BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3296

Length=624
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009788474.1|  PREDICTED: uncharacterized protein LOC104236281  56.2    5e-06   Nicotiana sylvestris
ref|XP_009594997.1|  PREDICTED: uncharacterized protein LOC104091376  55.5    1e-05   Nicotiana tomentosiformis
gb|KHN30650.1|  Proteasome subunit alpha type-5                       53.1    5e-05   Glycine soja [wild soybean]
emb|CDP17086.1|  unnamed protein product                              53.1    6e-05   Coffea canephora [robusta coffee]
ref|XP_011079575.1|  PREDICTED: uncharacterized protein LOC105163...  51.2    2e-04   Sesamum indicum [beniseed]
ref|XP_011079576.1|  PREDICTED: uncharacterized protein LOC105163...  51.2    2e-04   Sesamum indicum [beniseed]
ref|XP_011079577.1|  PREDICTED: uncharacterized protein LOC105163...  51.2    2e-04   Sesamum indicum [beniseed]



>ref|XP_009788474.1| PREDICTED: uncharacterized protein LOC104236281 [Nicotiana sylvestris]
Length=737

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 69/123 (56%), Gaps = 15/123 (12%)
 Frame = +3

Query  198  MDTLCLK------agvggggggaaLDVRATLPSHVNASSVGRSCAV-VSVEKPSLSIPQR  356
            MD++CL       AG     G  ALDVRAT     + S+VGRS A  +SVEKPS S   +
Sbjct  1    MDSICLTGGIQGMAGPIAVAGTGALDVRAT---QFSTSAVGRSSAASMSVEKPSSSQRNK  57

Query  357  ISPRRLSFRT---YRWPGGRRRCVVMAGDDVVLIDENVKRRAAE--QKDSWVMKILRVRS  521
             +    SFR      W GG+ R   +A DD VL+DE  +++  E  Q  +WV+KIL VRS
Sbjct  58   NTSWGFSFRYPLRSFWSGGKGRYDAIAVDDAVLMDEKEEKKDEEEGQNGNWVLKILHVRS  117

Query  522  LRN  530
            LR+
Sbjct  118  LRS  120



>ref|XP_009594997.1| PREDICTED: uncharacterized protein LOC104091376 [Nicotiana tomentosiformis]
Length=743

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 67/125 (54%), Gaps = 18/125 (14%)
 Frame = +3

Query  198  MDTLCLK------agvggggggaaLDVRATLPSHVNASSVGRSCAV-VSVEKPSLSIPQR  356
            MD++CL       AG     G  ALDVRAT     + S+VGRS A  +SVEKPS S   R
Sbjct  1    MDSICLTGGIQGMAGPIAVAGTGALDVRAT---QFSTSAVGRSSAASMSVEKPSSSQRNR  57

Query  357  ISPRRLSFRT---YRWPGGRRRCVVMAGDDVVLIDENVKRRAAE-----QKDSWVMKILR  512
             +    SFR      W GG+ R   +A DD VL+DE  ++   +     Q  +WV+KIL 
Sbjct  58   NTSWGFSFRYPLRSFWSGGKGRYDAIAVDDAVLMDEKEEKIEEKKDEEGQNGNWVLKILH  117

Query  513  VRSLR  527
            VRS+R
Sbjct  118  VRSMR  122



>gb|KHN30650.1| Proteasome subunit alpha type-5 [Glycine soja]
Length=953

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 73/156 (47%), Gaps = 31/156 (20%)
 Frame = +3

Query  198  MDTLCLKagvgggggga-aLDVRATLPSHVNASSVGRSCAVVSVEKPSLSIPQRISPRRL  374
            M+T+CLK+G+      + +LD RA  PS V  S+VGR+ A    +KP    PQR    R 
Sbjct  1    METVCLKSGMVPTISISGSLDARAN-PSQV--STVGRAAA----DKP----PQRSVFSRF  49

Query  375  SF---RTYRWP-GGRRRCVVMAGDDVVLIDENVKRRAAE----------QKDSWVMKILR  512
            SF       WP G   R   +A DD VL D N + +A            Q  +WVMKIL 
Sbjct  50   SFWYPLESLWPRGNNSRYKGLALDDAVLADNNAEAKAVRDGGQGDGTERQTGNWVMKILH  109

Query  513  VRSLRNGGHKSCGLGNSEAAKIEGRISDAGEESDVC  620
            V+S+  G  +     N E   +  +     +E +VC
Sbjct  110  VKSVWEGKQR-----NEEDGTVHDQTQTNFDEEEVC  140



>emb|CDP17086.1| unnamed protein product [Coffea canephora]
Length=765

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 64/127 (50%), Gaps = 19/127 (15%)
 Frame = +3

Query  198  MDTLCLKagvggg----gggaaLDVR-ATLPSHVNASSVGRSCAVVSVEKPSLSIPQRI-  359
            MDTLCLK G+           + +VR A  PSH+ A++VGRS A +SV+KPS S   R  
Sbjct  1    MDTLCLKGGIHSLPPPIAVAGSFEVRSAHHPSHICANAVGRSSAAISVDKPSASSSHRDW  60

Query  360  -SPRRLSFRTYRWPGGRRR---CVVMAGDDVVLI----DENVKRRAAEQKD----SWVMK  503
                R  FR+  WP G +      +   D V ++    D+N + +     D    +WV K
Sbjct  61   GFSFRYPFRSL-WPKGGKSTYDAAISVKDAVPVLAEEKDDNDEEKYELDHDGRNGNWVFK  119

Query  504  ILRVRSL  524
            IL VRSL
Sbjct  120  ILHVRSL  126



>ref|XP_011079575.1| PREDICTED: uncharacterized protein LOC105163063 isoform X1 [Sesamum 
indicum]
Length=747

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 53/104 (51%), Gaps = 8/104 (8%)
 Frame = +3

Query  327  EKPSLS-IPQRISPRRLSFRT---YRWPGGRRRC-VVMAGDDVVLIDENVKRRAAEQKD-  488
            EK S+S   QR  P   +FR      WPGG+ RC   +A DD VL++E      ++++  
Sbjct  30   EKASVSSAQQRTLPWGFTFRHPLRSLWPGGKNRCEPAIAVDDAVLVEEKEDDLESDEEGR  89

Query  489  --SWVMKILRVRSLRNGGHKSCGLGNSEAAKIEGRISDAGEESD  614
              +WV KIL VRSL   G K   L      K +G   +AGE+ +
Sbjct  90   NGNWVFKILHVRSLWKEGEKDGELTGDIEIKSDGDDENAGEDDE  133



>ref|XP_011079576.1| PREDICTED: uncharacterized protein LOC105163063 isoform X2 [Sesamum 
indicum]
Length=719

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 53/104 (51%), Gaps = 8/104 (8%)
 Frame = +3

Query  327  EKPSLS-IPQRISPRRLSFRT---YRWPGGRRRC-VVMAGDDVVLIDENVKRRAAEQKD-  488
            EK S+S   QR  P   +FR      WPGG+ RC   +A DD VL++E      ++++  
Sbjct  30   EKASVSSAQQRTLPWGFTFRHPLRSLWPGGKNRCEPAIAVDDAVLVEEKEDDLESDEEGR  89

Query  489  --SWVMKILRVRSLRNGGHKSCGLGNSEAAKIEGRISDAGEESD  614
              +WV KIL VRSL   G K   L      K +G   +AGE+ +
Sbjct  90   NGNWVFKILHVRSLWKEGEKDGELTGDIEIKSDGDDENAGEDDE  133



>ref|XP_011079577.1| PREDICTED: uncharacterized protein LOC105163063 isoform X3 [Sesamum 
indicum]
Length=718

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 53/104 (51%), Gaps = 8/104 (8%)
 Frame = +3

Query  327  EKPSLS-IPQRISPRRLSFRT---YRWPGGRRRC-VVMAGDDVVLIDENVKRRAAEQKD-  488
            EK S+S   QR  P   +FR      WPGG+ RC   +A DD VL++E      ++++  
Sbjct  30   EKASVSSAQQRTLPWGFTFRHPLRSLWPGGKNRCEPAIAVDDAVLVEEKEDDLESDEEGR  89

Query  489  --SWVMKILRVRSLRNGGHKSCGLGNSEAAKIEGRISDAGEESD  614
              +WV KIL VRSL   G K   L      K +G   +AGE+ +
Sbjct  90   NGNWVFKILHVRSLWKEGEKDGELTGDIEIKSDGDDENAGEDDE  133



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 913772722720