct  228   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  287

Query  973   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE  1152
             TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCT+KMNL DEVDLE
Sbjct  288   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTSKMNLSDEVDLE  347

Query  1153  DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DYVSRPDKISAAEI AICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDTDFEFYK
Sbjct  348   DYVSRPDKISAAEITAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK  404



>gb|EYU46034.1| hypothetical protein MIMGU_mgv1a007193mg [Erythranthe guttata]
Length=415

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/419 (91%), Positives = 393/419 (94%), Gaps = 6/419 (1%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASAQDVSY--DAEDDLYARLKSLQRQLEFIEIQEE  246
             MAT MVLDP    K +   P     A   D S+  DA+DDLY+RLK+LQRQLEF EIQEE
Sbjct  1     MATAMVLDP----KSALPQPPPTRPAPESDPSFLVDADDDLYSRLKTLQRQLEFFEIQEE  56

Query  247   YVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTI  426
             YVKDELKNLRRE LRAQEEVKRIQSVPLVIGQFMEMIDQNN+IVGSTTGSNYYVRILSTI
Sbjct  57    YVKDELKNLRRELLRAQEEVKRIQSVPLVIGQFMEMIDQNNAIVGSTTGSNYYVRILSTI  116

Query  427   NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE  606
             NRELLKPS SVALHRHSNALVDVLPPEADSSISLLSQSEKPDV YNDIGGCDIQKQEIRE
Sbjct  117   NRELLKPSGSVALHRHSNALVDVLPPEADSSISLLSQSEKPDVAYNDIGGCDIQKQEIRE  176

Query  607   AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY  786
             AVELPLTHHELY+QIGIDPPRGVLLYGPPGTGKTMLAKAVA+HTTA+FIRVVGSEFVQKY
Sbjct  177   AVELPLTHHELYQQIGIDPPRGVLLYGPPGTGKTMLAKAVAHHTTASFIRVVGSEFVQKY  236

Query  787   LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF  966
             LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF
Sbjct  237   LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF  296

Query  967   DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVD  1146
             DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVD
Sbjct  297   DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVD  356

Query  1147  LEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             LEDYVSRPDKISAAEI+AICQEAGM AVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK
Sbjct  357   LEDYVSRPDKISAAEISAICQEAGMQAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK  415



>ref|XP_009410502.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Musa acuminata 
subsp. malaccensis]
Length=415

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/417 (92%), Positives = 392/417 (94%), Gaps = 5/417 (1%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRTDASAQDVSY-DAEDDLYARLKSLQRQLEFIEIQEEYV  252
             A+ MV+DP    KPS      R DA    V   D EDDLY RLKSLQRQ+EFI+IQEEYV
Sbjct  3     ASAMVIDPR---KPSVSA-LPRVDALLSPVPVADEEDDLYGRLKSLQRQIEFIDIQEEYV  58

Query  253   KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINR  432
             KDELKNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTINR
Sbjct  59    KDELKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINR  118

Query  433   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV  612
             ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV
Sbjct  119   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV  178

Query  613   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  792
             ELPLTHH+LYKQIGIDPPRGVLLYGPPGTGKTMLAKAVA+HTTAAFIRVVGSEFVQKYLG
Sbjct  179   ELPLTHHDLYKQIGIDPPRGVLLYGPPGTGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLG  238

Query  793   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  972
             EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ
Sbjct  239   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  298

Query  973   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE  1152
             TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVDLE
Sbjct  299   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDLE  358

Query  1153  DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDTDF+FYK
Sbjct  359   DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK  415



>ref|XP_004307102.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Fragaria 
vesca subsp. vesca]
Length=408

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/406 (93%), Positives = 389/406 (96%), Gaps = 3/406 (1%)
 Frame = +1

Query  112   KPSFEVPATRTD--ASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREH  285
             +P    P+TR+D  +S Q  S D EDDLY+RLKSLQRQLEFI+IQEEYVKDE KNL+RE 
Sbjct  4     EPPASFPSTRSDPKSSEQPQSSD-EDDLYSRLKSLQRQLEFIDIQEEYVKDEQKNLKREL  62

Query  286   LRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVAL  465
             LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTINRE LKPSASVAL
Sbjct  63    LRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINREHLKPSASVAL  122

Query  466   HRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYK  645
             HRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHH+LYK
Sbjct  123   HRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHDLYK  182

Query  646   QIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFR  825
             QIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFR
Sbjct  183   QIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFR  242

Query  826   LAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATN  1005
             LAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATN
Sbjct  243   LAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATN  302

Query  1006  RADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISA  1185
             RADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISA
Sbjct  303   RADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISA  362

Query  1186  AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             AEI AICQEAGMHAVRKNRYVILPKDFEKGY+TNVKKPDTDFEFYK
Sbjct  363   AEITAICQEAGMHAVRKNRYVILPKDFEKGYQTNVKKPDTDFEFYK  408



>ref|XP_011089540.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Sesamum 
indicum]
Length=416

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/420 (91%), Positives = 396/420 (94%), Gaps = 7/420 (2%)
 Frame = +1

Query  73    MATPMVLDPNPT---PKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQE  243
             MA+ +VL P P+   P PS   P +   +SA D+    ++DLY+RLKSLQRQLEFIEIQE
Sbjct  1     MASAVVLHPKPSAKDPPPSRWKPDSDPSSSAADL----DEDLYSRLKSLQRQLEFIEIQE  56

Query  244   EYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILST  423
             EYVKDELKNLRRE LRAQEEVKRIQSVPLVIGQFMEMIDQNN+IVGSTTGSNYYVRILST
Sbjct  57    EYVKDELKNLRRELLRAQEEVKRIQSVPLVIGQFMEMIDQNNAIVGSTTGSNYYVRILST  116

Query  424   INRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIR  603
             INRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGG D QKQEIR
Sbjct  117   INRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGYDTQKQEIR  176

Query  604   EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK  783
             EAVELPLTHHELY+QIGIDPPRGVLLYGPPGTGKTMLAKAVA+HTTAAFIRVVGSEFVQK
Sbjct  177   EAVELPLTHHELYQQIGIDPPRGVLLYGPPGTGKTMLAKAVAHHTTAAFIRVVGSEFVQK  236

Query  784   YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG  963
             YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG
Sbjct  237   YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG  296

Query  964   FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEV  1143
             FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEV
Sbjct  297   FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEV  356

Query  1144  DLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DLEDYVSRPDKISAAEIAAICQEAGM AVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK
Sbjct  357   DLEDYVSRPDKISAAEIAAICQEAGMLAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK  416



>sp|P85200.1|PRS6B_HELAN RecName: Full=26S protease regulatory subunit 6B homolog [Helianthus 
annuus]
Length=414

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/386 (96%), Positives = 379/386 (98%), Gaps = 0/386 (0%)
 Frame = +1

Query  166   SYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQF  345
             S D+EDDLY RLK+L RQ+EFI+IQEEYVKDELKNL+RE LR+QEEVKRIQSVPLVIGQF
Sbjct  29    STDSEDDLYTRLKTLDRQIEFIDIQEEYVKDELKNLKREQLRSQEEVKRIQSVPLVIGQF  88

Query  346   MEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSIS  525
             MEMIDQNN IVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSIS
Sbjct  89    MEMIDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSIS  148

Query  526   LLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK  705
             LLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK
Sbjct  149   LLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK  208

Query  706   TMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIAT  885
             TMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIAT
Sbjct  209   TMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIAT  268

Query  886   ARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIE  1065
             ARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIE
Sbjct  269   ARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIE  328

Query  1066  FPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRY  1245
             FPLPDRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAAEI AICQEAGMHAVRKNRY
Sbjct  329   FPLPDRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAAEITAICQEAGMHAVRKNRY  388

Query  1246  VILPKDFEKGYRTNVKKPDTDFEFYK  1323
             VILPKDFEKGYRTNVKKPDTDF+FYK
Sbjct  389   VILPKDFEKGYRTNVKKPDTDFDFYK  414



>ref|XP_010252000.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Nelumbo 
nucifera]
Length=420

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/386 (97%), Positives = 379/386 (98%), Gaps = 0/386 (0%)
 Frame = +1

Query  166   SYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQF  345
             S+  EDDLYARLKSLQRQLEFI+IQEEYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQF
Sbjct  35    SFPDEDDLYARLKSLQRQLEFIDIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQF  94

Query  346   MEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSIS  525
             MEM+DQNN IVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSIS
Sbjct  95    MEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSIS  154

Query  526   LLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK  705
             LLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK
Sbjct  155   LLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK  214

Query  706   TMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIAT  885
             TMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIAT
Sbjct  215   TMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIAT  274

Query  886   ARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIE  1065
             ARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIE
Sbjct  275   ARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIE  334

Query  1066  FPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRY  1245
             FPLPDRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRY
Sbjct  335   FPLPDRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRY  394

Query  1246  VILPKDFEKGYRTNVKKPDTDFEFYK  1323
             VILPKDFEKGYR NVKKPDTDFEFYK
Sbjct  395   VILPKDFEKGYRANVKKPDTDFEFYK  420



>gb|ABK95490.1| unknown [Populus trichocarpa]
Length=412

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/416 (92%), Positives = 388/416 (93%), Gaps = 6/416 (1%)
 Frame = +1

Query  79    TPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDD-LYARLKSLQRQLEFIEIQEEYVK  255
             + MVLDP P P         R+D      +   EDD LY+RLKSLQRQLEFIEIQEEYVK
Sbjct  2     SAMVLDPKPAPATE-----PRSDLVLDPSTIPIEDDDLYSRLKSLQRQLEFIEIQEEYVK  56

Query  256   DELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRE  435
             DE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTINRE
Sbjct  57    DEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINRE  116

Query  436   LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE  615
             LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE
Sbjct  117   LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE  176

Query  616   LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE  795
             LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE
Sbjct  177   LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE  236

Query  796   GPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQT  975
             GPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQT
Sbjct  237   GPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQT  296

Query  976   VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLED  1155
             VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL  EVDLED
Sbjct  297   VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSGEVDLED  356

Query  1156  YVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             YVSRPDKISAAEI AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  357   YVSRPDKISAAEIQAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  412



>ref|XP_004294715.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Fragaria 
vesca subsp. vesca]
Length=418

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/418 (90%), Positives = 395/418 (94%), Gaps = 1/418 (0%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASAQD-VSYDAEDDLYARLKSLQRQLEFIEIQEEY  249
             MA+ MVLDP P P+P   VP+ R+D +  D  S D + DLY+RLK+LQRQ EFI+I+EEY
Sbjct  1     MASAMVLDPKPLPEPPASVPSLRSDPAFTDPTSSDEDSDLYSRLKALQRQNEFIDIKEEY  60

Query  250   VKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTIN  429
             VKDE KNL+RE LR+QEEVKRIQSVPLVIGQF+EM+D+N+ IVGSTTGSNYYVRILSTIN
Sbjct  61    VKDEQKNLKREMLRSQEEVKRIQSVPLVIGQFLEMVDENHGIVGSTTGSNYYVRILSTIN  120

Query  430   RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREA  609
             RE LKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTY+DIGGCDIQKQEIREA
Sbjct  121   REHLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYSDIGGCDIQKQEIREA  180

Query  610   VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYL  789
             VELPLTHH+LYKQIGIDPPRGVLLYGPPGTGKTMLAKAVAN TTAAFIRVVGSEFVQKYL
Sbjct  181   VELPLTHHDLYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANSTTAAFIRVVGSEFVQKYL  240

Query  790   GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD  969
             GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD
Sbjct  241   GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD  300

Query  970   QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDL  1149
             QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVDL
Sbjct  301   QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDL  360

Query  1150  EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             EDYVSRPDKISAAEI AICQEAGMHAVRKNRYVILPKDFEKGY+TNVKKPDTDFEFYK
Sbjct  361   EDYVSRPDKISAAEITAICQEAGMHAVRKNRYVILPKDFEKGYQTNVKKPDTDFEFYK  418



>ref|XP_006842586.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Amborella 
trichopoda]
 gb|ERN04261.1| hypothetical protein AMTR_s00077p00161980 [Amborella trichopoda]
Length=416

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/420 (91%), Positives = 389/420 (93%), Gaps = 10/420 (2%)
 Frame = +1

Query  70    TMATPMVLDPNPTPKP--SFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQE  243
              M  P  LD    P P  S   P   +D+         EDDLY+RLKSLQRQLEFI+IQE
Sbjct  5     VMVEPKTLDLRSEPPPVLSKSEPHLHSDSE--------EDDLYSRLKSLQRQLEFIDIQE  56

Query  244   EYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILST  423
             EYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILST
Sbjct  57    EYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILST  116

Query  424   INRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIR  603
             INRELLKPSASVALHRHSNALVDVLPPEADSSISLL QSEKPDVTYNDIGGCDIQKQEIR
Sbjct  117   INRELLKPSASVALHRHSNALVDVLPPEADSSISLLGQSEKPDVTYNDIGGCDIQKQEIR  176

Query  604   EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK  783
             EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK
Sbjct  177   EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK  236

Query  784   YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG  963
             YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG
Sbjct  237   YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG  296

Query  964   FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEV  1143
             FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEV
Sbjct  297   FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEV  356

Query  1144  DLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDF+FY+
Sbjct  357   DLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFDFYR  416



>ref|XP_009126768.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica 
rapa]
 emb|CDY32714.1| BnaA02g07760D [Brassica napus]
Length=404

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/417 (91%), Positives = 389/417 (93%), Gaps = 13/417 (3%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYV  252
             MA  MVLDP P+P             S  D+S   E+D Y+RLKSL+RQLEF +IQEEYV
Sbjct  1     MAAAMVLDPKPSP-------------SLMDLSTPDEEDPYSRLKSLERQLEFTDIQEEYV  47

Query  253   KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINR  432
             KDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTINR
Sbjct  48    KDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINR  107

Query  433   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV  612
             E LKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDV+YNDIGGCDIQKQEIREAV
Sbjct  108   EDLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVSYNDIGGCDIQKQEIREAV  167

Query  613   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  792
             ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG
Sbjct  168   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  227

Query  793   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  972
             EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ
Sbjct  228   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  287

Query  973   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE  1152
             TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVDLE
Sbjct  288   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDLE  347

Query  1153  DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK
Sbjct  348   DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK  404



>ref|NP_200637.1| regulatory particle triple-A ATPase 3 [Arabidopsis thaliana]
 ref|XP_002864561.1| hypothetical protein ARALYDRAFT_495939 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006279634.1| hypothetical protein CARUB_v10026512mg [Capsella rubella]
 sp|Q9SEI4.1|PRS6B_ARATH RecName: Full=26S protease regulatory subunit 6B homolog; AltName: 
Full=26S protease subunit 6B homolog; AltName: Full=26S 
proteasome AAA-ATPase subunit RPT3; AltName: Full=Protein 
BMAA insensitive morphology 409; AltName: Full=Regulatory particle 
triple-A ATPase subunit 3 [Arabidopsis thaliana]
 gb|AAF22523.1|AF123392_1 26S proteasome AAA-ATPase subunit RPT3 [Arabidopsis thaliana]
 dbj|BAA96920.1| 26S proteasome AAA-ATPase subunit RPT3 [Arabidopsis thaliana]
 gb|AAL49932.1| AT4g10340/F24G24_140 [Arabidopsis thaliana]
 gb|AAV85728.1| At5g58290 [Arabidopsis thaliana]
 gb|EFH40820.1| hypothetical protein ARALYDRAFT_495939 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED97029.1| regulatory particle triple-A ATPase 3 [Arabidopsis thaliana]
 gb|EOA12532.1| hypothetical protein CARUB_v10026512mg [Capsella rubella]
Length=408

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/420 (90%), Positives = 387/420 (92%), Gaps = 13/420 (3%)
 Frame = +1

Query  64    APTMATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQE  243
             A      MVLDP  +P             +  D+S   E+DLY RLKSL+RQLEF +IQE
Sbjct  2     ASAAVASMVLDPKASP-------------ALMDLSTADEEDLYGRLKSLERQLEFTDIQE  48

Query  244   EYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILST  423
             EYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILST
Sbjct  49    EYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILST  108

Query  424   INRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIR  603
             INRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDV+YNDIGGCDIQKQEIR
Sbjct  109   INRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVSYNDIGGCDIQKQEIR  168

Query  604   EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK  783
             EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK
Sbjct  169   EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK  228

Query  784   YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG  963
             YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG
Sbjct  229   YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG  288

Query  964   FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEV  1143
             FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCT+KMNL DEV
Sbjct  289   FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTSKMNLSDEV  348

Query  1144  DLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDTDFEFYK
Sbjct  349   DLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK  408



>gb|AFW70814.1| 26S proteasome regulatory complex ATPase RPT3 [Zea mays]
Length=474

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/442 (87%), Positives = 401/442 (91%), Gaps = 4/442 (1%)
 Frame = +1

Query  1     LFPTPLSSLQAPD-SSAPSR*GAPTMATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDA  177
             L P P +  Q    +SA S   A T  TP V  P   P PS+  PA+ T +++   S + 
Sbjct  36    LLPDPQNRTQVETLTSAFSMSAATTAPTPAVATPM-APPPSY--PASSTISASVAASVEE  92

Query  178   EDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMI  357
             EDDLY RLKSLQR +EF+EIQEEYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+
Sbjct  93    EDDLYGRLKSLQRHMEFVEIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMV  152

Query  358   DQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQ  537
             D NN IVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLL  
Sbjct  153   DGNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLGS  212

Query  538   SEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA  717
             SEKP+VTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA
Sbjct  213   SEKPNVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA  272

Query  718   KAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD  897
             KAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD
Sbjct  273   KAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD  332

Query  898   AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP  1077
             AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP
Sbjct  333   AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP  392

Query  1078  DRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILP  1257
             DRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAA+IAAICQEAGMHAVRKNRYVILP
Sbjct  393   DRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAADIAAICQEAGMHAVRKNRYVILP  452

Query  1258  KDFEKGYRTNVKKPDTDFEFYK  1323
             KDFEKGYRTNVKKP+TDF+FYK
Sbjct  453   KDFEKGYRTNVKKPETDFDFYK  474



>emb|CDY02806.1| BnaC02g10830D [Brassica napus]
Length=404

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/417 (91%), Positives = 389/417 (93%), Gaps = 13/417 (3%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYV  252
             MA  MVLDP P+P             S  D+S   E+D Y+RLKSL+RQLEF +IQEEYV
Sbjct  1     MAAAMVLDPKPSP-------------SLIDLSTPDEEDPYSRLKSLERQLEFTDIQEEYV  47

Query  253   KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINR  432
             KDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTINR
Sbjct  48    KDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINR  107

Query  433   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV  612
             E LKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDV+YNDIGGCDIQKQEIREAV
Sbjct  108   EDLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVSYNDIGGCDIQKQEIREAV  167

Query  613   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  792
             ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG
Sbjct  168   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  227

Query  793   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  972
             EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ
Sbjct  228   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  287

Query  973   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE  1152
             TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVDLE
Sbjct  288   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDLE  347

Query  1153  DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK
Sbjct  348   DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK  404



>ref|XP_008788111.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Phoenix 
dactylifera]
Length=418

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/386 (96%), Positives = 380/386 (98%), Gaps = 0/386 (0%)
 Frame = +1

Query  166   SYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQF  345
             S D ++DLY RLKSLQRQ+EF++IQEEYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQF
Sbjct  33    SVDEDEDLYGRLKSLQRQIEFVDIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQF  92

Query  346   MEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSIS  525
             MEM+DQNN IVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSIS
Sbjct  93    MEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSIS  152

Query  526   LLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK  705
             LLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK
Sbjct  153   LLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK  212

Query  706   TMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIAT  885
             TMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIAT
Sbjct  213   TMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIAT  272

Query  886   ARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIE  1065
             ARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIE
Sbjct  273   ARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIE  332

Query  1066  FPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRY  1245
             FPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRY
Sbjct  333   FPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRY  392

Query  1246  VILPKDFEKGYRTNVKKPDTDFEFYK  1323
             VILPKDFEKGYRTNVKKPDTDF+FYK
Sbjct  393   VILPKDFEKGYRTNVKKPDTDFDFYK  418



>ref|XP_008803008.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Phoenix 
dactylifera]
Length=418

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/405 (93%), Positives = 387/405 (96%), Gaps = 5/405 (1%)
 Frame = +1

Query  109   PKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHL  288
             P PSF  PA   D     ++ D ++DLY RLKSLQRQ+EFI+IQEEYVKDE KNL+RE L
Sbjct  19    PPPSF--PAVSADVF---LTVDDDEDLYGRLKSLQRQIEFIDIQEEYVKDEQKNLKRELL  73

Query  289   RAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALH  468
             RAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTINRELLKPSASVALH
Sbjct  74    RAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALH  133

Query  469   RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ  648
             RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ
Sbjct  134   RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ  193

Query  649   IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  828
             IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL
Sbjct  194   IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  253

Query  829   AKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR  1008
             AKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR
Sbjct  254   AKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR  313

Query  1009  ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAA  1188
             ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAA
Sbjct  314   ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAA  373

Query  1189  EIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             EIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDF+FYK
Sbjct  374   EIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFDFYK  418



>ref|XP_010553185.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Tarenaya 
hassleriana]
Length=404

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/418 (91%), Positives = 391/418 (94%), Gaps = 15/418 (4%)
 Frame = +1

Query  73    MATP-MVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEY  249
             MAT  M++DP  +P  S             D+ Y  E+DLY+RLKSLQRQLEFI+IQEEY
Sbjct  1     MATAAMIIDPKASPVIS-------------DL-YTEEEDLYSRLKSLQRQLEFIDIQEEY  46

Query  250   VKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTIN  429
             VKDE  NL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTIN
Sbjct  47    VKDEQNNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTIN  106

Query  430   RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREA  609
             RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREA
Sbjct  107   RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREA  166

Query  610   VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYL  789
             VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYL
Sbjct  167   VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYL  226

Query  790   GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD  969
             GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD
Sbjct  227   GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD  286

Query  970   QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDL  1149
             QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCT+KMNL DEVDL
Sbjct  287   QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTSKMNLSDEVDL  346

Query  1150  EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK
Sbjct  347   EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK  404



>ref|XP_003538341.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Glycine 
max]
Length=413

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/422 (91%), Positives = 395/422 (94%), Gaps = 17/422 (4%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRT------DASAQDVSYDAEDDLYARLKSLQRQLEFIEI  237
             A+ MVLDP P       +P+T++      DA+A D     E+DLY+RLKSL RQLEF++I
Sbjct  3     ASAMVLDPPPF------LPSTKSAYLQGGDATAFD-----EEDLYSRLKSLVRQLEFVDI  51

Query  238   QEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRIL  417
             QEEYVKDELKNLRRE LRA EEVKRIQSVPLVIGQFMEMIDQNN IVGST GSNYYVRIL
Sbjct  52    QEEYVKDELKNLRRELLRAMEEVKRIQSVPLVIGQFMEMIDQNNGIVGSTAGSNYYVRIL  111

Query  418   STINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQE  597
             STINRELLKPSASVALHRHSNALV+VLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQE
Sbjct  112   STINRELLKPSASVALHRHSNALVEVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQE  171

Query  598   IREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFV  777
             IREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFV
Sbjct  172   IREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFV  231

Query  778   QKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQM  957
             QKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQM
Sbjct  232   QKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQM  291

Query  958   DGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGD  1137
             DGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL D
Sbjct  292   DGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSD  351

Query  1138  EVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEF  1317
             EVDLEDYVSRPDKISAAEI+AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDT+FEF
Sbjct  352   EVDLEDYVSRPDKISAAEISAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTNFEF  411

Query  1318  YK  1323
             YK
Sbjct  412   YK  413



>ref|XP_010244563.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Nelumbo 
nucifera]
Length=421

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/385 (97%), Positives = 377/385 (98%), Gaps = 0/385 (0%)
 Frame = +1

Query  169   YDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFM  348
             +  EDDLY RLKSLQRQLEFI+IQEEYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFM
Sbjct  37    FSDEDDLYGRLKSLQRQLEFIDIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFM  96

Query  349   EMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISL  528
             EM+DQNN IVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISL
Sbjct  97    EMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISL  156

Query  529   LSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKT  708
             LSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKT
Sbjct  157   LSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKT  216

Query  709   MLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATA  888
             MLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATA
Sbjct  217   MLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATA  276

Query  889   RFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEF  1068
             RFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEF
Sbjct  277   RFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEF  336

Query  1069  PLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYV  1248
             PLPDRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYV
Sbjct  337   PLPDRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYV  396

Query  1249  ILPKDFEKGYRTNVKKPDTDFEFYK  1323
             ILPKDFEKGYR NVKKPDTDFEFYK
Sbjct  397   ILPKDFEKGYRANVKKPDTDFEFYK  421



>ref|NP_001150600.1| LOC100284233 [Zea mays]
 gb|ACG39710.1| 26S protease regulatory subunit 6B [Zea mays]
 gb|ACN34580.1| unknown [Zea mays]
 gb|ACN36183.1| unknown [Zea mays]
Length=420

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/428 (88%), Positives = 397/428 (93%), Gaps = 12/428 (3%)
 Frame = +1

Query  40    SSAPSR*GAPTMATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQ  219
             ++AP+    P +ATPM       P PS+  PA+ T +++   S + EDDLY RLKSLQR 
Sbjct  5     TTAPT----PAVATPM------APPPSY--PASSTISASVAASVEEEDDLYGRLKSLQRH  52

Query  220   LEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSN  399
             +EF+EIQEEYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+D NN IVGSTTGSN
Sbjct  53    MEFVEIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDGNNGIVGSTTGSN  112

Query  400   YYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGC  579
             YYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLL  SEKP+VTYNDIGGC
Sbjct  113   YYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLGSSEKPNVTYNDIGGC  172

Query  580   DIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRV  759
             DIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVA+HTTAAFIRV
Sbjct  173   DIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVAHHTTAAFIRV  232

Query  760   VGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILM  939
             VGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILM
Sbjct  233   VGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILM  292

Query  940   ELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTA  1119
             ELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTA
Sbjct  293   ELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTA  352

Query  1120  KMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKP  1299
             KMNL DEVDLEDYVSRPDKISAA+IAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKP
Sbjct  353   KMNLSDEVDLEDYVSRPDKISAADIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKP  412

Query  1300  DTDFEFYK  1323
             +TDF+FYK
Sbjct  413   ETDFDFYK  420



>ref|XP_010453468.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Camelina 
sativa]
 ref|XP_010443548.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Camelina 
sativa]
 ref|XP_010483400.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Camelina 
sativa]
Length=408

 Score =   767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/413 (91%), Positives = 386/413 (93%), Gaps = 13/413 (3%)
 Frame = +1

Query  85    MVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDEL  264
             MVLDP  +P             +  D+S   E+DLY RLKSL+RQLEF +IQEEYVKDE 
Sbjct  9     MVLDPKASP-------------ALMDLSTADEEDLYGRLKSLERQLEFTDIQEEYVKDEQ  55

Query  265   KNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLK  444
             KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTINRELLK
Sbjct  56    KNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINRELLK  115

Query  445   PSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPL  624
             PSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDV+YNDIGGCDIQKQEIREAVELPL
Sbjct  116   PSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVSYNDIGGCDIQKQEIREAVELPL  175

Query  625   THHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPR  804
             THHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPR
Sbjct  176   THHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPR  235

Query  805   MVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNV  984
             MVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNV
Sbjct  236   MVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNV  295

Query  985   KVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVS  1164
             KVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCT+KMNL DEVDLEDYVS
Sbjct  296   KVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTSKMNLSDEVDLEDYVS  355

Query  1165  RPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             RPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDTDFEFYK
Sbjct  356   RPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK  408



>ref|XP_010045430.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Eucalyptus 
grandis]
Length=414

 Score =   767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/387 (96%), Positives = 379/387 (98%), Gaps = 0/387 (0%)
 Frame = +1

Query  163   VSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQ  342
             V+   E+DLY+RLKSL+RQLEFI+IQEEYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQ
Sbjct  28    VAAAEEEDLYSRLKSLERQLEFIDIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQ  87

Query  343   FMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSI  522
             FMEM+DQNN IVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSI
Sbjct  88    FMEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSI  147

Query  523   SLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTG  702
             SLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTG
Sbjct  148   SLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTG  207

Query  703   KTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIA  882
             KTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIA
Sbjct  208   KTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIA  267

Query  883   TARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKI  1062
             TARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKI
Sbjct  268   TARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKI  327

Query  1063  EFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNR  1242
             EFPLPDRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNR
Sbjct  328   EFPLPDRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNR  387

Query  1243  YVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             YVILPKDFEKGYR NVKKPDTDFEFYK
Sbjct  388   YVILPKDFEKGYRANVKKPDTDFEFYK  414



>ref|XP_010922789.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Elaeis 
guineensis]
Length=418

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/387 (96%), Positives = 379/387 (98%), Gaps = 0/387 (0%)
 Frame = +1

Query  163   VSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQ  342
             +S D EDDLY RLKSLQRQ+EF++IQEEYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQ
Sbjct  32    LSVDEEDDLYGRLKSLQRQIEFVDIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQ  91

Query  343   FMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSI  522
             FMEM+DQNN IVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSI
Sbjct  92    FMEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSI  151

Query  523   SLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTG  702
             SLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTG
Sbjct  152   SLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTG  211

Query  703   KTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIA  882
             KTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIA
Sbjct  212   KTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIA  271

Query  883   TARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKI  1062
             TARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKI
Sbjct  272   TARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKI  331

Query  1063  EFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNR  1242
             EFPLPDRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNR
Sbjct  332   EFPLPDRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNR  391

Query  1243  YVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             YVILPKDFEKGYR NVKKPDTDF+FY+
Sbjct  392   YVILPKDFEKGYRANVKKPDTDFDFYR  418



>gb|KHG28345.1| 26S protease regulatory subunit 6B -like protein [Gossypium arboreum]
Length=416

 Score =   767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/419 (91%), Positives = 392/419 (94%), Gaps = 8/419 (2%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRTDAS---AQDVSYDAEDDLYARLKSLQRQLEFIEIQEE  246
             A+ +V +P PT +P F  PATR+D       D +   EDDLY +LKS QRQLEFI+IQEE
Sbjct  3     ASAIVAEPKPTAEPPF--PATRSDLGQYPMGDPTGAEEDDLYCKLKSFQRQLEFIDIQEE  60

Query  247   YVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTI  426
             YVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTI
Sbjct  61    YVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTI  120

Query  427   NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE  606
             NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE
Sbjct  121   NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE  180

Query  607   AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY  786
             AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY
Sbjct  181   AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY  240

Query  787   LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF  966
             LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF
Sbjct  241   LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF  300

Query  967   DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVD  1146
             DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRL   VCTAKMNL DEVD
Sbjct  301   DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRL---VCTAKMNLSDEVD  357

Query  1147  LEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             LEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  358   LEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  416



>ref|XP_011080639.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Sesamum 
indicum]
Length=415

 Score =   767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/418 (92%), Positives = 393/418 (94%), Gaps = 4/418 (1%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEV-PATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEY  249
             MA  MVLDP P+        P   +DAS    S D ++DLY+RLK+LQRQLEF EIQEEY
Sbjct  1     MAAAMVLDPKPSQSQPPPTRPVPESDAS---FSADPDEDLYSRLKTLQRQLEFFEIQEEY  57

Query  250   VKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTIN  429
             VKDELKNLRRE LRAQEEVKRIQSVPLVIGQFMEMIDQNN+IVGSTTGSNYYVRILSTIN
Sbjct  58    VKDELKNLRRELLRAQEEVKRIQSVPLVIGQFMEMIDQNNAIVGSTTGSNYYVRILSTIN  117

Query  430   RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREA  609
             RELLKPS SVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREA
Sbjct  118   RELLKPSGSVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREA  177

Query  610   VELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYL  789
             VELPLTHHELY+QIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTA+FIRVVGSEFVQKYL
Sbjct  178   VELPLTHHELYQQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTASFIRVVGSEFVQKYL  237

Query  790   GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD  969
             GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD
Sbjct  238   GEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFD  297

Query  970   QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDL  1149
             QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVDL
Sbjct  298   QTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDL  357

Query  1150  EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             EDYVSRPDKISAAEIAAICQEAGM AVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK
Sbjct  358   EDYVSRPDKISAAEIAAICQEAGMLAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK  415



>ref|XP_009404251.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Musa acuminata 
subsp. malaccensis]
Length=415

 Score =   767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/384 (97%), Positives = 379/384 (99%), Gaps = 0/384 (0%)
 Frame = +1

Query  172   DAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFME  351
             D +DDLY RLKSLQRQLEFIEIQEEYVKDELKNL+REHLRAQEEVKRIQSVPLVIGQFME
Sbjct  32    DEDDDLYGRLKSLQRQLEFIEIQEEYVKDELKNLKREHLRAQEEVKRIQSVPLVIGQFME  91

Query  352   MIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLL  531
             M+DQNN+IVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLL
Sbjct  92    MVDQNNAIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLL  151

Query  532   SQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTM  711
             SQSEKPDVTYNDIGG D QKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTM
Sbjct  152   SQSEKPDVTYNDIGGYDTQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTM  211

Query  712   LAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATAR  891
             LAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATAR
Sbjct  212   LAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATAR  271

Query  892   FDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFP  1071
             FDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFP
Sbjct  272   FDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFP  331

Query  1072  LPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVI  1251
             LPDRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVI
Sbjct  332   LPDRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVI  391

Query  1252  LPKDFEKGYRTNVKKPDTDFEFYK  1323
             LPKDFEKGYRTNVKKP+TDF+FYK
Sbjct  392   LPKDFEKGYRTNVKKPETDFDFYK  415



>ref|XP_010541475.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Tarenaya 
hassleriana]
Length=405

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/388 (95%), Positives = 381/388 (98%), Gaps = 0/388 (0%)
 Frame = +1

Query  160   DVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIG  339
             D++   E+DLY+RLKSLQRQLEFI+IQEEYVKDE KNL+RE LRAQEEVKRIQSVPLVIG
Sbjct  18    DLNAAEEEDLYSRLKSLQRQLEFIDIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIG  77

Query  340   QFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSS  519
             QFMEM+DQNN IVGSTTGSNYYVRILSTINRELLKP+ASVALHRHSNALVDVLPPEADSS
Sbjct  78    QFMEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPAASVALHRHSNALVDVLPPEADSS  137

Query  520   ISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGT  699
             ISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLL+GPPGT
Sbjct  138   ISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLFGPPGT  197

Query  700   GKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAI  879
             GKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAI
Sbjct  198   GKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAI  257

Query  880   ATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRK  1059
             ATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRK
Sbjct  258   ATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRK  317

Query  1060  IEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKN  1239
             IEFPLPDRRQKRLVFQVCT+KMNL DEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKN
Sbjct  318   IEFPLPDRRQKRLVFQVCTSKMNLSDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKN  377

Query  1240  RYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             RYVILPKDFEKGYR+NVKKPDTDFEFYK
Sbjct  378   RYVILPKDFEKGYRSNVKKPDTDFEFYK  405



>ref|XP_004500390.1| PREDICTED: 26S protease regulatory subunit 6B homolog isoform 
X2 [Cicer arietinum]
Length=418

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/388 (97%), Positives = 380/388 (98%), Gaps = 1/388 (0%)
 Frame = +1

Query  160   DVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIG  339
             D S D EDDLY+RLK LQRQLEFI+IQEEYVKDE KNL+RE LRAQEEVKRIQSVPLVIG
Sbjct  32    DASSD-EDDLYSRLKFLQRQLEFIDIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIG  90

Query  340   QFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSS  519
             QFMEM+DQNN IVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSS
Sbjct  91    QFMEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSS  150

Query  520   ISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGT  699
             ISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGT
Sbjct  151   ISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGT  210

Query  700   GKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAI  879
             GKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAI
Sbjct  211   GKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAI  270

Query  880   ATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRK  1059
             ATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRK
Sbjct  271   ATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRK  330

Query  1060  IEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKN  1239
             IEFPLPDRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAAEI+AICQEAGMHAVRKN
Sbjct  331   IEFPLPDRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAAEISAICQEAGMHAVRKN  390

Query  1240  RYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             RYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  391   RYVILPKDFEKGYRTNVKKPDTDFEFYK  418



>emb|CDY58566.1| BnaC03g12460D [Brassica napus]
Length=404

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/417 (90%), Positives = 387/417 (93%), Gaps = 13/417 (3%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYV  252
             MA  MVLDP  +P                D+S   E+D Y+RLKSL+RQLEF +IQEEYV
Sbjct  1     MAAAMVLDPKASP-------------PLMDLSTSDEEDPYSRLKSLERQLEFTDIQEEYV  47

Query  253   KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINR  432
             KDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTINR
Sbjct  48    KDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINR  107

Query  433   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV  612
             E LKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDV+YNDIGGCDIQKQEIREAV
Sbjct  108   EDLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVSYNDIGGCDIQKQEIREAV  167

Query  613   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  792
             ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG
Sbjct  168   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  227

Query  793   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  972
             EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ
Sbjct  228   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  287

Query  973   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE  1152
             TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVDLE
Sbjct  288   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDLE  347

Query  1153  DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK
Sbjct  348   DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK  404



>ref|XP_011040698.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Populus 
euphratica]
Length=412

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/419 (91%), Positives = 393/419 (94%), Gaps = 9/419 (2%)
 Frame = +1

Query  73    MATPMVLDPNPTP--KPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEE  246
             M+T MVLDP P P  +P +++    T    +D      DDLY+RLKSLQRQLEFI+IQEE
Sbjct  1     MST-MVLDPKPAPTVEPRWDLVPDPTTVPTED------DDLYSRLKSLQRQLEFIDIQEE  53

Query  247   YVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTI  426
             YVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQ N IVGSTTGSNYYVRILSTI
Sbjct  54    YVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQTNGIVGSTTGSNYYVRILSTI  113

Query  427   NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE  606
             +RELLKPSASVALHR SNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE
Sbjct  114   DRELLKPSASVALHRASNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE  173

Query  607   AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY  786
             AVELPLTHHELYKQIGIDPPRGVLL+GPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY
Sbjct  174   AVELPLTHHELYKQIGIDPPRGVLLHGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY  233

Query  787   LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF  966
             LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF
Sbjct  234   LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF  293

Query  967   DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVD  1146
             DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVD
Sbjct  294   DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVD  353

Query  1147  LEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  354   MEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  412



>emb|CDX88666.1| BnaA03g09830D [Brassica napus]
Length=404

 Score =   764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/417 (90%), Positives = 387/417 (93%), Gaps = 13/417 (3%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYV  252
             MA  MVLDP  +P                D+S   E+D Y+RLKSL+RQLEF +IQEEYV
Sbjct  1     MAAAMVLDPKASP-------------PLMDLSTADEEDPYSRLKSLERQLEFTDIQEEYV  47

Query  253   KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINR  432
             KDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTINR
Sbjct  48    KDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINR  107

Query  433   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV  612
             E LKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDV+YNDIGGCDIQKQEIREAV
Sbjct  108   EDLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVSYNDIGGCDIQKQEIREAV  167

Query  613   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  792
             ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG
Sbjct  168   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  227

Query  793   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  972
             EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ
Sbjct  228   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  287

Query  973   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE  1152
             TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVDLE
Sbjct  288   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDLE  347

Query  1153  DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK
Sbjct  348   DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK  404



>emb|CDY32995.1| BnaA10g12010D [Brassica napus]
Length=404

 Score =   764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/417 (90%), Positives = 386/417 (93%), Gaps = 13/417 (3%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYV  252
             MA  MVLDP  +P                D S   E+D Y+RLKSL+RQLEF +IQEEYV
Sbjct  1     MAAAMVLDPKSSP-------------PVMDQSTTDEEDPYSRLKSLERQLEFTDIQEEYV  47

Query  253   KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINR  432
             KDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTINR
Sbjct  48    KDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINR  107

Query  433   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV  612
             E LKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDV+YNDIGGCDIQKQEIREAV
Sbjct  108   EDLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVSYNDIGGCDIQKQEIREAV  167

Query  613   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  792
             ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG
Sbjct  168   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  227

Query  793   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  972
             EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ
Sbjct  228   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  287

Query  973   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE  1152
             TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVDLE
Sbjct  288   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDLE  347

Query  1153  DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK
Sbjct  348   DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK  404



>gb|KFK27360.1| hypothetical protein AALP_AA8G372700 [Arabis alpina]
Length=404

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/417 (90%), Positives = 388/417 (93%), Gaps = 13/417 (3%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYV  252
             MA  MVLDP  TP             +  D+S   ++DLY+RLKSL+RQLEF +IQEEYV
Sbjct  1     MAATMVLDPKATP-------------ALMDLSTADDEDLYSRLKSLERQLEFTDIQEEYV  47

Query  253   KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINR  432
             KDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTI+R
Sbjct  48    KDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTIDR  107

Query  433   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV  612
             E LKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDV+YNDIGGCDIQKQEIREAV
Sbjct  108   EQLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVSYNDIGGCDIQKQEIREAV  167

Query  613   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  792
             ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVAN TTAAFIRVVGSEFVQKYLG
Sbjct  168   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANSTTAAFIRVVGSEFVQKYLG  227

Query  793   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  972
             EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ
Sbjct  228   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  287

Query  973   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE  1152
             TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCT+KMNL DEVDLE
Sbjct  288   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTSKMNLSDEVDLE  347

Query  1153  DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK
Sbjct  348   DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK  404



>emb|CDY43865.1| BnaC09g33780D [Brassica napus]
Length=404

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/417 (90%), Positives = 386/417 (93%), Gaps = 13/417 (3%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYV  252
             MA  MVLDP  +P                D S   E+D Y+RLKSL+RQLEF +IQEEYV
Sbjct  1     MAAAMVLDPKASP-------------PLMDQSTTDEEDPYSRLKSLERQLEFTDIQEEYV  47

Query  253   KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINR  432
             KDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTINR
Sbjct  48    KDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINR  107

Query  433   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV  612
             E LKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDV+YNDIGGCDIQKQEIREAV
Sbjct  108   EDLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVSYNDIGGCDIQKQEIREAV  167

Query  613   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  792
             ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG
Sbjct  168   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  227

Query  793   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  972
             EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ
Sbjct  228   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  287

Query  973   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE  1152
             TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVDLE
Sbjct  288   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDLE  347

Query  1153  DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK
Sbjct  348   DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK  404



>ref|XP_002276130.2| PREDICTED: 26S protease regulatory subunit 6B homolog [Vitis 
vinifera]
Length=418

 Score =   764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/379 (98%), Positives = 374/379 (99%), Gaps = 0/379 (0%)
 Frame = +1

Query  187   LYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQN  366
             LY RLKSLQRQLEFI+IQEEYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQN
Sbjct  40    LYGRLKSLQRQLEFIDIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQN  99

Query  367   NSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEK  546
             N IVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEK
Sbjct  100   NGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEK  159

Query  547   PDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAV  726
             PDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAV
Sbjct  160   PDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAV  219

Query  727   ANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQT  906
             ANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQT
Sbjct  220   ANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQT  279

Query  907   GADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRR  1086
             GADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRR
Sbjct  280   GADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRR  339

Query  1087  QKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDF  1266
             QKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDF
Sbjct  340   QKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDF  399

Query  1267  EKGYRTNVKKPDTDFEFYK  1323
             EKGYRTNVKKPDTDFEFYK
Sbjct  400   EKGYRTNVKKPDTDFEFYK  418



>ref|XP_009120337.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica 
rapa]
Length=404

 Score =   763 bits (1969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/417 (90%), Positives = 386/417 (93%), Gaps = 13/417 (3%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYV  252
             MA  MVLDP  +P                D S   E+D Y+RLKSL+RQLEF +IQEEYV
Sbjct  1     MAAAMVLDPKSSP-------------PLMDQSTTDEEDPYSRLKSLERQLEFTDIQEEYV  47

Query  253   KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINR  432
             KDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTINR
Sbjct  48    KDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINR  107

Query  433   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV  612
             E LKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDV+YNDIGGCDIQKQEIREAV
Sbjct  108   EDLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVSYNDIGGCDIQKQEIREAV  167

Query  613   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  792
             ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG
Sbjct  168   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  227

Query  793   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  972
             EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ
Sbjct  228   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  287

Query  973   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE  1152
             TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVDLE
Sbjct  288   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDLE  347

Query  1153  DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK
Sbjct  348   DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK  404



>ref|XP_002307945.2| 26S proteasome subunit 7 family protein [Populus trichocarpa]
 gb|EEE91468.2| 26S proteasome subunit 7 family protein [Populus trichocarpa]
Length=384

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/382 (96%), Positives = 376/382 (98%), Gaps = 0/382 (0%)
 Frame = +1

Query  178   EDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMI  357
             +DDLY+R KSLQRQLEFI+IQ+EYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+
Sbjct  3     DDDLYSRFKSLQRQLEFIDIQDEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMV  62

Query  358   DQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQ  537
             DQ N IVGSTTGSNYYVRILSTI+RELLKPSASVALHRHSNALVDVLPPEADSSISLLSQ
Sbjct  63    DQTNGIVGSTTGSNYYVRILSTIDRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQ  122

Query  538   SEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA  717
             SEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA
Sbjct  123   SEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA  182

Query  718   KAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD  897
             KAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD
Sbjct  183   KAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD  242

Query  898   AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP  1077
             AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP
Sbjct  243   AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP  302

Query  1078  DRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILP  1257
             DRRQKRLVFQVCTAKMNL DEVD+EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILP
Sbjct  303   DRRQKRLVFQVCTAKMNLSDEVDMEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILP  362

Query  1258  KDFEKGYRTNVKKPDTDFEFYK  1323
             KDFEKGYRTNVKKPDTDFEFYK
Sbjct  363   KDFEKGYRTNVKKPDTDFEFYK  384



>ref|XP_009132068.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica 
rapa]
Length=404

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/417 (90%), Positives = 386/417 (93%), Gaps = 13/417 (3%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYV  252
             MA  MVLDP  +P                D+S   E+D Y+RLKSL+RQLEF +IQEEYV
Sbjct  1     MAAAMVLDPKASP-------------PLMDLSTSDEEDPYSRLKSLERQLEFTDIQEEYV  47

Query  253   KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINR  432
             KDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTINR
Sbjct  48    KDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINR  107

Query  433   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV  612
             E LKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDV+YNDIGGCDIQKQEIREAV
Sbjct  108   EDLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVSYNDIGGCDIQKQEIREAV  167

Query  613   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  792
             ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAF+RVVGS FVQKYLG
Sbjct  168   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFLRVVGSAFVQKYLG  227

Query  793   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  972
             EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ
Sbjct  228   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  287

Query  973   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE  1152
             TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVDLE
Sbjct  288   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDLE  347

Query  1153  DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDTDFEFYK
Sbjct  348   DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTDFEFYK  404



>ref|XP_003600548.1| 26S protease regulatory subunit 6B [Medicago truncatula]
 gb|AES70799.1| 26S protease regulatory subunit 6B [Medicago truncatula]
Length=415

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/416 (91%), Positives = 389/416 (94%), Gaps = 3/416 (1%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVK  255
             ++ MVLDP P  +     P+  + + A   S    DDLY  LKSLQRQLEFI+IQEEYVK
Sbjct  3     SSAMVLDPKPLTE---PPPSLSSSSPADTDSSSTSDDLYTLLKSLQRQLEFIDIQEEYVK  59

Query  256   DELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRE  435
             DE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+D NN IVGSTTGSNYYVRILSTINRE
Sbjct  60    DEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDTNNGIVGSTTGSNYYVRILSTINRE  119

Query  436   LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE  615
             LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE
Sbjct  120   LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE  179

Query  616   LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE  795
             LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE
Sbjct  180   LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE  239

Query  796   GPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQT  975
             GPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQT
Sbjct  240   GPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQT  299

Query  976   VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLED  1155
             VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVDLED
Sbjct  300   VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDLED  359

Query  1156  YVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             YVSRPDKISAAEI+AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  360   YVSRPDKISAAEISAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  415



>ref|XP_010684522.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Beta vulgaris 
subsp. vulgaris]
Length=421

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/379 (96%), Positives = 374/379 (99%), Gaps = 0/379 (0%)
 Frame = +1

Query  187   LYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQN  366
             LY RLKSL+RQ+EF++IQEEYVKDELKNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQN
Sbjct  43    LYGRLKSLERQIEFMDIQEEYVKDELKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQN  102

Query  367   NSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEK  546
             N IVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEK
Sbjct  103   NGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEK  162

Query  547   PDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAV  726
             PDV YNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAV
Sbjct  163   PDVNYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAV  222

Query  727   ANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQT  906
             ANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQT
Sbjct  223   ANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQT  282

Query  907   GADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRR  1086
             GADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRR
Sbjct  283   GADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRR  342

Query  1087  QKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDF  1266
             QKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAAEI+AICQEAGMHAVRKNRYVILPKDF
Sbjct  343   QKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAAEISAICQEAGMHAVRKNRYVILPKDF  402

Query  1267  EKGYRTNVKKPDTDFEFYK  1323
             EKGYR+NVKKPDTDF+FYK
Sbjct  403   EKGYRSNVKKPDTDFDFYK  421



>gb|KHG22968.1| 26S protease regulatory subunit 6B -like protein [Gossypium arboreum]
Length=417

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/420 (90%), Positives = 390/420 (93%), Gaps = 9/420 (2%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRTDAS---AQDVSYDA-EDDLYARLKSLQRQLEFIEIQE  243
             A+ +V +P  + +  F  P T TD       D    A EDDLY+RLKSLQRQLEFI+IQE
Sbjct  3     ASTVVAEPKSSAEAPF--PVTGTDLGKCLTMDPPLGADEDDLYSRLKSLQRQLEFIDIQE  60

Query  244   EYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILST  423
             EYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM++QNN IVGSTTGSNYYVRILST
Sbjct  61    EYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVNQNNGIVGSTTGSNYYVRILST  120

Query  424   INRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIR  603
             INRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIR
Sbjct  121   INRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIR  180

Query  604   EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK  783
             EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK
Sbjct  181   EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK  240

Query  784   YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG  963
             YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG
Sbjct  241   YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG  300

Query  964   FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEV  1143
             FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRL   VCTAKMNL DEV
Sbjct  301   FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRL---VCTAKMNLSDEV  357

Query  1144  DLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  358   DLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  417



>ref|XP_004500389.1| PREDICTED: 26S protease regulatory subunit 6B homolog isoform 
X1 [Cicer arietinum]
Length=431

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/401 (94%), Positives = 380/401 (95%), Gaps = 14/401 (3%)
 Frame = +1

Query  160   DVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIG  339
             D S D EDDLY+RLK LQRQLEFI+IQEEYVKDE KNL+RE LRAQEEVKRIQSVPLVIG
Sbjct  32    DASSD-EDDLYSRLKFLQRQLEFIDIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIG  90

Query  340   QFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSS  519
             QFMEM+DQNN IVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSS
Sbjct  91    QFMEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSS  150

Query  520   ISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGT  699
             ISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGT
Sbjct  151   ISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGT  210

Query  700   GKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAI  879
             GKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAI
Sbjct  211   GKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAI  270

Query  880   ATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRK  1059
             ATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRK
Sbjct  271   ATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRK  330

Query  1060  IEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEA--------  1215
             IEFPLPDRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAAEI+AICQEA        
Sbjct  331   IEFPLPDRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAAEISAICQEAGXXXXXXX  390

Query  1216  -----GMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
                  GMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  391   XXXXXGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  431



>ref|NP_001167681.1| 26S protease regulatory subunit 6B [Zea mays]
 ref|XP_008677785.1| PREDICTED: 26S proteasome regulatory complex ATPase RPT3 isoform 
X1 [Zea mays]
 gb|ACG35264.1| 26S protease regulatory subunit 6B [Zea mays]
 gb|AFW62465.1| 26S proteasome regulatory complex ATPase RPT3 isoform 1 [Zea 
mays]
 gb|AFW62466.1| 26S proteasome regulatory complex ATPase RPT3 isoform 2 [Zea 
mays]
Length=420

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/420 (90%), Positives = 394/420 (94%), Gaps = 8/420 (2%)
 Frame = +1

Query  64    APTMATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQE  243
             AP++ATPM       P PS+  PA+ T +S+   S + E+DLY RLKSLQR +EF+EIQE
Sbjct  9     APSVATPM------APPPSY--PASSTASSSISASAEEEEDLYGRLKSLQRHMEFVEIQE  60

Query  244   EYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILST  423
             EYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+D NN IVGSTTGSNYYVRILST
Sbjct  61    EYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDGNNGIVGSTTGSNYYVRILST  120

Query  424   INRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIR  603
             INRELLKPSASVALHRHSNALVDVLPPEADSSISLL  SEKP+VTYNDIGGCDIQKQEIR
Sbjct  121   INRELLKPSASVALHRHSNALVDVLPPEADSSISLLGSSEKPNVTYNDIGGCDIQKQEIR  180

Query  604   EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK  783
             EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVA+HTTAAFIRVVGSEFVQK
Sbjct  181   EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVAHHTTAAFIRVVGSEFVQK  240

Query  784   YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG  963
             YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG
Sbjct  241   YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG  300

Query  964   FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEV  1143
             FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEV
Sbjct  301   FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEV  360

Query  1144  DLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DLEDYVSRPDKISAA+IAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKP+TDF+FYK
Sbjct  361   DLEDYVSRPDKISAADIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPETDFDFYK  420



>gb|AFK43608.1| unknown [Medicago truncatula]
Length=415

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/416 (90%), Positives = 387/416 (93%), Gaps = 3/416 (1%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVK  255
             ++ MVLDP P  +     P+  + + A   S    DDLY  LKSL+RQLEFI+IQEEYVK
Sbjct  3     SSAMVLDPKPLTE---PPPSLSSSSPADTDSSSTSDDLYTLLKSLRRQLEFIDIQEEYVK  59

Query  256   DELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRE  435
             DE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+D NN IVGSTTGSNYYVRILSTINRE
Sbjct  60    DEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDTNNGIVGSTTGSNYYVRILSTINRE  119

Query  436   LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE  615
             LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE
Sbjct  120   LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE  179

Query  616   LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE  795
             LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE
Sbjct  180   LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE  239

Query  796   GPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQT  975
             GPRMVRD FRLAKENAPAIIFIDEVDAIATARFDAQTGAD EVQRILMELLNQMDGFDQT
Sbjct  240   GPRMVRDAFRLAKENAPAIIFIDEVDAIATARFDAQTGADGEVQRILMELLNQMDGFDQT  299

Query  976   VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLED  1155
             VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVDLED
Sbjct  300   VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDLED  359

Query  1156  YVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             YVSRPDKISAAEI+AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  360   YVSRPDKISAAEISAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  415



>gb|KFK27359.1| hypothetical protein AALP_AA8G372600 [Arabis alpina]
Length=404

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/417 (88%), Positives = 382/417 (92%), Gaps = 13/417 (3%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYV  252
             MA  MV  P  TP             +  D+S   E+D Y RLKSL+RQLEF +IQEEYV
Sbjct  1     MAATMVFAPTATP-------------ALMDLSTADEEDHYGRLKSLERQLEFTDIQEEYV  47

Query  253   KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINR  432
             KDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IV STTGSNYYVRILSTI+R
Sbjct  48    KDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVASTTGSNYYVRILSTIDR  107

Query  433   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV  612
             E LKPSASVALHRHSNALVDVLPPE+DSSISLLSQSEKPDV+Y+DIGGCDIQKQEIREAV
Sbjct  108   EQLKPSASVALHRHSNALVDVLPPESDSSISLLSQSEKPDVSYSDIGGCDIQKQEIREAV  167

Query  613   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  792
             ELPLTHHELYKQIGIDPPRGV LYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG
Sbjct  168   ELPLTHHELYKQIGIDPPRGVFLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  227

Query  793   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  972
             EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ
Sbjct  228   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  287

Query  973   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLE  1152
             TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCT+KMNL DEVDLE
Sbjct  288   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTSKMNLSDEVDLE  347

Query  1153  DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR+NVKKPDT FEFYK
Sbjct  348   DYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRSNVKKPDTAFEFYK  404



>ref|XP_002960799.1| hypothetical protein SELMODRAFT_163630 [Selaginella moellendorffii]
 ref|XP_002983870.1| hypothetical protein SELMODRAFT_180600 [Selaginella moellendorffii]
 gb|EFJ14882.1| hypothetical protein SELMODRAFT_180600 [Selaginella moellendorffii]
 gb|EFJ38338.1| hypothetical protein SELMODRAFT_163630 [Selaginella moellendorffii]
Length=408

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/381 (94%), Positives = 372/381 (98%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             DDLY   KSL R+LEF++IQEEY+KDELKNL+RE LRAQEEVKRIQSVPLVIGQF+EM+D
Sbjct  28    DDLYTWYKSLHRRLEFVDIQEEYIKDELKNLKRELLRAQEEVKRIQSVPLVIGQFIEMVD  87

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QNN IVGSTTGSNYYVRILST+NRELLKPS+SVALHRHSNALVDVLPPEADSSISLL+QS
Sbjct  88    QNNGIVGSTTGSNYYVRILSTVNRELLKPSSSVALHRHSNALVDVLPPEADSSISLLTQS  147

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPDV YNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK
Sbjct  148   EKPDVAYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  207

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIATARFDA
Sbjct  208   AVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATARFDA  267

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  268   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  327

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK
Sbjct  328   RRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  387

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGYRTNVKK DTDFEFYK
Sbjct  388   DFEKGYRTNVKKSDTDFEFYK  408



>ref|XP_003578118.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brachypodium 
distachyon]
Length=419

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/391 (93%), Positives = 377/391 (96%), Gaps = 0/391 (0%)
 Frame = +1

Query  151   SAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPL  330
             SA   + + +DDLY +LKSLQR +EF+EIQEEYVKDELKNL+RE LRAQEEVKRIQSVPL
Sbjct  29    SASAATAEDDDDLYGKLKSLQRHMEFVEIQEEYVKDELKNLKREVLRAQEEVKRIQSVPL  88

Query  331   VIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEA  510
             VIGQF+EM+D NN IVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEA
Sbjct  89    VIGQFLEMVDGNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEA  148

Query  511   DSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGP  690
             DSSISLL  SEKP+V Y+DIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGP
Sbjct  149   DSSISLLGSSEKPNVLYSDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGP  208

Query  691   PGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEV  870
             PGTGKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEV
Sbjct  209   PGTGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEV  268

Query  871   DAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRL  1050
             DAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRL
Sbjct  269   DAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRL  328

Query  1051  DRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAV  1230
             DRKIEFPLPDRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAA+IAAICQEAGMHAV
Sbjct  329   DRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAADIAAICQEAGMHAV  388

Query  1231  RKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             RKNRYVILPKDFEKGYRTNVKKP+TDF+FYK
Sbjct  389   RKNRYVILPKDFEKGYRTNVKKPETDFDFYK  419



>ref|XP_004952381.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Setaria 
italica]
Length=420

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/382 (95%), Positives = 373/382 (98%), Gaps = 0/382 (0%)
 Frame = +1

Query  178   EDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMI  357
             +DDLY RLKSLQR +EF+EIQEEYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+
Sbjct  39    DDDLYGRLKSLQRHMEFVEIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMV  98

Query  358   DQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQ  537
             D NN IVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLL  
Sbjct  99    DGNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLGS  158

Query  538   SEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA  717
             SEKP+VTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA
Sbjct  159   SEKPNVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA  218

Query  718   KAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD  897
             KAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD
Sbjct  219   KAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD  278

Query  898   AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP  1077
             AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP
Sbjct  279   AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP  338

Query  1078  DRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILP  1257
             DRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAA+IAAICQEAGMHAVRKNRYVILP
Sbjct  339   DRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAADIAAICQEAGMHAVRKNRYVILP  398

Query  1258  KDFEKGYRTNVKKPDTDFEFYK  1323
             KDFEKGYRTNVKKP+TDF+FYK
Sbjct  399   KDFEKGYRTNVKKPETDFDFYK  420



>ref|NP_001046700.1| Os02g0325100 [Oryza sativa Japonica Group]
 dbj|BAD15686.1| putative 26S proteasome regulatory particle triple-A ATPase subunit3 
[Oryza sativa Japonica Group]
 dbj|BAF08614.1| Os02g0325100 [Oryza sativa Japonica Group]
 dbj|BAG92514.1| unnamed protein product [Oryza sativa Japonica Group]
Length=419

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/382 (95%), Positives = 372/382 (97%), Gaps = 0/382 (0%)
 Frame = +1

Query  178   EDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMI  357
             +DDLY RLKSLQR +EF+EIQEEYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+
Sbjct  38    DDDLYGRLKSLQRHMEFVEIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMV  97

Query  358   DQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQ  537
             D NN IVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLL  
Sbjct  98    DGNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLGS  157

Query  538   SEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA  717
             SEKP+VTY DIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA
Sbjct  158   SEKPNVTYTDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA  217

Query  718   KAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD  897
             KAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD
Sbjct  218   KAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD  277

Query  898   AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP  1077
             AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP
Sbjct  278   AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP  337

Query  1078  DRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILP  1257
             DRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAA+IAAICQEAGMHAVRKNRYVILP
Sbjct  338   DRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAADIAAICQEAGMHAVRKNRYVILP  397

Query  1258  KDFEKGYRTNVKKPDTDFEFYK  1323
             KDFEKGYRTNVKKP+TDF+FYK
Sbjct  398   KDFEKGYRTNVKKPETDFDFYK  419



>ref|XP_003572718.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brachypodium 
distachyon]
Length=419

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/391 (93%), Positives = 376/391 (96%), Gaps = 0/391 (0%)
 Frame = +1

Query  151   SAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPL  330
             SA   + + +DDLY +LKSLQR +EF+EIQEEYVKDE KNL+RE LRAQEEVKRIQSVPL
Sbjct  29    SASAGAAEDDDDLYGKLKSLQRHMEFVEIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPL  88

Query  331   VIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEA  510
             VIGQFMEM+D NN IVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEA
Sbjct  89    VIGQFMEMVDGNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEA  148

Query  511   DSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGP  690
             DSSISLL  SEKP+V Y+DIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGP
Sbjct  149   DSSISLLGSSEKPNVLYSDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGP  208

Query  691   PGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEV  870
             PGTGKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEV
Sbjct  209   PGTGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEV  268

Query  871   DAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRL  1050
             DAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRL
Sbjct  269   DAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRL  328

Query  1051  DRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAV  1230
             DRKIEFPLPDRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAA+IAAICQEAGMHAV
Sbjct  329   DRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAADIAAICQEAGMHAV  388

Query  1231  RKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             RKNRYVILPKDFEKGYRTNVKKP+TDF+FYK
Sbjct  389   RKNRYVILPKDFEKGYRTNVKKPETDFDFYK  419



>ref|XP_001778695.1| predicted protein [Physcomitrella patens]
 gb|EDQ56488.1| predicted protein [Physcomitrella patens]
Length=416

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/382 (93%), Positives = 374/382 (98%), Gaps = 0/382 (0%)
 Frame = +1

Query  178   EDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMI  357
             E+DLY R K LQRQLEF++IQEEY+KDE KNL+RE LRAQEEVKRIQSVPLVIGQF+EM+
Sbjct  35    EEDLYTRQKLLQRQLEFVDIQEEYIKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFIEMV  94

Query  358   DQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQ  537
             DQNN IVGSTTGSNYYVRILSTINRELLKPS+SVALHRHSNALVDVLPPEADSSISLL+Q
Sbjct  95    DQNNGIVGSTTGSNYYVRILSTINRELLKPSSSVALHRHSNALVDVLPPEADSSISLLTQ  154

Query  538   SEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA  717
             SEKPDV+YNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA
Sbjct  155   SEKPDVSYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA  214

Query  718   KAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD  897
             KAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIATARFD
Sbjct  215   KAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATARFD  274

Query  898   AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP  1077
             AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP
Sbjct  275   AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP  334

Query  1078  DRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILP  1257
             DRRQKR+VFQVCTAKMNL +EVDLEDYVSRPDKISAAEI+AICQEAGMHAVRKNRYVILP
Sbjct  335   DRRQKRMVFQVCTAKMNLSEEVDLEDYVSRPDKISAAEISAICQEAGMHAVRKNRYVILP  394

Query  1258  KDFEKGYRTNVKKPDTDFEFYK  1323
             KDFEKGYR+NVKK DTDFEFY+
Sbjct  395   KDFEKGYRSNVKKSDTDFEFYR  416



>gb|AFW70813.1| hypothetical protein ZEAMMB73_780902 [Zea mays]
Length=463

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/431 (87%), Positives = 389/431 (90%), Gaps = 4/431 (1%)
 Frame = +1

Query  1     LFPTPLSSLQAPD-SSAPSR*GAPTMATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDA  177
             L P P +  Q    +SA S   A T  TP V  P   P PS+  PA+ T +++   S + 
Sbjct  36    LLPDPQNRTQVETLTSAFSMSAATTAPTPAVATPM-APPPSY--PASSTISASVAASVEE  92

Query  178   EDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMI  357
             EDDLY RLKSLQR +EF+EIQEEYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+
Sbjct  93    EDDLYGRLKSLQRHMEFVEIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMV  152

Query  358   DQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQ  537
             D NN IVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLL  
Sbjct  153   DGNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLGS  212

Query  538   SEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA  717
             SEKP+VTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA
Sbjct  213   SEKPNVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA  272

Query  718   KAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD  897
             KAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD
Sbjct  273   KAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD  332

Query  898   AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP  1077
             AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP
Sbjct  333   AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP  392

Query  1078  DRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILP  1257
             DRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAA+IAAICQEAGMHAVRKNRYVILP
Sbjct  393   DRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAADIAAICQEAGMHAVRKNRYVILP  452

Query  1258  KDFEKGYRTNV  1290
             KDFEKGYRTN 
Sbjct  453   KDFEKGYRTNC  463



>ref|XP_006405326.1| hypothetical protein EUTSA_v10027786mg [Eutrema salsugineum]
 gb|ESQ46779.1| hypothetical protein EUTSA_v10027786mg [Eutrema salsugineum]
Length=408

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/420 (88%), Positives = 383/420 (91%), Gaps = 15/420 (4%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYV  252
             MA  MVLDP  +       PA    ++A       E+DLY  LKSL+RQ+ F +IQEEYV
Sbjct  1     MAAAMVLDPRASS------PAVMDQSTAN------EEDLYGILKSLKRQIGFTDIQEEYV  48

Query  253   KDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINR  432
             KDE  NL+RE  RAQEEVKRIQSVPLVIGQFMEM+DQNN IVGS+TGSNYYVRILSTINR
Sbjct  49    KDEQNNLKREASRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSSTGSNYYVRILSTINR  108

Query  433   ELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV  612
             ELLKPSASVALHRHSNALVDVLPPE+DSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV
Sbjct  109   ELLKPSASVALHRHSNALVDVLPPESDSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAV  168

Query  613   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  792
             ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG
Sbjct  169   ELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLG  228

Query  793   EGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  972
             EGPRMVRDVFRLAK+NAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ
Sbjct  229   EGPRMVRDVFRLAKDNAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQ  288

Query  973   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVF---QVCTAKMNLGDEV  1143
             TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVF   QVCT+KMNL DEV
Sbjct  289   TVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQARQVCTSKMNLSDEV  348

Query  1144  DLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DLEDYVSRPDKISAAEI AICQEAGMHAVRKNRYVILPKDF+KGYR NVKKPDTDFEFYK
Sbjct  349   DLEDYVSRPDKISAAEITAICQEAGMHAVRKNRYVILPKDFDKGYRANVKKPDTDFEFYK  408



>ref|XP_001765848.1| predicted protein [Physcomitrella patens]
 gb|EDQ69439.1| predicted protein [Physcomitrella patens]
Length=387

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/382 (93%), Positives = 373/382 (98%), Gaps = 0/382 (0%)
 Frame = +1

Query  178   EDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMI  357
             E+DLY R K L RQLEF++IQEEY+KDE KNL+RE LRAQEEVKRIQSVPLVIGQF+EM+
Sbjct  6     EEDLYTRQKLLMRQLEFLDIQEEYIKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFIEMV  65

Query  358   DQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQ  537
             DQNN IVGSTTGSNYYVRILSTINRELLKPS+SVALHRHSNALVDVLPPEADSSISLL+Q
Sbjct  66    DQNNGIVGSTTGSNYYVRILSTINRELLKPSSSVALHRHSNALVDVLPPEADSSISLLTQ  125

Query  538   SEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA  717
             SEKPDV+YNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA
Sbjct  126   SEKPDVSYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA  185

Query  718   KAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD  897
             KAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIATARFD
Sbjct  186   KAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATARFD  245

Query  898   AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP  1077
             AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP
Sbjct  246   AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP  305

Query  1078  DRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILP  1257
             DRRQKRLVFQVCTAKMNL +EVDLEDYVSRPDKISAAEI+AICQEAGMHAVRKNRYVILP
Sbjct  306   DRRQKRLVFQVCTAKMNLSEEVDLEDYVSRPDKISAAEISAICQEAGMHAVRKNRYVILP  365

Query  1258  KDFEKGYRTNVKKPDTDFEFYK  1323
             KDFEKGYR+NVKK DTDFEFY+
Sbjct  366   KDFEKGYRSNVKKSDTDFEFYR  387



>ref|XP_006432050.1| hypothetical protein CICLE_v10003767mg [Citrus clementina]
 gb|ESR45290.1| hypothetical protein CICLE_v10003767mg [Citrus clementina]
Length=395

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/416 (89%), Positives = 380/416 (91%), Gaps = 23/416 (6%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVK  255
             A+ MVLDP P  +P    P+TR+D + Q   +  EDDLY+RLKSLQRQLEFI+IQEEYVK
Sbjct  3     ASAMVLDPKPVSEPP---PSTRSDLTEQ---WSDEDDLYSRLKSLQRQLEFIDIQEEYVK  56

Query  256   DELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRE  435
             DE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTINRE
Sbjct  57    DEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINRE  116

Query  436   LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE  615
             LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE
Sbjct  117   LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE  176

Query  616   LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE  795
             LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE
Sbjct  177   LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE  236

Query  796   GPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQT  975
             GPRMVRD                 VDAIATARFDAQTGADREVQRILMELLNQMDGFDQT
Sbjct  237   GPRMVRD-----------------VDAIATARFDAQTGADREVQRILMELLNQMDGFDQT  279

Query  976   VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLED  1155
             VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVDLED
Sbjct  280   VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDLED  339

Query  1156  YVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             YVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  340   YVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  395



>dbj|BAJ88792.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08031.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=410

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/382 (94%), Positives = 372/382 (97%), Gaps = 0/382 (0%)
 Frame = +1

Query  178   EDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMI  357
             +DDLY RLKSLQR +EF+EIQEEYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+
Sbjct  29    DDDLYGRLKSLQRHMEFVEIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMV  88

Query  358   DQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQ  537
             D NN IVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLL+ 
Sbjct  89    DGNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLAS  148

Query  538   SEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA  717
             SEKP+V Y+DIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA
Sbjct  149   SEKPNVLYSDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA  208

Query  718   KAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD  897
             KAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD
Sbjct  209   KAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD  268

Query  898   AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP  1077
             AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP
Sbjct  269   AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP  328

Query  1078  DRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILP  1257
             DRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAA+I AICQEAGMHAVRKNRYVILP
Sbjct  329   DRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAADITAICQEAGMHAVRKNRYVILP  388

Query  1258  KDFEKGYRTNVKKPDTDFEFYK  1323
             KDFEKGYRTNVKKP++DF+FYK
Sbjct  389   KDFEKGYRTNVKKPESDFDFYK  410



>ref|XP_006647211.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Oryza 
brachyantha]
Length=419

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/379 (95%), Positives = 369/379 (97%), Gaps = 0/379 (0%)
 Frame = +1

Query  187   LYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQN  366
             LY RLKSLQR +EF+EIQEEYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+D N
Sbjct  41    LYGRLKSLQRHMEFVEIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDGN  100

Query  367   NSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEK  546
             N IVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLL  SEK
Sbjct  101   NGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLGSSEK  160

Query  547   PDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAV  726
             P+VTY DIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAV
Sbjct  161   PNVTYTDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAV  220

Query  727   ANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQT  906
             A+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQT
Sbjct  221   AHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQT  280

Query  907   GADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRR  1086
             GADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRR
Sbjct  281   GADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRR  340

Query  1087  QKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDF  1266
             QKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAA+IAAICQEAGMHAVRKNRYVILPKDF
Sbjct  341   QKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAADIAAICQEAGMHAVRKNRYVILPKDF  400

Query  1267  EKGYRTNVKKPDTDFEFYK  1323
             EKGYRTNVKKP+TDF+FYK
Sbjct  401   EKGYRTNVKKPETDFDFYK  419



>ref|XP_008358903.1| PREDICTED: LOW QUALITY PROTEIN: 26S protease regulatory subunit 
6B homolog [Malus domestica]
Length=415

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/415 (89%), Positives = 389/415 (94%), Gaps = 2/415 (0%)
 Frame = +1

Query  85    MVLDPNPTPKPSFEVPATRTDASA-QDVSYDA-EDDLYARLKSLQRQLEFIEIQEEYVKD  258
             MVLDP P P+P   +P+ R+D     + S D+ EDDLY+RLKS QRQLEFI+IQEEYVKD
Sbjct  1     MVLDPKPLPEPPASIPSIRSDLQGYTEQSQDSDEDDLYSRLKSYQRQLEFIDIQEEYVKD  60

Query  259   ELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINREL  438
             +LK  +RE LRAQE+VKRIQSVPLVIGQFME++DQNN IVGSTTGSNYYV+ILSTINREL
Sbjct  61    KLKKKKRELLRAQEKVKRIQSVPLVIGQFMEIVDQNNGIVGSTTGSNYYVKILSTINREL  120

Query  439   LKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVEL  618
             LKPSASVALHR SNALV+VLPPEADSSISLLSQSEKPD TY+DIGGCDIQKQEIREAVEL
Sbjct  121   LKPSASVALHRLSNALVBVLPPEADSSISLLSQSEKPDFTYSDIGGCDIQKQEIREAVEL  180

Query  619   PLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEG  798
             PLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEG
Sbjct  181   PLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEG  240

Query  799   PRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTV  978
             PRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTV
Sbjct  241   PRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTV  300

Query  979   NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDY  1158
             NVKV MATNRADTLDPALLRPGRLD KIEFPLPDRRQKRLVFQVCTAKMNL DEVDLEDY
Sbjct  301   NVKVTMATNRADTLDPALLRPGRLDXKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDLEDY  360

Query  1159  VSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             VSRP KISAAEI+AICQEAGMHAV KNRYVILPKDFEKGY+TNVKKPDTDFEFYK
Sbjct  361   VSRPYKISAAEISAICQEAGMHAVPKNRYVILPKDFEKGYQTNVKKPDTDFEFYK  415



>ref|XP_001772217.1| predicted protein [Physcomitrella patens]
 gb|EDQ63030.1| predicted protein [Physcomitrella patens]
Length=412

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/380 (93%), Positives = 372/380 (98%), Gaps = 0/380 (0%)
 Frame = +1

Query  184   DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQ  363
             DLY R K LQRQLEF++IQEEY+KDE KNL+RE LRAQEEVKRIQSVPLVIGQF+EM+DQ
Sbjct  33    DLYTRQKLLQRQLEFLDIQEEYIKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFIEMVDQ  92

Query  364   NNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSE  543
             +N IVGSTTGSN+YVRILSTINRELLKPS+SVALHRHSNALVDVLPPEADSSISLL+QSE
Sbjct  93    DNGIVGSTTGSNFYVRILSTINRELLKPSSSVALHRHSNALVDVLPPEADSSISLLTQSE  152

Query  544   KPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKA  723
             KPDV+YNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKA
Sbjct  153   KPDVSYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKA  212

Query  724   VANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQ  903
             VA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVF+LAKENAPAIIFIDE+DAIATARFDAQ
Sbjct  213   VAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFQLAKENAPAIIFIDEIDAIATARFDAQ  272

Query  904   TGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDR  1083
             TGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDR
Sbjct  273   TGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDR  332

Query  1084  RQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKD  1263
             RQKRLVFQVCTAKMNL +EVDLEDYVSRPDKISAAEI+AICQEAGMHAVRKNRYVILPKD
Sbjct  333   RQKRLVFQVCTAKMNLSEEVDLEDYVSRPDKISAAEISAICQEAGMHAVRKNRYVILPKD  392

Query  1264  FEKGYRTNVKKPDTDFEFYK  1323
             FEKGYR+NVKK DTDFEFY+
Sbjct  393   FEKGYRSNVKKSDTDFEFYR  412



>ref|XP_001759290.1| predicted protein [Physcomitrella patens]
 gb|EDQ75974.1| predicted protein [Physcomitrella patens]
Length=412

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/382 (93%), Positives = 371/382 (97%), Gaps = 0/382 (0%)
 Frame = +1

Query  178   EDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMI  357
             E+DLY R K LQRQLEF++IQEEY+KDE KNL+RE LRAQEEVKRIQSVPLVIGQF EM+
Sbjct  31    EEDLYTRQKLLQRQLEFVDIQEEYIKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFNEMV  90

Query  358   DQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQ  537
             DQNN IVGSTTGSNYYVRILSTINRELLKPS+SVALHRHSNALVDVLPPEADSSISL++Q
Sbjct  91    DQNNGIVGSTTGSNYYVRILSTINRELLKPSSSVALHRHSNALVDVLPPEADSSISLMTQ  150

Query  538   SEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA  717
             +EKPDV Y DIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA
Sbjct  151   TEKPDVAYTDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA  210

Query  718   KAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD  897
             KAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIATARFD
Sbjct  211   KAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATARFD  270

Query  898   AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP  1077
             AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP
Sbjct  271   AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP  330

Query  1078  DRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILP  1257
             DRRQKRLVFQVCTAKMNL +EVDLEDYVSRPDKISAAEI+AICQEAGMHAVRKNRYVILP
Sbjct  331   DRRQKRLVFQVCTAKMNLSEEVDLEDYVSRPDKISAAEISAICQEAGMHAVRKNRYVILP  390

Query  1258  KDFEKGYRTNVKKPDTDFEFYK  1323
             KDFEKGYR+NV+K DTDFEFY+
Sbjct  391   KDFEKGYRSNVRKSDTDFEFYR  412



>ref|XP_010094442.1| 26S protease regulatory subunit 6B-like protein [Morus notabilis]
 gb|EXB56023.1| 26S protease regulatory subunit 6B-like protein [Morus notabilis]
Length=397

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/420 (87%), Positives = 377/420 (90%), Gaps = 26/420 (6%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASA---QDVSYDAEDDLYARLKSLQRQLEFIEIQE  243
             MA+ MV+DP P+P+P    P+TR+D      Q  S+  EDDLY+RLKSLQRQLEFI+IQE
Sbjct  1     MASAMVMDPKPSPEPPASFPSTRSDLQGLGDQSSSFSDEDDLYSRLKSLQRQLEFIDIQE  60

Query  244   EYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILST  423
             EYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILST
Sbjct  61    EYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILST  120

Query  424   INRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIR  603
             INRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIR
Sbjct  121   INRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIR  180

Query  604   EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK  783
             EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK
Sbjct  181   EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK  240

Query  784   YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG  963
             YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG
Sbjct  241   YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG  300

Query  964   FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEV  1143
             FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEV
Sbjct  301   FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEV  360

Query  1144  DLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DLEDYVSRPDKISAAE                       DFEKGYRTNVKKPDTDFEFYK
Sbjct  361   DLEDYVSRPDKISAAE-----------------------DFEKGYRTNVKKPDTDFEFYK  397



>ref|XP_002994701.1| hypothetical protein SELMODRAFT_139024, partial [Selaginella 
moellendorffii]
 gb|EFJ04233.1| hypothetical protein SELMODRAFT_139024, partial [Selaginella 
moellendorffii]
Length=368

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/368 (96%), Positives = 363/368 (99%), Gaps = 0/368 (0%)
 Frame = +1

Query  220   LEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSN  399
             LEF++IQEEY+KDELKNL+RE LRAQEEVKRIQSVPLVIGQF+EM+DQNN IVGSTTGSN
Sbjct  1     LEFVDIQEEYIKDELKNLKRELLRAQEEVKRIQSVPLVIGQFIEMVDQNNGIVGSTTGSN  60

Query  400   YYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGC  579
             YYVRILST+NRELLKPS+SVALHRHSNALVDVLPPEADSSISLL+QSEKPDV YNDIGGC
Sbjct  61    YYVRILSTVNRELLKPSSSVALHRHSNALVDVLPPEADSSISLLTQSEKPDVAYNDIGGC  120

Query  580   DIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRV  759
             DIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVA+HTTAAFIRV
Sbjct  121   DIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVAHHTTAAFIRV  180

Query  760   VGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILM  939
             VGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIATARFDAQTGADREVQRILM
Sbjct  181   VGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATARFDAQTGADREVQRILM  240

Query  940   ELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTA  1119
             ELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTA
Sbjct  241   ELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTA  300

Query  1120  KMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKP  1299
             KMNL DEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKK 
Sbjct  301   KMNLSDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKS  360

Query  1300  DTDFEFYK  1323
             DTDFEFYK
Sbjct  361   DTDFEFYK  368



>gb|EEC73047.1| hypothetical protein OsI_06998 [Oryza sativa Indica Group]
 gb|EEE56866.1| hypothetical protein OsJ_06499 [Oryza sativa Japonica Group]
Length=442

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/405 (89%), Positives = 372/405 (92%), Gaps = 23/405 (6%)
 Frame = +1

Query  178   EDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMI  357
             +DDLY RLKSLQR +EF+EIQEEYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+
Sbjct  38    DDDLYGRLKSLQRHMEFVEIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMV  97

Query  358   DQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQ  537
             D NN IVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLL  
Sbjct  98    DGNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLGS  157

Query  538   SEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA  717
             SEKP+VTY DIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA
Sbjct  158   SEKPNVTYTDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA  217

Query  718   KAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD  897
             KAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD
Sbjct  218   KAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD  277

Query  898   AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP  1077
             AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP
Sbjct  278   AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP  337

Query  1078  DRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAE----------------------  1191
             DRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAA+                      
Sbjct  338   DRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAADPMSEDCSAEDTFDAIVTCGTSV  397

Query  1192  -IAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
              IAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKP+TDF+FYK
Sbjct  398   LIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPETDFDFYK  442



>dbj|BAB78494.1| 26S proteasome regulatory particle triple-A ATPase subunit3 [Oryza 
sativa Japonica Group]
Length=368

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/368 (95%), Positives = 360/368 (98%), Gaps = 0/368 (0%)
 Frame = +1

Query  220   LEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSN  399
             +EF+EIQEEYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+D NN IVGSTTGSN
Sbjct  1     MEFVEIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDGNNGIVGSTTGSN  60

Query  400   YYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGC  579
             YYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLL  SEKP+VTY DIGGC
Sbjct  61    YYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLGSSEKPNVTYTDIGGC  120

Query  580   DIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRV  759
             DIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVA+HTTAAFIRV
Sbjct  121   DIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVAHHTTAAFIRV  180

Query  760   VGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILM  939
             VGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILM
Sbjct  181   VGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILM  240

Query  940   ELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTA  1119
             ELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTA
Sbjct  241   ELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTA  300

Query  1120  KMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKP  1299
             KMNL DEVDLEDYVSRPDKISAA+IAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKP
Sbjct  301   KMNLSDEVDLEDYVSRPDKISAADIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKP  360

Query  1300  DTDFEFYK  1323
             +TDF+FYK
Sbjct  361   ETDFDFYK  368



>gb|EMS47104.1| 26S protease regulatory subunit 6B-like protein [Triticum urartu]
Length=368

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/368 (95%), Positives = 360/368 (98%), Gaps = 0/368 (0%)
 Frame = +1

Query  220   LEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSN  399
             +EF+EIQEEYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+D NN IVGSTTGSN
Sbjct  1     MEFVEIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDGNNGIVGSTTGSN  60

Query  400   YYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGC  579
             YYVRILSTINRELLKPSASVALHRHSNALVD+LPPEADSSISLL+ SEKP+V Y+DIGGC
Sbjct  61    YYVRILSTINRELLKPSASVALHRHSNALVDILPPEADSSISLLASSEKPNVLYSDIGGC  120

Query  580   DIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRV  759
             DIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVA+HTTAAFIRV
Sbjct  121   DIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVAHHTTAAFIRV  180

Query  760   VGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILM  939
             VGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILM
Sbjct  181   VGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILM  240

Query  940   ELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTA  1119
             ELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTA
Sbjct  241   ELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTA  300

Query  1120  KMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKP  1299
             KMNL DEVDLEDYVSRPDKISAA+I AICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKP
Sbjct  301   KMNLSDEVDLEDYVSRPDKISAADITAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKP  360

Query  1300  DTDFEFYK  1323
             +TDF+FYK
Sbjct  361   ETDFDFYK  368



>ref|XP_005644165.1| 26S proteasome subunit P45 [Coccomyxa subellipsoidea C-169]
 gb|EIE19621.1| 26S proteasome subunit P45 [Coccomyxa subellipsoidea C-169]
Length=390

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/384 (89%), Positives = 365/384 (95%), Gaps = 0/384 (0%)
 Frame = +1

Query  172   DAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFME  351
             + E+DLY RLK+LQRQLEF EIQEEY+K+E ++L+RE LRAQEEVKRIQSVPLVIGQF+E
Sbjct  7     NGEEDLYTRLKTLQRQLEFYEIQEEYIKEEQRSLKRELLRAQEEVKRIQSVPLVIGQFLE  66

Query  352   MIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLL  531
             M+D N+ IVGSTTGSNYYVRILST+NRELLKPSAS+ALHRHSNALVD+LPPEADSSISLL
Sbjct  67    MVDTNSGIVGSTTGSNYYVRILSTLNRELLKPSASIALHRHSNALVDILPPEADSSISLL  126

Query  532   SQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTM  711
             +QSE+PDVTY DIGG DIQKQEIREAVELPLT H LYKQIGIDPPRGVLL+GPPGTGKTM
Sbjct  127   TQSERPDVTYQDIGGNDIQKQEIREAVELPLTQHALYKQIGIDPPRGVLLWGPPGTGKTM  186

Query  712   LAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATAR  891
             LAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATAR
Sbjct  187   LAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATAR  246

Query  892   FDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFP  1071
             FDAQTGADREVQRILMELLNQMDGF Q VNVKVIMATNRADTLDPALLRPGRLDRKIEFP
Sbjct  247   FDAQTGADREVQRILMELLNQMDGFHQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFP  306

Query  1072  LPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVI  1251
             LPDRRQKRLVFQ CTA MNL +EVDLEDYVSRPDKIS AEI+AICQEAGMHAVRKNRYVI
Sbjct  307   LPDRRQKRLVFQACTASMNLSEEVDLEDYVSRPDKISNAEISAICQEAGMHAVRKNRYVI  366

Query  1252  LPKDFEKGYRTNVKKPDTDFEFYK  1323
             LPKDFEKGY+ NVKK DTDF+FY+
Sbjct  367   LPKDFEKGYKANVKKSDTDFDFYQ  390



>ref|XP_007010402.1| Regulatory particle triple-A ATPase 3 isoform 1 [Theobroma cacao]
 gb|EOY19212.1| Regulatory particle triple-A ATPase 3 isoform 1 [Theobroma cacao]
Length=401

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/390 (91%), Positives = 367/390 (94%), Gaps = 5/390 (1%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRTD---ASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEE  246
             A+ MV++P P  +P F  P+TR+D   A A D +   EDDLY+RLKSLQRQLEFI+IQEE
Sbjct  3     ASAMVVEPKPLAEPPF--PSTRSDLGQALAVDPTGTEEDDLYSRLKSLQRQLEFIDIQEE  60

Query  247   YVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTI  426
             YVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTI
Sbjct  61    YVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTI  120

Query  427   NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE  606
             NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE
Sbjct  121   NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE  180

Query  607   AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY  786
             AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY
Sbjct  181   AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY  240

Query  787   LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF  966
             LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF
Sbjct  241   LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF  300

Query  967   DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVD  1146
             DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVD
Sbjct  301   DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVD  360

Query  1147  LEDYVSRPDKISAAEIAAICQEAGMHAVRK  1236
             LEDYVSRPDKISAAEIAAI QE  MHA++K
Sbjct  361   LEDYVSRPDKISAAEIAAIYQEEEMHAIQK  390



>ref|XP_002464184.1| hypothetical protein SORBIDRAFT_01g013750 [Sorghum bicolor]
 gb|EER91182.1| hypothetical protein SORBIDRAFT_01g013750 [Sorghum bicolor]
Length=420

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/381 (89%), Positives = 359/381 (94%), Gaps = 1/381 (0%)
 Frame = +1

Query  184   DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQ  363
             D Y   KSL+R  EF+EIQE+YVKDEL+NLRRE LR  EEVKR ++ PL IGQFMEM+D 
Sbjct  40    DFYCHYKSLRRHHEFLEIQEDYVKDELRNLRREELRGAEEVKRCRATPLEIGQFMEMVDA  99

Query  364   NNSIVG-STTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             ++ IV  +TTG ++YVR+LSTI RELLKPSASVALHRHS+ALVDVLPPEADSSISLL  S
Sbjct  100   DHGIVAPTTTGGSFYVRVLSTIGRELLKPSASVALHRHSHALVDVLPPEADSSISLLGSS  159

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKP+VTY+DIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK
Sbjct  160   EKPNVTYSDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  219

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA
Sbjct  220   AVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  279

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  280   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  339

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRLVFQVCTAKMNL DEVDLEDYV RPDKISAA+IAAICQEAGMHAVRKNRYVILPK
Sbjct  340   RRQKRLVFQVCTAKMNLSDEVDLEDYVCRPDKISAADIAAICQEAGMHAVRKNRYVILPK  399

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGYRTNVKKP+TDF+FYK
Sbjct  400   DFEKGYRTNVKKPETDFDFYK  420



>ref|XP_002947071.1| 26S proteasome regulatory complex [Volvox carteri f. nagariensis]
 gb|EFJ51661.1| 26S proteasome regulatory complex [Volvox carteri f. nagariensis]
Length=416

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/386 (88%), Positives = 363/386 (94%), Gaps = 3/386 (1%)
 Frame = +1

Query  175   AEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEM  354
             A++DLY  LK+LQRQLEF+EIQEEY+K+E KNL+RE LRAQEEVKRIQSVPLVIGQF+EM
Sbjct  31    ADEDLYTTLKNLQRQLEFLEIQEEYIKEEQKNLKRELLRAQEEVKRIQSVPLVIGQFLEM  90

Query  355   IDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLS  534
             +D N+ IVGSTTGS Y+VRILST+NRELLKPSASVALHRHSNALVD+LPPEADSSISLL 
Sbjct  91    VDANSGIVGSTTGSTYFVRILSTLNRELLKPSASVALHRHSNALVDILPPEADSSISLLG  150

Query  535   QSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTML  714
             + E+PDVTY DIGG D+QKQEIREAVELPL   +LYKQIGIDPPRGVLLYGPPGTGKTML
Sbjct  151   EHERPDVTYQDIGGYDMQKQEIREAVELPLVQADLYKQIGIDPPRGVLLYGPPGTGKTML  210

Query  715   AKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARF  894
             AKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARF
Sbjct  211   AKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARF  270

Query  895   DAQTGADREVQRILMELLNQMDGFDQTVNVK---VIMATNRADTLDPALLRPGRLDRKIE  1065
             DAQTGADREVQRILMELLNQMDGFDQTVNVK   VIMATNRADTLDPALLRPGRLDRKIE
Sbjct  271   DAQTGADREVQRILMELLNQMDGFDQTVNVKASTVIMATNRADTLDPALLRPGRLDRKIE  330

Query  1066  FPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRY  1245
              P+PDRRQKRL+FQVCT+KMNL DEVDLEDYVSRPDKISAAEIAAICQEAGM AVRKNRY
Sbjct  331   LPVPDRRQKRLIFQVCTSKMNLSDEVDLEDYVSRPDKISAAEIAAICQEAGMLAVRKNRY  390

Query  1246  VILPKDFEKGYRTNVKKPDTDFEFYK  1323
             VILPKDFEKGY+ NVKK DT+F FY+
Sbjct  391   VILPKDFEKGYKANVKKSDTEFAFYQ  416



>ref|XP_003059548.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56680.1| predicted protein [Micromonas pusilla CCMP1545]
Length=422

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/383 (86%), Positives = 363/383 (95%), Gaps = 0/383 (0%)
 Frame = +1

Query  175   AEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEM  354
             AE+DLY RLK LQR+LEF+EIQEEYVKDE KNL+ E LRAQEEVKRIQ+VPLVIGQF+EM
Sbjct  40    AEEDLYTRLKELQRELEFVEIQEEYVKDEQKNLKIELLRAQEEVKRIQAVPLVIGQFLEM  99

Query  355   IDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLS  534
             +D+++ IV STTGSNYYVRILST+NRELLKPS+SVALHRHSNALVD+LPPEADSSISLL+
Sbjct  100   VDESSGIVSSTTGSNYYVRILSTLNRELLKPSSSVALHRHSNALVDILPPEADSSISLLT  159

Query  535   QSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTML  714
              +E+PDV Y+D+GG D+QKQEIREAVELPLTH +LY+QIGIDPPRGVLLYGPPGTGKTML
Sbjct  160   DAERPDVKYSDVGGMDVQKQEIREAVELPLTHFDLYRQIGIDPPRGVLLYGPPGTGKTML  219

Query  715   AKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARF  894
             AKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVD+IATARF
Sbjct  220   AKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDSIATARF  279

Query  895   DAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPL  1074
             DA TGADREVQRILMELLNQMDGFDQTVNVKVIMATNR DTLDPALLRPGRLDRKIE P 
Sbjct  280   DAHTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRHDTLDPALLRPGRLDRKIECPA  339

Query  1075  PDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVIL  1254
             PDRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAA+I +ICQEAG+ AVRKNRYV++
Sbjct  340   PDRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAADIRSICQEAGLQAVRKNRYVVM  399

Query  1255  PKDFEKGYRTNVKKPDTDFEFYK  1323
             PKDFEKGY+++V+KP  DFEFYK
Sbjct  400   PKDFEKGYKSSVRKPGDDFEFYK  422



>ref|XP_002502202.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63460.1| predicted protein [Micromonas sp. RCC299]
Length=420

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/389 (85%), Positives = 366/389 (94%), Gaps = 0/389 (0%)
 Frame = +1

Query  157   QDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVI  336
             +D   ++E+DLY+RLK LQR+LEF+EIQEEYVKDE KNL+ E LRAQEEVKRIQ+VPLVI
Sbjct  32    KDGPGESEEDLYSRLKELQRELEFVEIQEEYVKDEQKNLKIELLRAQEEVKRIQAVPLVI  91

Query  337   GQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADS  516
             GQF+EM+D+N  IV STTGSNYYVRILST+NRELLKPS+SVALHRHSNALVD+LPPEADS
Sbjct  92    GQFLEMVDENAGIVSSTTGSNYYVRILSTLNRELLKPSSSVALHRHSNALVDILPPEADS  151

Query  517   SISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPG  696
             SISLLS +E+PDV Y+D+GG D+QKQEIREAVELPLTH +LY+QIGIDPPRGVLLYGPPG
Sbjct  152   SISLLSDAERPDVKYSDVGGMDVQKQEIREAVELPLTHFDLYRQIGIDPPRGVLLYGPPG  211

Query  697   TGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDA  876
             TGKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVD+
Sbjct  212   TGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDS  271

Query  877   IATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDR  1056
             IATARFDA TGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDR
Sbjct  272   IATARFDAHTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDR  331

Query  1057  KIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRK  1236
             KIE P PDRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAA+I AICQEAG+ AVRK
Sbjct  332   KIECPAPDRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAADIRAICQEAGLQAVRK  391

Query  1237  NRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             NRYV++PKDFEKGY+++V+KP  +F FY+
Sbjct  392   NRYVVMPKDFEKGYKSSVRKPGDEFSFYQ  420



>ref|XP_008366215.1| PREDICTED: LOW QUALITY PROTEIN: 26S protease regulatory subunit 
6B homolog [Malus domestica]
Length=379

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/376 (91%), Positives = 355/376 (94%), Gaps = 4/376 (1%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRTDA---SAQDVSYDAEDDLYARLKSLQRQLEFIEIQEE  246
              + MVLDP P P+P   +P+ R+D    + Q  + D EDDLY+RLKS QRQLEFI+IQEE
Sbjct  3     GSAMVLDPKPLPEPPASIPSIRSDLQRYTEQSQASD-EDDLYSRLKSYQRQLEFIDIQEE  61

Query  247   YVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTI  426
             YVKDELKNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTI
Sbjct  62    YVKDELKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTI  121

Query  427   NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE  606
             NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTY+DIGGCDIQKQEIRE
Sbjct  122   NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYSDIGGCDIQKQEIRE  181

Query  607   AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY  786
             AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY
Sbjct  182   AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY  241

Query  787   LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF  966
             LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF
Sbjct  242   LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF  301

Query  967   DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVD  1146
             DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVD
Sbjct  302   DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVD  361

Query  1147  LEDYVSRPDKISAAEI  1194
             LEDYVSRPDKISAAE+
Sbjct  362   LEDYVSRPDKISAAEV  377



>ref|XP_004982342.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Setaria 
italica]
Length=418

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/382 (87%), Positives = 359/382 (94%), Gaps = 0/382 (0%)
 Frame = +1

Query  178   EDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMI  357
             EDDLY RLKSLQR LEF+EIQE+ VKDEL+NLRRE +R +EEVKR ++ PL IGQFMEM+
Sbjct  37    EDDLYGRLKSLQRALEFVEIQEDCVKDELRNLRREEVRMKEEVKRCRATPLEIGQFMEMV  96

Query  358   DQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQ  537
             D ++ IV  T+G ++YVR+LSTI RE LKPSASVAL RHS+ALVDVLPPEADSSISLL  
Sbjct  97    DADHGIVAPTSGGSFYVRVLSTIGREELKPSASVALDRHSHALVDVLPPEADSSISLLGS  156

Query  538   SEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA  717
             +EKP+VTYNDIGGCDIQKQEIREAVELPLT HELYKQIGIDPPRGVLL+GPPGTGKTMLA
Sbjct  157   AEKPNVTYNDIGGCDIQKQEIREAVELPLTQHELYKQIGIDPPRGVLLFGPPGTGKTMLA  216

Query  718   KAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD  897
             KAVA+HTTA+FIRV GSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD
Sbjct  217   KAVAHHTTASFIRVNGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD  276

Query  898   AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP  1077
             AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP
Sbjct  277   AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP  336

Query  1078  DRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILP  1257
             DRRQKRLVFQVCTAKMN+ DEVDLED++SRPDKISAA+I AICQEAGMHAVRKNRYVIL 
Sbjct  337   DRRQKRLVFQVCTAKMNMSDEVDLEDFISRPDKISAADITAICQEAGMHAVRKNRYVILQ  396

Query  1258  KDFEKGYRTNVKKPDTDFEFYK  1323
             KDFEKGYRTNVKKP+T+F+FYK
Sbjct  397   KDFEKGYRTNVKKPETEFDFYK  418



>gb|KJB78679.1| hypothetical protein B456_013G011900 [Gossypium raimondii]
Length=397

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/378 (90%), Positives = 355/378 (94%), Gaps = 5/378 (1%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRTDASAQ---DVSYDAEDDLYARLKSLQRQLEFIEIQEE  246
             A+ +V +P P+ +P F  PATR+D       D +   EDDLY RLKSLQRQLEFI+IQEE
Sbjct  3     ASAIVAEPKPSAEPPF--PATRSDLGQYPMVDPTGAEEDDLYCRLKSLQRQLEFIDIQEE  60

Query  247   YVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTI  426
             YVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTI
Sbjct  61    YVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTI  120

Query  427   NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE  606
             NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE
Sbjct  121   NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE  180

Query  607   AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY  786
             AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY
Sbjct  181   AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY  240

Query  787   LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF  966
             LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF
Sbjct  241   LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF  300

Query  967   DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVD  1146
             DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEVD
Sbjct  301   DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVD  360

Query  1147  LEDYVSRPDKISAAEIAA  1200
             LEDYVSRPDKISAAE+++
Sbjct  361   LEDYVSRPDKISAAEVSS  378



>ref|XP_001419562.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97855.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=417

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/403 (83%), Positives = 364/403 (90%), Gaps = 3/403 (1%)
 Frame = +1

Query  124   EVPATRTDASA---QDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRA  294
             ++PAT  +AS             DLYARLKSLQR+LE +EIQEEY+KDE KNL+ E LRA
Sbjct  15    QMPATHANASGATTTSEGSSTTTDLYARLKSLQRELELVEIQEEYIKDEQKNLKIELLRA  74

Query  295   QEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRH  474
             QEEVKRIQSVPLVIGQF+EM+D    I+ STTGSNYYVRILST+NRELLKPS+SVALHRH
Sbjct  75    QEEVKRIQSVPLVIGQFLEMVDAETGIISSTTGSNYYVRILSTLNRELLKPSSSVALHRH  134

Query  475   SNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIG  654
             SNALV++LPPEADSSISLLS +E+PDV Y+DIGG D+QKQEIREAVELPLTH +LY+QIG
Sbjct  135   SNALVEILPPEADSSISLLSDAERPDVKYSDIGGADVQKQEIREAVELPLTHFDLYRQIG  194

Query  655   IDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAK  834
             IDPPRGVLLYGPPGTGKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAK
Sbjct  195   IDPPRGVLLYGPPGTGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAK  254

Query  835   ENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRAD  1014
             ENAPAIIFIDEVD+IATARFDA TGADREVQRILMELLNQMDGFDQTVNVKVIMATNRAD
Sbjct  255   ENAPAIIFIDEVDSIATARFDAHTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRAD  314

Query  1015  TLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEI  1194
             TLDPALLRPGRLDRKIE P PDRRQKRLVFQVC  KM+L DEVDLEDYVSRPDKISAA+I
Sbjct  315   TLDPALLRPGRLDRKIECPHPDRRQKRLVFQVCVNKMSLSDEVDLEDYVSRPDKISAADI  374

Query  1195  AAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
              +ICQEAG+ AVRKNRYV+LPKDFE  Y+TNV+KPD DFEFY+
Sbjct  375   RSICQEAGLQAVRKNRYVVLPKDFEVAYKTNVRKPDNDFEFYR  417



>ref|XP_007510638.1| 26S protease regulatory subunit 6B [Bathycoccus prasinos]
 emb|CCO18171.1| 26S protease regulatory subunit 6B [Bathycoccus prasinos]
Length=414

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/380 (86%), Positives = 358/380 (94%), Gaps = 0/380 (0%)
 Frame = +1

Query  184   DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQ  363
             DLY R K+LQR+LEFI+IQEEYV+DE KNL+ E +RAQEEVKRIQSVPLVIGQF+EM+D+
Sbjct  35    DLYVRYKTLQRELEFIQIQEEYVRDEQKNLKIELMRAQEEVKRIQSVPLVIGQFLEMVDE  94

Query  364   NNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSE  543
             N+ IV STTGSNYYVRILST+NRELLKPS+SVALHRHSNALV +LPPEADSSISL+S +E
Sbjct  95    NSGIVSSTTGSNYYVRILSTLNRELLKPSSSVALHRHSNALVAILPPEADSSISLMSDAE  154

Query  544   KPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKA  723
             +PDVTY DIGG D+QKQE+REAVELPLTH +LY+QIGIDPPRGVL+YGPPGTGKTMLAKA
Sbjct  155   RPDVTYADIGGADVQKQEMREAVELPLTHFDLYRQIGIDPPRGVLMYGPPGTGKTMLAKA  214

Query  724   VANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQ  903
             VA+HT+AAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAP I+FIDEVD+IATARFDA 
Sbjct  215   VAHHTSAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPCIVFIDEVDSIATARFDAH  274

Query  904   TGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDR  1083
             TGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFP PDR
Sbjct  275   TGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPNPDR  334

Query  1084  RQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKD  1263
             RQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAA+I +ICQEAG+ AVRKNRYV++PKD
Sbjct  335   RQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAADIRSICQEAGLQAVRKNRYVVMPKD  394

Query  1264  FEKGYRTNVKKPDTDFEFYK  1323
             FEK Y+ +V+KP  DFEFYK
Sbjct  395   FEKAYKVSVRKPGDDFEFYK  414



>gb|KJB37073.1| hypothetical protein B456_006G188400 [Gossypium raimondii]
Length=384

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/379 (90%), Positives = 353/379 (93%), Gaps = 6/379 (2%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRTDAS---AQDVSYDA-EDDLYARLKSLQRQLEFIEIQE  243
             A+ +V +P  + +P F  PATRTD       D    A EDDLY+RLKSLQRQLEFI+IQE
Sbjct  3     ASTVVAEPKSSAEPPF--PATRTDLGKCLTMDPPLGADEDDLYSRLKSLQRQLEFIDIQE  60

Query  244   EYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILST  423
             EYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM++QNN IVGSTTGSNYYVRILST
Sbjct  61    EYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVNQNNGIVGSTTGSNYYVRILST  120

Query  424   INRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIR  603
             INRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIR
Sbjct  121   INRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIR  180

Query  604   EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK  783
             EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK
Sbjct  181   EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK  240

Query  784   YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG  963
             YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG
Sbjct  241   YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG  300

Query  964   FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEV  1143
             FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNL DEV
Sbjct  301   FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEV  360

Query  1144  DLEDYVSRPDKISAAEIAA  1200
             DLEDYVSRPDKISAAE+  
Sbjct  361   DLEDYVSRPDKISAAEVGC  379



>gb|ELT94669.1| hypothetical protein CAPTEDRAFT_159938 [Capitella teleta]
Length=418

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/409 (80%), Positives = 363/409 (89%), Gaps = 5/409 (1%)
 Frame = +1

Query  97    PNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLR  276
             P    +PS   P    D    DV     DDLY + K LQRQLEF+E+QEEY+KDE KNL+
Sbjct  15    PAGESRPSTSFPPPSQDTIGLDV-----DDLYVKYKKLQRQLEFLEVQEEYIKDEQKNLK  69

Query  277   REHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSAS  456
             +E+L AQEEVKRIQSVPLVIGQF+E +DQNN IVGSTTGSNYYVRILSTI+RELLKPSAS
Sbjct  70    KEYLHAQEEVKRIQSVPLVIGQFLEAVDQNNGIVGSTTGSNYYVRILSTIDRELLKPSAS  129

Query  457   VALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHE  636
             VALH+HSNALVDVLPPEADSSI++LS  EKPD+ Y DIGG DIQKQE+REAVELPLTH +
Sbjct  130   VALHKHSNALVDVLPPEADSSITMLSADEKPDICYADIGGMDIQKQEVREAVELPLTHFD  189

Query  637   LYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRD  816
             LYKQIGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRD
Sbjct  190   LYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRD  249

Query  817   VFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIM  996
             VFRLAKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQTVNVKVIM
Sbjct  250   VFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTVNVKVIM  309

Query  997   ATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDK  1176
             ATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T KMNL D+VDLED+++RPD+
Sbjct  310   ATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITGKMNLSDDVDLEDFIARPDR  369

Query  1177  ISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             IS A+I AICQEAGM AVR+NRYV+LPKDFEKGY+ N+KK +T+ EFYK
Sbjct  370   ISGADINAICQEAGMQAVRENRYVVLPKDFEKGYKNNIKKDETEHEFYK  418



>ref|XP_009046288.1| hypothetical protein LOTGIDRAFT_212332 [Lottia gigantea]
 gb|ESP02818.1| hypothetical protein LOTGIDRAFT_212332 [Lottia gigantea]
Length=418

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/391 (84%), Positives = 360/391 (92%), Gaps = 1/391 (0%)
 Frame = +1

Query  151   SAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPL  330
             +A  +S D ED LY + K LQRQLEF+E+QEEY+KDE KNL++E+L AQEEVKRIQSVPL
Sbjct  29    NADPLSVDMED-LYIKYKKLQRQLEFLEVQEEYIKDEQKNLKKEYLHAQEEVKRIQSVPL  87

Query  331   VIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEA  510
             VIGQF+E +DQNN IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEA
Sbjct  88    VIGQFLEAVDQNNGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEA  147

Query  511   DSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGP  690
             DSSI++LS  EKPD+ Y DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL++GP
Sbjct  148   DSSITMLSADEKPDIQYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMFGP  207

Query  691   PGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEV  870
             PG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+
Sbjct  208   PGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEI  267

Query  871   DAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRL  1050
             DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRL
Sbjct  268   DAIATKRFDAQTGADREVQRILLELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRL  327

Query  1051  DRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAV  1230
             DRKIEFPLPDRRQKRL+F   TAKMNL +EVDLEDYV+RPDKIS A+I AICQEAGM AV
Sbjct  328   DRKIEFPLPDRRQKRLIFSTITAKMNLSEEVDLEDYVARPDKISGADINAICQEAGMQAV  387

Query  1231  RKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             R+NRYV+L KDFEKGY+ N+KK +T+ EFYK
Sbjct  388   RENRYVVLAKDFEKGYKNNIKKDETEHEFYK  418



>ref|XP_005106028.1| PREDICTED: 26S protease regulatory subunit 6B-like [Aplysia californica]
Length=420

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/398 (82%), Positives = 360/398 (90%), Gaps = 0/398 (0%)
 Frame = +1

Query  130   PATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVK  309
             P T    ++ D      +DLY + K LQ+QLEF+E+QEEY+KDE KNL++E+L AQEEVK
Sbjct  23    PGTGLAGASGDPMNPDLEDLYVKYKKLQKQLEFLEVQEEYIKDEQKNLKKEYLHAQEEVK  82

Query  310   RIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALV  489
             RIQSVPLVIGQF+E +DQNN IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALV
Sbjct  83    RIQSVPLVIGQFLEAVDQNNGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALV  142

Query  490   DVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPR  669
             DVLPPEADSSI++L   EKPDVTY+DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPR
Sbjct  143   DVLPPEADSSITMLQADEKPDVTYSDIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPR  202

Query  670   GVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPA  849
             GVL++GPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPA
Sbjct  203   GVLMFGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPA  262

Query  850   IIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPA  1029
             IIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQTVNVKVIMATNRADTLDPA
Sbjct  263   IIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTVNVKVIMATNRADTLDPA  322

Query  1030  LLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQ  1209
             LLRPGRLDRKIEFPLPDRRQKRL+F   T KMNL DEVDLEDYV+RPDKIS A+I AICQ
Sbjct  323   LLRPGRLDRKIEFPLPDRRQKRLIFSTITGKMNLSDEVDLEDYVARPDKISGADINAICQ  382

Query  1210  EAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             EAGM AVR+NRYV+L KDFEKGY+ N+KK +T+ EFYK
Sbjct  383   EAGMQAVRENRYVVLAKDFEKGYKNNIKKDETEHEFYK  420



>ref|NP_001105252.1| 26S proteasome regulatory complex ATPase RPT3 [Zea mays]
 gb|AAS21759.1| 26S proteasome regulatory complex ATPase RPT3 [Zea mays]
Length=348

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/368 (90%), Positives = 341/368 (93%), Gaps = 20/368 (5%)
 Frame = +1

Query  220   LEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSN  399
             +EF+EIQEEYV                     QSVPLVIGQFMEM+D NN IVGSTTGSN
Sbjct  1     MEFVEIQEEYVN--------------------QSVPLVIGQFMEMVDGNNGIVGSTTGSN  40

Query  400   YYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGC  579
             YYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLL  SEKP+VTYNDIGGC
Sbjct  41    YYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLGSSEKPNVTYNDIGGC  100

Query  580   DIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRV  759
             DIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVA+HTTAAFIRV
Sbjct  101   DIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVAHHTTAAFIRV  160

Query  760   VGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILM  939
             VGSE VQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILM
Sbjct  161   VGSEGVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILM  220

Query  940   ELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTA  1119
             ELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTA
Sbjct  221   ELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTA  280

Query  1120  KMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKP  1299
             KMNL DEVDLEDYVSRPDKISAA+IAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKP
Sbjct  281   KMNLSDEVDLEDYVSRPDKISAADIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKP  340

Query  1300  DTDFEFYK  1323
             +TDF+FYK
Sbjct  341   ETDFDFYK  348



>gb|ERL88150.1| hypothetical protein D910_05538 [Dendroctonus ponderosae]
Length=410

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/398 (82%), Positives = 362/398 (91%), Gaps = 3/398 (1%)
 Frame = +1

Query  130   PATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVK  309
             PA  +    QD+  D ED LY + K LQ+ LEF+E+QEEY+KDE +NL++E+L AQEEVK
Sbjct  16    PAESSKQPLQDL--DTED-LYTKFKKLQQMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVK  72

Query  310   RIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALV  489
             RIQSVPLVIGQF+E +DQN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALV
Sbjct  73    RIQSVPLVIGQFLEAVDQNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALV  132

Query  490   DVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPR  669
             DVLPPEADSSIS+L   EKPDV+Y+DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPR
Sbjct  133   DVLPPEADSSISMLQADEKPDVSYSDIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPR  192

Query  670   GVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPA  849
             GVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PA
Sbjct  193   GVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPA  252

Query  850   IIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPA  1029
             IIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPA
Sbjct  253   IIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPA  312

Query  1030  LLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQ  1209
             LLRPGRLDRKIEFPLPDRRQKRLVF   T+KMNL +EVDLEDYV+RPDKIS A+I AICQ
Sbjct  313   LLRPGRLDRKIEFPLPDRRQKRLVFSTITSKMNLSEEVDLEDYVARPDKISGADINAICQ  372

Query  1210  EAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             EAGMHAVR+NRY++LPKDFEKGY+ N+KK +++ EFYK
Sbjct  373   EAGMHAVRENRYIVLPKDFEKGYKNNIKKDESEHEFYK  410



>gb|AEE62856.1| unknown [Dendroctonus ponderosae]
Length=410

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/398 (82%), Positives = 361/398 (91%), Gaps = 3/398 (1%)
 Frame = +1

Query  130   PATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVK  309
             PA  +    QD+  D ED LY + K LQ+ LEF+E+QEEY+KDE +NL++E+L AQEEVK
Sbjct  16    PAESSKQPLQDL--DTED-LYTKFKKLQQMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVK  72

Query  310   RIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALV  489
             RIQSVPLVIGQF+E +DQN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALV
Sbjct  73    RIQSVPLVIGQFLEAVDQNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALV  132

Query  490   DVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPR  669
             DVLPPEADSSIS+L   EKPDV+Y+DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPR
Sbjct  133   DVLPPEADSSISMLQADEKPDVSYSDIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPR  192

Query  670   GVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPA  849
             GVL+YGPPG GKTMLAKAVA+HTTA FIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PA
Sbjct  193   GVLMYGPPGCGKTMLAKAVAHHTTATFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPA  252

Query  850   IIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPA  1029
             IIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPA
Sbjct  253   IIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPA  312

Query  1030  LLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQ  1209
             LLRPGRLDRKIEFPLPDRRQKRLVF   T+KMNL +EVDLEDYV+RPDKIS A+I AICQ
Sbjct  313   LLRPGRLDRKIEFPLPDRRQKRLVFSTITSKMNLSEEVDLEDYVARPDKISGADINAICQ  372

Query  1210  EAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             EAGMHAVR+NRY++LPKDFEKGY+ N+KK +++ EFYK
Sbjct  373   EAGMHAVRENRYIVLPKDFEKGYKNNIKKDESEHEFYK  410



>gb|AII16486.1| 26S protease regulatory subunit 6B, partial [Paracyclopina nana]
Length=413

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/403 (80%), Positives = 364/403 (90%), Gaps = 5/403 (1%)
 Frame = +1

Query  115   PSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRA  294
             PS  + AT  D  + D+     DDLY++ K LQ+QLEFI++QEEY+KDE +NL++E+L A
Sbjct  16    PSINLAATDLDLKSADL-----DDLYSKYKKLQQQLEFIQVQEEYIKDEQRNLKKEYLHA  70

Query  295   QEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRH  474
             QEEVKRIQSVPLVIGQF+E +DQN  IVGSTTGSNYYVRILST++RELLKPSASVALH+H
Sbjct  71    QEEVKRIQSVPLVIGQFLEAVDQNTGIVGSTTGSNYYVRILSTLDRELLKPSASVALHKH  130

Query  475   SNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIG  654
             SNALVDVLPPEADSSIS+L   EKPDV+YNDIGG D+QKQE+REAVELPLTH +LYKQIG
Sbjct  131   SNALVDVLPPEADSSISMLQPDEKPDVSYNDIGGMDMQKQEMREAVELPLTHFDLYKQIG  190

Query  655   IDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAK  834
             IDPPRGVL+YGPPG GKTMLAKAVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLAK
Sbjct  191   IDPPRGVLMYGPPGCGKTMLAKAVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLAK  250

Query  835   ENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRAD  1014
             EN+PAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNR D
Sbjct  251   ENSPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRQD  310

Query  1015  TLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEI  1194
             TLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T++MNL +EVDLEDYV+RPD+IS A+I
Sbjct  311   TLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSRMNLSEEVDLEDYVARPDRISGADI  370

Query  1195  AAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
              AICQEAGM AVR+NRY++LPKDFEKGY+ N+KK +T+ EFYK
Sbjct  371   NAICQEAGMQAVRENRYIVLPKDFEKGYKNNIKKDETEHEFYK  413



>ref|XP_001846717.1| 26S protease regulatory subunit 6B [Culex quinquefasciatus]
 gb|EDS44446.1| 26S protease regulatory subunit 6B [Culex quinquefasciatus]
Length=409

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/393 (82%), Positives = 360/393 (92%), Gaps = 2/393 (1%)
 Frame = +1

Query  151   SAQDVSYDAE--DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSV  324
             S++D   D E  +DLY + K LQ+ LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSV
Sbjct  17    SSKDTPLDEESMEDLYTKYKKLQKMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSV  76

Query  325   PLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPP  504
             PLVIGQF+E +DQNN IVGSTTGSNY+VRILSTI+RELLKPSASVALH+HSNALVDVLPP
Sbjct  77    PLVIGQFLEAVDQNNGIVGSTTGSNYFVRILSTIDRELLKPSASVALHKHSNALVDVLPP  136

Query  505   EADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLY  684
             EADSSIS+L   EKP+V Y+DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+Y
Sbjct  137   EADSSISMLQADEKPEVQYSDIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMY  196

Query  685   GPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFID  864
             GPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIFID
Sbjct  197   GPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFID  256

Query  865   EVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPG  1044
             E+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPG
Sbjct  257   EIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPG  316

Query  1045  RLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMH  1224
             RLDRKIEFPLPDRRQKRL+F   TAKMNL ++VDLEDYV+RPDKIS A+I AICQEAGMH
Sbjct  317   RLDRKIEFPLPDRRQKRLIFSTITAKMNLSEDVDLEDYVARPDKISGADINAICQEAGMH  376

Query  1225  AVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             AVR+NRY++L KDFEKGY+ N+KK +T+ EFYK
Sbjct  377   AVRENRYIVLAKDFEKGYKNNIKKDETEHEFYK  409



>emb|CEI86955.1| Putative PRS6_MANSE 26S PROTEASE REGULATORY SUBUNIT 6B (ATPASE 
MS73) [Rhizopus microsporus]
Length=412

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/383 (84%), Positives = 356/383 (93%), Gaps = 0/383 (0%)
 Frame = +1

Query  175   AEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEM  354
             +E DLY +LK LQR +EFIE+QEEY+KDE KNL+RE +RAQEEVKRI+SVPLV+GQF+E 
Sbjct  30    SEKDLYVKLKKLQRDIEFIELQEEYIKDEQKNLKRELVRAQEEVKRIKSVPLVLGQFLEP  89

Query  355   IDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLS  534
             IDQ+  IVGSTTGSNY VRILSTI+RELLKPS+SVALHRHSNALVDVLPPEADSSI+LL 
Sbjct  90    IDQHTGIVGSTTGSNYVVRILSTIDRELLKPSSSVALHRHSNALVDVLPPEADSSIALLG  149

Query  535   QSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTML  714
               EKPDV+Y+D+GG DIQKQEIREAVELPLTH +LY+QIGIDPPRGVLLYGPPGTGKTML
Sbjct  150   ADEKPDVSYSDVGGLDIQKQEIREAVELPLTHFDLYRQIGIDPPRGVLLYGPPGTGKTML  209

Query  715   AKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARF  894
              KAVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLA+EN+P+I+FIDE+DAIAT RF
Sbjct  210   VKAVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLARENSPSIVFIDEIDAIATKRF  269

Query  895   DAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPL  1074
             DAQTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFP 
Sbjct  270   DAQTGADREVQRILLELLNQMDGFDQTSNVKVIMATNRADTLDPALLRPGRLDRKIEFPT  329

Query  1075  PDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVIL  1254
             PDRRQKRL+FQ  T+KMNL +EVDLED+VSRPDK+S AEIAAICQEAGMHAVRKNRYVIL
Sbjct  330   PDRRQKRLIFQTITSKMNLSEEVDLEDFVSRPDKLSGAEIAAICQEAGMHAVRKNRYVIL  389

Query  1255  PKDFEKGYRTNVKKPDTDFEFYK  1323
              KD EKGY+ NVKK D++FEFYK
Sbjct  390   SKDLEKGYKANVKKEDSNFEFYK  412



>gb|KFM81157.1| 26S protease regulatory subunit 6B, partial [Stegodyphus mimosarum]
Length=415

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/381 (85%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             DDLY + K LQRQLEF+E+QEEY+KDE KNL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  35    DDLYTKYKKLQRQLEFLEVQEEYIKDEQKNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  94

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
              N  IVGSTTGSNYYVRILSTI+RELLKPS+SVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  95    PNTGIVGSTTGSNYYVRILSTIDRELLKPSSSVALHKHSNALVDVLPPEADSSISMLRAD  154

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPDVTY DIGG DIQKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  155   EKPDVTYADIGGLDIQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  214

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLA+ENAPAIIFIDE+DAIAT RFDA
Sbjct  215   AVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLARENAPAIIFIDEIDAIATKRFDA  274

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  275   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  334

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   T +MNL DEVDLEDYV+RPDKIS A+I AICQEAGMHAVR+NRYV+L K
Sbjct  335   RRQKRLIFSTITTRMNLSDEVDLEDYVARPDKISGADINAICQEAGMHAVRENRYVVLAK  394

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK +++ EFYK
Sbjct  395   DFEKGYKNNIKKDESEHEFYK  415



>ref|XP_004364047.1| 26S protease regulatory subunit 6B [Capsaspora owczarzaki ATCC 
30864]
 gb|KJE92195.1| 26S protease regulatory subunit 6B [Capsaspora owczarzaki ATCC 
30864]
Length=402

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/383 (84%), Positives = 354/383 (92%), Gaps = 0/383 (0%)
 Frame = +1

Query  175   AEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEM  354
             +++DL+   K LQRQLEF++IQE+Y+KDE KNL+RE+LRAQEEVKRIQSVPLVIGQF+E 
Sbjct  20    SDEDLFLTYKRLQRQLEFLQIQEDYIKDEQKNLKREYLRAQEEVKRIQSVPLVIGQFLEA  79

Query  355   IDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLS  534
             ID N  IVG+TTGSNYYVRILST++RELLK SASVALH+HSNALV +LPPEADSSI +L 
Sbjct  80    IDHNTGIVGATTGSNYYVRILSTLDRELLKASASVALHKHSNALVAILPPEADSSIQMLG  139

Query  535   QSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTML  714
               EKPDV+Y DIGG DIQKQE+REAVELPLTHHELYKQIGIDPPRGVL++GPPGTGKTML
Sbjct  140   ADEKPDVSYGDIGGLDIQKQEMREAVELPLTHHELYKQIGIDPPRGVLMWGPPGTGKTML  199

Query  715   AKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARF  894
             AKAVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIFIDEVDAIAT RF
Sbjct  200   AKAVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFIDEVDAIATKRF  259

Query  895   DAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPL  1074
             DAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNRADTLDPALLRPGRLDRKIEFPL
Sbjct  260   DAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPL  319

Query  1075  PDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVIL  1254
             PDRRQKRL+F   T+KMNL DEVDLED++SRPDKIS AEI+AICQEAGM AVRKNRYV+L
Sbjct  320   PDRRQKRLIFTTITSKMNLSDEVDLEDFISRPDKISGAEISAICQEAGMQAVRKNRYVVL  379

Query  1255  PKDFEKGYRTNVKKPDTDFEFYK  1323
              KDFEKGY+ NV+K +TD EFYK
Sbjct  380   AKDFEKGYKNNVRKTETDHEFYK  402



>emb|CEG64923.1| Putative PRS6_MANSE 26S PROTEASE REGULATORY SUBUNIT 6B (ATPASE 
MS73) [Rhizopus microsporus]
Length=412

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/383 (84%), Positives = 355/383 (93%), Gaps = 0/383 (0%)
 Frame = +1

Query  175   AEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEM  354
             +E DLY +LK LQR +EFIE+QEEY+KDE KNL+RE +RAQEEVKRI+SVPLV+GQF+E 
Sbjct  30    SEKDLYVKLKKLQRDIEFIELQEEYIKDEQKNLKRELVRAQEEVKRIKSVPLVLGQFLEP  89

Query  355   IDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLS  534
             IDQ+  IVGSTTGSNY VRILSTI+RELLKPS+SVALHRHSNALVDVLPPEADSSI+LL 
Sbjct  90    IDQHTGIVGSTTGSNYVVRILSTIDRELLKPSSSVALHRHSNALVDVLPPEADSSIALLG  149

Query  535   QSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTML  714
               EKPDV Y+D+GG DIQKQEIREAVELPLTH +LY+QIGIDPPRGVLLYGPPGTGKTML
Sbjct  150   ADEKPDVAYSDVGGLDIQKQEIREAVELPLTHFDLYRQIGIDPPRGVLLYGPPGTGKTML  209

Query  715   AKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARF  894
              KAVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLA+EN+P+I+FIDE+DAIAT RF
Sbjct  210   VKAVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLARENSPSIVFIDEIDAIATKRF  269

Query  895   DAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPL  1074
             DAQTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFP 
Sbjct  270   DAQTGADREVQRILLELLNQMDGFDQTSNVKVIMATNRADTLDPALLRPGRLDRKIEFPT  329

Query  1075  PDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVIL  1254
             PDRRQKRL+FQ  T+KMNL +EVDLED+VSRPDK+S AEIAAICQEAGMHAVRKNRYVIL
Sbjct  330   PDRRQKRLIFQTITSKMNLSEEVDLEDFVSRPDKLSGAEIAAICQEAGMHAVRKNRYVIL  389

Query  1255  PKDFEKGYRTNVKKPDTDFEFYK  1323
              KD EKGY+ NVKK D++FEFYK
Sbjct  390   SKDLEKGYKANVKKEDSNFEFYK  412



>gb|ETN58492.1| 26S protease regulatory subunit 6b [Anopheles darlingi]
Length=412

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/391 (82%), Positives = 357/391 (91%), Gaps = 0/391 (0%)
 Frame = +1

Query  151   SAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPL  330
             SA  +    E+DLY + K LQ+ LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPL
Sbjct  22    SANPLEEATEEDLYIKYKKLQKMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPL  81

Query  331   VIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEA  510
             VIGQF+E +DQN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEA
Sbjct  82    VIGQFLEAVDQNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEA  141

Query  511   DSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGP  690
             DSSIS+L   EKPDV Y+DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGP
Sbjct  142   DSSISMLQADEKPDVQYSDIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGP  201

Query  691   PGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEV  870
             PG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIFIDE+
Sbjct  202   PGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFIDEI  261

Query  871   DAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRL  1050
             DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRL
Sbjct  262   DAIATKRFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRL  321

Query  1051  DRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAV  1230
             DRKIEFPLPDRRQKRL+F   TAKMNL ++VDLED+V+RPDKIS A+I AICQEAGMHAV
Sbjct  322   DRKIEFPLPDRRQKRLIFSTITAKMNLSEDVDLEDFVARPDKISGADINAICQEAGMHAV  381

Query  1231  RKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             R+NRY++L KDFEKGY+ N+KK +T+ EFYK
Sbjct  382   RENRYIVLAKDFEKGYKNNIKKDETEHEFYK  412



>ref|XP_011441086.1| PREDICTED: 26S protease regulatory subunit 6B isoform X2 [Crassostrea 
gigas]
Length=418

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/398 (81%), Positives = 358/398 (90%), Gaps = 0/398 (0%)
 Frame = +1

Query  130   PATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVK  309
             P T   A+  D      +DLY + K LQRQLEF+E+QEEY+KDE KNL++E+L AQEEVK
Sbjct  21    PGTSQTATHLDPLGSDMEDLYVKYKKLQRQLEFLEVQEEYIKDEQKNLKKEYLHAQEEVK  80

Query  310   RIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALV  489
             RIQSVPLVIGQF+E +DQN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALV
Sbjct  81    RIQSVPLVIGQFLEAVDQNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALV  140

Query  490   DVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPR  669
             DVLPPEADSSI++L   EKPDV Y DIGG DIQKQE+REAVELPLTH +LYKQIGIDPPR
Sbjct  141   DVLPPEADSSITMLQADEKPDVQYADIGGMDIQKQEVREAVELPLTHFDLYKQIGIDPPR  200

Query  670   GVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPA  849
             GVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPA
Sbjct  201   GVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPA  260

Query  850   IIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPA  1029
             IIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQTVNVKVIMATNRADTLDPA
Sbjct  261   IIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTVNVKVIMATNRADTLDPA  320

Query  1030  LLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQ  1209
             LLRPGRLDRKIEFP+PDRRQKRL+F   T+KMN+ +EVDLEDYV+RPDKIS A+I AICQ
Sbjct  321   LLRPGRLDRKIEFPIPDRRQKRLIFSTITSKMNVSEEVDLEDYVARPDKISGADINAICQ  380

Query  1210  EAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             EAGM AVR+NRY++L KDFEKGY+ N+KK +T+ EFYK
Sbjct  381   EAGMQAVRENRYIVLAKDFEKGYKNNIKKDETEHEFYK  418



>gb|KCW87587.1| hypothetical protein EUGRSUZ_B040322, partial [Eucalyptus grandis]
Length=370

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/343 (96%), Positives = 336/343 (98%), Gaps = 0/343 (0%)
 Frame = +1

Query  163   VSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQ  342
             V+   E+DLY+RLKSL+RQLEFI+IQEEYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQ
Sbjct  28    VAAAEEEDLYSRLKSLERQLEFIDIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQ  87

Query  343   FMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSI  522
             FMEM+DQNN IVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSI
Sbjct  88    FMEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSI  147

Query  523   SLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTG  702
             SLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTG
Sbjct  148   SLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTG  207

Query  703   KTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIA  882
             KTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIA
Sbjct  208   KTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIA  267

Query  883   TARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKI  1062
             TARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKI
Sbjct  268   TARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKI  327

Query  1063  EFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAE  1191
             EFPLPDRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAAE
Sbjct  328   EFPLPDRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAAE  370



>gb|ESA10100.1| hypothetical protein GLOINDRAFT_335580 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX56830.1| proteasome regulatory particle base subunit RPT3 [Rhizophagus 
irregularis DAOM 197198w]
Length=409

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/399 (81%), Positives = 360/399 (90%), Gaps = 3/399 (1%)
 Frame = +1

Query  127   VPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEV  306
             +P   T    +D++   E+DLY++LK LQR LEF+E+QEEY+KDE KNL+RE +RAQEEV
Sbjct  14    IPVITTSELLEDLT---EEDLYSKLKKLQRHLEFLELQEEYIKDEQKNLKRELIRAQEEV  70

Query  307   KRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNAL  486
             KRIQSVPLVIGQF+E IDQ+  IVGSTTGSNY VRILSTI+RELLKPS+SVALHRHSN+L
Sbjct  71    KRIQSVPLVIGQFLEPIDQHTGIVGSTTGSNYVVRILSTIDRELLKPSSSVALHRHSNSL  130

Query  487   VDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPP  666
             VDVLPPEADSSI++L   EKPDVTY+D+GG DIQKQEIREAVELPLTH +LY+QIGIDPP
Sbjct  131   VDVLPPEADSSIAMLGSDEKPDVTYSDVGGLDIQKQEIREAVELPLTHFDLYRQIGIDPP  190

Query  667   RGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAP  846
             RGVLLYGPPGTGKTML KAVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLA+EN+P
Sbjct  191   RGVLLYGPPGTGKTMLVKAVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLARENSP  250

Query  847   AIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDP  1026
             +IIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDP
Sbjct  251   SIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTSNVKVIMATNRADTLDP  310

Query  1027  ALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAIC  1206
             ALLRPGRLDRKIEFP PDRRQKRL+F   T+ MNL +EVDLED++SRPDK+S AEI AIC
Sbjct  311   ALLRPGRLDRKIEFPTPDRRQKRLIFSTITSNMNLSEEVDLEDFISRPDKLSGAEIHAIC  370

Query  1207  QEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             QEAGM AVRKNRYVIL KD EKGY+ NVKK DTDFEFYK
Sbjct  371   QEAGMQAVRKNRYVILNKDIEKGYKANVKKADTDFEFYK  409



>ref|XP_011441085.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Crassostrea 
gigas]
 gb|EKC24481.1| 26S protease regulatory subunit 6B [Crassostrea gigas]
Length=420

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/398 (81%), Positives = 358/398 (90%), Gaps = 0/398 (0%)
 Frame = +1

Query  130   PATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVK  309
             P T   A+  D      +DLY + K LQRQLEF+E+QEEY+KDE KNL++E+L AQEEVK
Sbjct  23    PGTSQTATHLDPLGSDMEDLYVKYKKLQRQLEFLEVQEEYIKDEQKNLKKEYLHAQEEVK  82

Query  310   RIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALV  489
             RIQSVPLVIGQF+E +DQN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALV
Sbjct  83    RIQSVPLVIGQFLEAVDQNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALV  142

Query  490   DVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPR  669
             DVLPPEADSSI++L   EKPDV Y DIGG DIQKQE+REAVELPLTH +LYKQIGIDPPR
Sbjct  143   DVLPPEADSSITMLQADEKPDVQYADIGGMDIQKQEVREAVELPLTHFDLYKQIGIDPPR  202

Query  670   GVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPA  849
             GVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPA
Sbjct  203   GVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPA  262

Query  850   IIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPA  1029
             IIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQTVNVKVIMATNRADTLDPA
Sbjct  263   IIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTVNVKVIMATNRADTLDPA  322

Query  1030  LLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQ  1209
             LLRPGRLDRKIEFP+PDRRQKRL+F   T+KMN+ +EVDLEDYV+RPDKIS A+I AICQ
Sbjct  323   LLRPGRLDRKIEFPIPDRRQKRLIFSTITSKMNVSEEVDLEDYVARPDKISGADINAICQ  382

Query  1210  EAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             EAGM AVR+NRY++L KDFEKGY+ N+KK +T+ EFYK
Sbjct  383   EAGMQAVRENRYIVLAKDFEKGYKNNIKKDETEHEFYK  420



>gb|KFB40496.1| hypothetical protein ZHAS_00008015 [Anopheles sinensis]
Length=412

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/383 (84%), Positives = 353/383 (92%), Gaps = 0/383 (0%)
 Frame = +1

Query  175   AEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEM  354
              E+DLY + K LQ+ LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E 
Sbjct  30    TEEDLYIKYKKLQKMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEA  89

Query  355   IDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLS  534
             +DQN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L 
Sbjct  90    VDQNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQ  149

Query  535   QSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTML  714
               EKPDV Y DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTML
Sbjct  150   ADEKPDVQYADIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTML  209

Query  715   AKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARF  894
             AKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIFIDE+DAIAT RF
Sbjct  210   AKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFIDEIDAIATKRF  269

Query  895   DAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPL  1074
             DAQTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPL
Sbjct  270   DAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPL  329

Query  1075  PDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVIL  1254
             PDRRQKRL+F   TAKMNL D+VDLED+V+RPDKIS A+I AICQEAGMHAVR+NRY++L
Sbjct  330   PDRRQKRLIFSTITAKMNLSDDVDLEDFVARPDKISGADINAICQEAGMHAVRENRYIVL  389

Query  1255  PKDFEKGYRTNVKKPDTDFEFYK  1323
              KDFEKGY+ N+KK +T+ EFYK
Sbjct  390   AKDFEKGYKNNIKKDETEHEFYK  412



>ref|XP_003436353.1| AGAP003008-PB [Anopheles gambiae str. PEST]
 ref|XP_311871.4| AGAP003008-PA [Anopheles gambiae str. PEST]
 gb|EAA44836.4| AGAP003008-PA [Anopheles gambiae str. PEST]
 gb|EGK96659.1| AGAP003008-PB [Anopheles gambiae str. PEST]
Length=412

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/382 (84%), Positives = 355/382 (93%), Gaps = 0/382 (0%)
 Frame = +1

Query  178   EDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMI  357
             E+DLY + K LQ+ LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +
Sbjct  31    EEDLYIKYKKLQKMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAV  90

Query  358   DQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQ  537
             DQN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L+ 
Sbjct  91    DQNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLNA  150

Query  538   SEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA  717
              EKPDV Y+DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLA
Sbjct  151   DEKPDVQYSDIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLA  210

Query  718   KAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD  897
             KAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIFIDE+DAIAT RFD
Sbjct  211   KAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFIDEIDAIATKRFD  270

Query  898   AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP  1077
             AQTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLP
Sbjct  271   AQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP  330

Query  1078  DRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILP  1257
             DRRQKRL+F   TAKMNL ++VDLED+V+RPDKIS A+I AICQEAGMHAVR+NRY++L 
Sbjct  331   DRRQKRLIFSTITAKMNLSEDVDLEDFVARPDKISGADINAICQEAGMHAVRENRYIVLA  390

Query  1258  KDFEKGYRTNVKKPDTDFEFYK  1323
             KDFEKGY+ N+KK +T+ EFYK
Sbjct  391   KDFEKGYKNNIKKDETEHEFYK  412



>ref|XP_009020773.1| hypothetical protein HELRODRAFT_82280, partial [Helobdella robusta]
 gb|ESO01061.1| hypothetical protein HELRODRAFT_82280, partial [Helobdella robusta]
Length=374

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/374 (85%), Positives = 350/374 (94%), Gaps = 0/374 (0%)
 Frame = +1

Query  202   KSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVG  381
             + LQ+QLEF+E+QEEY+KDE KNL++E+L AQEEVKRIQSVPLVIGQF+E +DQNN IVG
Sbjct  1     QKLQKQLEFLEVQEEYIKDEQKNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVDQNNGIVG  60

Query  382   STTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTY  561
             STTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSI++LS  EKPDV+Y
Sbjct  61    STTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSITMLSADEKPDVSY  120

Query  562   NDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTT  741
             +DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL++GPPG GKTMLAKAVA+HTT
Sbjct  121   SDIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMFGPPGCGKTMLAKAVAHHTT  180

Query  742   AAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADRE  921
             AAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDAQTGADRE
Sbjct  181   AAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADRE  240

Query  922   VQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLV  1101
             VQRIL+ELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRL+
Sbjct  241   VQRILLELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLI  300

Query  1102  FQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR  1281
             F   T KMNL D+VDLEDY+SRPDKIS A+I AICQEAGM AVR+NRYV+LPKDFEKGY+
Sbjct  301   FSTITGKMNLSDDVDLEDYISRPDKISGADINAICQEAGMQAVRENRYVVLPKDFEKGYK  360

Query  1282  TNVKKPDTDFEFYK  1323
              N KK + + EFYK
Sbjct  361   NNTKKDEQEHEFYK  374



>ref|XP_003426762.1| PREDICTED: 26S protease regulatory subunit 6B isoform X2 [Nasonia 
vitripennis]
Length=412

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/381 (83%), Positives = 351/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY + K LQR LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  32    EDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  91

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  92    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQAD  151

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPD+ Y+DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  152   EKPDILYSDIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  211

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIF+DE+DAIAT RFDA
Sbjct  212   AVARHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFVDEIDAIATKRFDA  271

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  272   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  331

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   T KMNL +EVDLEDYV+RPDKIS A+I AICQEAGMHAVR+NRY++L K
Sbjct  332   RRQKRLIFSTITTKMNLSEEVDLEDYVARPDKISGADINAICQEAGMHAVRENRYIVLAK  391

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK +++ EFYK
Sbjct  392   DFEKGYKNNIKKDESEHEFYK  412



>ref|XP_004536707.1| PREDICTED: 26S protease regulatory subunit 6B-like [Ceratitis 
capitata]
Length=409

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/381 (84%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             DDLY R K LQ+ LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  29    DDLYVRYKKLQKTLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  88

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  89    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQPD  148

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPDV+Y DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  149   EKPDVSYADIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  208

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  209   AVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  268

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  269   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  328

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   T+KMNL D+VDLED+V+RPDKIS A+I AICQEAGMHAVR+NRY++L K
Sbjct  329   RRQKRLIFSTITSKMNLSDDVDLEDFVARPDKISGADINAICQEAGMHAVRENRYIVLGK  388

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK + + EFYK
Sbjct  389   DFEKGYKNNIKKDEQEHEFYK  409



>gb|EIE86992.1| 26S protease regulatory subunit 6B [Rhizopus delemar RA 99-880]
Length=412

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/383 (84%), Positives = 355/383 (93%), Gaps = 0/383 (0%)
 Frame = +1

Query  175   AEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEM  354
             +E DLY +LK LQR +EFIE+QEEY+KDE KNL+RE +RAQEEVKRI+SVPLV+GQF+E 
Sbjct  30    SERDLYVKLKKLQRDIEFIELQEEYIKDEQKNLKRELVRAQEEVKRIKSVPLVLGQFLEP  89

Query  355   IDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLS  534
             IDQ+  IVGSTTGSNY VRILSTI+RELLKPS+SVALHRHSNALVDVLPPEADSSI+LL 
Sbjct  90    IDQHTGIVGSTTGSNYVVRILSTIDRELLKPSSSVALHRHSNALVDVLPPEADSSIALLG  149

Query  535   QSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTML  714
               EKPDV Y+D+GG DIQKQEIREAVELPLTH +LY+QIGIDPPRGVLLYGPPGTGKTML
Sbjct  150   ADEKPDVAYSDVGGLDIQKQEIREAVELPLTHFDLYRQIGIDPPRGVLLYGPPGTGKTML  209

Query  715   AKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARF  894
              KAVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLA+EN+P+I+FIDE+DAIAT RF
Sbjct  210   VKAVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLARENSPSIVFIDEIDAIATKRF  269

Query  895   DAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPL  1074
             DAQTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFP 
Sbjct  270   DAQTGADREVQRILLELLNQMDGFDQTSNVKVIMATNRADTLDPALLRPGRLDRKIEFPT  329

Query  1075  PDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVIL  1254
             PDRRQKRL+FQ  T+KMNL +EVDLED+VSRPDK+S AEIAAICQEAGMHAVRKNRYVIL
Sbjct  330   PDRRQKRLIFQTVTSKMNLSEEVDLEDFVSRPDKLSGAEIAAICQEAGMHAVRKNRYVIL  389

Query  1255  PKDFEKGYRTNVKKPDTDFEFYK  1323
              KD EKGY+ NVKK D++F+FYK
Sbjct  390   SKDLEKGYKANVKKEDSNFDFYK  412



>dbj|BAN21086.1| 26S protease regulatory subunit 6b [Riptortus pedestris]
Length=415

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/391 (82%), Positives = 359/391 (92%), Gaps = 1/391 (0%)
 Frame = +1

Query  154   AQDVSYDAE-DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPL  330
              Q+++ D++  DL+ + K LQRQLEF+ +QEEY+KDE +NL++E+L AQEEVKRIQSVPL
Sbjct  25    GQNLNDDSDTSDLFTKFKKLQRQLEFLAVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPL  84

Query  331   VIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEA  510
             VIGQF+E +DQN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEA
Sbjct  85    VIGQFLEAVDQNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEA  144

Query  511   DSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGP  690
             DSSIS+L   EKPDV Y+DIGG D+QKQEIREAVELPLTH ELY+QIGIDPPRGVL+YGP
Sbjct  145   DSSISMLQADEKPDVQYSDIGGMDMQKQEIREAVELPLTHFELYRQIGIDPPRGVLMYGP  204

Query  691   PGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEV  870
             PG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+
Sbjct  205   PGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEI  264

Query  871   DAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRL  1050
             DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRL
Sbjct  265   DAIATKRFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRL  324

Query  1051  DRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAV  1230
             DRKIEFPLPDRRQKRLVF   TAKMNL +EVDLEDYV+RPD++S A+I AICQEAGMHAV
Sbjct  325   DRKIEFPLPDRRQKRLVFSTITAKMNLSEEVDLEDYVARPDRVSGADINAICQEAGMHAV  384

Query  1231  RKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             R+NRY++L KDFEKGY+ N+KK +++ EFYK
Sbjct  385   RENRYIVLAKDFEKGYKNNIKKDESEHEFYK  415



>gb|EIE77945.1| 26S protease regulatory subunit 6B [Rhizopus delemar RA 99-880]
Length=412

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/383 (84%), Positives = 355/383 (93%), Gaps = 0/383 (0%)
 Frame = +1

Query  175   AEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEM  354
             +E DLY +LK LQR +EFIE+QEEY+KDE KNL+RE +RAQEEVKRI+SVPLV+GQF+E 
Sbjct  30    SEKDLYVKLKKLQRDIEFIELQEEYIKDEQKNLKRELVRAQEEVKRIKSVPLVLGQFLEP  89

Query  355   IDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLS  534
             IDQ+  IVGSTTGSNY VRILSTI+RELLKPS+SVALHRHSNALVDVLPPEADSSI+LL 
Sbjct  90    IDQHTGIVGSTTGSNYVVRILSTIDRELLKPSSSVALHRHSNALVDVLPPEADSSIALLG  149

Query  535   QSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTML  714
               EKPDV Y+D+GG DIQKQEIREAVELPLTH +LY+QIGIDPPRGVLLYGPPGTGKTML
Sbjct  150   ADEKPDVAYSDVGGLDIQKQEIREAVELPLTHFDLYRQIGIDPPRGVLLYGPPGTGKTML  209

Query  715   AKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARF  894
              KAVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLA+EN+P+I+FIDE+DAIAT RF
Sbjct  210   VKAVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLARENSPSIVFIDEIDAIATKRF  269

Query  895   DAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPL  1074
             DAQTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFP 
Sbjct  270   DAQTGADREVQRILLELLNQMDGFDQTSNVKVIMATNRADTLDPALLRPGRLDRKIEFPT  329

Query  1075  PDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVIL  1254
             PDRRQKRL+FQ  T+KMNL +EVDLED+VSRPDK+S AEIAAICQEAGMHAVRKNRYVIL
Sbjct  330   PDRRQKRLIFQTITSKMNLSEEVDLEDFVSRPDKLSGAEIAAICQEAGMHAVRKNRYVIL  389

Query  1255  PKDFEKGYRTNVKKPDTDFEFYK  1323
              KD EKGY+ NVKK D++F+FYK
Sbjct  390   NKDLEKGYKANVKKEDSNFDFYK  412



>ref|XP_001992538.1| GH24150 [Drosophila grimshawi]
 gb|EDV92245.1| GH24150 [Drosophila grimshawi]
Length=408

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/381 (84%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             DDLY R K LQ+ LEFIE+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  28    DDLYVRYKKLQKTLEFIEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  87

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  88    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQPD  147

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPDV+Y DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  148   EKPDVSYADIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  207

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  208   AVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  267

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  268   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  327

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRLVF   T+KMNL ++VDLE++V+RPDKIS A+I AICQEAGMHAVR+NRY++L K
Sbjct  328   RRQKRLVFSTITSKMNLSEDVDLEEFVARPDKISGADINAICQEAGMHAVRENRYIVLAK  387

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK + + EFYK
Sbjct  388   DFEKGYKNNIKKDEQEHEFYK  408



>ref|XP_001652644.1| AAEL007297-PA [Aedes aegypti]
 gb|EAT41016.1| AAEL007297-PA [Aedes aegypti]
Length=460

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/391 (82%), Positives = 358/391 (92%), Gaps = 2/391 (1%)
 Frame = +1

Query  157   QDVSYDAED--DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPL  330
             +D + D  D  DLY + K LQ+ LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPL
Sbjct  70    KDTTLDELDMEDLYTKYKKLQKMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPL  129

Query  331   VIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEA  510
             VIGQF+E +DQNN IVGSTTGSNY+VRILSTI+RELLKPSASVALH+HSNALVDVLPPEA
Sbjct  130   VIGQFLEAVDQNNGIVGSTTGSNYFVRILSTIDRELLKPSASVALHKHSNALVDVLPPEA  189

Query  511   DSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGP  690
             DSSIS+L   EKP+V Y+DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGP
Sbjct  190   DSSISMLQADEKPEVQYSDIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGP  249

Query  691   PGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEV  870
             PG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIFIDE+
Sbjct  250   PGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFIDEI  309

Query  871   DAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRL  1050
             DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRL
Sbjct  310   DAIATKRFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRL  369

Query  1051  DRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAV  1230
             DRKIEFPLPDRRQKRL+F   TAKMNL ++VDLEDYV+RPDKIS A+I AICQEAGMHAV
Sbjct  370   DRKIEFPLPDRRQKRLIFSTITAKMNLSEDVDLEDYVARPDKISGADINAICQEAGMHAV  429

Query  1231  RKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             R+NRY++L KDFEKGY+ N+KK +T+ EFYK
Sbjct  430   RENRYIVLAKDFEKGYKNNIKKDETEHEFYK  460



>ref|XP_001599924.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Nasonia 
vitripennis]
Length=415

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/381 (83%), Positives = 351/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY + K LQR LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  35    EDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  94

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  95    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQAD  154

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPD+ Y+DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  155   EKPDILYSDIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  214

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIF+DE+DAIAT RFDA
Sbjct  215   AVARHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFVDEIDAIATKRFDA  274

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  275   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  334

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   T KMNL +EVDLEDYV+RPDKIS A+I AICQEAGMHAVR+NRY++L K
Sbjct  335   RRQKRLIFSTITTKMNLSEEVDLEDYVARPDKISGADINAICQEAGMHAVRENRYIVLAK  394

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK +++ EFYK
Sbjct  395   DFEKGYKNNIKKDESEHEFYK  415



>gb|KDR18744.1| 26S protease regulatory subunit 6B [Zootermopsis nevadensis]
Length=415

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/381 (83%), Positives = 353/381 (93%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY + K LQRQLEF+ +QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  35    EDLYTKYKKLQRQLEFLAVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  94

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  95    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQAD  154

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPDV Y+DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  155   EKPDVQYSDIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  214

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIFIDE+DAIAT RFDA
Sbjct  215   AVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFIDEIDAIATKRFDA  274

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  275   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  334

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRLVF   T++MNL +EVDLEDYV+RPD+IS A+I AICQEAGMHAVR+NRY++L K
Sbjct  335   RRQKRLVFSTITSRMNLSEEVDLEDYVARPDRISGADINAICQEAGMHAVRENRYIVLAK  394

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK +++ EFYK
Sbjct  395   DFEKGYKNNIKKDESEHEFYK  415



>ref|XP_967976.1| PREDICTED: 26S protease regulatory subunit 6B [Tribolium castaneum]
 gb|EFA02331.1| hypothetical protein TcasGA2_TC007999 [Tribolium castaneum]
Length=409

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/381 (83%), Positives = 354/381 (93%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY + K LQ+ LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  29    EDLYTKYKKLQQMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  88

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  89    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQAD  148

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPDV Y+DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  149   EKPDVQYSDIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  208

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIFIDE+DAIAT RFDA
Sbjct  209   AVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFIDEIDAIATKRFDA  268

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  269   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  328

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   T+KMNL +EVDLED+V+RPD+IS A+I AICQEAGMHAVR+NRY++LPK
Sbjct  329   RRQKRLIFSTITSKMNLSEEVDLEDFVARPDRISGADINAICQEAGMHAVRENRYIVLPK  388

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK +++ EFYK
Sbjct  389   DFEKGYKNNIKKDESEHEFYK  409



>ref|XP_002426965.1| 26S protease regulatory subunit 6B, putative [Pediculus humanus 
corporis]
 gb|EEB14227.1| 26S protease regulatory subunit 6B, putative [Pediculus humanus 
corporis]
Length=417

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/398 (81%), Positives = 359/398 (90%), Gaps = 1/398 (0%)
 Frame = +1

Query  130   PATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVK  309
             PA   +A      +D ED LY + K LQRQLEF+ +QEEY+KDE +NL++E+L AQEEVK
Sbjct  21    PAWGNNAIGGGDEFDQED-LYTKYKKLQRQLEFLAVQEEYIKDEQRNLKKEYLHAQEEVK  79

Query  310   RIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALV  489
             RIQSVPLVIGQF+E +DQN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALV
Sbjct  80    RIQSVPLVIGQFLEAVDQNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALV  139

Query  490   DVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPR  669
             DVLPPEADSSIS+L   EKPDV Y+DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPR
Sbjct  140   DVLPPEADSSISMLQADEKPDVQYSDIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPR  199

Query  670   GVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPA  849
             GVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PA
Sbjct  200   GVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPA  259

Query  850   IIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPA  1029
             IIFIDE+D+IAT RFDAQTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPA
Sbjct  260   IIFIDEIDSIATKRFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPA  319

Query  1030  LLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQ  1209
             LLRPGRLDRKIEFP+PDRRQKRL+F   TAKMNL +EVDLED+V+RPD+IS A+I AICQ
Sbjct  320   LLRPGRLDRKIEFPMPDRRQKRLIFSTITAKMNLSEEVDLEDFVARPDRISGADINAICQ  379

Query  1210  EAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             EAGMHAVR+NRY++L KDFEKGY+ N+KK +++ EFYK
Sbjct  380   EAGMHAVRENRYIVLAKDFEKGYKNNIKKEESEHEFYK  417



>ref|XP_005706946.1| AAA-type ATPase [Galdieria sulphuraria]
 gb|EME30426.1| AAA-type ATPase [Galdieria sulphuraria]
Length=413

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/389 (81%), Positives = 355/389 (91%), Gaps = 0/389 (0%)
 Frame = +1

Query  157   QDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVI  336
             + + Y   +D Y RLK+LQRQLEF+EIQEEY+KDE+KNL+RE+ +AQEEVKRIQSVPLVI
Sbjct  25    KSLEYSWSNDYYVRLKTLQRQLEFLEIQEEYIKDEMKNLKREYQQAQEEVKRIQSVPLVI  84

Query  337   GQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADS  516
             GQF+EMID N +IVGST GSNYYVR+LST+NRE LKP++SVALHRHSNALVDVLPPE+DS
Sbjct  85    GQFLEMIDANTAIVGSTAGSNYYVRVLSTVNREQLKPNSSVALHRHSNALVDVLPPESDS  144

Query  517   SISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPG  696
             +I++L   EKPDV+Y+DIGG DIQKQEIREAVELPLT  +LYKQIGIDPPRGVLLYGPPG
Sbjct  145   TIAMLQAGEKPDVSYSDIGGLDIQKQEIREAVELPLTDPDLYKQIGIDPPRGVLLYGPPG  204

Query  697   TGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDA  876
             TGKTMLAKAVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLA+ENAP I+FIDE+DA
Sbjct  205   TGKTMLAKAVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLARENAPCIVFIDEIDA  264

Query  877   IATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDR  1056
             IAT RFDAQTGADREVQRILMELLNQMDGFDQ+ N+KVIM TNR DTLDPALLRPGRLDR
Sbjct  265   IATKRFDAQTGADREVQRILMELLNQMDGFDQSTNIKVIMCTNRHDTLDPALLRPGRLDR  324

Query  1057  KIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRK  1236
             KIEFPLPDRRQKRL+FQV T KMNL +EVDLEDYVSRPDKIS A+IAAICQEAGM AVRK
Sbjct  325   KIEFPLPDRRQKRLIFQVVTGKMNLSEEVDLEDYVSRPDKISGADIAAICQEAGMQAVRK  384

Query  1237  NRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             NRY+ILPKDFEK Y+  V+K + +F FYK
Sbjct  385   NRYIILPKDFEKAYKIVVRKDEQEFAFYK  413



>gb|EPB90875.1| 26S protease regulatory subunit 6B [Mucor circinelloides f. circinelloides 
1006PhL]
 dbj|GAN07692.1| 26S protease regulatory subunit 6 [Mucor ambiguus]
Length=412

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/383 (84%), Positives = 354/383 (92%), Gaps = 0/383 (0%)
 Frame = +1

Query  175   AEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEM  354
             +E DLY +LK LQR LEFIE+QEEY+KDE KNL+RE +RAQEEVKRI+SVPLV+GQF+E 
Sbjct  30    SEGDLYVKLKKLQRDLEFIELQEEYIKDEQKNLKRELVRAQEEVKRIKSVPLVLGQFLEP  89

Query  355   IDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLS  534
             IDQ+  IVGSTTGSNY VRILSTI+RELLKPS+SVALHRHSNALVDVLPPEADSSISLL 
Sbjct  90    IDQHTGIVGSTTGSNYVVRILSTIDRELLKPSSSVALHRHSNALVDVLPPEADSSISLLG  149

Query  535   QSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTML  714
               E+P+V Y D+GG DIQKQEIREAVELPLTH +LY+QIGIDPPRGVLLYGPPGTGKTML
Sbjct  150   ADERPEVAYADVGGLDIQKQEIREAVELPLTHFDLYRQIGIDPPRGVLLYGPPGTGKTML  209

Query  715   AKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARF  894
              KAVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLA+EN+P+I+FIDE+DAIAT RF
Sbjct  210   VKAVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLARENSPSIVFIDEIDAIATKRF  269

Query  895   DAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPL  1074
             DAQTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFP 
Sbjct  270   DAQTGADREVQRILLELLNQMDGFDQTSNVKVIMATNRADTLDPALLRPGRLDRKIEFPT  329

Query  1075  PDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVIL  1254
             PDRRQKRL+FQ  T+KMNL +EVDLE++VSRPDK+S AEIAAICQEAGMHAVRKNRYVIL
Sbjct  330   PDRRQKRLIFQTITSKMNLSEEVDLEEFVSRPDKLSGAEIAAICQEAGMHAVRKNRYVIL  389

Query  1255  PKDFEKGYRTNVKKPDTDFEFYK  1323
              KD EKGY+ NVKK D++FEFYK
Sbjct  390   SKDLEKGYKANVKKEDSNFEFYK  412



>ref|XP_011187616.1| PREDICTED: 26S protease regulatory subunit 6B [Bactrocera cucurbitae]
Length=409

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/381 (83%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             DDLY R K LQ+ LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  29    DDLYVRYKKLQKTLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  88

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  89    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQPD  148

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPDV+Y DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  149   EKPDVSYADIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  208

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  209   AVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  268

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  269   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  328

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   T+KMNL ++VDLED+V+RPDKIS A+I AICQEAGMHAVR+NRY++L K
Sbjct  329   RRQKRLIFSTITSKMNLSEDVDLEDFVARPDKISGADINAICQEAGMHAVRENRYIVLGK  388

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK + + EFYK
Sbjct  389   DFEKGYKNNIKKDEQEHEFYK  409



>emb|CEP11541.1| hypothetical protein [Parasitella parasitica]
Length=412

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/383 (84%), Positives = 354/383 (92%), Gaps = 0/383 (0%)
 Frame = +1

Query  175   AEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEM  354
             +E DLY +LK LQR LEFIE+QEEY+KDE KNL+RE +RAQEEVKRI+SVPLV+GQF+E 
Sbjct  30    SEGDLYVKLKKLQRDLEFIELQEEYIKDEQKNLKRELVRAQEEVKRIKSVPLVLGQFLEP  89

Query  355   IDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLS  534
             IDQ+  IVGSTTGSNY VRILSTI+RELLKPS+SVALHRHSNALVDVLPPEADSSISLL 
Sbjct  90    IDQHTGIVGSTTGSNYVVRILSTIDRELLKPSSSVALHRHSNALVDVLPPEADSSISLLG  149

Query  535   QSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTML  714
               E+P+V Y D+GG DIQKQEIREAVELPLTH +LY+QIGIDPPRGVLLYGPPGTGKTML
Sbjct  150   ADERPEVAYADVGGLDIQKQEIREAVELPLTHFDLYRQIGIDPPRGVLLYGPPGTGKTML  209

Query  715   AKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARF  894
              KAVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLA+EN+P+I+FIDE+DAIAT RF
Sbjct  210   VKAVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLARENSPSIVFIDEIDAIATKRF  269

Query  895   DAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPL  1074
             DAQTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFP 
Sbjct  270   DAQTGADREVQRILLELLNQMDGFDQTSNVKVIMATNRADTLDPALLRPGRLDRKIEFPT  329

Query  1075  PDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVIL  1254
             PDRRQKRL+FQ  T+KMNL +EVDLE++VSRPDK+S AEIAAICQEAGMHAVRKNRYVIL
Sbjct  330   PDRRQKRLIFQTITSKMNLSEEVDLEEFVSRPDKLSGAEIAAICQEAGMHAVRKNRYVIL  389

Query  1255  PKDFEKGYRTNVKKPDTDFEFYK  1323
              KD EKGY+ NVKK D++FEFYK
Sbjct  390   SKDLEKGYKANVKKEDSNFEFYK  412



>ref|XP_012061865.1| PREDICTED: 26S protease regulatory subunit 6B [Atta cephalotes]
Length=415

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/381 (83%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY + K LQR LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  35    EDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  94

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  95    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQAD  154

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPD+ Y+DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  155   EKPDIQYSDIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  214

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIF+DE+DAIAT RFDA
Sbjct  215   AVARHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFVDEIDAIATKRFDA  274

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  275   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  334

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   TAKMNL +EVDLEDYV+RPD+IS A+I AICQEAGMHAVR+NRY++L K
Sbjct  335   RRQKRLIFSTITAKMNLSEEVDLEDYVARPDRISGADINAICQEAGMHAVRENRYIVLAK  394

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK +++ EFYK
Sbjct  395   DFEKGYKNNIKKDESEHEFYK  415



>ref|XP_002067350.1| GK16371 [Drosophila willistoni]
 gb|EDW78336.1| GK16371 [Drosophila willistoni]
Length=413

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/381 (84%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             DDLY R K LQ+ LEFIE+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  33    DDLYVRYKKLQKTLEFIEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  92

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  93    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQPD  152

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPDV+Y DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  153   EKPDVSYADIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  212

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  213   AVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  272

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  273   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  332

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRLVF   T+KMNL ++VDLE++V+RPDKIS A+I AICQEAGMHAVR+NRY++L K
Sbjct  333   RRQKRLVFSTITSKMNLSEDVDLEEFVARPDKISGADINAICQEAGMHAVRENRYIVLAK  392

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK + + EFYK
Sbjct  393   DFEKGYKNNIKKDEQEHEFYK  413



>ref|XP_002058291.1| GJ15572 [Drosophila virilis]
 gb|EDW66399.1| GJ15572 [Drosophila virilis]
Length=408

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/381 (84%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             DDLY R K LQ+ LEFIE+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  28    DDLYVRYKKLQKTLEFIEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  87

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  88    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQPD  147

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPDV+Y DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  148   EKPDVSYADIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  207

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  208   AVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  267

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  268   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  327

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRLVF   T+KMNL ++VDLE++V+RPDKIS A+I AICQEAGMHAVR+NRY++L K
Sbjct  328   RRQKRLVFTTITSKMNLSEDVDLEEFVARPDKISGADINAICQEAGMHAVRENRYIVLAK  387

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK + + EFYK
Sbjct  388   DFEKGYKNNIKKDEQEHEFYK  408



>ref|XP_011691070.1| PREDICTED: 26S protease regulatory subunit 6B [Wasmannia auropunctata]
Length=415

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/381 (83%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY + K LQR LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  35    EDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  94

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  95    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQAD  154

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPD+ Y+DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  155   EKPDIQYSDIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  214

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIF+DE+DAIAT RFDA
Sbjct  215   AVARHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFVDEIDAIATKRFDA  274

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  275   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  334

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   TAKMNL +EVDLEDYV+RPD+IS A+I AICQEAGMHAVR+NRY++L K
Sbjct  335   RRQKRLIFSTITAKMNLSEEVDLEDYVARPDRISGADINAICQEAGMHAVRENRYIVLAK  394

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK +++ EFYK
Sbjct  395   DFEKGYKNNIKKDESEHEFYK  415



>ref|XP_011881061.1| PREDICTED: 26S protease regulatory subunit 6B [Vollenhovia emeryi]
Length=415

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/381 (83%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY + K LQR LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  35    EDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  94

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  95    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQAD  154

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPD+ Y+DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  155   EKPDIQYSDIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  214

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIF+DE+DAIAT RFDA
Sbjct  215   AVARHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFVDEIDAIATKRFDA  274

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  275   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  334

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   TAKMNL +EVDLEDYV+RPD+IS A+I AICQEAGMHAVR+NRY++L K
Sbjct  335   RRQKRLIFSTITAKMNLSEEVDLEDYVARPDRISGADINAICQEAGMHAVRENRYIVLAK  394

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK +++ EFYK
Sbjct  395   DFEKGYKNNIKKDESEHEFYK  415



>ref|XP_011213714.1| PREDICTED: 26S protease regulatory subunit 6B [Bactrocera dorsalis]
Length=409

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/381 (83%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             DDLY R K LQ+ LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  29    DDLYVRYKKLQKTLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  88

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  89    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQPD  148

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPDV+Y DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  149   EKPDVSYADIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  208

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  209   AVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  268

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  269   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  328

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   T+KMNL ++VDLED+V+RPDKIS A+I AICQEAGMHAVR+NRY++L K
Sbjct  329   RRQKRLIFSTITSKMNLSEDVDLEDFVARPDKISGADINAICQEAGMHAVRENRYIVLGK  388

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK + + EFYK
Sbjct  389   DFEKGYKNNIKKDEQEHEFYK  409



>ref|XP_001963428.1| GF20295 [Drosophila ananassae]
 gb|EDV44504.1| GF20295 [Drosophila ananassae]
Length=413

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/381 (84%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             DDLY R K LQ+ LEFIE+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  33    DDLYVRYKKLQKTLEFIEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  92

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  93    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQPD  152

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPDV+Y DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  153   EKPDVSYADIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  212

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  213   AVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  272

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  273   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  332

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRLVF   T+KMNL ++VDLE++V+RPDKIS A+I AICQEAGMHAVR+NRY++L K
Sbjct  333   RRQKRLVFSTITSKMNLSEDVDLEEFVARPDKISGADINAICQEAGMHAVRENRYIVLAK  392

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK + + EFYK
Sbjct  393   DFEKGYKNNIKKDEQEHEFYK  413



>ref|XP_011343132.1| PREDICTED: 26S protease regulatory subunit 6B [Cerapachys biroi]
 gb|EZA51657.1| 26S protease regulatory subunit 6B [Cerapachys biroi]
Length=415

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/381 (83%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY + K LQR LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  35    EDLYTKYKKLQRLLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  94

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  95    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQAD  154

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPD+ Y+DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  155   EKPDIQYSDIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  214

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIF+DE+DAIAT RFDA
Sbjct  215   AVARHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFVDEIDAIATKRFDA  274

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  275   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  334

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   TAKMNL +EVDLEDYV+RPD+IS A+I AICQEAGMHAVR+NRY++L K
Sbjct  335   RRQKRLIFSTITAKMNLSEEVDLEDYVARPDRISGADINAICQEAGMHAVRENRYIVLAK  394

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK +++ EFYK
Sbjct  395   DFEKGYKNNIKKDESEHEFYK  415



>ref|XP_011262588.1| PREDICTED: 26S protease regulatory subunit 6B [Camponotus floridanus]
Length=415

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/381 (83%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY + K LQR LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  35    EDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  94

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  95    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQAD  154

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPD+ Y+DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  155   EKPDIQYSDIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  214

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIF+DE+DAIAT RFDA
Sbjct  215   AVARHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFVDEIDAIATKRFDA  274

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  275   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  334

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   TAKMNL +EVDLEDYV+RPD+IS A+I AICQEAGMHAVR+NRY++L K
Sbjct  335   RRQKRLIFSTITAKMNLSEEVDLEDYVARPDRISGADINAICQEAGMHAVRENRYIVLAK  394

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK +++ EFYK
Sbjct  395   DFEKGYKNNIKKDESEHEFYK  415



>emb|CDH54035.1| 26s protease regulatory subunit 6b [Lichtheimia corymbifera JMRC:FSU:9682]
Length=411

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/383 (84%), Positives = 352/383 (92%), Gaps = 0/383 (0%)
 Frame = +1

Query  175   AEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEM  354
             +E DLY +LK LQR LEF+ +QEEY+KDELKNL+RE LRAQEEVKRI+SVPLVIGQF+E 
Sbjct  29    SEKDLYVKLKKLQRNLEFLALQEEYIKDELKNLKRELLRAQEEVKRIKSVPLVIGQFLEP  88

Query  355   IDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLS  534
             +DQ+  IVGSTTG+N+ VRILSTI+RELLKPS+SVALHRHSNALVDVLPPEADSSI++L 
Sbjct  89    LDQHTGIVGSTTGNNFVVRILSTIDRELLKPSSSVALHRHSNALVDVLPPEADSSIAMLG  148

Query  535   QSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTML  714
               E+PDVTY D+GG DIQKQEIREAVELPLTH +LY+QIGIDPPRGVLLYGPPGTGKTML
Sbjct  149   ADERPDVTYQDVGGLDIQKQEIREAVELPLTHFDLYRQIGIDPPRGVLLYGPPGTGKTML  208

Query  715   AKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARF  894
              KAVA+HTTA  IRVVGSEFVQKYLGEGPRMVRDVFRLA+EN+PAIIFIDE+DAIAT RF
Sbjct  209   VKAVAHHTTANVIRVVGSEFVQKYLGEGPRMVRDVFRLARENSPAIIFIDEIDAIATKRF  268

Query  895   DAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPL  1074
             DAQTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFP 
Sbjct  269   DAQTGADREVQRILLELLNQMDGFDQTSNVKVIMATNRADTLDPALLRPGRLDRKIEFPT  328

Query  1075  PDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVIL  1254
             PDRRQKRL+F   T+KMNL +EVDLED+VSRPDK+S AEIAAICQEAGMHAVRKNRYVIL
Sbjct  329   PDRRQKRLIFSTITSKMNLSEEVDLEDFVSRPDKLSGAEIAAICQEAGMHAVRKNRYVIL  388

Query  1255  PKDFEKGYRTNVKKPDTDFEFYK  1323
              KD EKGY+ NVKK DT+FEFYK
Sbjct  389   SKDIEKGYKANVKKEDTNFEFYK  411



>ref|XP_003402114.1| PREDICTED: 26S protease regulatory subunit 6B-like isoform 1 
[Bombus terrestris]
Length=415

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/381 (83%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY + K LQR LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  35    EDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  94

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  95    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQAD  154

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPD+ Y+DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  155   EKPDIQYSDIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  214

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIF+DE+DAIAT RFDA
Sbjct  215   AVARHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFVDEIDAIATKRFDA  274

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  275   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  334

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   TAKMNL +EVDLEDYV+RPD+IS A+I AICQEAGMHAVR+NRY++L K
Sbjct  335   RRQKRLIFSTITAKMNLSEEVDLEDYVARPDRISGADINAICQEAGMHAVRENRYIVLAK  394

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK +++ EFYK
Sbjct  395   DFEKGYKNNIKKDESEHEFYK  415



>ref|XP_011141739.1| PREDICTED: 26S protease regulatory subunit 6B [Harpegnathos saltator]
Length=415

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/381 (83%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY + K LQR LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  35    EDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  94

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  95    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQAD  154

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPD+ Y+DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  155   EKPDIQYSDIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  214

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIF+DE+DAIAT RFDA
Sbjct  215   AVARHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFVDEIDAIATKRFDA  274

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  275   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  334

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   TAKMNL +EVDLEDYV+RPD+IS A+I AICQEAGMHAVR+NRY++L K
Sbjct  335   RRQKRLIFSTITAKMNLSEEVDLEDYVARPDRISGADINAICQEAGMHAVRENRYIVLAK  394

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK +++ EFYK
Sbjct  395   DFEKGYKNNIKKDESEHEFYK  415



>ref|XP_003489550.1| PREDICTED: 26S protease regulatory subunit 6B-like isoform 1 
[Bombus impatiens]
Length=415

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/381 (83%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY + K LQR LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  35    EDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  94

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  95    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQAD  154

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPD+ Y+DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  155   EKPDIQYSDIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  214

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIF+DE+DAIAT RFDA
Sbjct  215   AVARHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFVDEIDAIATKRFDA  274

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  275   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  334

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   TAKMNL +EVDLEDYV+RPD+IS A+I AICQEAGMHAVR+NRY++L K
Sbjct  335   RRQKRLIFSTITAKMNLSEEVDLEDYVARPDRISGADINAICQEAGMHAVRENRYIVLAK  394

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK +++ EFYK
Sbjct  395   DFEKGYKNNIKKDESEHEFYK  415



>ref|XP_001945593.1| PREDICTED: 26S protease regulatory subunit 6B [Acyrthosiphon 
pisum]
Length=414

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/380 (84%), Positives = 351/380 (92%), Gaps = 0/380 (0%)
 Frame = +1

Query  184   DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQ  363
             D Y+R K LQR LEF+ +QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +DQ
Sbjct  35    DHYSRYKRLQRYLEFLTVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVDQ  94

Query  364   NNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSE  543
             N  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   E
Sbjct  95    NTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQADE  154

Query  544   KPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKA  723
             KPD+ Y DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAKA
Sbjct  155   KPDIQYADIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKA  214

Query  724   VANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQ  903
             VA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIFIDE+DAIAT RFDAQ
Sbjct  215   VAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFIDEIDAIATKRFDAQ  274

Query  904   TGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDR  1083
             TGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDR
Sbjct  275   TGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDR  334

Query  1084  RQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKD  1263
             RQKRLVF   TAKMNL +EVDLEDYV+RPD+IS A+I AICQEAGMHAVR+NRY++LPKD
Sbjct  335   RQKRLVFSTITAKMNLSEEVDLEDYVARPDRISGADINAICQEAGMHAVRENRYIVLPKD  394

Query  1264  FEKGYRTNVKKPDTDFEFYK  1323
             FEKGY+ N+KK +++ EFYK
Sbjct  395   FEKGYKNNIKKDESEHEFYK  414



>ref|NP_001040338.1| 26S protease regulatory subunit 6B [Bombyx mori]
 gb|ABF51215.1| 26S protease regulatory subunit 6B [Bombyx mori]
Length=415

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/407 (79%), Positives = 364/407 (89%), Gaps = 2/407 (0%)
 Frame = +1

Query  109   PKPSFEVPATRTDASAQDVSYDA--EDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRRE  282
             P+   +V  ++  A A   S+D    +DLY + K LQR LEF+E+QEEY+KDE +NL++E
Sbjct  9     PEKDDQVTDSKGLAFAGPQSFDELESEDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKE  68

Query  283   HLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVA  462
             +L AQEEVKRIQSVPLVIGQF+E +DQN  IVGSTTGSNYYVRILSTI+RELLKPSASVA
Sbjct  69    YLHAQEEVKRIQSVPLVIGQFLEAVDQNTGIVGSTTGSNYYVRILSTIDRELLKPSASVA  128

Query  463   LHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELY  642
             LH+HSNALVDVLPPEADSSIS+L   EKPDV Y+DIGG D QKQEIREAVELPLTH ELY
Sbjct  129   LHKHSNALVDVLPPEADSSISMLQADEKPDVQYSDIGGMDTQKQEIREAVELPLTHVELY  188

Query  643   KQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVF  822
             +QIGI+PPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVF
Sbjct  189   RQIGIEPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVF  248

Query  823   RLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMAT  1002
             RLAKEN+PAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQT NVKVIMAT
Sbjct  249   RLAKENSPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMAT  308

Query  1003  NRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKIS  1182
             NRADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T KMNL DEVDLE++V+RPD++S
Sbjct  309   NRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITTKMNLSDEVDLEEFVARPDRVS  368

Query  1183  AAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
              A+I AICQEAGMHAVR+NRY++LPKDFEKGY+ N+KK ++++EFYK
Sbjct  369   GADINAICQEAGMHAVRENRYIVLPKDFEKGYKNNIKKDESEYEFYK  415



>ref|XP_001977168.1| GG18392 [Drosophila erecta]
 gb|EDV46095.1| GG18392 [Drosophila erecta]
Length=410

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/381 (84%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY R K LQR LEFIE+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  30    EDLYVRYKKLQRTLEFIEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  89

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  90    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQPD  149

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPDV+Y DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  150   EKPDVSYADIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  209

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  210   AVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  269

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  270   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  329

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRLVF   T+KMNL ++VDLE++V+RPDKIS A+I AICQEAGMHAVR+NRY++L K
Sbjct  330   RRQKRLVFSTITSKMNLSEDVDLEEFVARPDKISGADINAICQEAGMHAVRENRYIVLAK  389

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK + + EFYK
Sbjct  390   DFEKGYKNNIKKDEQEHEFYK  410



>ref|XP_011310104.1| PREDICTED: 26S protease regulatory subunit 6B [Fopius arisanus]
Length=416

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/381 (83%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY + K LQR LEF+++QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  36    EDLYTKYKKLQRMLEFLKVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  95

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  96    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQAD  155

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPD+ Y+DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  156   EKPDILYSDIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  215

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIF+DE+DAIAT RFDA
Sbjct  216   AVARHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFVDEIDAIATKRFDA  275

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  276   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  335

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   TAKMNL +EVDLEDYV+RPD+IS A+I AICQEAGMHAVR+NRY++L K
Sbjct  336   RRQKRLIFSTITAKMNLSEEVDLEDYVARPDRISGADINAICQEAGMHAVRENRYIVLAK  395

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK +++ EFYK
Sbjct  396   DFEKGYKNNIKKDESEHEFYK  416



>ref|XP_005179381.1| PREDICTED: 26S protease regulatory subunit 6B [Musca domestica]
Length=409

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/381 (83%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             DDLY R K LQ+ LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  29    DDLYVRYKKLQKTLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  88

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  89    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQPD  148

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPDV+Y DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  149   EKPDVSYADIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  208

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  209   AVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  268

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  269   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  328

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRLVF   T+KMNL ++VDLE++V+RPDKIS A+I AICQEAGMHAVR+NRY++L K
Sbjct  329   RRQKRLVFSTITSKMNLSEDVDLEEFVARPDKISGADINAICQEAGMHAVRENRYIVLSK  388

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK + + EFYK
Sbjct  389   DFEKGYKNNIKKDEQEHEFYK  409



>gb|KHN18648.1| 26S protease regulatory subunit 6B like [Glycine soja]
Length=326

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/326 (99%), Positives = 323/326 (99%), Gaps = 0/326 (0%)
 Frame = +1

Query  346   MEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSIS  525
             MEMIDQNN IVGST GSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSIS
Sbjct  1     MEMIDQNNGIVGSTAGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSIS  60

Query  526   LLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK  705
             LLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK
Sbjct  61    LLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK  120

Query  706   TMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIAT  885
             TMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIAT
Sbjct  121   TMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIAT  180

Query  886   ARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIE  1065
             ARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIE
Sbjct  181   ARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIE  240

Query  1066  FPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRY  1245
             FPLPDRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRY
Sbjct  241   FPLPDRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRY  300

Query  1246  VILPKDFEKGYRTNVKKPDTDFEFYK  1323
             VILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  301   VILPKDFEKGYRTNVKKPDTDFEFYK  326



>ref|XP_003251449.1| PREDICTED: 26S protease regulatory subunit 6B isoform 1 [Apis 
mellifera]
 ref|XP_003696539.1| PREDICTED: 26S protease regulatory subunit 6B-like [Apis florea]
 ref|XP_006622065.1| PREDICTED: 26S protease regulatory subunit 6B-like [Apis dorsata]
Length=415

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/381 (83%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY + K LQR LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  35    EDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  94

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  95    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQAD  154

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPD+ Y+DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  155   EKPDIQYSDIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  214

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIF+DE+DAIAT RFDA
Sbjct  215   AVARHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFVDEIDAIATKRFDA  274

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  275   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  334

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   TAKMNL +EVDLEDYV+RPD+IS A+I AICQEAGMHAVR+NRY++L K
Sbjct  335   RRQKRLIFSTITAKMNLSEEVDLEDYVARPDRISGADINAICQEAGMHAVRENRYIVLAK  394

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK +++ EFYK
Sbjct  395   DFEKGYKNNIKKDESEHEFYK  415



>ref|XP_003705364.1| PREDICTED: 26S protease regulatory subunit 6B [Megachile rotundata]
Length=415

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/381 (83%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY + K LQR LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  35    EDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  94

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  I+GSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  95    QNTGIIGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQAD  154

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPD+ Y+DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  155   EKPDIQYSDIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  214

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIF+DE+DAIAT RFDA
Sbjct  215   AVARHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFVDEIDAIATKRFDA  274

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  275   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  334

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   TAKMNL +EVDLEDYV+RPD+IS A+I AICQEAGMHAVR+NRY++L K
Sbjct  335   RRQKRLIFSTITAKMNLSEEVDLEDYVARPDRISGADINAICQEAGMHAVRENRYIVLAK  394

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK +++ EFYK
Sbjct  395   DFEKGYKNNIKKDESEHEFYK  415



>ref|XP_001355501.1| GA14216 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002027914.1| GL27100 [Drosophila persimilis]
 gb|EAL32560.1| GA14216 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW37646.1| GL27100 [Drosophila persimilis]
Length=413

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/381 (84%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             DDLY R K LQ+ LEFIE+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  33    DDLYVRYKKLQKTLEFIEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  92

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  93    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQPD  152

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPDV+Y DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  153   EKPDVSYADIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  212

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  213   AVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  272

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  273   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  332

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRLVF   T+KMNL ++VDLE++V+RPDKIS A+I AICQEAGMHAVR+NRY++L K
Sbjct  333   RRQKRLVFSTITSKMNLSEDVDLEEFVARPDKISGADINAICQEAGMHAVRENRYIVLAK  392

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK + + EFYK
Sbjct  393   DFEKGYKNNIKKDEQEHEFYK  413



>ref|XP_005719329.1| 26S proteasome ATP-dependent regulatory subunit [Chondrus crispus]
 emb|CDF39418.1| 26S proteasome ATP-dependent regulatory subunit [Chondrus crispus]
Length=413

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/384 (83%), Positives = 350/384 (91%), Gaps = 0/384 (0%)
 Frame = +1

Query  172   DAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFME  351
             D  +DLY + K+L+RQLEFIEIQE YVKDE+ +L+RE L AQEEVKRIQSVPLVIGQF+E
Sbjct  30    DNSEDLYVKYKTLERQLEFIEIQESYVKDEMNSLKRELLHAQEEVKRIQSVPLVIGQFLE  89

Query  352   MIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLL  531
             M+D N+ IVGSTTGSNY+VRILSTINRELLKPS+SVALHRHSNALVD+LPPEADS+IS++
Sbjct  90    MVDANSGIVGSTTGSNYFVRILSTINRELLKPSSSVALHRHSNALVDILPPEADSTISMM  149

Query  532   SQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTM  711
                EKPDV+Y+DIGG DIQKQEIREAVELPLTH  LY+QIGIDPPRGVLLYG PGTGKTM
Sbjct  150   GADEKPDVSYSDIGGLDIQKQEIREAVELPLTHAGLYEQIGIDPPRGVLLYGAPGTGKTM  209

Query  712   LAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATAR  891
             LAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLA+ENAPAIIFIDE+DAIAT R
Sbjct  210   LAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLARENAPAIIFIDEIDAIATKR  269

Query  892   FDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFP  1071
             FDAQTGADREVQRILMELLNQMDGFDQ  NVKVIM TNRADTLDPALLRPGRLDRKIEFP
Sbjct  270   FDAQTGADREVQRILMELLNQMDGFDQHSNVKVIMCTNRADTLDPALLRPGRLDRKIEFP  329

Query  1072  LPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVI  1251
             +PDRRQKRLVFQV T +MNL DEVDLE++VSRPDKIS AEIA+ICQEAGM AVRKNRYV+
Sbjct  330   MPDRRQKRLVFQVVTGRMNLADEVDLEEFVSRPDKISGAEIASICQEAGMQAVRKNRYVV  389

Query  1252  LPKDFEKGYRTNVKKPDTDFEFYK  1323
             L  DFE  Y+ NV+K D +F FYK
Sbjct  390   LQSDFETAYKANVQKDDEEFAFYK  413



>emb|CDS13275.1| Putative 26S protease regulatory subunit 6B [Absidia idahoensis 
var. thermophila]
Length=411

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/383 (83%), Positives = 352/383 (92%), Gaps = 0/383 (0%)
 Frame = +1

Query  175   AEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEM  354
             +E DLY +LK LQR LEF+ +QEEY+KDELKNL+RE LRAQEEVKRI+SVPLVIGQF+E 
Sbjct  29    SEKDLYVKLKKLQRNLEFLALQEEYIKDELKNLKRELLRAQEEVKRIKSVPLVIGQFLEP  88

Query  355   IDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLS  534
             +DQ+  IVGSTTG+N+ VRILSTI+RELLKPS+SVALHRHSNALVDVLPPEADSSI++L 
Sbjct  89    LDQHTGIVGSTTGNNFVVRILSTIDRELLKPSSSVALHRHSNALVDVLPPEADSSIAMLG  148

Query  535   QSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTML  714
               E+PDV+Y D+GG DIQKQEIREAVELPLTH +LY+QIGIDPPRGVLLYGPPGTGKTML
Sbjct  149   ADERPDVSYQDVGGLDIQKQEIREAVELPLTHFDLYRQIGIDPPRGVLLYGPPGTGKTML  208

Query  715   AKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARF  894
              KAVA+HTTA  IRVVGSEFVQKYLGEGPRMVRDVFRLA+EN+PAIIFIDE+DAIAT RF
Sbjct  209   VKAVAHHTTANVIRVVGSEFVQKYLGEGPRMVRDVFRLARENSPAIIFIDEIDAIATKRF  268

Query  895   DAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPL  1074
             DAQTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFP 
Sbjct  269   DAQTGADREVQRILLELLNQMDGFDQTSNVKVIMATNRADTLDPALLRPGRLDRKIEFPT  328

Query  1075  PDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVIL  1254
             PDRRQKRL+F   T+KMNL +EVDLED+VSRPDK+S AEIAAICQEAGMHAVRKNRYVIL
Sbjct  329   PDRRQKRLIFSTITSKMNLSEEVDLEDFVSRPDKLSGAEIAAICQEAGMHAVRKNRYVIL  388

Query  1255  PKDFEKGYRTNVKKPDTDFEFYK  1323
              KD EKGY+ NVKK DT+FEFYK
Sbjct  389   SKDIEKGYKANVKKEDTNFEFYK  411



>ref|XP_008550503.1| PREDICTED: 26S protease regulatory subunit 6B [Microplitis demolitor]
Length=415

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/381 (83%), Positives = 351/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY R K LQR LEF+++QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  35    EDLYTRYKKLQRMLEFLQVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  94

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  95    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQAD  154

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPD+ Y+DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  155   EKPDIQYSDIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  214

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIF+DE+DAIAT RFDA
Sbjct  215   AVARHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFVDEIDAIATKRFDA  274

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  275   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  334

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   T KMNL +EVDLEDYV+RPD+IS A+I AICQEAGMHAVR+NRY++L K
Sbjct  335   RRQKRLIFSTITTKMNLSEEVDLEDYVARPDRISGADINAICQEAGMHAVRENRYIVLAK  394

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK +++ EFYK
Sbjct  395   DFEKGYKNNIKKDESEHEFYK  415



>ref|NP_572686.1| regulatory particle triple-A ATPase 3, isoform A [Drosophila 
melanogaster]
 ref|NP_001285108.1| regulatory particle triple-A ATPase 3, isoform B [Drosophila 
melanogaster]
 gb|AAF08387.1|AF145306_1 26S proteasome regulatory complex subunit p48A [Drosophila melanogaster]
 gb|AAF48001.1| regulatory particle triple-A ATPase 3, isoform A [Drosophila 
melanogaster]
 gb|ACI46532.1| GH06151p [Drosophila melanogaster]
 emb|CBA35179.1| CG16916 protein [Drosophila melanogaster]
 emb|CBA35180.1| CG16916 protein [Drosophila melanogaster]
 emb|CBA35181.1| CG16916 protein [Drosophila melanogaster]
 emb|CBA35182.1| CG16916 protein [Drosophila melanogaster]
 emb|CBA35183.1| CG16916 protein [Drosophila melanogaster]
 emb|CBA35184.1| CG16916 protein [Drosophila melanogaster]
 emb|CBA35185.1| CG16916 protein [Drosophila melanogaster]
 emb|CBA35186.1| CG16916 protein [Drosophila melanogaster]
 emb|CBA35187.1| CG16916 protein [Drosophila melanogaster]
 emb|CBA35189.1| CG16916 protein [Drosophila melanogaster]
 gb|AHN59578.1| regulatory particle triple-A ATPase 3, isoform B [Drosophila 
melanogaster]
Length=413

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/381 (83%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY R K LQ+ LEFIE+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  33    EDLYVRYKKLQKTLEFIEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  92

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  93    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQPD  152

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPDV+Y DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  153   EKPDVSYADIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  212

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  213   AVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  272

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  273   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  332

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRLVF   T+KMNL ++VDLE++V+RPDKIS A+I AICQEAGMHAVR+NRY++L K
Sbjct  333   RRQKRLVFSTITSKMNLSEDVDLEEFVARPDKISGADINAICQEAGMHAVRENRYIVLAK  392

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK + + EFYK
Sbjct  393   DFEKGYKNNIKKDEQEHEFYK  413



>ref|XP_002608254.1| hypothetical protein BRAFLDRAFT_115078 [Branchiostoma floridae]
 gb|EEN64264.1| hypothetical protein BRAFLDRAFT_115078 [Branchiostoma floridae]
Length=417

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/409 (78%), Positives = 363/409 (89%), Gaps = 7/409 (2%)
 Frame = +1

Query  97    PNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLR  276
             P+P  +P   + +T ++        D  +DLY R K LQRQLEF+E+QEEY+KDE +NL+
Sbjct  16    PSPESRPGTGLSSTISEK-------DTSEDLYTRYKKLQRQLEFLEVQEEYIKDEQRNLK  68

Query  277   REHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSAS  456
             +E+L AQEEVKRIQSVPLVIGQF+E +DQN  IVGSTTGSNYYVRILSTI+RELLKPS+S
Sbjct  69    KEYLHAQEEVKRIQSVPLVIGQFLEAVDQNTGIVGSTTGSNYYVRILSTIDRELLKPSSS  128

Query  457   VALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHE  636
             VALH+HSNALVDVLPPEADSSI++LS  EKPDV Y DIGG D+QKQEIREAVELPLTH +
Sbjct  129   VALHKHSNALVDVLPPEADSSITMLSAEEKPDVAYADIGGMDMQKQEIREAVELPLTHFD  188

Query  637   LYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRD  816
             LY+QIGIDPPRGVL+YGPPG GKTMLAKAVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRD
Sbjct  189   LYQQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTASFIRVVGSEFVQKYLGEGPRMVRD  248

Query  817   VFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIM  996
             VFRLAKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQTVNVKVIM
Sbjct  249   VFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTVNVKVIM  308

Query  997   ATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDK  1176
             ATNRADTLDPALLRPGRLDRKIEFP+PDRRQKRL+FQ  T KMN+ +EVDLEDYV+RPD+
Sbjct  309   ATNRADTLDPALLRPGRLDRKIEFPMPDRRQKRLIFQTITGKMNMSEEVDLEDYVARPDR  368

Query  1177  ISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             IS A+I +I QEAGM AVR+NRY++L KDFEK Y+T +KK +T+ EFYK
Sbjct  369   ISGADINSIVQEAGMLAVRENRYIVLAKDFEKAYKTAIKKDETEHEFYK  417



>ref|XP_002100910.1| GE15910 [Drosophila yakuba]
 gb|EDX02018.1| GE15910 [Drosophila yakuba]
Length=413

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/381 (83%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY R K LQ+ LEFIE+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  33    EDLYVRYKKLQKTLEFIEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  92

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  93    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQPD  152

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPDV+Y DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  153   EKPDVSYADIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  212

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  213   AVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  272

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  273   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  332

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRLVF   T+KMNL ++VDLE++V+RPDKIS A+I AICQEAGMHAVR+NRY++L K
Sbjct  333   RRQKRLVFSTITSKMNLSEDVDLEEFVARPDKISGADINAICQEAGMHAVRENRYIVLAK  392

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK + + EFYK
Sbjct  393   DFEKGYKNNIKKDEQEHEFYK  413



>ref|XP_002130593.1| PREDICTED: 26S protease regulatory subunit 6B [Ciona intestinalis]
Length=416

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/408 (78%), Positives = 363/408 (89%), Gaps = 4/408 (1%)
 Frame = +1

Query  112   KPSFEVPATRTDASAQDV----SYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRR  279
             KP+   P +    + Q +      D  +DLY + K LQ+QLEF+ +QEEY+KDE+KNLR+
Sbjct  9     KPAIVTPESSRPGTVQSMLSTTEIDKIEDLYTKYKKLQKQLEFLGVQEEYIKDEMKNLRK  68

Query  280   EHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASV  459
             E+L AQEEVKRIQS+P+VIGQF+E +DQNN+IV STTGSNYYVRILSTI+RELLKP++SV
Sbjct  69    EYLHAQEEVKRIQSIPVVIGQFLEAVDQNNAIVLSTTGSNYYVRILSTIDRELLKPNSSV  128

Query  460   ALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHEL  639
             ALH+HSNALVDVLPPEADSSI++LS  EKPDV+Y+DIGG DIQKQE++EAVELPLTH EL
Sbjct  129   ALHKHSNALVDVLPPEADSSITMLSADEKPDVSYSDIGGMDIQKQEVKEAVELPLTHFEL  188

Query  640   YKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDV  819
             YKQIGIDPPRGVL++GPPG GKTMLAKAVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDV
Sbjct  189   YKQIGIDPPRGVLMFGPPGCGKTMLAKAVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDV  248

Query  820   FRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMA  999
             FRLAKEN+PAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQTVNVKVIMA
Sbjct  249   FRLAKENSPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTVNVKVIMA  308

Query  1000  TNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKI  1179
             TNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVF   T KMNL DEVDLEDYV+RPDKI
Sbjct  309   TNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITGKMNLSDEVDLEDYVARPDKI  368

Query  1180  SAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             + A+I AICQEAGM AVR+NRYV+L KDFEK Y+T +KK + + EFYK
Sbjct  369   TGADINAICQEAGMLAVRENRYVVLSKDFEKAYKTQMKKDEQEMEFYK  416



>emb|CDP04036.1| unnamed protein product [Coffea canephora]
Length=326

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/326 (99%), Positives = 323/326 (99%), Gaps = 0/326 (0%)
 Frame = +1

Query  346   MEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSIS  525
             MEMIDQNN IVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSIS
Sbjct  1     MEMIDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSIS  60

Query  526   LLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK  705
             LLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK
Sbjct  61    LLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK  120

Query  706   TMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIAT  885
             TMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIAT
Sbjct  121   TMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIAT  180

Query  886   ARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIE  1065
             ARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIE
Sbjct  181   ARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIE  240

Query  1066  FPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRY  1245
             FPLPDRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRY
Sbjct  241   FPLPDRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRY  300

Query  1246  VILPKDFEKGYRTNVKKPDTDFEFYK  1323
             VILPKDFEKGYR NVKKPDTDFEFYK
Sbjct  301   VILPKDFEKGYRANVKKPDTDFEFYK  326



>emb|CBA35188.1| CG16916 protein [Drosophila melanogaster]
Length=413

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/381 (83%), Positives = 351/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY R K LQ+ LEFIE+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  33    EDLYVRYKKLQKTLEFIEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  92

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  93    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQPD  152

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPDV+Y DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  153   EKPDVSYADIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  212

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  213   AVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  272

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  273   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  332

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRLVF   T+KMNL ++VDLE++V+RPDKIS A+I AICQEAGMHAVR+NRY++  K
Sbjct  333   RRQKRLVFSTITSKMNLSEDVDLEEFVARPDKISGADINAICQEAGMHAVRENRYIVWAK  392

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK + + EFYK
Sbjct  393   DFEKGYKNNIKKDEQEHEFYK  413



>ref|XP_011499440.1| PREDICTED: 26S protease regulatory subunit 6B [Ceratosolen solmsi 
marchali]
Length=415

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/381 (83%), Positives = 350/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY + K LQR LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  35    EDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  94

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  95    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQAD  154

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPD+ Y+DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  155   EKPDIQYSDIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  214

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIF+DE+DAIAT RFDA
Sbjct  215   AVARHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFVDEIDAIATKRFDA  274

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  275   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  334

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   T KMNL +EVDLEDYV+RPD+IS A+I AICQEAGMHAVR+NRY++L K
Sbjct  335   RRQKRLIFSTITTKMNLSEEVDLEDYVARPDRISGADINAICQEAGMHAVRENRYIVLAK  394

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEK Y+ N+KK +++ EFYK
Sbjct  395   DFEKSYKNNIKKDESEHEFYK  415



>emb|CAX70788.1| 26S proteasome regulatory subunit T3 [Schistosoma japonicum]
 emb|CAX70789.1| 26S proteasome regulatory subunit T3 [Schistosoma japonicum]
 emb|CAX75877.1| 26S proteasome regulatory subunit T3 [Schistosoma japonicum]
 emb|CAX75880.1| 26S proteasome regulatory subunit T3 [Schistosoma japonicum]
Length=415

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/382 (83%), Positives = 353/382 (92%), Gaps = 0/382 (0%)
 Frame = +1

Query  178   EDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMI  357
             E+DLY +LK L++Q+EFI++QE Y+KDE KNL++E+L AQEEVKRI+SVPLVIGQF+E +
Sbjct  34    EEDLYVKLKILKKQIEFIKVQENYIKDEQKNLKKEYLHAQEEVKRIKSVPLVIGQFLEAV  93

Query  358   DQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQ  537
             DQN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSI++L  
Sbjct  94    DQNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSITMLQA  153

Query  538   SEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLA  717
              EKPDV+Y DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLA
Sbjct  154   DEKPDVSYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLA  213

Query  718   KAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFD  897
             KAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFD
Sbjct  214   KAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFD  273

Query  898   AQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLP  1077
             AQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNRADTLDPALLRPGRLDRKIEFP+P
Sbjct  274   AQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPMP  333

Query  1078  DRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILP  1257
             DRRQKRL+F   T+KMNL D++DLEDYV+RPDKIS A+I AICQEAGM AVR+NRYV+L 
Sbjct  334   DRRQKRLIFSTITSKMNLSDDIDLEDYVARPDKISGADINAICQEAGMQAVRENRYVVLA  393

Query  1258  KDFEKGYRTNVKKPDTDFEFYK  1323
             KDFEKGY+ N+KK D + EFYK
Sbjct  394   KDFEKGYKNNLKKDDQELEFYK  415



>emb|CCD76272.1| putative 26s protease regulatory subunit 6b [Schistosoma mansoni]
Length=415

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/383 (82%), Positives = 355/383 (93%), Gaps = 0/383 (0%)
 Frame = +1

Query  175   AEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEM  354
             +E+DLY +LK L++Q+EFI++QE Y+KDE KNL++E+L AQEEVKRI+SVPLVIGQF+E 
Sbjct  33    SEEDLYVKLKILEKQIEFIQVQENYIKDEQKNLKKEYLHAQEEVKRIKSVPLVIGQFLEA  92

Query  355   IDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLS  534
             +DQ+  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSI++L 
Sbjct  93    VDQSTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSITMLQ  152

Query  535   QSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTML  714
               EKPDV+Y+DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTML
Sbjct  153   ADEKPDVSYSDIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTML  212

Query  715   AKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARF  894
             AKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RF
Sbjct  213   AKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRF  272

Query  895   DAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPL  1074
             DAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNRADTLDPALLRPGRLDRKIEFP+
Sbjct  273   DAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPM  332

Query  1075  PDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVIL  1254
             PDRRQKRL+F   T+KMNL D++DLEDYV+RPDKIS A+I AICQEAGM AVR+NRYV+L
Sbjct  333   PDRRQKRLIFSTVTSKMNLSDDIDLEDYVARPDKISGADINAICQEAGMQAVRENRYVVL  392

Query  1255  PKDFEKGYRTNVKKPDTDFEFYK  1323
              KDFEKGY+ ++KK + + EFYK
Sbjct  393   AKDFEKGYKNSLKKDEQELEFYK  415



>gb|EHJ67194.1| 26S protease regulatory subunit 6B [Danaus plexippus]
Length=415

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/407 (78%), Positives = 364/407 (89%), Gaps = 2/407 (0%)
 Frame = +1

Query  109   PKPSFEVPATRTDASAQDVSYDA--EDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRRE  282
             P+   +V  T+  + A   S+D    +DLY + K LQR LEF+E+QE+Y+KDE +NL++E
Sbjct  9     PEKDDQVTDTKGLSFAGPQSFDELESEDLYTKYKKLQRMLEFLEVQEDYIKDEQRNLKKE  68

Query  283   HLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVA  462
             +L AQEEVKRIQSVPLVIGQF+E +DQN  IVGSTTGSNYYVRILSTI+RELLKPSASVA
Sbjct  69    YLHAQEEVKRIQSVPLVIGQFLEAVDQNTGIVGSTTGSNYYVRILSTIDRELLKPSASVA  128

Query  463   LHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELY  642
             LH+HSNALVDVLPPEADSSIS+L   EKPDV Y+DIGG D QKQEIREAVELPLTH ELY
Sbjct  129   LHKHSNALVDVLPPEADSSISMLQADEKPDVQYSDIGGMDTQKQEIREAVELPLTHVELY  188

Query  643   KQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVF  822
             +QIGI+PPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVF
Sbjct  189   RQIGIEPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVF  248

Query  823   RLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMAT  1002
             RLAKEN+PAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQT NVKVIMAT
Sbjct  249   RLAKENSPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMAT  308

Query  1003  NRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKIS  1182
             NRADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   TAKMNL +EVDLE++V+RP+++S
Sbjct  309   NRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITAKMNLSEEVDLEEFVARPERVS  368

Query  1183  AAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
              A+I AICQEAGMHAVR+NRY++LPKDFEKGY+ N+KK + ++EFYK
Sbjct  369   GADINAICQEAGMHAVRENRYIVLPKDFEKGYKNNIKKDECEYEFYK  415



>ref|XP_009514770.1| hypothetical protein PHYSODRAFT_554008 [Phytophthora sojae]
 gb|EGZ27495.1| hypothetical protein PHYSODRAFT_554008 [Phytophthora sojae]
Length=405

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/386 (81%), Positives = 359/386 (93%), Gaps = 0/386 (0%)
 Frame = +1

Query  163   VSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQ  342
             V+ +++ DLYA+ KSL+R LEF++IQE Y+KDE+KNL+RE +RA+EEVKRIQSVPLVIGQ
Sbjct  19    VTIESKTDLYAKYKSLERHLEFLDIQEGYIKDEMKNLKRELIRAKEEVKRIQSVPLVIGQ  78

Query  343   FMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSI  522
             F+EM+D N  IVGST GSNYYVRILST++RE LKP++SVALHRHS+A+VDVLPPE+DSSI
Sbjct  79    FLEMVDANYGIVGSTAGSNYYVRILSTLDRERLKPNSSVALHRHSHAVVDVLPPESDSSI  138

Query  523   SLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTG  702
              ++  SE+PDV+Y+DIGG DIQKQE+REAVELPLTH +LYKQIG+DPPRGVL+YGPPGTG
Sbjct  139   QMMQMSERPDVSYSDIGGMDIQKQEVREAVELPLTHFDLYKQIGVDPPRGVLMYGPPGTG  198

Query  703   KTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIA  882
             KTMLAKAVAN TTAAFI VVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAI+FIDEVDAIA
Sbjct  199   KTMLAKAVANATTAAFISVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIVFIDEVDAIA  258

Query  883   TARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKI  1062
             T RFDAQTGADREVQRIL+ELLNQMDGFDQ  NVKVIMATNRADTLDPALLRPGRLDRKI
Sbjct  259   TKRFDAQTGADREVQRILLELLNQMDGFDQATNVKVIMATNRADTLDPALLRPGRLDRKI  318

Query  1063  EFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNR  1242
             EFPLPDRRQKRL++Q CTAKMNLGDEVDLEDYV+RP+KIS+A+IA+ICQEAG+ AVRKNR
Sbjct  319   EFPLPDRRQKRLIYQACTAKMNLGDEVDLEDYVNRPEKISSADIASICQEAGLQAVRKNR  378

Query  1243  YVILPKDFEKGYRTNVKKPDTDFEFY  1320
             YV+LPKDF+KGY+  +K+ DT FEFY
Sbjct  379   YVVLPKDFDKGYKNAIKRADTTFEFY  404



>ref|XP_008913005.1| 26S protease regulatory subunit 6B [Phytophthora parasitica INRA-310]
 gb|ETK75538.1| 26S protease regulatory subunit 6B [Phytophthora parasitica]
 gb|ETL28996.1| 26S protease regulatory subunit 6B [Phytophthora parasitica]
 gb|ETL82206.1| 26S protease regulatory subunit 6B [Phytophthora parasitica]
 gb|ETM35443.1| 26S protease regulatory subunit 6B [Phytophthora parasitica]
 gb|ETN01690.1| 26S protease regulatory subunit 6B [Phytophthora parasitica INRA-310]
 gb|ETO64020.1| 26S protease regulatory subunit 6B [Phytophthora parasitica P1976]
 gb|ETP05131.1| 26S protease regulatory subunit 6B [Phytophthora parasitica CJ01A1]
 gb|ETP33249.1| 26S protease regulatory subunit 6B [Phytophthora parasitica P10297]
Length=405

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/397 (79%), Positives = 361/397 (91%), Gaps = 0/397 (0%)
 Frame = +1

Query  130   PATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVK  309
             P T  +     V+ + + DLYA+ KSL+R LEF++IQE Y+KDE+KNL+RE +RA+EEVK
Sbjct  8     PVTADEEPLVPVTIETKTDLYAKYKSLERHLEFLDIQEGYIKDEMKNLKRELIRAKEEVK  67

Query  310   RIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALV  489
             RIQSVPLVIGQF+EM+D N  IVGST GSNYYVRILST++RE LKP++SVALHRHS+A+V
Sbjct  68    RIQSVPLVIGQFLEMVDANYGIVGSTAGSNYYVRILSTLDRERLKPNSSVALHRHSHAVV  127

Query  490   DVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPR  669
             DVLPPE+DSSI ++  SE+PDV+Y+DIGG DIQKQE+REAVELPLTH +LYKQIG+DPPR
Sbjct  128   DVLPPESDSSIQMMQMSERPDVSYSDIGGMDIQKQEVREAVELPLTHFDLYKQIGVDPPR  187

Query  670   GVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPA  849
             GVL+YGPPGTGKTMLAKAVAN TTAAFI VVGSEFVQKYLGEGPRMVRDVFRLAKEN+PA
Sbjct  188   GVLMYGPPGTGKTMLAKAVANATTAAFISVVGSEFVQKYLGEGPRMVRDVFRLAKENSPA  247

Query  850   IIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPA  1029
             I+FIDEVDAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ  NVKVIMATNRADTLDPA
Sbjct  248   IVFIDEVDAIATKRFDAQTGADREVQRILLELLNQMDGFDQATNVKVIMATNRADTLDPA  307

Query  1030  LLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQ  1209
             LLRPGRLDRKIEFPLPDRRQKRL++Q CTAKMNLGDEVDLEDYV+RP+KIS+A+IA+ICQ
Sbjct  308   LLRPGRLDRKIEFPLPDRRQKRLIYQACTAKMNLGDEVDLEDYVNRPEKISSADIASICQ  367

Query  1210  EAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFY  1320
             EAG+ AVRKNRYV+LPKDF+KGY+  +K+ DT FEFY
Sbjct  368   EAGLQAVRKNRYVVLPKDFDKGYKNAIKRADTTFEFY  404



>ref|XP_002158042.1| PREDICTED: 26S protease regulatory subunit 6B-like [Hydra vulgaris]
Length=395

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/390 (82%), Positives = 356/390 (91%), Gaps = 1/390 (0%)
 Frame = +1

Query  154   AQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLV  333
             AQ+   D  DDLY + K LQ+QLEF+E+QEEY+KDE KNL++E+L AQEEVKRIQSVPLV
Sbjct  7     AQNTDPDT-DDLYIKYKKLQKQLEFLEVQEEYIKDEQKNLKKEYLHAQEEVKRIQSVPLV  65

Query  334   IGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEAD  513
             IGQF+E IDQN  IVGSTTGSNYYVRILSTI+RELLKP++SVALH+HSNALVD+LPPEAD
Sbjct  66    IGQFLEAIDQNTGIVGSTTGSNYYVRILSTIDRELLKPNSSVALHKHSNALVDILPPEAD  125

Query  514   SSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPP  693
             SSI++L   EKP+V+Y DIGG DIQKQE+REAVELPLTH +LYKQIGIDPPRGVL+YGPP
Sbjct  126   SSIAMLQADEKPEVSYADIGGMDIQKQEMREAVELPLTHFQLYKQIGIDPPRGVLMYGPP  185

Query  694   GTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVD  873
             G GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+D
Sbjct  186   GCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEID  245

Query  874   AIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLD  1053
             AIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNRADTLDPALLRPGRLD
Sbjct  246   AIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLD  305

Query  1054  RKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVR  1233
             RKIEFP+PDRRQKRL+F   TAKMNL DEVDLEDY++RPDKIS A+I AI QEAGM AVR
Sbjct  306   RKIEFPMPDRRQKRLIFSTITAKMNLSDEVDLEDYIARPDKISGADINAIVQEAGMQAVR  365

Query  1234  KNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +NRYV+L KDFEKGY++N+KK + + +FYK
Sbjct  366   ENRYVVLAKDFEKGYKSNIKKDEQEHDFYK  395



>gb|KHN24720.1| 26S protease regulatory subunit 6B like [Glycine soja]
Length=326

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/326 (98%), Positives = 323/326 (99%), Gaps = 0/326 (0%)
 Frame = +1

Query  346   MEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSIS  525
             MEMIDQNN IVGST GSNYYVRILSTINRELLKPSASVALHRHSNALV+VLPPEADSSIS
Sbjct  1     MEMIDQNNGIVGSTAGSNYYVRILSTINRELLKPSASVALHRHSNALVEVLPPEADSSIS  60

Query  526   LLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK  705
             LLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK
Sbjct  61    LLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK  120

Query  706   TMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIAT  885
             TMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIAT
Sbjct  121   TMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIAT  180

Query  886   ARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIE  1065
             ARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIE
Sbjct  181   ARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIE  240

Query  1066  FPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRY  1245
             FPLPDRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAAEI+AICQEAGMHAVRKNRY
Sbjct  241   FPLPDRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAAEISAICQEAGMHAVRKNRY  300

Query  1246  VILPKDFEKGYRTNVKKPDTDFEFYK  1323
             VILPKDFEKGYRTNVKKPDT+FEFYK
Sbjct  301   VILPKDFEKGYRTNVKKPDTNFEFYK  326



>ref|XP_011401722.1| 26S protease regulatory subunit 6B-like protein [Auxenochlorella 
protothecoides]
 gb|KFM28677.1| 26S protease regulatory subunit 6B-like protein [Auxenochlorella 
protothecoides]
Length=415

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/416 (80%), Positives = 366/416 (88%), Gaps = 8/416 (2%)
 Frame = +1

Query  76    ATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVK  255
             A PM LD   T +P  E    R    A +V   A++DLY RLK+LQRQLEF+ IQEEY+K
Sbjct  8     ARPMDLD---TKEPGLET--GRDTGDALEV---ADEDLYPRLKALQRQLEFLGIQEEYIK  59

Query  256   DELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRE  435
             +E ++L+ E LRAQEEVKRIQ+VPLVIGQF+EM+D    IVGSTTGSNYYVRILST+NRE
Sbjct  60    EEQRSLKNELLRAQEEVKRIQAVPLVIGQFLEMVDPVTGIVGSTTGSNYYVRILSTLNRE  119

Query  436   LLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVE  615
             LLKPSASVA+HRHSNALVDVLPPEADS+IS++S +E+PDVTY DIGG D+QKQEIREAVE
Sbjct  120   LLKPSASVAMHRHSNALVDVLPPEADSTISVMSAAERPDVTYADIGGMDVQKQEIREAVE  179

Query  616   LPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGE  795
             LPLT   LY+QIGIDPPRGVLLYGPPGTGKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGE
Sbjct  180   LPLTQGGLYEQIGIDPPRGVLLYGPPGTGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGE  239

Query  796   GPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQT  975
             GPRMVRDVFRLAKENAP+IIF+DEVDAIATARFDAQTGADREVQRILMELL QMDGF+Q 
Sbjct  240   GPRMVRDVFRLAKENAPSIIFVDEVDAIATARFDAQTGADREVQRILMELLTQMDGFEQA  299

Query  976   VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLED  1155
              +VKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQ CT+KMNL  EVDLED
Sbjct  300   THVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQSCTSKMNLSPEVDLED  359

Query  1156  YVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             YV+RPDKI+ AEI++ICQEAGM AVRKNRYVILPKDFEK Y+  V+K    FEFYK
Sbjct  360   YVARPDKINNAEISSICQEAGMLAVRKNRYVILPKDFEKAYKVVVRKSSDSFEFYK  415



>gb|ETI35279.1| 26S protease regulatory subunit 6B [Phytophthora parasitica P1569]
Length=435

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/397 (79%), Positives = 361/397 (91%), Gaps = 0/397 (0%)
 Frame = +1

Query  130   PATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVK  309
             P T  +     V+ + + DLYA+ KSL+R LEF++IQE Y+KDE+KNL+RE +RA+EEVK
Sbjct  38    PVTADEEPLVPVTIETKTDLYAKYKSLERHLEFLDIQEGYIKDEMKNLKRELIRAKEEVK  97

Query  310   RIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALV  489
             RIQSVPLVIGQF+EM+D N  IVGST GSNYYVRILST++RE LKP++SVALHRHS+A+V
Sbjct  98    RIQSVPLVIGQFLEMVDANYGIVGSTAGSNYYVRILSTLDRERLKPNSSVALHRHSHAVV  157

Query  490   DVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPR  669
             DVLPPE+DSSI ++  SE+PDV+Y+DIGG DIQKQE+REAVELPLTH +LYKQIG+DPPR
Sbjct  158   DVLPPESDSSIQMMQMSERPDVSYSDIGGMDIQKQEVREAVELPLTHFDLYKQIGVDPPR  217

Query  670   GVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPA  849
             GVL+YGPPGTGKTMLAKAVAN TTAAFI VVGSEFVQKYLGEGPRMVRDVFRLAKEN+PA
Sbjct  218   GVLMYGPPGTGKTMLAKAVANATTAAFISVVGSEFVQKYLGEGPRMVRDVFRLAKENSPA  277

Query  850   IIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPA  1029
             I+FIDEVDAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ  NVKVIMATNRADTLDPA
Sbjct  278   IVFIDEVDAIATKRFDAQTGADREVQRILLELLNQMDGFDQATNVKVIMATNRADTLDPA  337

Query  1030  LLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQ  1209
             LLRPGRLDRKIEFPLPDRRQKRL++Q CTAKMNLGDEVDLEDYV+RP+KIS+A+IA+ICQ
Sbjct  338   LLRPGRLDRKIEFPLPDRRQKRLIYQACTAKMNLGDEVDLEDYVNRPEKISSADIASICQ  397

Query  1210  EAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFY  1320
             EAG+ AVRKNRYV+LPKDF+KGY+  +K+ DT FEFY
Sbjct  398   EAGLQAVRKNRYVVLPKDFDKGYKNAIKRADTTFEFY  434



>ref|XP_002896373.1| 26S protease regulatory subunit 6B [Phytophthora infestans T30-4]
 gb|EEY67608.1| 26S protease regulatory subunit 6B [Phytophthora infestans T30-4]
Length=405

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/386 (81%), Positives = 358/386 (93%), Gaps = 0/386 (0%)
 Frame = +1

Query  163   VSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQ  342
             V+ + + DLYA+ KSL+R LEF++IQE Y+KDE+KNL+RE +RA+EEVKRIQSVPLVIGQ
Sbjct  19    VTIETKTDLYAKYKSLERHLEFLDIQEGYIKDEMKNLKRELIRAKEEVKRIQSVPLVIGQ  78

Query  343   FMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSI  522
             F+EM+D N  IVGST GSNYYVRILST++RE LKP++SVALHRHS+A+VDVLPPE+DSSI
Sbjct  79    FLEMVDANYGIVGSTAGSNYYVRILSTLDRERLKPNSSVALHRHSHAVVDVLPPESDSSI  138

Query  523   SLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTG  702
              ++  SE+PDV+Y+DIGG DIQKQE+REAVELPLTH +LYKQIG+DPPRGVL+YGPPGTG
Sbjct  139   QMMQMSERPDVSYSDIGGMDIQKQEVREAVELPLTHFDLYKQIGVDPPRGVLMYGPPGTG  198

Query  703   KTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIA  882
             KTMLAKAVAN TTAAFI VVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAI+FIDEVDAIA
Sbjct  199   KTMLAKAVANATTAAFISVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIVFIDEVDAIA  258

Query  883   TARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKI  1062
             T RFDAQTGADREVQRIL+ELLNQMDGFDQ  NVKVIMATNRADTLDPALLRPGRLDRKI
Sbjct  259   TKRFDAQTGADREVQRILLELLNQMDGFDQATNVKVIMATNRADTLDPALLRPGRLDRKI  318

Query  1063  EFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNR  1242
             EFPLPDRRQKRL++Q CTAKMNLGDEVDLEDYV+RP+KIS+A+IA+ICQEAG+ AVRKNR
Sbjct  319   EFPLPDRRQKRLIYQACTAKMNLGDEVDLEDYVNRPEKISSADIASICQEAGLQAVRKNR  378

Query  1243  YVILPKDFEKGYRTNVKKPDTDFEFY  1320
             YV+LPKDF+KGY+  +K+ DT FEFY
Sbjct  379   YVVLPKDFDKGYKNAIKRADTTFEFY  404



>ref|XP_010903654.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Esox 
lucius]
Length=418

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/405 (80%), Positives = 362/405 (89%), Gaps = 5/405 (1%)
 Frame = +1

Query  124   EVPATRTDASAQDVSYDA---ED--DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHL  288
             EVPA  +      +S+ A   ED  DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L
Sbjct  14    EVPAMLSSRPQTGLSFLAPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFL  73

Query  289   RAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALH  468
              AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH
Sbjct  74    HAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALH  133

Query  469   RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ  648
             +HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQ
Sbjct  134   KHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQ  193

Query  649   IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  828
             IGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL
Sbjct  194   IGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  253

Query  829   AKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR  1008
             AKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQTVNVKVIMATNR
Sbjct  254   AKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTVNVKVIMATNR  313

Query  1009  ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAA  1188
             ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVF   T+KMNL +EVDLEDYV+RPDKIS A
Sbjct  314   ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITSKMNLSEEVDLEDYVARPDKISGA  373

Query  1189  EIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +I +ICQEAGM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  374   DINSICQEAGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  418



>sp|P46507.1|PRS6B_MANSE RecName: Full=26S protease regulatory subunit 6B; AltName: Full=ATPase 
MS73 [Manduca sexta]
 emb|CAA86294.1| DEAD-box ATPase [Manduca sexta]
Length=415

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/381 (82%), Positives = 353/381 (93%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY + K LQR LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  35    EDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  94

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  95    QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQAD  154

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPDV Y+DIGG D QKQEIREAVELPLTH ELY+QIGI+PPRGVL+YGPPG GKTMLA 
Sbjct  155   EKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPRGVLMYGPPGCGKTMLAN  214

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIFIDE+DAIAT RFDA
Sbjct  215   AVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFIDEIDAIATKRFDA  274

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  275   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  334

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   TAKMNL +EVDLE++V+RPD++S A+I AICQEAGM+AVR+NRY++LPK
Sbjct  335   RRQKRLIFSTITAKMNLSEEVDLEEFVARPDRVSGADINAICQEAGMNAVRENRYIVLPK  394

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK ++++EFYK
Sbjct  395   DFEKGYKNNIKKDESEYEFYK  415



>ref|XP_003383670.1| PREDICTED: 26S protease regulatory subunit 6B-like [Amphimedon 
queenslandica]
Length=414

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/400 (80%), Positives = 362/400 (91%), Gaps = 2/400 (1%)
 Frame = +1

Query  124   EVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEE  303
             E P+  T +S  + + + E+DLY + K LQRQ++F+++QE+Y+KDELKNLR+E+L AQEE
Sbjct  17    ETPSRPTTSS--NTATEHEEDLYIKFKKLQRQIDFLQVQEDYIKDELKNLRQEYLYAQEE  74

Query  304   VKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNA  483
             VKRIQSVPLVIGQF+E +DQN +IVGSTTG NYYVR+LST++ ELLKP++SVALH+HSNA
Sbjct  75    VKRIQSVPLVIGQFLEAVDQNYAIVGSTTGPNYYVRVLSTLDHELLKPNSSVALHKHSNA  134

Query  484   LVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDP  663
             LVDVLPPEADSSI++L+  EKPDV Y+DIGG DIQKQEIREAVELPLTH +LYKQIGIDP
Sbjct  135   LVDVLPPEADSSIAMLTADEKPDVCYSDIGGMDIQKQEIREAVELPLTHFDLYKQIGIDP  194

Query  664   PRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENA  843
             PRGVLL+GPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENA
Sbjct  195   PRGVLLFGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENA  254

Query  844   PAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLD  1023
             PAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQTVNVKVIMATNRADTLD
Sbjct  255   PAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTVNVKVIMATNRADTLD  314

Query  1024  PALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAI  1203
             PALLRPGRLDRKIEFPLPDRRQKRLVF   T KMNL +EVDLEDYV+RPDKIS A+I AI
Sbjct  315   PALLRPGRLDRKIEFPLPDRRQKRLVFSTITNKMNLSEEVDLEDYVARPDKISGADINAI  374

Query  1204  CQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             CQEAGM AVR+NRY+ILPKDFEK Y+  +KK D + +FYK
Sbjct  375   CQEAGMQAVRENRYIILPKDFEKAYKKTIKKDDQEHDFYK  414



>ref|NP_001140138.1| 26S protease regulatory subunit 6B [Salmo salar]
 gb|ACM09405.1| 26S protease regulatory subunit 6B [Salmo salar]
Length=418

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/405 (80%), Positives = 361/405 (89%), Gaps = 5/405 (1%)
 Frame = +1

Query  124   EVPATRTDASAQDVSYDA---ED--DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHL  288
             EVPA         +S+ A   ED  DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L
Sbjct  14    EVPAMLNSRPHTGLSFLAPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFL  73

Query  289   RAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALH  468
              AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH
Sbjct  74    HAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALH  133

Query  469   RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ  648
             +HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQ
Sbjct  134   KHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQ  193

Query  649   IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  828
             IGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL
Sbjct  194   IGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  253

Query  829   AKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR  1008
             AKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQTVNVKVIMATNR
Sbjct  254   AKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTVNVKVIMATNR  313

Query  1009  ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAA  1188
             ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVF   T+KMNL +EVDLEDYV+RPDKIS A
Sbjct  314   ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITSKMNLSEEVDLEDYVARPDKISGA  373

Query  1189  EIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +I +ICQEAGM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  374   DINSICQEAGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  418



>gb|EFX89046.1| hypothetical protein DAPPUDRAFT_304599 [Daphnia pulex]
Length=417

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/381 (83%), Positives = 349/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             DDLY + K LQ QLE + +QE Y+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  37    DDLYTKYKKLQMQLESLTVQEAYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  96

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNY+VRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  97    QNTGIVGSTTGSNYFVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLGAD  156

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPDV+Y DIGG D+QKQE+REAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  157   EKPDVSYADIGGMDMQKQEMREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  216

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIFIDE+DAIAT RFDA
Sbjct  217   AVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFIDEIDAIATKRFDA  276

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  277   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  336

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRLVF   TAKMNL DEVDLED+V+RPDKIS A+I AICQEAGMHAVR+NRY++L K
Sbjct  337   RRQKRLVFATITAKMNLSDEVDLEDFVARPDKISGADINAICQEAGMHAVRENRYIVLAK  396

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK + + EFYK
Sbjct  397   DFEKGYKNNIKKDEAEHEFYK  417



>ref|XP_003737662.1| PREDICTED: 26S protease regulatory subunit 6B-like [Metaseiulus 
occidentalis]
Length=403

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/390 (81%), Positives = 355/390 (91%), Gaps = 1/390 (0%)
 Frame = +1

Query  157   QDVSYDAE-DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLV  333
             Q  + DAE +D+Y +   L+RQLEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPLV
Sbjct  14    QSANDDAELEDIYVKYMKLKRQLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLV  73

Query  334   IGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEAD  513
             IGQF+E +DQN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEAD
Sbjct  74    IGQFLEAVDQNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEAD  133

Query  514   SSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPP  693
             SSIS+L   EKP+V+Y DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL+YGPP
Sbjct  134   SSISMLRPDEKPEVSYADIGGLDIQKQEMREAVELPLTHFELYKQIGIDPPRGVLMYGPP  193

Query  694   GTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVD  873
             G GKTMLAKAVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLA+EN+PAIIFIDE+D
Sbjct  194   GCGKTMLAKAVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLARENSPAIIFIDEID  253

Query  874   AIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLD  1053
             AIAT RFDAQTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLD
Sbjct  254   AIATKRFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLD  313

Query  1054  RKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVR  1233
             RKIEFP+PDRRQKRL+F   T++MNL DEVDLEDYV+RPD+IS A+I AICQE GMHAVR
Sbjct  314   RKIEFPMPDRRQKRLIFSTITSRMNLSDEVDLEDYVARPDRISGADINAICQEGGMHAVR  373

Query  1234  KNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +NRYV+LPKDFEK Y+ N KK + + EFYK
Sbjct  374   ENRYVVLPKDFEKAYKNNTKKDECEHEFYK  403



>gb|EFZ19093.1| hypothetical protein SINV_07148, partial [Solenopsis invicta]
Length=373

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/372 (84%), Positives = 346/372 (93%), Gaps = 0/372 (0%)
 Frame = +1

Query  208   LQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGST  387
             LQR LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +DQN  IVGST
Sbjct  2     LQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVDQNTGIVGST  61

Query  388   TGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYND  567
             TGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   EKPD+ Y+D
Sbjct  62    TGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQADEKPDIQYSD  121

Query  568   IGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAA  747
             IGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAKAVA HTTAA
Sbjct  122   IGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVARHTTAA  181

Query  748   FIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQ  927
             FIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIF+DE+DAIAT RFDAQTGADREVQ
Sbjct  182   FIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFVDEIDAIATKRFDAQTGADREVQ  241

Query  928   RILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQ  1107
             RIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F 
Sbjct  242   RILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFS  301

Query  1108  VCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTN  1287
               TAKMNL +EVDLEDYV+RPD+IS A+I AICQEAGMHAVR+NRY++L KDFEKGY+ N
Sbjct  302   TITAKMNLSEEVDLEDYVARPDRISGADINAICQEAGMHAVRENRYIVLAKDFEKGYKNN  361

Query  1288  VKKPDTDFEFYK  1323
             +KK +++ EFYK
Sbjct  362   IKKDESEHEFYK  373



>emb|CDQ64781.1| unnamed protein product [Oncorhynchus mykiss]
 emb|CDQ58069.1| unnamed protein product [Oncorhynchus mykiss]
Length=418

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/405 (80%), Positives = 361/405 (89%), Gaps = 5/405 (1%)
 Frame = +1

Query  124   EVPATRTDASAQDVSYDA---ED--DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHL  288
             EVPA         +S+ A   ED  DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L
Sbjct  14    EVPAMLNSRPQTGLSFLAPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFL  73

Query  289   RAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALH  468
              AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH
Sbjct  74    HAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALH  133

Query  469   RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ  648
             +HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQ
Sbjct  134   KHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQ  193

Query  649   IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  828
             IGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL
Sbjct  194   IGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  253

Query  829   AKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR  1008
             AKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQTVNVKVIMATNR
Sbjct  254   AKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTVNVKVIMATNR  313

Query  1009  ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAA  1188
             ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVF   T+KMNL +EVDLEDYV+RPDKIS A
Sbjct  314   ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITSKMNLSEEVDLEDYVARPDKISGA  373

Query  1189  EIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +I +ICQEAGM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  374   DINSICQEAGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  418



>ref|XP_010903655.1| PREDICTED: 26S protease regulatory subunit 6B isoform X2 [Esox 
lucius]
Length=401

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/381 (83%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L AQEEVKRIQS+PLVIGQF+E +D
Sbjct  21    EDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVD  80

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH+HSNALVDVLPPEADSSI +L+  
Sbjct  81    QNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSD  140

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  141   QKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  200

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  201   AVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  260

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  261   QTGADREVQRILLELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  320

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRLVF   T+KMNL +EVDLEDYV+RPDKIS A+I +ICQEAGM AVR+NRY++L K
Sbjct  321   RRQKRLVFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQEAGMLAVRENRYIVLAK  380

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEK Y+T +KK + + EFYK
Sbjct  381   DFEKAYKTVIKKDEQEHEFYK  401



>ref|XP_005848629.1| hypothetical protein CHLNCDRAFT_30648 [Chlorella variabilis]
 gb|EFN56527.1| hypothetical protein CHLNCDRAFT_30648 [Chlorella variabilis]
Length=423

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/416 (79%), Positives = 362/416 (87%), Gaps = 24/416 (6%)
 Frame = +1

Query  148   ASAQDVSYDAE-------------DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHL  288
             A AQDV   AE             +DLY +LK+LQRQLEF+EIQEEY+K+E KNL+ E L
Sbjct  8     AKAQDVPSRAEPEAMETTEAGQPQEDLYTKLKTLQRQLEFLEIQEEYIKEEQKNLKNELL  67

Query  289   RAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALH  468
             RAQEEVKRIQ+VPLVIGQF+EM+D N  IVGSTTGSNYYVRILST+NRELL+PSASVALH
Sbjct  68    RAQEEVKRIQAVPLVIGQFLEMVDNNTGIVGSTTGSNYYVRILSTLNRELLRPSASVALH  127

Query  469   RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ  648
             RHSNALVD+LPPEADS+IS++SQ+E+PDVTY DIGG DIQKQEI+EAVELPL   +LY+Q
Sbjct  128   RHSNALVDILPPEADSTISVMSQTERPDVTYQDIGGMDIQKQEIKEAVELPLVQGDLYEQ  187

Query  649   IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  828
             IGIDPPRGVLLYGPPGTGKTMLAKAVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDVFRL
Sbjct  188   IGIDPPRGVLLYGPPGTGKTMLAKAVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRL  247

Query  829   AKENAPAIIFIDEVDAIATARFDAQTGADR--EVQRILMELLNQMDGFDQTVNVKVIMAT  1002
             AK+NAP+IIF+DEVDAIATARFDAQTGADR  EVQRILMELL QMDGF+Q+ NVKVIMAT
Sbjct  248   AKQNAPSIIFVDEVDAIATARFDAQTGADRRVEVQRILMELLTQMDGFEQSTNVKVIMAT  307

Query  1003  NRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKIS  1182
             NRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQ CT+ MNL +EVDLEDYV+RPDKI+
Sbjct  308   NRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQACTSAMNLSEEVDLEDYVARPDKIN  367

Query  1183  AAEIAAICQ---------EAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
              AEIA+ICQ         EAGM AVRKNRYVILPKDFEK Y+  V+K    FEFYK
Sbjct  368   NAEIASICQARRWCGCACEAGMLAVRKNRYVILPKDFEKAYKNVVRKTSDSFEFYK  423



>ref|XP_008119139.1| PREDICTED: 26S protease regulatory subunit 6B [Anolis carolinensis]
Length=418

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/405 (79%), Positives = 361/405 (89%), Gaps = 5/405 (1%)
 Frame = +1

Query  124   EVPATRTDASAQDVSY---DAED--DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHL  288
             E+PA         +S+   +AED  DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L
Sbjct  14    EIPALSISRPQTGLSFLVPEAEDVEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFL  73

Query  289   RAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALH  468
              AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH
Sbjct  74    HAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALH  133

Query  469   RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ  648
             +HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQ
Sbjct  134   KHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQ  193

Query  649   IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  828
             IGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL
Sbjct  194   IGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  253

Query  829   AKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR  1008
             AKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNR
Sbjct  254   AKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNR  313

Query  1009  ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAA  1188
             ADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A
Sbjct  314   ADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGA  373

Query  1189  EIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +I +ICQEAGM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  374   DINSICQEAGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  418



>ref|XP_007432262.1| PREDICTED: 26S protease regulatory subunit 6B-like [Python bivittatus]
Length=418

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/405 (79%), Positives = 361/405 (89%), Gaps = 5/405 (1%)
 Frame = +1

Query  124   EVPATRTDASAQDVSY---DAED--DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHL  288
             E+PA         +S+   +AED  DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L
Sbjct  14    ELPALSISRPQTGLSFLVPEAEDVEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFL  73

Query  289   RAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALH  468
              AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH
Sbjct  74    HAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALH  133

Query  469   RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ  648
             +HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQ
Sbjct  134   KHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQ  193

Query  649   IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  828
             IGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL
Sbjct  194   IGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  253

Query  829   AKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR  1008
             AKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNR
Sbjct  254   AKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNR  313

Query  1009  ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAA  1188
             ADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A
Sbjct  314   ADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGA  373

Query  1189  EIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +I +ICQEAGM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  374   DINSICQEAGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  418



>gb|KHN24721.1| 26S protease regulatory subunit 6B like [Glycine soja]
Length=325

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/326 (98%), Positives = 323/326 (99%), Gaps = 1/326 (0%)
 Frame = +1

Query  346   MEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSIS  525
             MEM+DQNN IVGSTTGSNYYVRILSTINRELLKPSASVALH HSNALVDVLPPEADSSIS
Sbjct  1     MEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALH-HSNALVDVLPPEADSSIS  59

Query  526   LLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK  705
             LLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK
Sbjct  60    LLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK  119

Query  706   TMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIAT  885
             TMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIAT
Sbjct  120   TMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIAT  179

Query  886   ARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIE  1065
             ARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIE
Sbjct  180   ARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIE  239

Query  1066  FPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRY  1245
             FPLPDRRQKRLVFQVCTAKMNL DEVDLEDYVSRPDKISAAEI+AICQEAGMHAVRKNRY
Sbjct  240   FPLPDRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAAEISAICQEAGMHAVRKNRY  299

Query  1246  VILPKDFEKGYRTNVKKPDTDFEFYK  1323
             VILPKDFEKGYRTNVKKPDTDFEFYK
Sbjct  300   VILPKDFEKGYRTNVKKPDTDFEFYK  325



>gb|ENN79977.1| hypothetical protein YQE_03591, partial [Dendroctonus ponderosae]
 gb|ENN82273.1| hypothetical protein YQE_01351, partial [Dendroctonus ponderosae]
Length=369

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/368 (85%), Positives = 345/368 (94%), Gaps = 0/368 (0%)
 Frame = +1

Query  220   LEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSN  399
             LEF+E+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +DQN  IVGSTTGSN
Sbjct  2     LEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVDQNTGIVGSTTGSN  61

Query  400   YYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGC  579
             YYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   EKPDV+Y+DIGG 
Sbjct  62    YYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQADEKPDVSYSDIGGM  121

Query  580   DIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRV  759
             D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAKAVA+HTTA FIRV
Sbjct  122   DMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTATFIRV  181

Query  760   VGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILM  939
             VGSEFVQKYLGEGPRMVRDVFRLAKEN+PAIIFIDE+DAIAT RFDAQTGADREVQRIL+
Sbjct  182   VGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFIDEIDAIATKRFDAQTGADREVQRILL  241

Query  940   ELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTA  1119
             ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVF   T+
Sbjct  242   ELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITS  301

Query  1120  KMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKP  1299
             KMNL +EVDLEDYV+RPDKIS A+I AICQEAGMHAVR+NRY++LPKDFEKGY+ N+KK 
Sbjct  302   KMNLSEEVDLEDYVARPDKISGADINAICQEAGMHAVRENRYIVLPKDFEKGYKNNIKKD  361

Query  1300  DTDFEFYK  1323
             +++ EFYK
Sbjct  362   ESEHEFYK  369



>ref|XP_004346014.1| 26S protease regulatory subunit 6B family protein [Acanthamoeba 
castellanii str. Neff]
 gb|ELR21470.1| 26S protease regulatory subunit 6B family protein [Acanthamoeba 
castellanii str. Neff]
Length=413

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/420 (78%), Positives = 361/420 (86%), Gaps = 13/420 (3%)
 Frame = +1

Query  64    APTMATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQE  243
             AP+ +  MV+D   +P  + ++          +   + EDDLY  LK  ++QL F+EIQE
Sbjct  7     APSGSQTMVID---SPHSAMDI----------ETKEEREDDLYLTLKDYEKQLRFLEIQE  53

Query  244   EYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILST  423
             EYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQF+EMIDQN  I+GSTTGSNYYVRILST
Sbjct  54    EYVKDEHKNLKRELLRAQEEVKRIQSVPLVIGQFLEMIDQNTGIIGSTTGSNYYVRILST  113

Query  424   INRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIR  603
             INRE LKP+ASVALHRHSNALVD+LPPEADSSI L+   EKP+VTY  IGG DIQKQEIR
Sbjct  114   INREELKPAASVALHRHSNALVDILPPEADSSIQLMGAGEKPNVTYQMIGGLDIQKQEIR  173

Query  604   EAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK  783
             EAVELPLTH +LY+QIGIDPPRGVLLYG PGTGKTMLAKAVA+HT+A+FI VVGSEFVQK
Sbjct  174   EAVELPLTHFDLYRQIGIDPPRGVLLYGSPGTGKTMLAKAVAHHTSASFIAVVGSEFVQK  233

Query  784   YLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDG  963
             YLGEGPRMVRDVFRLAKENAPAIIF+DEVDAIAT RFDAQTGADREVQRIL+ELLNQMDG
Sbjct  234   YLGEGPRMVRDVFRLAKENAPAIIFVDEVDAIATKRFDAQTGADREVQRILLELLNQMDG  293

Query  964   FDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEV  1143
             FDQ+VNVKVIMATNRADTLDPALLRPGRLDRKIEFP PDRRQKRL+F V T KMNL +EV
Sbjct  294   FDQSVNVKVIMATNRADTLDPALLRPGRLDRKIEFPSPDRRQKRLIFSVLTGKMNLSEEV  353

Query  1144  DLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DLEDYVSRPDK+S AEI AICQEAGM AVRKNRYVILPKDFEKGY++  +    +F FY+
Sbjct  354   DLEDYVSRPDKLSGAEINAICQEAGMQAVRKNRYVILPKDFEKGYKSVARGGGNEFLFYQ  413



>emb|CDI98382.1| 26S proteasome regulatory subunit T3 [Echinococcus multilocularis]
Length=415

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/411 (78%), Positives = 363/411 (88%), Gaps = 1/411 (0%)
 Frame = +1

Query  91    LDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKN  270
             L PNP  +   +VP          +  + ED LY +LKSL++QLEFI++QE+Y+KDE KN
Sbjct  6     LSPNPHEQGEVDVPDFAPITPVDPLRLNDED-LYQKLKSLKKQLEFIQVQEDYIKDEQKN  64

Query  271   LRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPS  450
             L++E++ AQEEVKRI+SVPLVIGQF+E +DQ   IVGSTTGSNYYVRILSTI+RELLKPS
Sbjct  65    LKKEYMHAQEEVKRIKSVPLVIGQFLEAVDQTTGIVGSTTGSNYYVRILSTIDRELLKPS  124

Query  451   ASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTH  630
             ASVALH+HSNALVDVLPPEADSSI++L   EKPDV+Y DIGG D+QKQE+REAVELPLTH
Sbjct  125   ASVALHKHSNALVDVLPPEADSSITMLQADEKPDVSYADIGGMDLQKQEVREAVELPLTH  184

Query  631   HELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMV  810
              +LYKQIGIDPPRGVL++GPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMV
Sbjct  185   FDLYKQIGIDPPRGVLMFGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMV  244

Query  811   RDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKV  990
             RDVFRLAKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKV
Sbjct  245   RDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQAVNVKV  304

Query  991   IMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRP  1170
             IMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV+RP
Sbjct  305   IMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARP  364

Query  1171  DKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DKIS A+I AICQEAGM AVR+NRYV+L KDFEKGY+ N+KK + + +FYK
Sbjct  365   DKISGADINAICQEAGMQAVRENRYVVLAKDFEKGYKNNIKKGNQELDFYK  415



>gb|EUB63262.1| 26S protease regulatory subunit 6B [Echinococcus granulosus]
 emb|CDS20038.1| 26S proteasome regulatory subunit T3 [Echinococcus granulosus]
Length=415

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/411 (78%), Positives = 364/411 (89%), Gaps = 1/411 (0%)
 Frame = +1

Query  91    LDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKN  270
             L PNP  +   +VP          +  + ED LY +LKSL++QLEFI++QE+Y+KDE KN
Sbjct  6     LSPNPHEQGEVDVPDFAPITPVDPLRLNDED-LYQKLKSLKKQLEFIQVQEDYIKDEQKN  64

Query  271   LRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPS  450
             L++E++ AQEEVKRI+SVPLVIGQF+E +DQ+  IVGSTTGSNYYVRILSTI+RELLKPS
Sbjct  65    LKKEYMHAQEEVKRIKSVPLVIGQFLEAVDQSTGIVGSTTGSNYYVRILSTIDRELLKPS  124

Query  451   ASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTH  630
             ASVALH+HSNALVDVLPPEADSSI++L   EKPDV+Y DIGG D+QKQE+REAVELPLTH
Sbjct  125   ASVALHKHSNALVDVLPPEADSSITMLQADEKPDVSYADIGGMDLQKQEVREAVELPLTH  184

Query  631   HELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMV  810
              +LYKQIGIDPPRGVL++GPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMV
Sbjct  185   FDLYKQIGIDPPRGVLMFGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMV  244

Query  811   RDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKV  990
             RDVFRLAKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKV
Sbjct  245   RDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQAVNVKV  304

Query  991   IMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRP  1170
             IMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV+RP
Sbjct  305   IMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARP  364

Query  1171  DKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             DKIS A+I AICQEAGM AVR+NRYV+L KDFEKGY+ N+KK + + +FYK
Sbjct  365   DKISGADINAICQEAGMQAVRENRYVVLAKDFEKGYKNNIKKGNQELDFYK  415



>ref|XP_001635544.1| predicted protein [Nematostella vectensis]
 gb|EDO43481.1| predicted protein [Nematostella vectensis]
Length=417

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/399 (80%), Positives = 354/399 (89%), Gaps = 1/399 (0%)
 Frame = +1

Query  130   PATRTDASAQDVSYDAE-DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEV  306
             P T    S+     D E DDLY   K L++QLEF+E+QEEY+KDE KNL++E L AQEEV
Sbjct  19    PTTAGTISSLCSPVDPEMDDLYITYKKLEKQLEFLEVQEEYIKDEQKNLKKELLHAQEEV  78

Query  307   KRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNAL  486
             KRIQSVPLVIGQF+E +DQN  IV STTGSNYYVRILSTI++ELLKPSASVALH+HSNAL
Sbjct  79    KRIQSVPLVIGQFLEAVDQNTGIVASTTGSNYYVRILSTIDKELLKPSASVALHKHSNAL  138

Query  487   VDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPP  666
             VD+LPPEADSSI++L+  EKP+V+Y +IGG DIQKQEIREAVELPLTH ELYKQIGIDPP
Sbjct  139   VDILPPEADSSIAMLTNEEKPNVSYAEIGGMDIQKQEIREAVELPLTHFELYKQIGIDPP  198

Query  667   RGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAP  846
             RGVLLYGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAP
Sbjct  199   RGVLLYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAP  258

Query  847   AIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDP  1026
             AIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNR DTLDP
Sbjct  259   AIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRQDTLDP  318

Query  1027  ALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAIC  1206
             ALLRPGRLDRKIEFPLPDRRQKRL+F   T KMNL +EVDLEDYV+RPDKIS A+I A+C
Sbjct  319   ALLRPGRLDRKIEFPLPDRRQKRLIFSTITNKMNLSEEVDLEDYVARPDKISGADINAVC  378

Query  1207  QEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             QEAGM AVR+NRY+IL KDFEKGY+ NVKK + + EFYK
Sbjct  379   QEAGMQAVRENRYIILAKDFEKGYKNNVKKDEQEHEFYK  417



>ref|XP_004670466.1| PREDICTED: 26S protease regulatory subunit 6B [Jaculus jaculus]
Length=382

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/381 (82%), Positives = 351/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L AQEEVKRIQS+PLVIGQF+E +D
Sbjct  2     EDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVD  61

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH+HSNALVDVLPPEADSSI +L+  
Sbjct  62    QNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSD  121

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  122   QKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  181

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  182   AVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  241

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  242   QTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  301

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A+I +ICQE+GM AVR+NRY++L K
Sbjct  302   RRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAK  361

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEK Y+T +KK + + EFYK
Sbjct  362   DFEKAYKTVIKKDEQEHEFYK  382



>ref|XP_008322265.1| PREDICTED: 26S protease regulatory subunit 6B isoform X4 [Cynoglossus 
semilaevis]
Length=404

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/381 (82%), Positives = 351/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L AQEEVKRIQS+PLVIGQF+E +D
Sbjct  24    EDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVD  83

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH+HSNALVDVLPPEADSSI +L+  
Sbjct  84    QNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSD  143

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  144   QKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  203

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  204   AVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  263

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  264   QTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  323

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A+I +ICQEAGM AVR+NRY++L K
Sbjct  324   RRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQEAGMLAVRENRYIVLAK  383

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEK Y+T +KK + + EFYK
Sbjct  384   DFEKAYKTVIKKDEQEHEFYK  404



>dbj|BAE40993.1| unnamed protein product [Mus musculus]
Length=418

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/405 (79%), Positives = 361/405 (89%), Gaps = 5/405 (1%)
 Frame = +1

Query  124   EVPATRTDASAQDVSY---DAED--DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHL  288
             E+PA         +S+   ++ED  DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L
Sbjct  14    EIPALSVSRPQTGLSFLGPESEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFL  73

Query  289   RAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALH  468
              AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH
Sbjct  74    HAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALH  133

Query  469   RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ  648
             +HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQ
Sbjct  134   KHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQ  193

Query  649   IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  828
             IGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL
Sbjct  194   IGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  253

Query  829   AKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR  1008
             AKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNR
Sbjct  254   AKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNR  313

Query  1009  ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAA  1188
             ADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A
Sbjct  314   ADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGA  373

Query  1189  EIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +I +ICQE+GM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  374   DINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  418



>ref|XP_004441589.1| PREDICTED: 26S protease regulatory subunit 6B isoform 1 [Ceratotherium 
simum simum]
Length=418

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/405 (79%), Positives = 361/405 (89%), Gaps = 5/405 (1%)
 Frame = +1

Query  124   EVPATRTDASAQDVSY---DAED--DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHL  288
             E+PA         +S+   + ED  DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L
Sbjct  14    EIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFL  73

Query  289   RAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALH  468
              AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH
Sbjct  74    HAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALH  133

Query  469   RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ  648
             +HSNALVDVLPPEADSSI +L+  +KPDV Y+DIGG DIQKQE+REAVELPLTH ELYKQ
Sbjct  134   KHSNALVDVLPPEADSSIMMLTSDQKPDVMYSDIGGMDIQKQEVREAVELPLTHFELYKQ  193

Query  649   IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  828
             IGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL
Sbjct  194   IGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  253

Query  829   AKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR  1008
             AKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNR
Sbjct  254   AKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNR  313

Query  1009  ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAA  1188
             ADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A
Sbjct  314   ADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGA  373

Query  1189  EIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +I +ICQE+GM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  374   DINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  418



>ref|XP_006641599.1| PREDICTED: 26S protease regulatory subunit 6B-like isoform X1 
[Lepisosteus oculatus]
Length=418

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/381 (83%), Positives = 350/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY R K LQ++LEF+E+QEEY+KDE KNL++E L AQEEVKRIQS+PLVIGQF+E +D
Sbjct  38    EDLYTRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVD  97

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH+HSNALVDVLPPEADSSI +L+  
Sbjct  98    QNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSD  157

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  158   QKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  217

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  218   AVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  277

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  278   QTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  337

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRLVF   T+KMNL +EVDLEDYV+RPDKIS A+I +ICQEAGM AVR+NRY++L K
Sbjct  338   RRQKRLVFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQEAGMLAVRENRYIVLAK  397

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEK Y+T +KK + + EFYK
Sbjct  398   DFEKAYKTVIKKDEQEHEFYK  418



>emb|CEF99068.1| 26S proteasome subunit P45 [Ostreococcus tauri]
Length=407

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/383 (86%), Positives = 355/383 (93%), Gaps = 0/383 (0%)
 Frame = +1

Query  175   AEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEM  354
             +E DLYAR+K L R+LE IEIQEEY+KDE KNL+ E LRAQEEVKRIQSVPLVIGQF+EM
Sbjct  25    SEGDLYARVKQLTRELELIEIQEEYIKDEQKNLKIELLRAQEEVKRIQSVPLVIGQFLEM  84

Query  355   IDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLS  534
             +D    IV STTGSNYYVRILST+NRELLKPS+SVALHRHSNALV++LPPEADSSISLLS
Sbjct  85    VDAETGIVSSTTGSNYYVRILSTLNRELLKPSSSVALHRHSNALVEILPPEADSSISLLS  144

Query  535   QSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTML  714
              +E+PDV Y+DIGG D+QKQEIREAVELPLTH +LY+QIGIDPPRGVLLYGPPGTGKTML
Sbjct  145   DAERPDVKYSDIGGADVQKQEIREAVELPLTHFDLYRQIGIDPPRGVLLYGPPGTGKTML  204

Query  715   AKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARF  894
             AKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVD+IATARF
Sbjct  205   AKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDSIATARF  264

Query  895   DAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPL  1074
             DA TGADREVQRILMELLNQMDGFDQ+VNVKVIMATNRADTLDPALLRPGRLDRKIE P 
Sbjct  265   DAHTGADREVQRILMELLNQMDGFDQSVNVKVIMATNRADTLDPALLRPGRLDRKIECPH  324

Query  1075  PDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVIL  1254
             PDRRQKRLVFQVC  KM+L DEVDLEDYVSRPDKISAA+I +ICQEAG+ AVRKNRYV+L
Sbjct  325   PDRRQKRLVFQVCVGKMSLSDEVDLEDYVSRPDKISAADIRSICQEAGLQAVRKNRYVVL  384

Query  1255  PKDFEKGYRTNVKKPDTDFEFYK  1323
             PKDFE  Y+ NV+KPD DFEFYK
Sbjct  385   PKDFEVAYKINVRKPDNDFEFYK  407



>ref|XP_002762172.1| PREDICTED: 26S protease regulatory subunit 6B [Callithrix jacchus]
 ref|XP_003943201.1| PREDICTED: 26S protease regulatory subunit 6B [Saimiri boliviensis 
boliviensis]
Length=418

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/405 (79%), Positives = 361/405 (89%), Gaps = 5/405 (1%)
 Frame = +1

Query  124   EVPA---TRTDASAQDVSYDAED--DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHL  288
             E+PA   +R   S   +  + ED  DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L
Sbjct  14    EIPALSVSRPQTSLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFL  73

Query  289   RAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALH  468
              AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH
Sbjct  74    HAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALH  133

Query  469   RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ  648
             +HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQ
Sbjct  134   KHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQ  193

Query  649   IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  828
             IGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL
Sbjct  194   IGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  253

Query  829   AKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR  1008
             AKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNR
Sbjct  254   AKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNR  313

Query  1009  ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAA  1188
             ADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A
Sbjct  314   ADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGA  373

Query  1189  EIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +I +ICQE+GM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  374   DINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  418



>ref|XP_008880342.1| 26S protease regulatory subunit 6B [Aphanomyces invadans]
 gb|ETV91062.1| 26S protease regulatory subunit 6B [Aphanomyces invadans]
Length=407

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/387 (80%), Positives = 357/387 (92%), Gaps = 0/387 (0%)
 Frame = +1

Query  160   DVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIG  339
             D  ++ EDD++++ K+L+R LEF++IQE Y+KDE+KNL+RE +RA+EEVKRIQSVPLVIG
Sbjct  20    DNKHEQEDDMFSKYKALERHLEFLDIQEGYIKDEMKNLKRELIRAKEEVKRIQSVPLVIG  79

Query  340   QFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSS  519
             QF+EM+D N  IVGST GSNYYVRILST++RE LKP++SVALHRHS+A+V +LPPE+DSS
Sbjct  80    QFLEMVDANYGIVGSTAGSNYYVRILSTLDRERLKPNSSVALHRHSHAVVAILPPESDSS  139

Query  520   ISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGT  699
             I ++   E+PDV+Y+DIGG DIQKQE+REAVELPLTH +LYKQIGIDPPRGVL+YGPPGT
Sbjct  140   IQMMQMEERPDVSYSDIGGMDIQKQEVREAVELPLTHFDLYKQIGIDPPRGVLMYGPPGT  199

Query  700   GKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAI  879
             GKTMLAKAVAN TTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+P I+FIDEVDAI
Sbjct  200   GKTMLAKAVANATTASFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPCIVFIDEVDAI  259

Query  880   ATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRK  1059
             AT RFDAQTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRK
Sbjct  260   ATKRFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRK  319

Query  1060  IEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKN  1239
             IEFPLPDRRQKRL++Q CTAKMNLGDEVDLEDYV+RP+KIS A+IA+ICQEAG+ AVRKN
Sbjct  320   IEFPLPDRRQKRLIYQACTAKMNLGDEVDLEDYVNRPEKISCADIASICQEAGLQAVRKN  379

Query  1240  RYVILPKDFEKGYRTNVKKPDTDFEFY  1320
             RYVILPKDF+KGY+  +K+ DT FEFY
Sbjct  380   RYVILPKDFDKGYKNAIKRADTTFEFY  406



>ref|XP_004078465.1| PREDICTED: 26S protease regulatory subunit 6B [Oryzias latipes]
Length=417

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/381 (83%), Positives = 351/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L AQEEVKRIQS+PLVIGQF+E +D
Sbjct  37    EDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVD  96

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH+HSNALVDVLPPEADSSI +L+  
Sbjct  97    QNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSD  156

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  157   QKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  216

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  217   AVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  276

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  277   QTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  336

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRLVF   T+KMNL +EVDLEDYV+RPDKIS A+I +ICQEAGM AVR+NRY++L K
Sbjct  337   RRQKRLVFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQEAGMLAVRENRYIVLAK  396

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEK Y+T +KK + + EFYK
Sbjct  397   DFEKAYKTVIKKDEQEHEFYK  417



>ref|XP_004620804.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Sorex 
araneus]
Length=418

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/405 (79%), Positives = 360/405 (89%), Gaps = 5/405 (1%)
 Frame = +1

Query  124   EVPATRTDASAQDVSYDA---ED--DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHL  288
             E+PA         +S+ A   ED  DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L
Sbjct  14    EIPALSVSRPQTGLSFLAPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFL  73

Query  289   RAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALH  468
              AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH
Sbjct  74    HAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALH  133

Query  469   RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ  648
             +HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQ
Sbjct  134   KHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQ  193

Query  649   IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  828
             IGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL
Sbjct  194   IGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  253

Query  829   AKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR  1008
             AKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNR
Sbjct  254   AKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNR  313

Query  1009  ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAA  1188
             ADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A
Sbjct  314   ADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGA  373

Query  1189  EIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +I +ICQE+GM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  374   DINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  418



>ref|XP_004571156.1| PREDICTED: 26S protease regulatory subunit 6B-like isoform X2 
[Maylandia zebra]
Length=404

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/414 (78%), Positives = 360/414 (87%), Gaps = 11/414 (3%)
 Frame = +1

Query  82    PMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDE  261
             P VL   P    SF  P        +D+     +DLY R K LQ++LEF+E+QEEY+KDE
Sbjct  2     PAVLSSRPQTGLSFLAP------EPEDL-----EDLYTRYKKLQQELEFLEVQEEYIKDE  50

Query  262   LKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELL  441
              KNL++E L AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELL
Sbjct  51    QKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELL  110

Query  442   KPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELP  621
             KP+ASVALH+HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELP
Sbjct  111   KPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELP  170

Query  622   LTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGP  801
             LTH ELYKQIGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGP
Sbjct  171   LTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGP  230

Query  802   RMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVN  981
             RMVRDVFRLAKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VN
Sbjct  231   RMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVN  290

Query  982   VKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYV  1161
             VKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV
Sbjct  291   VKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYV  350

Query  1162  SRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +RPDKIS A+I +ICQEAGM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  351   ARPDKISGADINSICQEAGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  404



>ref|XP_005801852.1| PREDICTED: 26S protease regulatory subunit 6B-like isoform X1 
[Xiphophorus maculatus]
 ref|XP_007576991.1| PREDICTED: 26S protease regulatory subunit 6B [Poecilia formosa]
Length=417

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/419 (77%), Positives = 367/419 (88%), Gaps = 4/419 (1%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAED--DLYARLKSLQRQLEFIEIQEE  246
             M   +V++ +P   PS  + ++R       ++ + ED  DLY R K LQ++LEF+E+QEE
Sbjct  1     MEDCVVVEKSPEELPS--ILSSRPQTGLSFLAPEPEDLEDLYTRYKKLQQELEFLEVQEE  58

Query  247   YVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTI  426
             Y+KDE KNL++E L AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI
Sbjct  59    YIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTI  118

Query  427   NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE  606
             +RELLKP+ASVALH+HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+RE
Sbjct  119   DRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVRE  178

Query  607   AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY  786
             AVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKY
Sbjct  179   AVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKY  238

Query  787   LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF  966
             LGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGF
Sbjct  239   LGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGF  298

Query  967   DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVD  1146
             DQ VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVD
Sbjct  299   DQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVD  358

Query  1147  LEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             LEDYV+RPDKIS A+I +ICQEAGM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  359   LEDYVARPDKISGADINSICQEAGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  417



>ref|XP_008322264.1| PREDICTED: 26S protease regulatory subunit 6B isoform X3 [Cynoglossus 
semilaevis]
Length=418

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/381 (82%), Positives = 351/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L AQEEVKRIQS+PLVIGQF+E +D
Sbjct  38    EDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVD  97

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH+HSNALVDVLPPEADSSI +L+  
Sbjct  98    QNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSD  157

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  158   QKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  217

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  218   AVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  277

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  278   QTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  337

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A+I +ICQEAGM AVR+NRY++L K
Sbjct  338   RRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQEAGMLAVRENRYIVLAK  397

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEK Y+T +KK + + EFYK
Sbjct  398   DFEKAYKTVIKKDEQEHEFYK  418



>ref|XP_008288751.1| PREDICTED: 26S protease regulatory subunit 6B [Stegastes partitus]
Length=417

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/415 (77%), Positives = 361/415 (87%), Gaps = 11/415 (3%)
 Frame = +1

Query  79    TPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKD  258
              P +L   P    SF  P        +D+     +DLY+R K LQ++LEF+E+QEEY+KD
Sbjct  14    VPTILSSRPQTGLSFLAP------EPEDL-----EDLYSRYKKLQQELEFLEVQEEYIKD  62

Query  259   ELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINREL  438
             E KNL++E L AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+REL
Sbjct  63    EQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDREL  122

Query  439   LKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVEL  618
             LKP+ASVALH+HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVEL
Sbjct  123   LKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVEL  182

Query  619   PLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEG  798
             PLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEG
Sbjct  183   PLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEG  242

Query  799   PRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTV  978
             PRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ V
Sbjct  243   PRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNV  302

Query  979   NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDY  1158
             NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDY
Sbjct  303   NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDY  362

Query  1159  VSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             V+RPDKIS A+I +ICQEAGM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  363   VARPDKISGADINSICQEAGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  417



>ref|XP_003462064.1| PREDICTED: 26S protease regulatory subunit 6B isoform 1 [Cavia 
porcellus]
 ref|XP_004648056.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Octodon 
degus]
 ref|XP_005414136.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Chinchilla 
lanigera]
Length=418

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/405 (79%), Positives = 360/405 (89%), Gaps = 5/405 (1%)
 Frame = +1

Query  124   EVPATRTDASAQDVSY---DAED--DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHL  288
             E+PA         +S+   + ED  DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L
Sbjct  14    EIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFL  73

Query  289   RAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALH  468
              AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH
Sbjct  74    HAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALH  133

Query  469   RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ  648
             +HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQ
Sbjct  134   KHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQ  193

Query  649   IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  828
             IGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL
Sbjct  194   IGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  253

Query  829   AKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR  1008
             AKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNR
Sbjct  254   AKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNR  313

Query  1009  ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAA  1188
             ADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A
Sbjct  314   ADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGA  373

Query  1189  EIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +I +ICQE+GM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  374   DINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  418



>ref|XP_001498459.1| PREDICTED: 26S protease regulatory subunit 6B isoform 1 [Equus 
caballus]
 ref|XP_004694174.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Condylura 
cristata]
 ref|XP_006871488.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Chrysochloris 
asiatica]
 ref|XP_008530303.1| PREDICTED: 26S protease regulatory subunit 6B [Equus przewalskii]
Length=418

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/405 (79%), Positives = 360/405 (89%), Gaps = 5/405 (1%)
 Frame = +1

Query  124   EVPATRTDASAQDVSY---DAED--DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHL  288
             E+PA         +S+   + ED  DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L
Sbjct  14    EIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFL  73

Query  289   RAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALH  468
              AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH
Sbjct  74    HAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALH  133

Query  469   RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ  648
             +HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQ
Sbjct  134   KHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQ  193

Query  649   IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  828
             IGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL
Sbjct  194   IGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  253

Query  829   AKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR  1008
             AKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNR
Sbjct  254   AKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNR  313

Query  1009  ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAA  1188
             ADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A
Sbjct  314   ADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGA  373

Query  1189  EIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +I +ICQE+GM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  374   DINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  418



>ref|XP_008612954.1| 26S protease regulatory subunit 6B [Saprolegnia diclina VS20]
 gb|EQC33731.1| 26S protease regulatory subunit 6B [Saprolegnia diclina VS20]
 gb|KDO28098.1| 26S protease regulatory subunit 6B [Saprolegnia parasitica CBS 
223.65]
Length=405

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/392 (79%), Positives = 359/392 (92%), Gaps = 0/392 (0%)
 Frame = +1

Query  145   DASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSV  324
             D +   +S   EDD++++ K+LQR LEF++IQE Y+KDE+KNL+RE +RA+EEVKRIQSV
Sbjct  13    DVAMLPLSDKQEDDMFSKYKALQRHLEFLDIQEGYIKDEMKNLKRELIRAKEEVKRIQSV  72

Query  325   PLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPP  504
             PLVIGQF+EM+D N  IVGST GSNYYVRILST++RE LKP++SVALHRHS+A+V +LPP
Sbjct  73    PLVIGQFLEMVDANYGIVGSTAGSNYYVRILSTLDRERLKPNSSVALHRHSHAVVAILPP  132

Query  505   EADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLY  684
             E+DSSI ++  SE+PDV+Y+DIGG D+QKQE+REAVELPLTH +LYKQIG+DPPRGVL+Y
Sbjct  133   ESDSSIQMMQMSERPDVSYSDIGGMDVQKQEVREAVELPLTHFDLYKQIGVDPPRGVLMY  192

Query  685   GPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFID  864
             GPPGTGKTMLAKAVAN TTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+PAI+FID
Sbjct  193   GPPGTGKTMLAKAVANATTASFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIVFID  252

Query  865   EVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPG  1044
             EVDAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ  NVKVIMATNRADTLDPALLRPG
Sbjct  253   EVDAIATKRFDAQTGADREVQRILLELLNQMDGFDQATNVKVIMATNRADTLDPALLRPG  312

Query  1045  RLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMH  1224
             RLDRKIEFPLPDRRQKRL++Q CTA MNLGDEVDLEDYV+RP+KIS+A+IA+ICQEAG+ 
Sbjct  313   RLDRKIEFPLPDRRQKRLIYQACTANMNLGDEVDLEDYVNRPEKISSADIASICQEAGLQ  372

Query  1225  AVRKNRYVILPKDFEKGYRTNVKKPDTDFEFY  1320
             AVRKNRYVILPKDF+KGY+  +K+ DT F+FY
Sbjct  373   AVRKNRYVILPKDFDKGYKNAIKRADTTFDFY  404



>ref|XP_006096781.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Myotis 
lucifugus]
 ref|XP_006763730.1| PREDICTED: 26S protease regulatory subunit 6B [Myotis davidii]
 ref|XP_008137819.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Eptesicus 
fuscus]
Length=418

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/405 (79%), Positives = 360/405 (89%), Gaps = 5/405 (1%)
 Frame = +1

Query  124   EVPA---TRTDASAQDVSYDAED--DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHL  288
             E+PA   TR       +  + ED  DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L
Sbjct  14    EIPALSVTRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFL  73

Query  289   RAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALH  468
              AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH
Sbjct  74    HAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALH  133

Query  469   RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ  648
             +HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQ
Sbjct  134   KHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQ  193

Query  649   IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  828
             IGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL
Sbjct  194   IGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  253

Query  829   AKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR  1008
             AKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNR
Sbjct  254   AKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNR  313

Query  1009  ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAA  1188
             ADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A
Sbjct  314   ADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGA  373

Query  1189  EIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +I +ICQE+GM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  374   DINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  418



>ref|XP_008428901.1| PREDICTED: 26S protease regulatory subunit 6B [Poecilia reticulata]
Length=417

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/419 (77%), Positives = 367/419 (88%), Gaps = 4/419 (1%)
 Frame = +1

Query  73    MATPMVLDPNPTPKPSFEVPATRTDASAQDVSYDAED--DLYARLKSLQRQLEFIEIQEE  246
             M   +V++ +P   PS  V ++R       ++ + ED  DLY R K LQ++LEF+E+QEE
Sbjct  1     MEDCVVVEKSPEELPS--VLSSRPHTGLSFLAPEPEDLEDLYTRYKKLQQELEFLEVQEE  58

Query  247   YVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTI  426
             Y+KDE KNL++E L AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI
Sbjct  59    YIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTI  118

Query  427   NRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIRE  606
             +RELLKP+ASVALH+HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+RE
Sbjct  119   DRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVRE  178

Query  607   AVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKY  786
             AVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKY
Sbjct  179   AVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKY  238

Query  787   LGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGF  966
             LGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGF
Sbjct  239   LGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGF  298

Query  967   DQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVD  1146
             DQ VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVD
Sbjct  299   DQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVD  358

Query  1147  LEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             LEDYV+RPDKIS A+I +ICQEAGM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  359   LEDYVARPDKISGADINSICQEAGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  417



>ref|NP_956044.2| 26S protease regulatory subunit 6B [Danio rerio]
 emb|CAQ15368.1| novel protein (zgc:63709) [Danio rerio]
Length=418

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/409 (79%), Positives = 362/409 (89%), Gaps = 5/409 (1%)
 Frame = +1

Query  112   KPSFEVPATRTDASAQDVSYDA---ED--DLYARLKSLQRQLEFIEIQEEYVKDELKNLR  276
             KP  +VPA         +S+ A   ED  DLY+  K LQ++LEF+E+QEEY+KDE KNL+
Sbjct  10    KPQDDVPALLNSRPQTGLSFLAPEPEDLEDLYSIYKKLQQELEFLEVQEEYIKDEQKNLK  69

Query  277   REHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSAS  456
             +E L AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+AS
Sbjct  70    KEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNAS  129

Query  457   VALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHE  636
             VALH+HSNALVDVLPPEADSSI +L+  +KPDV Y+DIGG DIQKQE+REAVELPLTH E
Sbjct  130   VALHKHSNALVDVLPPEADSSIMMLTSDQKPDVLYSDIGGMDIQKQEVREAVELPLTHFE  189

Query  637   LYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRD  816
             LYKQIGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRD
Sbjct  190   LYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRD  249

Query  817   VFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIM  996
             VFRLAKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIM
Sbjct  250   VFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIM  309

Query  997   ATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDK  1176
             ATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVF   T+KMNL +EVDLEDYV+RPDK
Sbjct  310   ATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITSKMNLSEEVDLEDYVARPDK  369

Query  1177  ISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             IS A+I +ICQEAGM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  370   ISGADINSICQEAGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  418



>ref|NP_001083300.1| proteasome 26S ATPase subunit 4 isoform 1 [Xenopus laevis]
 gb|AAH60362.1| Psmc4 protein [Xenopus laevis]
Length=420

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/381 (82%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L AQEEVKRIQS+PLVIGQF+E +D
Sbjct  40    EDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVD  99

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH+HSNALVDVLPPEADSSI++L+  
Sbjct  100   QNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSITMLTAD  159

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             +KPDV Y+DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  160   QKPDVLYSDIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  219

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  220   AVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  279

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  280   QTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  339

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   T+ MNL +EVDLEDYV+RPDKIS A+I +ICQEAGM AVR+NRY++L K
Sbjct  340   RRQKRLIFSTITSNMNLSEEVDLEDYVARPDKISGADINSICQEAGMLAVRENRYIVLAK  399

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEK Y+T +KK + + EFYK
Sbjct  400   DFEKAYKTVIKKDEQEHEFYK  420



>ref|NP_006494.1| 26S protease regulatory subunit 6B isoform 1 [Homo sapiens]
 ref|NP_001030255.1| 26S protease regulatory subunit 6B [Bos taurus]
 ref|NP_001253265.1| 26S protease regulatory subunit 6B [Macaca mulatta]
 ref|NP_001271757.1| 26S protease regulatory subunit 6B [Macaca fascicularis]
 ref|XP_001141307.1| PREDICTED: 26S protease regulatory subunit 6B [Pan troglodytes]
 ref|XP_002723309.1| PREDICTED: 26S protease regulatory subunit 6B [Oryctolagus cuniculus]
 ref|XP_002923751.1| PREDICTED: 26S protease regulatory subunit 6B [Ailuropoda melanoleuca]
 ref|XP_003270413.1| PREDICTED: 26S protease regulatory subunit 6B isoform 1 [Nomascus 
leucogenys]
 ref|XP_003779230.1| PREDICTED: 26S protease regulatory subunit 6B [Pongo abelii]
 ref|XP_003802167.1| PREDICTED: 26S protease regulatory subunit 6B isoform 1 [Otolemur 
garnettii]
 ref|XP_003812544.1| PREDICTED: 26S protease regulatory subunit 6B [Pan paniscus]
 ref|XP_003915578.1| PREDICTED: 26S protease regulatory subunit 6B [Papio anubis]
 ref|XP_004015299.1| PREDICTED: 26S protease regulatory subunit 6B [Ovis aries]
 ref|XP_004060779.1| PREDICTED: 26S protease regulatory subunit 6B isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004271336.1| PREDICTED: 26S protease regulatory subunit 6B isoform 1 [Orcinus 
orca]
 ref|XP_004390920.1| PREDICTED: 26S protease regulatory subunit 6B isoform 1 [Trichechus 
manatus latirostris]
 ref|XP_004396425.1| PREDICTED: 26S protease regulatory subunit 6B isoform 1 [Odobenus 
rosmarus divergens]
 ref|XP_004474080.1| PREDICTED: 26S protease regulatory subunit 6B isoform 1 [Dasypus 
novemcinctus]
 ref|XP_004710381.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Echinops 
telfairi]
 ref|XP_004776204.1| PREDICTED: 26S protease regulatory subunit 6B isoform X4 [Mustela 
putorius furo]
 ref|XP_004810266.1| PREDICTED: 26S protease regulatory subunit 6B isoform X4 [Mustela 
putorius furo]
 ref|XP_004878582.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Heterocephalus 
glaber]
 ref|XP_004874225.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Heterocephalus 
glaber]
 ref|XP_005336482.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Ictidomys 
tridecemlineatus]
 ref|XP_005616634.1| PREDICTED: 26S protease regulatory subunit 6B isoform X2 [Canis 
lupus familiaris]
 ref|XP_005692463.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Capra 
hircus]
 ref|XP_005890624.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Bos 
mutus]
 ref|XP_005963545.1| PREDICTED: 26S protease regulatory subunit 6B isoform X2 [Pantholops 
hodgsonii]
 ref|XP_006177995.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Camelus 
ferus]
 ref|XP_006215085.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Vicugna 
pacos]
 ref|XP_006140450.1| PREDICTED: 26S protease regulatory subunit 6B [Tupaia chinensis]
 ref|XP_006743470.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Leptonychotes 
weddellii]
 ref|XP_006905464.1| PREDICTED: 26S protease regulatory subunit 6B [Pteropus alecto]
 ref|XP_007087277.1| PREDICTED: 26S protease regulatory subunit 6B [Panthera tigris 
altaica]
 ref|XP_007128133.1| PREDICTED: 26S protease regulatory subunit 6B [Physeter catodon]
 ref|XP_006050106.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Bubalus 
bubalis]
 ref|XP_007180032.1| PREDICTED: 26S protease regulatory subunit 6B [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007458721.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Lipotes 
vexillifer]
 ref|XP_007941182.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Orycteropus 
afer afer]
 ref|XP_007994995.1| PREDICTED: 26S protease regulatory subunit 6B [Chlorocebus sabaeus]
 ref|XP_008052941.1| PREDICTED: 26S protease regulatory subunit 6B [Tarsius syrichta]
 ref|XP_008580502.1| PREDICTED: 26S protease regulatory subunit 6B [Galeopterus variegatus]
 ref|XP_010379185.1| PREDICTED: 26S protease regulatory subunit 6B [Rhinopithecus 
roxellana]
 ref|XP_010612801.1| PREDICTED: 26S protease regulatory subunit 6B [Fukomys damarensis]
 ref|XP_010847530.1| PREDICTED: 26S protease regulatory subunit 6B [Bison bison bison]
 ref|XP_010945546.1| PREDICTED: 26S protease regulatory subunit 6B [Camelus bactrianus]
 ref|XP_010983490.1| PREDICTED: 26S protease regulatory subunit 6B [Camelus dromedarius]
 ref|XP_011288187.1| PREDICTED: 26S protease regulatory subunit 6B [Felis catus]
 ref|XP_011839373.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Mandrillus 
leucophaeus]
 ref|XP_011839380.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Mandrillus 
leucophaeus]
 ref|XP_011807847.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Colobus 
angolensis palliatus]
 ref|XP_011807848.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Colobus 
angolensis palliatus]
 ref|XP_011942068.1| PREDICTED: 26S protease regulatory subunit 6B [Cercocebus atys]
 ref|XP_011986521.1| PREDICTED: 26S protease regulatory subunit 6B [Ovis aries musimon]
 sp|P43686.2|PRS6B_HUMAN RecName: Full=26S protease regulatory subunit 6B; AltName: Full=26S 
proteasome AAA-ATPase subunit RPT3; AltName: Full=MB67-interacting 
protein; AltName: Full=MIP224; AltName: Full=Proteasome 
26S subunit ATPase 4; AltName: Full=Tat-binding protein 
7; Short=TBP-7 [Homo sapiens]
 sp|Q4R7L3.1|PRS6B_MACFA RecName: Full=26S protease regulatory subunit 6B; AltName: Full=26S 
proteasome AAA-ATPase subunit RPT3; AltName: Full=Proteasome 
26S subunit ATPase 4 [Macaca fascicularis]
 sp|Q3T030.1|PRS6B_BOVIN RecName: Full=26S protease regulatory subunit 6B; AltName: Full=26S 
proteasome AAA-ATPase subunit RPT3; AltName: Full=Proteasome 
26S subunit ATPase 4 [Bos taurus]
 gb|AAD39267.1|AC007842_2 ATPase homolog [Homo sapiens]
 gb|AAC26843.1| 26S proteasome ATPase subunit [Homo sapiens]
 gb|AAC99817.1| MIP224 [Homo sapiens]
 gb|AAH00343.1| Proteasome (prosome, macropain) 26S subunit, ATPase, 4 [Homo 
sapiens]
 gb|AAH14488.1| Proteasome (prosome, macropain) 26S subunit, ATPase, 4 [Homo 
sapiens]
 gb|AAP35896.1| proteasome (prosome, macropain) 26S subunit, ATPase, 4 [Homo 
sapiens]
 gb|AAX41690.1| proteasome 26S subunit 4 [synthetic construct]
 dbj|BAE00909.1| unnamed protein product [Macaca fascicularis]
 gb|AAI02596.1| Proteasome (prosome, macropain) 26S subunit, ATPase, 4 [Bos taurus]
 gb|EAW56929.1| proteasome (prosome, macropain) 26S subunit, ATPase, 4, isoform 
CRA_b [Homo sapiens]
 gb|ABM82801.1| proteasome (prosome, macropain) 26S subunit, ATPase, 4 [synthetic 
construct]
 gb|ABM85802.1| proteasome (prosome, macropain) 26S subunit, ATPase, 4 [synthetic 
construct]
 dbj|BAF82974.1| unnamed protein product [Homo sapiens]
 dbj|BAG36000.1| unnamed protein product [Homo sapiens]
 tpg|DAA19919.1| TPA: 26S protease regulatory subunit 6B [Bos taurus]
 gb|EHA99106.1| 26S protease regulatory subunit 6B [Heterocephalus glaber]
 gb|EHH30037.1| hypothetical protein EGK_10613 [Macaca mulatta]
 gb|EHH59583.1| hypothetical protein EGM_09728 [Macaca fascicularis]
 gb|ELK18210.1| 26S protease regulatory subunit 6B [Pteropus alecto]
 gb|ELR60149.1| 26S protease regulatory subunit 6B [Bos mutus]
 gb|AIC49509.1| PSMC4, partial [synthetic construct]
Length=418

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/405 (79%), Positives = 360/405 (89%), Gaps = 5/405 (1%)
 Frame = +1

Query  124   EVPATRTDASAQDVSY---DAED--DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHL  288
             E+PA         +S+   + ED  DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L
Sbjct  14    EIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFL  73

Query  289   RAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALH  468
              AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH
Sbjct  74    HAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALH  133

Query  469   RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ  648
             +HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQ
Sbjct  134   KHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQ  193

Query  649   IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  828
             IGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL
Sbjct  194   IGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  253

Query  829   AKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR  1008
             AKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNR
Sbjct  254   AKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNR  313

Query  1009  ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAA  1188
             ADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A
Sbjct  314   ADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGA  373

Query  1189  EIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +I +ICQE+GM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  374   DINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  418



>ref|XP_011763084.1| PREDICTED: 26S protease regulatory subunit 6B [Macaca nemestrina]
Length=418

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/405 (79%), Positives = 360/405 (89%), Gaps = 5/405 (1%)
 Frame = +1

Query  124   EVPATRTDASAQDVSY---DAED--DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHL  288
             E+PA         +S+   + ED  DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L
Sbjct  14    EIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFL  73

Query  289   RAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALH  468
              AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH
Sbjct  74    HAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALH  133

Query  469   RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ  648
             +HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQ
Sbjct  134   KHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQ  193

Query  649   IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  828
             IGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL
Sbjct  194   IGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  253

Query  829   AKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR  1008
             AKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNR
Sbjct  254   AKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNR  313

Query  1009  ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAA  1188
             ADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A
Sbjct  314   ADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGA  373

Query  1189  EIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +I +ICQE+GM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  374   DINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  418



>gb|EPZ35598.1| 26S protease regulatory subunit 6B-like protein [Rozella allomycis 
CSF55]
Length=397

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/396 (81%), Positives = 350/396 (88%), Gaps = 2/396 (1%)
 Frame = +1

Query  142   TDASAQDVSYDA--EDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRI  315
             TD S    S+    E DLY R K LQRQLEF+ +QEEY+KDE KNL+ E LRAQEEVKRI
Sbjct  2     TDVSPNPASFKKQEEKDLYIRYKKLQRQLEFLNLQEEYIKDEQKNLKSELLRAQEEVKRI  61

Query  316   QSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDV  495
             +SVPL IGQF+E ID+N  I+GS +GSN  VRILST++RELLKP  SVALHRHS+A+VD+
Sbjct  62    KSVPLTIGQFLEPIDENTGIIGSASGSNTVVRILSTLDRELLKPGCSVALHRHSSAIVDI  121

Query  496   LPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGV  675
             LPPEADSSISLLS  EKPDVTY DIGG D+QKQEIREAVELPLTH +LYKQIGIDPPRGV
Sbjct  122   LPPEADSSISLLSADEKPDVTYADIGGLDMQKQEIREAVELPLTHFDLYKQIGIDPPRGV  181

Query  676   LLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAII  855
             LLYGPPGTGKTML KAVANHTTA+FIRVVGSEFVQKYLGEGPRMVRD+F+LAKENAP+I+
Sbjct  182   LLYGPPGTGKTMLVKAVANHTTASFIRVVGSEFVQKYLGEGPRMVRDIFKLAKENAPSIV  241

Query  856   FIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALL  1035
             FIDE+DAIAT RFDAQTGADREVQRIL+ELL QMDGFDQ+VNVKVIMATNRADTLDPALL
Sbjct  242   FIDEIDAIATKRFDAQTGADREVQRILIELLTQMDGFDQSVNVKVIMATNRADTLDPALL  301

Query  1036  RPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEA  1215
             RPGRLDRKIEFP PDRRQKRL+FQ  T+KMNL DEVDLED+VSRPDK+S AEIAAICQEA
Sbjct  302   RPGRLDRKIEFPTPDRRQKRLIFQAITSKMNLSDEVDLEDFVSRPDKLSGAEIAAICQEA  361

Query  1216  GMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             GM AVRKNRYVIL KD EKGY + VKK D DFEFYK
Sbjct  362   GMLAVRKNRYVILNKDLEKGYSSQVKKTDLDFEFYK  397



>gb|EPQ09332.1| 26S protease regulatory subunit 6B [Myotis brandtii]
Length=413

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/405 (79%), Positives = 360/405 (89%), Gaps = 5/405 (1%)
 Frame = +1

Query  124   EVPA---TRTDASAQDVSYDAED--DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHL  288
             E+PA   TR       +  + ED  DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L
Sbjct  9     EIPALSVTRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFL  68

Query  289   RAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALH  468
              AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH
Sbjct  69    HAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALH  128

Query  469   RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ  648
             +HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQ
Sbjct  129   KHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQ  188

Query  649   IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  828
             IGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL
Sbjct  189   IGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  248

Query  829   AKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR  1008
             AKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNR
Sbjct  249   AKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNR  308

Query  1009  ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAA  1188
             ADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A
Sbjct  309   ADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGA  368

Query  1189  EIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +I +ICQE+GM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  369   DINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  413



>ref|XP_011616501.1| PREDICTED: 26S protease regulatory subunit 6B isoform X2 [Takifugu 
rubripes]
Length=404

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/381 (82%), Positives = 351/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L AQEEVKRIQS+PLVIGQF+E +D
Sbjct  24    EDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVD  83

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH+HSNALVDVLPPEADSSI +L+  
Sbjct  84    QNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSD  143

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  144   QKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  203

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  204   AVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  263

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  264   QTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  323

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A+I +ICQEAGM AVR+NRY++L K
Sbjct  324   RRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQEAGMLAVRENRYIVLAK  383

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEK Y+T +KK + + EFYK
Sbjct  384   DFEKAYKTVIKKDEQEHEFYK  404



>ref|NP_001008010.1| proteasome 26S ATPase subunit 4 isoform 1 [Xenopus (Silurana) 
tropicalis]
 gb|AAH80888.1| proteasome (prosome, macropain) 26S subunit, ATPase, 4 [Xenopus 
(Silurana) tropicalis]
 emb|CAJ83257.1| Psmc4 [Xenopus (Silurana) tropicalis]
Length=420

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/381 (82%), Positives = 351/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L AQEEVKRIQS+PLVIGQF+E +D
Sbjct  40    EDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVD  99

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH+HSNALVDVLPPEADSSI +L+  
Sbjct  100   QNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSD  159

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             +KPDV Y+DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  160   QKPDVLYSDIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  219

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  220   AVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  279

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  280   QTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  339

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A+I +ICQE GM AVR+NRY++L K
Sbjct  340   RRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQEGGMLAVRENRYIVLAK  399

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEK Y+T +KK + + EFYK
Sbjct  400   DFEKAYKTVIKKDEQEHEFYK  420



>ref|XP_005086609.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Mesocricetus 
auratus]
 ref|XP_006996524.1| PREDICTED: 26S protease regulatory subunit 6B [Peromyscus maniculatus 
bairdii]
 ref|XP_008852196.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Nannospalax 
galili]
 ref|XP_008852197.1| PREDICTED: 26S protease regulatory subunit 6B isoform X2 [Nannospalax 
galili]
Length=418

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/405 (79%), Positives = 360/405 (89%), Gaps = 5/405 (1%)
 Frame = +1

Query  124   EVPATRTDASAQDVSY---DAED--DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHL  288
             E+PA         +S+   + ED  DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L
Sbjct  14    EIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFL  73

Query  289   RAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALH  468
              AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH
Sbjct  74    HAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALH  133

Query  469   RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ  648
             +HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQ
Sbjct  134   KHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQ  193

Query  649   IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  828
             IGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL
Sbjct  194   IGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  253

Query  829   AKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR  1008
             AKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNR
Sbjct  254   AKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNR  313

Query  1009  ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAA  1188
             ADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A
Sbjct  314   ADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGA  373

Query  1189  EIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +I +ICQE+GM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  374   DINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  418



>gb|KDD74891.1| AAA+ ATPase [Helicosporidium sp. ATCC 50920]
Length=417

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/413 (78%), Positives = 362/413 (88%), Gaps = 4/413 (1%)
 Frame = +1

Query  88    VLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEE-YVKDEL  264
             V  P+   +P      +R  A + D+   A++DLY RLK+LQRQ+EF EIQ+E Y+K+E 
Sbjct  7     VQKPSAIAEPHAVGTVSRDGAGSADI---ADNDLYPRLKALQRQVEFAEIQQEDYIKEEQ  63

Query  265   KNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLK  444
             +NL+ E  RAQEEVKRIQ+VPLVIGQF+EM+D +  IVGSTTGSNYYVRILST+NRELLK
Sbjct  64    RNLKSELFRAQEEVKRIQAVPLVIGQFLEMVDDSTGIVGSTTGSNYYVRILSTLNRELLK  123

Query  445   PSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPL  624
             PSASVALHRHSNALVD+LPPEADS+IS++S +E+PDV+Y+DIGG D QKQEIREAVELPL
Sbjct  124   PSASVALHRHSNALVDILPPEADSTISVMSAAERPDVSYSDIGGLDAQKQEIREAVELPL  183

Query  625   THHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPR  804
             T   LY+QIGIDPPRGVLLYGPPGTGKTMLAKAVA+HTTA+FIRVVGSEFVQKYLGEGPR
Sbjct  184   TQGGLYEQIGIDPPRGVLLYGPPGTGKTMLAKAVAHHTTASFIRVVGSEFVQKYLGEGPR  243

Query  805   MVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNV  984
             MVRDVFRLAKENAPAIIF+DEVDAIATARFDAQTGADREVQRILMELL QMDGF+Q  +V
Sbjct  244   MVRDVFRLAKENAPAIIFVDEVDAIATARFDAQTGADREVQRILMELLTQMDGFEQNTHV  303

Query  985   KVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVS  1164
             KVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQ CTA MNL DEVDLEDYV 
Sbjct  304   KVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQACTAPMNLSDEVDLEDYVG  363

Query  1165  RPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             RPDKI+ AEI++ICQEAGM AVR NRYVILPKDFEK Y+  V+K    FEFYK
Sbjct  364   RPDKINNAEISSICQEAGMLAVRANRYVILPKDFEKAYKNVVRKSSDAFEFYK  416



>ref|NP_476463.1| 26S protease regulatory subunit 6B [Rattus norvegicus]
 ref|NP_036004.2| 26S protease regulatory subunit 6B [Mus musculus]
 sp|Q63570.1|PRS6B_RAT RecName: Full=26S protease regulatory subunit 6B; AltName: Full=26S 
proteasome AAA-ATPase subunit RPT3; AltName: Full=Proteasome 
26S subunit ATPase 4; Short=S6 ATPase; AltName: Full=Tat-binding 
protein 7; Short=TBP-7 [Rattus norvegicus]
 sp|P54775.2|PRS6B_MOUSE RecName: Full=26S protease regulatory subunit 6B; AltName: Full=26S 
proteasome AAA-ATPase subunit RPT3; AltName: Full=CIP21; 
AltName: Full=MB67-interacting protein; AltName: Full=MIP224; 
AltName: Full=Proteasome 26S subunit ATPase 4; AltName: 
Full=Tat-binding protein 7; Short=TBP-7 [Mus musculus]
 dbj|BAA09340.1| proteasomal ATPase (Tat-binding protein7) [Rattus norvegicus]
 gb|AAH12708.1| Proteasome (prosome, macropain) 26S subunit, ATPase, 4 [Mus musculus]
 dbj|BAC36835.1| unnamed protein product [Mus musculus]
 gb|AAH63145.1| Proteasome (prosome, macropain) 26S subunit, ATPase, 4 [Rattus 
norvegicus]
 dbj|BAE35967.1| unnamed protein product [Mus musculus]
 dbj|BAE32301.1| unnamed protein product [Mus musculus]
 dbj|BAE39209.1| unnamed protein product [Mus musculus]
 gb|EDL24160.1| proteasome (prosome, macropain) 26S subunit, ATPase, 4 [Mus musculus]
 gb|EDM07920.1| proteasome (prosome, macropain) 26S subunit, ATPase, 4, isoform 
CRA_a [Rattus norvegicus]
Length=418

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/405 (79%), Positives = 360/405 (89%), Gaps = 5/405 (1%)
 Frame = +1

Query  124   EVPATRTDASAQDVSY---DAED--DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHL  288
             E+PA         +S+   + ED  DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L
Sbjct  14    EIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFL  73

Query  289   RAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALH  468
              AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH
Sbjct  74    HAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALH  133

Query  469   RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ  648
             +HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQ
Sbjct  134   KHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQ  193

Query  649   IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  828
             IGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL
Sbjct  194   IGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  253

Query  829   AKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR  1008
             AKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNR
Sbjct  254   AKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNR  313

Query  1009  ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAA  1188
             ADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A
Sbjct  314   ADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGA  373

Query  1189  EIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +I +ICQE+GM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  374   DINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  418



>ref|XP_004571155.1| PREDICTED: 26S protease regulatory subunit 6B-like isoform X1 
[Maylandia zebra]
 ref|XP_005753182.1| PREDICTED: 26S protease regulatory subunit 6B-like [Pundamilia 
nyererei]
 ref|XP_005948302.1| PREDICTED: 26S protease regulatory subunit 6B-like [Haplochromis 
burtoni]
Length=417

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/414 (78%), Positives = 360/414 (87%), Gaps = 11/414 (3%)
 Frame = +1

Query  82    PMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDE  261
             P VL   P    SF  P        +D+     +DLY R K LQ++LEF+E+QEEY+KDE
Sbjct  15    PAVLSSRPQTGLSFLAP------EPEDL-----EDLYTRYKKLQQELEFLEVQEEYIKDE  63

Query  262   LKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELL  441
              KNL++E L AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELL
Sbjct  64    QKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELL  123

Query  442   KPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELP  621
             KP+ASVALH+HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELP
Sbjct  124   KPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELP  183

Query  622   LTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGP  801
             LTH ELYKQIGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGP
Sbjct  184   LTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGP  243

Query  802   RMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVN  981
             RMVRDVFRLAKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VN
Sbjct  244   RMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVN  303

Query  982   VKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYV  1161
             VKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV
Sbjct  304   VKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYV  363

Query  1162  SRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +RPDKIS A+I +ICQEAGM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  364   ARPDKISGADINSICQEAGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  417



>ref|XP_005868901.1| PREDICTED: 26S protease regulatory subunit 6B [Myotis brandtii]
Length=408

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/405 (79%), Positives = 360/405 (89%), Gaps = 5/405 (1%)
 Frame = +1

Query  124   EVPA---TRTDASAQDVSYDAED--DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHL  288
             E+PA   TR       +  + ED  DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L
Sbjct  4     EIPALSVTRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFL  63

Query  289   RAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALH  468
              AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH
Sbjct  64    HAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALH  123

Query  469   RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ  648
             +HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQ
Sbjct  124   KHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQ  183

Query  649   IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  828
             IGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL
Sbjct  184   IGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  243

Query  829   AKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR  1008
             AKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNR
Sbjct  244   AKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNR  303

Query  1009  ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAA  1188
             ADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A
Sbjct  304   ADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGA  363

Query  1189  EIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +I +ICQE+GM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  364   DINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  408



>gb|AAP36910.1| Homo sapiens proteasome (prosome, macropain) 26S subunit, ATPase, 
4 [synthetic construct]
 gb|AAX43328.1| proteasome 26S subunit 4, partial [synthetic construct]
 gb|AAX43329.1| proteasome 26S subunit 4, partial [synthetic construct]
Length=419

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/405 (79%), Positives = 360/405 (89%), Gaps = 5/405 (1%)
 Frame = +1

Query  124   EVPATRTDASAQDVSY---DAED--DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHL  288
             E+PA         +S+   + ED  DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L
Sbjct  14    EIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFL  73

Query  289   RAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALH  468
              AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH
Sbjct  74    HAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALH  133

Query  469   RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ  648
             +HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQ
Sbjct  134   KHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQ  193

Query  649   IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  828
             IGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL
Sbjct  194   IGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  253

Query  829   AKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR  1008
             AKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNR
Sbjct  254   AKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNR  313

Query  1009  ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAA  1188
             ADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A
Sbjct  314   ADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGA  373

Query  1189  EIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +I +ICQE+GM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  374   DINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  418



>ref|XP_003977146.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Takifugu 
rubripes]
Length=417

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/381 (82%), Positives = 351/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L AQEEVKRIQS+PLVIGQF+E +D
Sbjct  37    EDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVD  96

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH+HSNALVDVLPPEADSSI +L+  
Sbjct  97    QNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSD  156

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  157   QKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  216

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  217   AVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  276

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  277   QTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  336

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A+I +ICQEAGM AVR+NRY++L K
Sbjct  337   RRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQEAGMLAVRENRYIVLAK  396

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEK Y+T +KK + + EFYK
Sbjct  397   DFEKAYKTVIKKDEQEHEFYK  417



>ref|XP_006119266.1| PREDICTED: 26S protease regulatory subunit 6B-like [Pelodiscus 
sinensis]
Length=443

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/408 (78%), Positives = 359/408 (88%), Gaps = 0/408 (0%)
 Frame = +1

Query  100   NPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRR  279
             NP   P+  +   +T  S      +  +DLY+R K LQ++LEF+E+QEEY+KDE KNL++
Sbjct  36    NPDELPALAISRPQTSLSFLAPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKK  95

Query  280   EHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASV  459
             E L AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+ASV
Sbjct  96    EFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASV  155

Query  460   ALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHEL  639
             ALH+HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH EL
Sbjct  156   ALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFEL  215

Query  640   YKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDV  819
             YKQIGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDV
Sbjct  216   YKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDV  275

Query  820   FRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMA  999
             FRLAKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMA
Sbjct  276   FRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMA  335

Query  1000  TNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKI  1179
             TNRADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV+RPDKI
Sbjct  336   TNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKI  395

Query  1180  SAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             S A+I +ICQE GM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  396   SGADINSICQEGGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  443



>ref|XP_003451328.1| PREDICTED: 26S protease regulatory subunit 6B [Oreochromis niloticus]
Length=417

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/414 (78%), Positives = 360/414 (87%), Gaps = 11/414 (3%)
 Frame = +1

Query  82    PMVLDPNPTPKPSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDE  261
             P VL   P    SF  P        +D+     +DLY R K LQ++LEF+E+QEEY+KDE
Sbjct  15    PAVLSSRPQTGLSFLAP------EPEDL-----EDLYTRYKKLQQELEFLEVQEEYIKDE  63

Query  262   LKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELL  441
              KNL++E L AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELL
Sbjct  64    QKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELL  123

Query  442   KPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELP  621
             KP+ASVALH+HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELP
Sbjct  124   KPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELP  183

Query  622   LTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGP  801
             LTH ELYKQIGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGP
Sbjct  184   LTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGP  243

Query  802   RMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVN  981
             RMVRDVFRLAKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VN
Sbjct  244   RMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVN  303

Query  982   VKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYV  1161
             VKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV
Sbjct  304   VKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYV  363

Query  1162  SRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +RPDKIS A+I +ICQEAGM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  364   ARPDKISGADINSICQEAGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  417



>gb|EFB16330.1| hypothetical protein PANDA_012963, partial [Ailuropoda melanoleuca]
Length=406

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/405 (79%), Positives = 360/405 (89%), Gaps = 5/405 (1%)
 Frame = +1

Query  124   EVPATRTDASAQDVSY---DAED--DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHL  288
             E+PA         +S+   + ED  DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L
Sbjct  2     EIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFL  61

Query  289   RAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALH  468
              AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH
Sbjct  62    HAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALH  121

Query  469   RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ  648
             +HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQ
Sbjct  122   KHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQ  181

Query  649   IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  828
             IGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL
Sbjct  182   IGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  241

Query  829   AKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR  1008
             AKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNR
Sbjct  242   AKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNR  301

Query  1009  ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAA  1188
             ADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A
Sbjct  302   ADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGA  361

Query  1189  EIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +I +ICQE+GM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  362   DINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  406



>ref|XP_008322263.1| PREDICTED: 26S protease regulatory subunit 6B isoform X2 [Cynoglossus 
semilaevis]
Length=432

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/381 (82%), Positives = 351/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L AQEEVKRIQS+PLVIGQF+E +D
Sbjct  52    EDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVD  111

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH+HSNALVDVLPPEADSSI +L+  
Sbjct  112   QNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSD  171

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  172   QKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  231

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  232   AVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  291

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  292   QTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  351

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A+I +ICQEAGM AVR+NRY++L K
Sbjct  352   RRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQEAGMLAVRENRYIVLAK  411

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEK Y+T +KK + + EFYK
Sbjct  412   DFEKAYKTVIKKDEQEHEFYK  432



>gb|EGW06399.1| 26S protease regulatory subunit 6B, partial [Cricetulus griseus]
Length=409

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/405 (79%), Positives = 360/405 (89%), Gaps = 5/405 (1%)
 Frame = +1

Query  124   EVPATRTDASAQDVSY---DAED--DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHL  288
             E+PA         +S+   + ED  DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L
Sbjct  5     EIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFL  64

Query  289   RAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALH  468
              AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH
Sbjct  65    HAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALH  124

Query  469   RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ  648
             +HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQ
Sbjct  125   KHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQ  184

Query  649   IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  828
             IGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL
Sbjct  185   IGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  244

Query  829   AKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR  1008
             AKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNR
Sbjct  245   AKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNR  304

Query  1009  ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAA  1188
             ADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A
Sbjct  305   ADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGA  364

Query  1189  EIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +I +ICQE+GM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  365   DINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  409



>dbj|BAE39598.1| unnamed protein product [Mus musculus]
Length=418

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/403 (78%), Positives = 359/403 (89%), Gaps = 0/403 (0%)
 Frame = +1

Query  115   PSFEVPATRTDASAQDVSYDAEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRA  294
             P+  V   +T  S+     +  +DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L A
Sbjct  16    PALSVSRPQTGLSSLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHA  75

Query  295   QEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRH  474
             QEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH+H
Sbjct  76    QEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKH  135

Query  475   SNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIG  654
             SNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQIG
Sbjct  136   SNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIG  195

Query  655   IDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAK  834
             IDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFV+KYLGEGPRMVRDVFRLAK
Sbjct  196   IDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVKKYLGEGPRMVRDVFRLAK  255

Query  835   ENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRAD  1014
             ENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNRAD
Sbjct  256   ENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRAD  315

Query  1015  TLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEI  1194
             TLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A+I
Sbjct  316   TLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADI  375

Query  1195  AAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
              +ICQE+GM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  376   NSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  418



>gb|ACO09848.1| 26S protease regulatory subunit 6B [Osmerus mordax]
Length=418

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/381 (82%), Positives = 350/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L AQEEVKRIQS+PLVIGQF+E +D
Sbjct  38    EDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVD  97

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH+HSNALVDVLPPEADSSI +L+  
Sbjct  98    QNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSD  157

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  158   QKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  217

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  218   AVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  277

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  278   QTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  337

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRLVF   T+ MNL +EVDLEDYV+RPDKIS A+I +ICQEAGM AVR+NRY++L K
Sbjct  338   RRQKRLVFSTITSNMNLSEEVDLEDYVARPDKISGADINSICQEAGMLAVRENRYIVLAK  397

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEK Y+T +KK + + EFYK
Sbjct  398   DFEKAYKTVIKKDEQEHEFYK  418



>ref|XP_005313327.1| PREDICTED: 26S protease regulatory subunit 6B [Chrysemys picta 
bellii]
 ref|XP_007069897.1| PREDICTED: 26S protease regulatory subunit 6B-like isoform X1 
[Chelonia mydas]
Length=418

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/381 (82%), Positives = 350/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L AQEEVKRIQS+PLVIGQF+E +D
Sbjct  38    EDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVD  97

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH+HSNALVDVLPPEADSSI +L+  
Sbjct  98    QNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSD  157

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  158   QKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  217

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  218   AVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  277

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  278   QTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  337

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A+I +ICQE GM AVR+NRY++L K
Sbjct  338   RRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQEGGMLAVRENRYIVLAK  397

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEK Y+T +KK + + EFYK
Sbjct  398   DFEKAYKTVIKKDEQEHEFYK  418



>ref|XP_005371358.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Microtus 
ochrogaster]
Length=418

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/381 (82%), Positives = 351/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L AQEEVKRIQS+PLVIGQF+E +D
Sbjct  38    EDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVD  97

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH+HSNALVDVLPPEADSSI +L+  
Sbjct  98    QNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSD  157

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  158   QKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  217

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  218   AVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  277

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  278   QTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  337

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A+I +ICQE+GM AVR+NRY++L K
Sbjct  338   RRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAK  397

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEK Y+T +KK + + EFYK
Sbjct  398   DFEKAYKTVIKKDEQEHEFYK  418



>ref|XP_008322262.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Cynoglossus 
semilaevis]
Length=452

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/381 (82%), Positives = 351/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L AQEEVKRIQS+PLVIGQF+E +D
Sbjct  72    EDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVD  131

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH+HSNALVDVLPPEADSSI +L+  
Sbjct  132   QNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSD  191

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  192   QKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  251

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  252   AVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  311

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  312   QTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  371

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A+I +ICQEAGM AVR+NRY++L K
Sbjct  372   RRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQEAGMLAVRENRYIVLAK  431

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEK Y+T +KK + + EFYK
Sbjct  432   DFEKAYKTVIKKDEQEHEFYK  452



>ref|XP_002733557.1| PREDICTED: 26S protease regulatory subunit 6B-like [Saccoglossus 
kowalevskii]
Length=392

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/374 (84%), Positives = 346/374 (93%), Gaps = 0/374 (0%)
 Frame = +1

Query  202   KSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVG  381
             + L  QLEF+E+QEEY+KDE KNL++E+L AQEEVKRIQSVPLVIGQF+E +DQN  IVG
Sbjct  19    QKLGMQLEFLEVQEEYIKDEQKNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVDQNTGIVG  78

Query  382   STTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTY  561
             STTGSNYY+RILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSI++LS  E+PDV Y
Sbjct  79    STTGSNYYIRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSITMLSADERPDVCY  138

Query  562   NDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTT  741
             +DIGG D+QKQEIREAVELPLTHH+LYKQIGIDPPRGVLL+GPPG GKTMLAKAVA+HTT
Sbjct  139   SDIGGMDMQKQEIREAVELPLTHHDLYKQIGIDPPRGVLLFGPPGCGKTMLAKAVAHHTT  198

Query  742   AAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADRE  921
             A+FIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDAQTGADRE
Sbjct  199   ASFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADRE  258

Query  922   VQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLV  1101
             VQRIL+ELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFP+PDRRQKRL+
Sbjct  259   VQRILLELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPMPDRRQKRLI  318

Query  1102  FQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR  1281
             F     +MNL DEVDLEDYV+RPDKIS A+I AICQEAGM AVR+NRYVIL KDFEKGY+
Sbjct  319   FSTICNRMNLSDEVDLEDYVARPDKISGADINAICQEAGMQAVRENRYVILAKDFEKGYK  378

Query  1282  TNVKKPDTDFEFYK  1323
              N+KK + + EFYK
Sbjct  379   NNIKKDEQEHEFYK  392



>gb|EPY85975.1| 26S protease regulatory subunit 6B isoform 1 [Camelus ferus]
Length=430

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/409 (78%), Positives = 362/409 (89%), Gaps = 5/409 (1%)
 Frame = +1

Query  112   KPSFEVPATRTDASAQDVSY---DAED--DLYARLKSLQRQLEFIEIQEEYVKDELKNLR  276
             +P  E+PA         +S+   + ED  DLY+R K LQ++LEF+E+QEEY+KDE KNL+
Sbjct  22    QPKDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLK  81

Query  277   REHLRAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSAS  456
             +E L AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+AS
Sbjct  82    KEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNAS  141

Query  457   VALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHE  636
             VALH+HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH E
Sbjct  142   VALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFE  201

Query  637   LYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRD  816
             LYKQIGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRD
Sbjct  202   LYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRD  261

Query  817   VFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIM  996
             VFRLAKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIM
Sbjct  262   VFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIM  321

Query  997   ATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDK  1176
             ATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV+RPDK
Sbjct  322   ATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDK  381

Query  1177  ISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             IS A+I +ICQE+GM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  382   ISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  430



>ref|XP_007643926.1| PREDICTED: 26S protease regulatory subunit 6B isoform X1 [Cricetulus 
griseus]
Length=442

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/405 (79%), Positives = 360/405 (89%), Gaps = 5/405 (1%)
 Frame = +1

Query  124   EVPATRTDASAQDVSY---DAED--DLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHL  288
             E+PA         +S+   + ED  DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L
Sbjct  38    EIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFL  97

Query  289   RAQEEVKRIQSVPLVIGQFMEMIDQNNSIVGSTTGSNYYVRILSTINRELLKPSASVALH  468
              AQEEVKRIQS+PLVIGQF+E +DQN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH
Sbjct  98    HAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALH  157

Query  469   RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQ  648
             +HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQ
Sbjct  158   KHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQ  217

Query  649   IGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  828
             IGIDPPRGVL+YGPPG GKTMLAKAVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL
Sbjct  218   IGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRL  277

Query  829   AKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNR  1008
             AKENAPAIIFIDE+DAIAT RFDAQTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNR
Sbjct  278   AKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNR  337

Query  1009  ADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAA  1188
             ADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A
Sbjct  338   ADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGA  397

Query  1189  EIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK  1323
             +I +ICQE+GM AVR+NRY++L KDFEK Y+T +KK + + EFYK
Sbjct  398   DINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK  442



>ref|XP_003341107.1| PREDICTED: 26S protease regulatory subunit 6B [Monodelphis domestica]
Length=418

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/381 (82%), Positives = 350/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY+R K LQ++LEF+E+QEEY+KDE KNL++E L AQEEVKRIQS+PLVIGQF+E +D
Sbjct  38    EDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVD  97

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN +IVGSTTGSNYYVRILSTI+RELLKP+ASVALH+HSNALVDVLPPEADSSI +L+  
Sbjct  98    QNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSD  157

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  158   QKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  217

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  218   AVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  277

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQ VNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  278   QTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  337

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRL+F   T+KMNL +EVDLEDYV+RPDKIS A+I +ICQE GM AVR+NRY++L K
Sbjct  338   RRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQEGGMLAVRENRYIVLAK  397

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEK Y+T +KK + + EFYK
Sbjct  398   DFEKAYKTVIKKDEQEHEFYK  418



>ref|XP_002041940.1| GM11458 [Drosophila sechellia]
 gb|EDW45788.1| GM11458 [Drosophila sechellia]
Length=858

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/381 (83%), Positives = 352/381 (92%), Gaps = 0/381 (0%)
 Frame = +1

Query  181   DDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMID  360
             +DLY R K LQ+ LEFIE+QEEY+KDE +NL++E+L AQEEVKRIQSVPLVIGQF+E +D
Sbjct  478   EDLYVRYKKLQKTLEFIEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVD  537

Query  361   QNNSIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQS  540
             QN  IVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   
Sbjct  538   QNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQPD  597

Query  541   EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAK  720
             EKPDV+Y DIGG D+QKQEIREAVELPLTH ELYKQIGIDPPRGVL+YGPPG GKTMLAK
Sbjct  598   EKPDVSYADIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK  657

Query  721   AVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDA  900
             AVA+HTTA+FIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDE+DAIAT RFDA
Sbjct  658   AVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDA  717

Query  901   QTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  1080
             QTGADREVQRIL+ELLNQMDGFDQT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD
Sbjct  718   QTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPD  777

Query  1081  RRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPK  1260
             RRQKRLVF   T+KMNL ++VDLE++V+RPDKIS A+I AICQEAGMHAVR+NRY++L K
Sbjct  778   RRQKRLVFSTITSKMNLSEDVDLEEFVARPDKISGADINAICQEAGMHAVRENRYIVLAK  837

Query  1261  DFEKGYRTNVKKPDTDFEFYK  1323
             DFEKGY+ N+KK + + EFYK
Sbjct  838   DFEKGYKNNIKKDEQEHEFYK  858



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4348753807882